BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000001-PA

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EG68_CAEEL  unnamed protein product                                 34.7    0.033
Q7KQP6_DROME  unnamed protein product                                 28.1    4.3  
L0MN91_DROME  unnamed protein product                                 28.1    4.3  


>G5EG68_CAEEL unnamed protein product
Length=1473

 Score = 34.7 bits (78),  Expect = 0.033, Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query  77   DVRVRVKRVLKGDSSVE-GTIVVVGGFGNPSFCSSRVRHLDTRIFLVKHHEGTYRLDSSL  135
            ++ V  +R+ KG   VE    +V+G       C+ R+   D RIF + + +G + LD+ +
Sbjct  63   NITVIPRRIYKGREYVEENKNIVIGNILETEPCAHRLLASDVRIFSLTNQQGVFLLDAPM  122

Query  136  LPITIHFLDKV  146
            + +++   D +
Sbjct  123  IRVSLPIFDAL  133


>Q7KQP6_DROME unnamed protein product
Length=8648

 Score = 28.1 bits (61),  Expect = 4.3, Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 15/59 (25%)

Query  21    SRRRRPRRHCREASLEDREDRADLVFTGKVVRVEKPTGPPLLSVRDNNDVEPAKEYDVR  79
             +RRRRP    R  S++D ED            + KP+ P    +RD  D  P    DV+
Sbjct  1175  TRRRRPSIDVRRPSVQDLED-----------LINKPSTP----LRDVGDGGPPSIVDVQ  1218


>L0MN91_DROME unnamed protein product
Length=8866

 Score = 28.1 bits (61),  Expect = 4.3, Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 15/59 (25%)

Query  21    SRRRRPRRHCREASLEDREDRADLVFTGKVVRVEKPTGPPLLSVRDNNDVEPAKEYDVR  79
             +RRRRP    R  S++D ED            + KP+ P    +RD  D  P    DV+
Sbjct  1393  TRRRRPSIDVRRPSVQDLED-----------LINKPSTP----LRDVGDGGPPSIVDVQ  1436



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000002-PA

Length=904
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VWC6_DROME  unnamed protein product                                 103     3e-22
Q7YU17_DROME  unnamed protein product                                 103     3e-22
Q0PCD8_CAEEL  unnamed protein product                                 82.4    6e-17


>Q9VWC6_DROME unnamed protein product
Length=1596

 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 61/112 (54%), Gaps = 1/112 (1%)

Query  775   GHLKCKECGIVFKKASVLVQHNKHVHGGTGLYLCEMCNVQFDDQQQYEAHLKTSHEGQRI  834
             G +KC EC   F K   L QHNK  H G   + C+ C  +F  +  Y  HL       + 
Sbjct  1324  GRIKCLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKP  1383

Query  835   YPCTLCHKHFNHRTDLKRHL-CTHTGQRPFECVTCKKRFIRKDHMRKHFEKH  885
             + C LC K F+H+TDL+RH+   HTG +   C  C+K F RKDH+RKH E H
Sbjct  1384  HKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLETH  1435


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)

Query  436  DPKRPKTYLCEICNKWFTSSGHLK  459
            + +RPKTY C  CNKWFTSSGHLK
Sbjct  545  EARRPKTYNCTACNKWFTSSGHLK  568


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (2%)

Query  837   CTLCHKHFNHRTDLKRH-LCTHTGQRPFECVTCKKRFIRKDHMRKHFEKHLEADGSAKAE  895
             C  C K F     L +H    H+G+ PF C  C KRF  +D    H  +H   D   K E
Sbjct  1328  CLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCE  1387


 Score = 30.8 bits (68),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  777  LKCKECGIVFKKASVLVQHNKHVHG  801
            L+CK+CGI+    S L +H  +VHG
Sbjct  280  LQCKKCGILTTNESELQEHIANVHG  304


>Q7YU17_DROME unnamed protein product
Length=1596

 Score = 103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 61/112 (54%), Gaps = 1/112 (1%)

Query  775   GHLKCKECGIVFKKASVLVQHNKHVHGGTGLYLCEMCNVQFDDQQQYEAHLKTSHEGQRI  834
             G +KC EC   F K   L QHNK  H G   + C+ C  +F  +  Y  HL       + 
Sbjct  1324  GRIKCLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKP  1383

Query  835   YPCTLCHKHFNHRTDLKRHL-CTHTGQRPFECVTCKKRFIRKDHMRKHFEKH  885
             + C LC K F+H+TDL+RH+   HTG +   C  C+K F RKDH+RKH E H
Sbjct  1384  HKCELCPKQFHHKTDLRRHVEAIHTGLKQHMCDICEKGFCRKDHLRKHLETH  1435


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)

Query  436  DPKRPKTYLCEICNKWFTSSGHLK  459
            + +RPKTY C  CNKWFTSSGHLK
Sbjct  545  EARRPKTYNCTACNKWFTSSGHLK  568


 Score = 40.8 bits (94),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 26/60 (43%), Gaps = 1/60 (2%)

Query  837   CTLCHKHFNHRTDLKRH-LCTHTGQRPFECVTCKKRFIRKDHMRKHFEKHLEADGSAKAE  895
             C  C K F     L +H    H+G+ PF C  C KRF  +D    H  +H   D   K E
Sbjct  1328  CLECDKEFTKNCYLTQHNKSFHSGEYPFRCQKCGKRFQSEDVYTTHLGRHRTQDKPHKCE  1387


 Score = 30.8 bits (68),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)

Query  777  LKCKECGIVFKKASVLVQHNKHVHG  801
            L+CK+CGI+    S L +H  +VHG
Sbjct  280  LQCKKCGILTTNESELQEHIANVHG  304


>Q0PCD8_CAEEL unnamed protein product
Length=273

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 58/109 (53%), Gaps = 2/109 (2%)

Query  777  LKCKECGIVFKKASVLVQHNKHVHGGTGLYLCEMCNVQFDDQQQYEAHLKTSHEGQRIYP  836
             +C+ CG  F +A+ L  H K +H G   ++C +CN  F        H +T H G+R YP
Sbjct  166  FRCQTCGKAFSQAANLTAH-KRIHTGEKPFMCPVCNRPFSQSSSLVTHRRT-HTGERPYP  223

Query  837  CTLCHKHFNHRTDLKRHLCTHTGQRPFECVTCKKRFIRKDHMRKHFEKH  885
            C  C K F   + L +HL THTG +P+ C  C  +F +  ++ +H + H
Sbjct  224  CAQCEKAFTDSSTLTKHLRTHTGHKPYVCSICMMKFTQSGNLHRHMKTH  272



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000003-PA

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZW8_TRYB2  unnamed protein product                                 141     4e-36
Q8T089_DROME  unnamed protein product                                 47.8    1e-05
Q8SX72_DROME  unnamed protein product                                 48.5    2e-05


>Q57ZW8_TRYB2 unnamed protein product
Length=459

 Score = 141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 116/407 (29%), Positives = 173/407 (43%), Gaps = 56/407 (14%)

Query  1    MSRSSPWRQKCPPSVEKRQEKVLSDGGVPFFLVRQGGPTAFGIRDDARRLIYQVRLGDPH  60
            MSRS PWR  CP +V     ++ S       LV++ GPT+F +      + Y+  +GDPH
Sbjct  1    MSRSVPWRNTCPEAVTDILNQLPS---CQLLLVKRVGPTSFLLSKRDGLVKYRTSIGDPH  57

Query  61   RCSCPVYYREKDLCVHICWVLLRKFRIMSHDPLSYQLGLLPREINGILQGVYDTRPQQIV  120
             CSC      ++ C+H+ +VL + F +   +PL +Q  L+  EI+ IL+     R     
Sbjct  58   SCSCDA---SREQCIHVVFVLCKVFFLPRENPLVWQRSLVAAEIDEILRSENRLRNAWKN  114

Query  121  PSEIPREGLLESMKVPQRDISDEDICPICQEELAKKKKVPVTFCRYGCGNNVHLTCMKLW  180
              +  R+     + VP R I + D+CPIC EE      +   +C  GCG  +H  C K +
Sbjct  115  VDDTRRD-----VAVP-RPIEEGDVCPICFEEFGNDTSL--DYCGGGCGKYIHTRCFKQY  166

Query  181  VEHQPMEKGTPNVLCPLCRGVFSNRQDLMHEIRISRHCNPSASGGIIHHGFTCFHCDIKP  240
              H  +      + CP CR +++N          S+ C+                   K 
Sbjct  167  KRHNLVGP----LRCPYCRSLWTNTVGAT-----SKRCSGCK----------------KY  201

Query  241  VTGNLYRCYQCPLATFCSSCILLDVVQRSHQRHDFQF-------RQFPGQRWRLMPPGSF  293
              G+ Y+C  C     CS C      + +H  H F          +  G     MP  S 
Sbjct  202  ANGSCYKCLFCQEYFLCSDCFHR---RETHSHHPFSLVGTREVAERHEGNSALPMPVSSE  258

Query  294  GSVLSPAVVEALQRREMGERDYELLMHLDESSRIISKKTLPERLLNQLPSVVVTSKHRLL  353
             +V  P  +  L  RE+   DYE L+ LD+ +   SK+ L     + L S   +S   LL
Sbjct  259  PTVSIPEELHPLMYREIDPEDYETLLRLDDQN---SKRKLTAEEFSVLHSECWSSG--LL  313

Query  354  DNGEQCSFCFRPFLVGEVARRLHCHHMFHATCIDFWLVHRSATCPLD  400
               ++C+ C   F V      L C H FH +C   WL    A CP+D
Sbjct  314  T--DECNICLDTFDVTSGCVWLPCGHFFHTSCAQRWLTEHVAECPID  358


>Q8T089_DROME unnamed protein product
Length=352

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query  333  LPERLLNQLPSVVVTSKHRLLDNGEQCSFCFRPFLVGEVARRLHCHHMFHATCIDFWLVH  392
            LP+ +L +LP V+  +K+   +  + C  C   F+  +  R L C H +H  CID WL  
Sbjct  26   LPKSMLKKLP-VLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTE  84

Query  393  RSATCPLDGHDVNAKLVEGRAAR  415
                CP+    V  K  E RA+R
Sbjct  85   NRRVCPICKRKVFTK-GEARASR  106


>Q8SX72_DROME unnamed protein product
Length=868

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 50/106 (47%), Gaps = 7/106 (7%)

Query  297  LSPAVVEALQRREMGE-RDYELLMHLDESSRIISKKTLPERLLNQLPSVVVTSKHRLLDN  355
            LSP     L   +  E  +YE L+ L E       + L    ++QLPS     +   + N
Sbjct  710  LSPYNQHDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPE---VHN  766

Query  356  GEQ--CSFCFRPFLVGEVARRLHCHHMFHATCIDFWLVHRSATCPL  399
            G+Q  C  C   F + ++ R L C H FHA C+D WL   + TCP+
Sbjct  767  GDQSSCVVCMCDFELRQLLRVLPCSHEFHAKCVDKWL-RSNRTCPI  811



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000004-PA

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FEN1_CAEEL  unnamed protein product                                   478     2e-169
FEN1_TRYB2  unnamed protein product                                   379     2e-130
FEN1_PLAF7  unnamed protein product                                   367     3e-122


>FEN1_CAEEL unnamed protein product
Length=382

 Score = 478 bits (1229),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 217/344 (63%), Positives = 277/344 (81%), Gaps = 0/344 (0%)

Query  1    MGIQGLAKLIADEAPAAIKESEIKNYFGRKVAVDASMSLYQFLIAVRSEGAQLTNADGET  60
            MGI+GL+++IAD AP+AIK +E+K +FGR VA+DASM LYQFLIAVR +G+QL + DGET
Sbjct  1    MGIKGLSQVIADNAPSAIKVNEMKAFFGRTVAIDASMCLYQFLIAVRQDGSQLQSEDGET  60

Query  61   TSHLMGFFYRTIRMVEHGIKPLYVFDGKPPQMKSGELAKRQERRVEAQKALEKAEEAGNM  120
            TSHLMG   RT+RM E+G+KP+YVFDGKPP MK GEL KR ERR EA+KAL +A+E G++
Sbjct  61   TSHLMGMLNRTVRMFENGVKPVYVFDGKPPDMKGGELEKRSERRAEAEKALTEAKEKGDV  120

Query  121  QDVDKFSRRLVKVTRQHADDAKKLLDLMGIPYVEAPCEAEAQCAALVKAGRVFATATEDM  180
            ++ +KF RRLVKVT+Q  D+AK+LL LMGIP VEAPCEAEAQCA LVKAG+VF T TEDM
Sbjct  121  KEAEKFERRLVKVTKQQNDEAKRLLGLMGIPVVEAPCEAEAQCAHLVKAGKVFGTVTEDM  180

Query  181  DGLTFGSDVLLRHMTFSEARKMPIREFHLSRVLEGLSLTHEEFVDLCILMGCDYCDTIKG  240
            D LTFGS VLLRH     A+K+PI+EF+LS  LE + L+ EEF+DLCIL+GCDYC TI+G
Sbjct  181  DALTFGSTVLLRHFLAPVAKKIPIKEFNLSLALEEMKLSVEEFIDLCILLGCDYCGTIRG  240

Query  241  VGPKRAIELIRQHRTIENVVKSLDKKKHTMPDDWPYEEARRLFKTPEVADPESLQMQWKD  300
            VGPK+A+ELIRQH+ IE +++++D+ K+  P+DWPY+ AR LF  PEV  PE +++ WK+
Sbjct  241  VGPKKAVELIRQHKNIETILENIDQNKYPPPEDWPYKRARELFLNPEVTKPEEVELTWKE  300

Query  301  PDEEGLVQFLCKEKGFSEDRVKNGAKKLLKGRHGATQGRLDSFF  344
             D EG++QFLC EK F+E+R++N   KL   R   TQGR+DSFF
Sbjct  301  ADVEGVIQFLCGEKNFNEERIRNALAKLKTSRKSGTQGRIDSFF  344


>FEN1_TRYB2 unnamed protein product
Length=393

 Score = 379 bits (973),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/371 (48%), Positives = 260/371 (70%), Gaps = 8/371 (2%)

Query  1    MGIQGLAKLIADEAPAAIKESEIKNYFGRKVAVDASMSLYQFLIAVRS----EGAQLTNA  56
            MG+ GL+KL+ D  P AIKE E+K YFGR++A+DASM++YQF+IA++     +  +LTN 
Sbjct  1    MGVLGLSKLLYDRTPGAIKEQELKVYFGRRIAIDASMAVYQFVIAMKGFQEGQSVELTNE  60

Query  57   DGETTSHLMGFFYRTIRMVEHGIKPLYVFDGKPPQMKSGELAKRQERRVEAQKALEKAEE  116
             G+ TSHL G F+RT+RM++ G++P+YVFDGKPP +K+ EL  R++R  +A+   EKA+E
Sbjct  61   AGDVTSHLSGIFFRTLRMIDEGLRPIYVFDGKPPTLKASELESRRQRAEDAKHEFEKAKE  120

Query  117  AGNMQDVDKFSRRLVKVTRQHADDAKKLLDLMGIPYVEAPCEAEAQCAALVKAGRVFATA  176
             G+ + ++K S+R+V+V R   ++ K LL LMGIP V+AP EAEAQCA LVK  + +A  
Sbjct  121  EGDDEAMEKMSKRMVRVGRDQMEEVKTLLRLMGIPVVQAPSEAEAQCAELVKKNKAWAVG  180

Query  177  TEDMDGLTFGSDVLLRHMTFSEARKMPIREFHLSRVLEGLSLTHEEFVDLCILMGCDYCD  236
            TEDMD L FGS V+LRH+T+ EA+K PI E+HL  +LE    + ++F+DLCIL+GCDY  
Sbjct  181  TEDMDALAFGSRVMLRHLTYGEAKKRPIAEYHLDEILEASGFSMQQFIDLCILLGCDYVP  240

Query  237  TIKGVGPKRAIELIRQHRTIENVVKSLDKKKHTMPDDWPYEEARRLFKTPEVADPESLQM  296
             I G+GP +A E I+++ ++E  ++SLD  ++ +P+++ Y++AR  F  PEV   E + +
Sbjct  241  RISGIGPHKAWEGIKKYGSLEAFIESLDGTRYVVPEEFNYKDARNFFLEPEVTPGEEIDI  300

Query  297  QWKDPDEEGLVQFLCKEKGFSEDRVKNGAKKLLKGRHGATQGRLDSFFTV-KPNPNA---  352
            Q+++PDEEGL++FL  EK FS++RV  G ++L       TQGRLD FFT+ KP       
Sbjct  301  QFREPDEEGLIKFLVDEKLFSKERVLKGIQRLRDALTKKTQGRLDQFFTITKPQKQVNSE  360

Query  353  AANAAAKRKVG  363
            A+ A  KR  G
Sbjct  361  ASTAGTKRNRG  371


>FEN1_PLAF7 unnamed protein product
Length=672

 Score = 367 bits (943),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 248/358 (69%), Gaps = 13/358 (4%)

Query  1    MGIQGLAKLIADEAPAAIKESEIKNYFGRKVAVDASMSLYQFLIAVRS--EGAQLTNADG  58
            MGI+GL K IAD AP AIKE +I++  GR +A+DASMSLYQF+IA+R   +   LTN  G
Sbjct  1    MGIKGLTKFIADAAPNAIKEIKIESLMGRIIAIDASMSLYQFIIAIRDSEQYGNLTNESG  60

Query  59   ETTSHLMGFFYRTIRMVEHGIKPLYVFDGKPPQMKSGELAKRQERRVEAQKALEKAEEAG  118
            ETTSH+ G   R+IR++E+G+KP+YVFDG PP++K  EL KR E+R +A++ L+KA+E G
Sbjct  61   ETTSHISGLMSRSIRLMENGLKPIYVFDGAPPELKGSELEKRGEKRQKAEELLKKAKEEG  120

Query  119  NMQDVDKFSRRLVKVTRQHADDAKKLLDLMGIPYVEAPCEAEAQCAALVKAGRVFATATE  178
            N++++ K S R V+VTR+  ++AKKLL LMGIP +EAPCEAE+QCA L K     ATATE
Sbjct  121  NLEEIKKQSGRTVRVTRKQNEEAKKLLTLMGIPIIEAPCEAESQCAFLTKYNLAHATATE  180

Query  179  DMDGLTFGSDVLLRHMTFS-----------EARKMPIREFHLSRVLEGLSLTHEEFVDLC  227
            D D L FG+ +L+R++  +             R   + E +L +VL+GL+LT +EF+D C
Sbjct  181  DADALVFGTKILIRNLNANATSNQNKNKNNSKRGYILTEINLEQVLKGLNLTMDEFIDFC  240

Query  228  ILMGCDYCDTIKGVGPKRAIELIRQHRTIENVVKSLDKKKHTMPDDWPYEEARRLFKTPE  287
            IL GCDYCDTIKG+G K A  LI+++  IE +++++D+ K+ +P ++ ++EAR+ F  P 
Sbjct  241  ILCGCDYCDTIKGIGSKTAYNLIKEYNCIEKIIENIDQNKYQVPSNFRFQEARKSFINPN  300

Query  288  VADPESLQMQWKDPDEEGLVQFLCKEKGFSEDRVKNGAKKLLKGRHGATQGRLDSFFT  345
            V   E +++ W +P  E L  FL K+  F+E RV N   +LLK R   TQ RLD+FFT
Sbjct  301  VLPKEDIKIDWNEPQIEELKHFLIKDYNFNELRVTNYINRLLKARKVTTQRRLDNFFT  358



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000005-PA

Length=430
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FUCO_DROME  unnamed protein product                                   443     3e-153
FUCO_DICDI  unnamed protein product                                   306     7e-100
O96610_DROME  unnamed protein product                                 30.4    4.1   


>FUCO_DROME unnamed protein product
Length=494

 Score = 443 bits (1140),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 219/460 (48%), Positives = 289/460 (63%), Gaps = 59/460 (13%)

Query  27   QYQPNWKSLDKRPLPKWYDEAKIGIFPHWGVFSVPSFGSEWFWNYWQSGQKP-YVDFMQK  85
            +YQPNW SLD+RPLP+WYD+AK+GIF H+GV+SVPSFGSEWFW  W++ + P YV FMQ+
Sbjct  33   RYQPNWASLDQRPLPQWYDDAKVGIFLHYGVYSVPSFGSEWFWTNWKNLRNPEYVQFMQR  92

Query  86   NYRPGFTYADFGPEFTAEFYDPDWWAELFKSSGAKYVVLNSKHH----------------  129
            NY+P FTY +F  +FTAE ++   WA LFK SGA+YVVL SKHH                
Sbjct  93   NYKPDFTYQEFASQFTAELFNATKWALLFKDSGARYVVLTSKHHDGFTLWPSKNSYGWNS  152

Query  130  ----------ASLSSAIRNKTDLVFGVYHSLYEWFNPMYLSDKSNHFQTRQFADQKAISE  179
                        L++AIR ++DL FG+Y+SL+EWFNP++  DK +    + F ++K   E
Sbjct  153  MDVGPKRDIVKELAAAIRKESDLRFGLYYSLFEWFNPLWTDDKLHLLMQQHFVERKVRPE  212

Query  180  LYELVNQYKVEIIWSDGDWEAPEEYWNSTGFLAWLYNESPVKDTVVVNDRWGSGIPCHHG  239
              ELV QY  EIIWSDGDWEAP +YW S  F+AWLYN+SPV+DTVV NDRWG G  C HG
Sbjct  213  QMELVQQYLPEIIWSDGDWEAPAKYWRSEEFIAWLYNDSPVRDTVVTNDRWGFGTACMHG  272

Query  240  DFFTCSDRYNPGVLQKHKWENAMTLDKKSWGFRREAVLSDYLTIEELLVALAETISCGGN  299
            DF+ C+DR+NPGVLQ HKWENA TLD+ SWG R +  LSD++T +E++  +  T+SC GN
Sbjct  273  DFYNCADRFNPGVLQAHKWENAFTLDRTSWGQRFDVSLSDFMTSKEVIKEIITTVSCNGN  332

Query  300  LLVSIGPTKEGRIIPVLEERLRQLGQWLSINGEAIYKSTPWRAQNDTITPGVWYTTRGA-  358
            +L+++GPTK G I+P+ EERLR +G+WL  NGE IY S PW  QNDTI   VWYT +   
Sbjct  333  VLINVGPTKFGTILPIFEERLRDMGRWLKFNGEGIYGSVPWIYQNDTINGNVWYTRQKEA  392

Query  359  -----NVYAIVLNWPEKST-----------------------LVLGAPQLTPKLSQITIL  390
                  +YA VL +P  +                        +  G   L  + +++ +L
Sbjct  393  SNGKITIYAFVLEYPYDTNELDIYPLGKDINIFRNVMLTGIDMGTGGDILNEQSTEVVML  452

Query  391  GNEEQKVPFRHGKTGWEIAFPPMSHIKSR---WAWVLKMV  427
            G E+ K+ +        I FPP +HI  R   +AW  K+ 
Sbjct  453  GMEDTKIKWNADHNRLHIVFPPKNHIDKRGLDYAWTFKIT  492


>FUCO_DICDI unnamed protein product
Length=461

 Score = 306 bits (783),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 170/433 (39%), Positives = 242/433 (56%), Gaps = 53/433 (12%)

Query  27   QYQPNWKSLDKRPLPKWYDEAKIGIFPHWGVFSVPSFG----SEWFWNYWQSGQKPYVD-  81
            QY P W  ++ RPLP WYD+ K GIF H+G++SVP+F     +EW   YW + + P  D 
Sbjct  20   QYGPTWDQINSRPLPGWYDDVKFGIFIHFGIYSVPAFANGGYAEW---YWWTLKNPSSDG  76

Query  82   -----FMQKNYRPGFTYADFGPEFTAEFYDPDWWAELFKSSGAKYVVLNSKHH-------  129
                 + +K +   FTY DF   F    +D + WA + + SGAKYVVL SKHH       
Sbjct  77   GATQRYHEKEFGANFTYQDFVSRFDCRLFDANEWASIIEKSGAKYVVLTSKHHEGYTLWN  136

Query  130  -------------------ASLSSAIRNKTDLVFGVYHSLYEWFNPMYLSDKSN--HFQT  168
                                 L+ +++N   L  G+YHSL+EWFNP+YL+D     +  T
Sbjct  137  SEQSWNWNSVETGPGIDIVGELTKSVKN-MGLHMGLYHSLFEWFNPLYLADAETGKNPTT  195

Query  169  RQFADQKAISELYELVNQYKVEIIWSDGDWEAPEEYWNSTGFLAWLYNESPVKDTVVVND  228
            + + D+  + +L ++V  Y+ E+IW+DGDW     YW ST FL+WLY  S VKDTV+VND
Sbjct  196  QVYVDEILMKQLKDIVTTYEPELIWADGDWMQLSNYWKSTEFLSWLYTNSSVKDTVIVND  255

Query  229  RWGSGIPCHHGDFFTCSDRYNPGVLQKHKWENAMTLDKKSWGFRREAVLSDYLTIEELLV  288
            RWGS     +G F+T +D +NP  LQ HKWEN  T+   S+G+      +DY    EL++
Sbjct  256  RWGSECRDKNGGFYTGADHFNPYKLQSHKWENCATI-GYSYGYDEYEQATDYQNATELII  314

Query  289  ALAETISCGGNLLVSIGPTKEGRIIPVLEERLRQLGQWLSINGEAIYKSTPWRAQNDTIT  348
             L  T++CGGN L+ +GP  +G I   + +RL ++G WLSIN E+IY S+PWR QN  +T
Sbjct  315  DLVTTVACGGNFLLDVGPDAQGTIPNNMVDRLLEIGNWLSINSESIYGSSPWRVQN--MT  372

Query  349  PGVWYTTR--GANVYAIVLNWPEKSTLVLGAPQLTPKLSQITILGNEEQK-----VPFRH  401
              +WYTT     NVYA V   P+   L+L  P    K ++ T+LG + +K     +P   
Sbjct  373  FNIWYTTNTTNGNVYAFVFELPDDGVLILSDPIGNNK-TEATLLGLKGEKGVEVSLPIES  431

Query  402  GKTGWEIAFPPMS  414
             K G  +  P ++
Sbjct  432  TKPGITLNIPMVA  444


>O96610_DROME unnamed protein product
Length=1750

 Score = 30.4 bits (67),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 45/122 (37%), Gaps = 13/122 (11%)

Query  270   GFRREAVLSDYLTIEELLVALAETISCGGNLLVSIGPTKEGRIIPVLEERLRQLGQWLSI  329
             GFR     + Y T       +   + C    ++ +G   +G+ IP        L  W   
Sbjct  934   GFRISNANTSYATCRSYPAIIVAPVQCSDAAIMHLGRCFKGQRIP--------LPTWRHA  985

Query  330   NGEAIYKSTPWRAQNDTITPGVWYTTRGA--NVYAIVLNWPEKSTLVLGAPQLTPKLSQI  387
             NG  + +       N     G+   T G+  N +  V ++PE+    L      PKL+ +
Sbjct  986   NGALLIRGG---QPNSKSVIGMLKNTTGSTTNAHHDVTHYPEQDKYFLALINTMPKLTPL  1042

Query  388   TI  389
              +
Sbjct  1043  AL  1044



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000006-PA

Length=348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O76455_DROME  unnamed protein product                                 235     8e-75
Q9VFP6_DROME  unnamed protein product                                 234     2e-74
IMPA3_DROME  unnamed protein product                                  69.7    4e-13


>O76455_DROME unnamed protein product
Length=375

 Score = 235 bits (600),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 203/364 (56%), Gaps = 22/364 (6%)

Query  4    LLTTLLRCSEKAANIARACREERALFSLLVEEKDPLVRGKGFVQDFKTLADVLVQETVRH  63
            LL  L+ C+EKAANIAR CR    L +LLV+EK      + F  DFKTLADVL+QET++H
Sbjct  10   LLRVLINCAEKAANIARICRSNEQLLALLVQEKIGSEANERFEHDFKTLADVLIQETIKH  69

Query  64   DLEGRWPELRGEVHGEESNSFTNTLGQSATLEVKDGPEETAKVLRQVLDGNEEAADTLAK  123
            ++   +P ++  + GEES +FTN LG+S T+ V    E+TA  L+ VL G+E+AA  LA 
Sbjct  70   EVGALFPAMKDAILGEESANFTNQLGESVTIAVGATEEDTAASLQAVLSGHEDAASALAT  129

Query  124  QVHGDVAIVLGK-----EFPDMEVKMDEVAVWIDPIDSTAEYIRGGPSTAETSPL-QKGL  177
            +VH DV+    K     + PD E+    + +WIDPID+TAEYI G     +   +   GL
Sbjct  130  EVHRDVSFSSEKLGEIAQLPD-ELDYGNLGIWIDPIDATAEYISGDTMFTDFPGITSTGL  188

Query  178  HCVTVLIGVYNRNTGCPLAGIVNQPFYTQ-ENGRWQGRVYWGYDFSGHRG--CSIPTPPS  234
             CVTVLIGVY R+TG P+ G+V QPF  + E   +   ++WG      R   C       
Sbjct  189  DCVTVLIGVYERDTGVPVMGVVAQPFGEKLEENVYSSSMFWGVCLPTVRAHNCDFEARDE  248

Query  235  SSGLPVLISSTEDDGVVQKLASKYTVKEVPGAGYKMLCVAVGLAHAFVLSKPSTYFWDAC  294
            +  L +  SS + D + + L   Y      GAG+K L V       ++LSK ST+ WD C
Sbjct  249  NRRLGIFSSSEQSDILQRFLDLGYEFAFSAGAGHKALKVITHEVDVYLLSKGSTFKWDTC  308

Query  295  APHGIIKGLGGQVMKFNGT--DE----LVY-----NTNGKWS-NSGGIIATRDKSSLQDI  342
            AP  I++ LGG V+ +  +  D+    L Y       +  W  N+GGII+ R+   + ++
Sbjct  309  APQAILRALGGDVLDYAASVADQKAVPLKYLIEDAEADADWKRNAGGIISVRNVDVVDEL  368

Query  343  VSLL  346
            ++ L
Sbjct  369  LAKL  372


>Q9VFP6_DROME unnamed protein product
Length=375

 Score = 234 bits (598),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/364 (39%), Positives = 201/364 (55%), Gaps = 22/364 (6%)

Query  4    LLTTLLRCSEKAANIARACREERALFSLLVEEKDPLVRGKGFVQDFKTLADVLVQETVRH  63
            LL  L+ C+EKAANIAR CR    L +LLV+EK      + F  DFKTLADVL+QET++H
Sbjct  10   LLRVLINCAEKAANIARICRSNEQLLALLVQEKIGSEANERFEHDFKTLADVLIQETIKH  69

Query  64   DLEGRWPELRGEVHGEESNSFTNTLGQSATLEVKDGPEETAKVLRQVLDGNEEAADTLAK  123
            ++   +P ++  + GEES +FTN LG+S T+ V    E+TA  L+ VL G+E+AA  LA 
Sbjct  70   EVGALFPAMKDAILGEESPNFTNQLGESVTIAVGATEEDTAACLQAVLSGHEDAASALAT  129

Query  124  QVHGDVAIVLGK-----EFPDMEVKMDEVAVWIDPIDSTAEYIRGGPSTAETSPL-QKGL  177
            +VH DV+    K     + PD E+    + +WIDPID+TAEYI G     +   +   GL
Sbjct  130  EVHRDVSFSSEKLGEIAQLPD-ELDYGNLGIWIDPIDATAEYISGDTMFTDFPGITSTGL  188

Query  178  HCVTVLIGVYNRNTGCPLAGIVNQPFYTQ-ENGRWQGRVYWGYDFSGHRG--CSIPTPPS  234
             CVTVLIGVY R+TG P+ G+V QPF  + E   +   ++WG      R   C       
Sbjct  189  DCVTVLIGVYERDTGVPVMGVVAQPFGEKLEENVYSSSMFWGVCLPTVRAHNCDFEARDE  248

Query  235  SSGLPVLISSTEDDGVVQKLASKYTVKEVPGAGYKMLCVAVGLAHAFVLSKPSTYFWDAC  294
            +  L +  SS + D + + L   Y      GAG+K L V       ++LSK ST+ WD C
Sbjct  249  NRRLGIFSSSEQSDILQRFLDLGYEFAFSAGAGHKALKVITHEVDVYLLSKGSTFKWDTC  308

Query  295  APHGIIKGLGGQVMKFNGTDE------LVY-----NTNGKWS-NSGGIIATRDKSSLQDI  342
            AP  I++ LGG V+ +  +        L Y       +  W  N+GGII+ R+   + ++
Sbjct  309  APQAILRALGGDVLDYAASVAEQKAVPLKYLIEDAEADADWKRNAGGIISVRNVDVVDEL  368

Query  343  VSLL  346
            ++ L
Sbjct  369  LAKL  372


>IMPA3_DROME unnamed protein product
Length=355

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 88/207 (43%), Gaps = 28/207 (14%)

Query  136  EFPDMEVKMDEVAVWIDPIDSTAEYIRGGPSTAETSPLQKGLHCVTVLIGVYNRNTGCPL  195
            + PD+ V   +V VW+DP+D+T E+      T E       + CV V         G P+
Sbjct  151  QIPDVTVNAQDVTVWVDPLDATKEF------TEELYEYVTTMVCVAV--------AGRPI  196

Query  196  AGIVNQPFYTQENGRWQGRVYWGYDFSGHRGCSIPTPPSSSGLPVLISSTEDDGVVQKLA  255
             G+++ PF  Q    W G     Y  + H     P    ++  P++  S       + LA
Sbjct  197  IGVIHSPFNGQTAWAWVGNSMSEYLSNLH-----PQHSPNNQAPIITVSRSHTAGAKDLA  251

Query  256  -----SKYTVKEVPGAGYKMLCVAVGLAHAFVLSKPSTYFWDACAPHGIIKGLGGQVMKF  310
                    ++    GAGYK+L V    A A+ L       WD CA   I+  LGG +   
Sbjct  252  RGIFGENVSLLTAAGAGYKVLQVVANNATAY-LHTSKIKKWDICAGDAILHALGGTMTTL  310

Query  311  NGTDELV-YNTNGKWSNSGGIIATRDK  336
            N  D+L+ Y       N+ G++AT ++
Sbjct  311  N--DQLINYGPEESPVNTEGLLATLEQ  335



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000007-PA

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACKL_DROME  unnamed protein product                                   134     7e-32
ARK1_CAEEL  unnamed protein product                                   64.7    3e-10


>ACKL_DROME unnamed protein product
Length=1337

 Score = 134 bits (337),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 87/128 (68%), Gaps = 7/128 (5%)

Query  61   KREQLAYRVGDVITVVDKKPMPDMPHVWKGVLNSGKTGLFNPAYTITYLGANLPSAKPNF  120
            K++ L YR GD+I+V+D+         WKGVL++GKTG FNP+ T+ +L     S + +F
Sbjct  414  KKDHLLYRQGDIISVLDRNTGTPF---WKGVLSTGKTGYFNPSNTVAFLEGLPSSTRDSF  470

Query  121  QRGDGKNVYSSKRRLRPDMISSPQGDLKHTGHVGLDGAYFGDVAFLG--DKHHQLPKQIV  178
             R     +  SKR+LR +MIS PQ D KHTGHVG+DGA FGD+AFLG    ++ +PKQIV
Sbjct  471  SRVSDHRI--SKRKLRTEMISKPQNDFKHTGHVGIDGATFGDIAFLGSSQNYNHVPKQIV  528

Query  179  TPYKPQED  186
            TPYKP ED
Sbjct  529  TPYKPSED  536


 Score = 133 bits (335),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 125/421 (30%), Positives = 185/421 (44%), Gaps = 108/421 (26%)

Query  231   KSLVD--HEYHEISDEENGVDSPHFEKSFDLGPSLMDEVFRALGSTSGA----PSRAELD  284
             +S+VD  HEYHEISD+E   D        D GPSL+DE+    GS S A    P     D
Sbjct  642   RSIVDDPHEYHEISDDEIAADK------LDFGPSLLDEINSMFGSISAATGSHPKSPGFD  695

Query  285   DAQRDEAHNAKNELKEIASRAVMR-GDSG-----------RATSRKQATVKPISAADQRT  332
                     N KNE+ E++++   + GD+             +  +   TVKPIS  D++ 
Sbjct  696   HV------NNKNEITEMSAKLGQKSGDTNGNKHGHGLLPTLSKKKSSGTVKPISVKDEKI  749

Query  333   LDSAIAMANELASRSMLDLDLRSGNNGECSDH--ALDSPRTPSSPNKRKFSFKF------  384
             L+ AI +ANE+++RSM+DL          SD    + SP       KRKFSF+F      
Sbjct  750   LNHAIEIANEISARSMIDL---------VSDQTPVIHSP-------KRKFSFRFPHLSNN  793

Query  385   ------------------SSGRGSPKAERRNFAEEAASISDIQSSLTEEAKEAYNTLIEK  426
                               + G  SP  +++NF EE  SI DIQS + +E  EAYN+LIE+
Sbjct  794   GSGDKSGGLGTSGSAHTPTHGNASPFPKKKNFTEELQSIPDIQSLIGKEGLEAYNSLIER  853

Query  427   PALVEPPSTPPVFSPPPPSPGADSEDSNPLRMLRL-------GVPMRA---RVRGNKHQH  476
              AL++         P P +      D++   +  L        +P R    RVR  +   
Sbjct  854   KALLD-------IGPSPAATLLRHLDTDEFDLQSLHQSQRPMTLPTRGATQRVRKAELAA  906

Query  477   TVPRNPVTGPPRLDRSKLPPPPVSPKPRFAKPPPLTIIDSNGTSCNGGNYNGDEEVPNPL  536
              + R+       L+  + P        +F +  P   +              + E PNP+
Sbjct  907   GLSRHNDENSNSLEACESPSYMTHGSYKFPEAQPTEQLP-------------EPESPNPI  953

Query  537   PLPPRDRTRPSVPSRPRHQRKYPLVIPGGGPGANCVEEQMDEV-DIADGVLDSPELQEEA  595
             PLPPR+  +    S  RH RKYPL+IP     AN ++  + ++ D  D    SPE+   +
Sbjct  954   PLPPREGKKQVKTSTKRHVRKYPLIIP-----ANGLQRTLSKLADFGDEAAKSPEISTSS  1008

Query  596   E  596
             +
Sbjct  1009  Q  1009


 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 53/72 (74%), Gaps = 8/72 (11%)

Query  1   LQQYYNGMKNDLKIQNVPQLKYVAEDDLHQIGMSKPEMRRLKKYFQKYCPQTYLSKFKK-  59
           LQQYYN +KN+LKI N  Q KY A++DL  IG+S+PE+RRL+K+++K+ P +YLSK K+ 
Sbjct  17  LQQYYNAVKNELKITNAAQFKYAADEDLRFIGLSRPEIRRLRKFYEKHFPHSYLSKIKRL  76

Query  60  -------VKREQ  64
                  VKRE+
Sbjct  77  LQAPGTMVKREE  88


 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 62/101 (61%), Gaps = 12/101 (12%)

Query  674   SDHVSCEDLLEFALDRPDGRRTRGRSRGRDSDEVRIMQKVLGKERVGGDEACLAALDATD  733
             S+ VSCEDLLEF+  +P     +G  RG DSDEVRIM KVLGK+       CL AL+  +
Sbjct  1236  SNSVSCEDLLEFSDKKP-----KGCERGVDSDEVRIMVKVLGKDST--PNRCLGALEFIN  1288

Query  734   WDIHKAIKLARLQATLMSHQVATSAIAPGHALDSLEVCQWD  774
             WD+HK+IKL +LQ  +    ++  A     + ++L+  +WD
Sbjct  1289  WDVHKSIKLIKLQNLVSEANLSLEA-----SFEALQQHEWD  1324


>ARK1_CAEEL unnamed protein product
Length=1043

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 58/111 (52%), Gaps = 13/111 (12%)

Query  63   EQLAYRVGDVITVVDKKP--MPDMPHVWKGVLNSGKTGLFNPAYTITYLGANLPSAKPNF  120
            + L ++  D+I V+ + P   PD  + W G L +GK GLF P  T+ +LG+  P +    
Sbjct  396  DHLHFKKDDLIVVISRSPAQYPD-GYYWFGSLRNGKLGLFRPTDTVAHLGSEPPCSNGTI  454

Query  121  QRG----------DGKNVYSSKRRLRPDMISSPQGDLKHTGHVGLDGAYFG  161
            + G          + K    S+R  +  +IS P GD++HT HVG+DG  FG
Sbjct  455  ENGFSEKEKGGKKNKKAEKESERERKKLLISEPVGDVRHTCHVGIDGTAFG  505


 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 35/59 (59%), Gaps = 0/59 (0%)

Query  1   LQQYYNGMKNDLKIQNVPQLKYVAEDDLHQIGMSKPEMRRLKKYFQKYCPQTYLSKFKK  59
           L  Y + ++  LK++N   L+YV E DL  +GMS+PE +RL+K + K  P     K KK
Sbjct  23  LSGYESDLRRKLKLRNAADLQYVEEVDLLSVGMSRPEQKRLRKEYTKMFPSGIFGKVKK  81



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000008-PA

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEP2_DROME  unnamed protein product                                   684     0.0   
NEP4_DROME  unnamed protein product                                   414     2e-131
NEPL2_CAEEL  unnamed protein product                                  402     9e-130


>NEP2_DROME unnamed protein product
Length=774

 Score = 684 bits (1764),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/779 (44%), Positives = 480/779 (62%), Gaps = 83/779 (11%)

Query  1    MERNLTLLIGVCLLV-AVGLAVALAAIL-----TSRQGRAMTETLPSLAEALKGGSSRGG  54
            +E++L + +G+  +V A G  + +  +L     ++ Q  A+     ++ +   G +S+G 
Sbjct  17   LEKSLLVSLGIMFVVLATGFGLWIGKVLRTSPPSNPQATALHGDSTTINQVPTGTASKGK  76

Query  55   RKYEENLPTDINDLCLTDGCVQTSADIMRSVDKSKDPCDNFYEFACGGFVKTTTIPDDKT  114
                     D  D+CLT  C+ T++ ++R +    +PCDNFYEFACG +++   IPDDK 
Sbjct  77   SG-------DSGDVCLTQECIHTASTVLRKMKPEVEPCDNFYEFACGTYLEEENIPDDKV  129

Query  115  QMTTFGILSDKLDEQLRILVEQPVKDDEPVSFRLVKNLYKSCMNKTLIEQLGLDPLKNIV  174
             ++TF ++SDKL EQL+ ++     + EP  FRL   LYK+CMNKTLIE LG +P+  + 
Sbjct  130  SISTFSVISDKLQEQLKDIITAERPETEPKHFRLPNLLYKACMNKTLIETLGPEPITRVA  189

Query  175  KELGGWPVVEGDQWDPS-RFDWRQSVYKFRRMGYSVDYFLDFSVTTDVKNSTRRIIDIDQ  233
            + LGGWP+++GD W+    + W++ V KFR  G+S+DY +DFS+  D++NST+R+ID+DQ
Sbjct  190  ERLGGWPLIKGDSWNADDSWTWQEQVKKFRTAGFSMDYIIDFSIGVDLQNSTKRLIDLDQ  249

Query  234  PSLGLSREYILRGPEDKDVKSYLNYQVRLAQLLGADVDRARKELREVLDFEIKLANFSLP  293
             SL LSREY+++G  +  V +Y  Y V +A L GA+ D A+ EL   L+FE+ LAN S P
Sbjct  250  SSLALSREYLVKGFNETLVTAYYKYMVDIAVLFGANRDLAKTELLLSLEFEMALANISWP  309

Query  294  REERRNASKLYNPMTIEELGRRYPSIPWMEYINNLLPEGMKVGIDETVIVDVPPYVRSFE  353
             E+RRN+S+LYN  T  +L   YP + W++Y+N LLPEG+ V  DE + + VP +     
Sbjct  310  NEKRRNSSELYNLRTPAQLQAAYPYVQWVDYMNALLPEGLNVAEDEMINLSVPSFFEDLG  369

Query  354  KLISETDKRIQGNYVLWRAVAASVSYTTEEARRIQLDYSSALTGRAAREPRWKECVGVVS  413
            KL+++T KR+  NY+ WR    SV + +EE R+ QL Y++AL+GR  +E RWKECV + +
Sbjct  370  KLLAKTPKRVIANYMFWRIHGFSVGFLSEEFRKRQLQYATALSGRQEQEARWKECVDIAT  429

Query  414  GRYSGTQSSLTDVLAKFREGDESEYGSLANAVGALYVRNHFREDARQNAQDMVRDIRAEF  473
                   SS+ +V        E ++ SL  +VG+LYV  HF +D++ NA +MV +IR  F
Sbjct  430  -------SSMDEVC-------EDDFDSLGISVGSLYVGKHFHKDSKANALEMVNEIRNVF  475

Query  474  LQMLDELDWMAGPTKSRARDKAQSMDTHIGYPIELLDDNKLNELYKGV-----KFPAGIL  528
              +LDE++WM   TK  A+ K  SM THIGYP E+LD+ KL   Y  +     K+    L
Sbjct  476  NDILDEVNWMDAKTKKEAKLKLHSMATHIGYPDEMLDNEKLAAYYAKLDIDPDKYFESFL  535

Query  529  QGVFFSND-------------------RP-------------------------------  538
                F  D                   RP                               
Sbjct  536  GMNIFGTDYSFNKLRLPVNKTDWVRHARPAIVNAFYSSLENSIQFPAGILQGHFFNAQRP  595

Query  539  RYMNYGAIGWVIGHEITHGFDDQGRQFDKEGNLVDWWEKATMKQYLDKAQCIIWQYGNYT  598
            +YMN+GAIG+VIGHEITHGFDDQGRQFD +GNL DWW   T K YL KA+CII QYGNYT
Sbjct  596  KYMNFGAIGYVIGHEITHGFDDQGRQFDVKGNLRDWWHPDTQKAYLAKAKCIIEQYGNYT  655

Query  599  APSVGLNLNGINTQGENIADNGGVKEAYRAYQKWVKQNGKEKQLPGLPYSQNQLFWISAA  658
              + GLNLNGINTQGENIADNGGVKE+Y AY++W +++G E +LPGL Y+  Q+FW++A 
Sbjct  656  ERATGLNLNGINTQGENIADNGGVKESYIAYRRWAEKHGPEAKLPGLDYTPEQMFWVAAG  715

Query  659  NVWCNTYRPETLKLRILTGVHSPGEFRVIGPFSNMPEFAKDFRCPAGSRMNPNNKCRVW  717
              WC  YR E+LK+RI TGVHSP EFRV+G  SNM +FAKDF CP GS MNP  KC VW
Sbjct  716  QTWCAKYRKESLKMRITTGVHSPSEFRVLGSLSNMKDFAKDFHCPEGSPMNPVQKCEVW  774


>NEP4_DROME unnamed protein product
Length=1040

 Score = 414 bits (1065),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 235/672 (35%), Positives = 355/672 (53%), Gaps = 103/672 (15%)

Query  107   TTIPDDKTQMTTFGILSDKLD--EQLRILVE--QPVKDDEPVSFRLVKNLYKSCMNKTLI  162
               +P DKT+        DK D  EQL +  +  +P +D +  +    KNLY+SC+N  ++
Sbjct  411   VVLPKDKTK--------DKSDNEEQLHVPTDFLKPHQDAQLKA----KNLYRSCVNSAVL  458

Query  163   EQLGLDPLKNIVKELGGWPVVEGDQWDPSRFDWRQSVYKFRRMGYSVDYFLDFSVTTDVK  222
              + GL+PL  +++ELGGWPV+E  QW  S F+W+      RR  Y+ D  +   V  D+K
Sbjct  459   AKRGLEPLHTLIRELGGWPVLES-QWSESNFNWQVLAATLRR--YNNDILIVQWVGADIK  515

Query  223   NSTRRIIDIDQPSLGL-SREYILRGPEDKDVKSYLNYQVRLAQLLGADVDRARKELREVL  281
             NS   I+  DQ  LGL +REY L+    K +++Y  Y   +   +GA    A++   E++
Sbjct  516   NSEENIVQFDQTGLGLPTREYFLQPSNAKYLQAYQRYMAEVMHKMGASKADAQRVASELV  575

Query  282   DFEIKLANFSLPREERRNASKLYNPMTIEELGRRYPSIPWMEYINNLLPEGMKVGIDETV  341
              FE +LA  + P E+R N +KLY  MT+++L    P I W  Y+ +L    + +G +E V
Sbjct  576   AFETQLAGITAPAEQRLNVTKLYKRMTLDQLQAVVPEIKWRAYLQSLQDREV-LGTEEVV  634

Query  342   IVDVPPYVRSFEKLISETDKRIQGNYVLWRAVAASVSYTTEEARRIQLDYSSALTGRAAR  401
             I  V  Y+     L+ ETD R   NY++WR V   ++   +    I+  +  AL GR   
Sbjct  635   IYAVE-YMSKLVTLLDETDPRTVSNYMMWRFVRHRINNVDDRFDDIKQSFYHALFGREES  693

Query  402   EPRWKECVGVVSGRYSGTQSSLTDVLAKFREGDESEYGSLANAVGALYVRNHFREDARQN  461
               RWK C+  V+                          ++  AVG+++V  +F  +++++
Sbjct  694   PQRWKVCIAQVNT-------------------------NMGMAVGSMFVSRYFDNNSKRD  728

Query  462   AQDMVRDIRAEFLQMLDELDWMAGPTKSRARDKAQSMDTHIGYPIELLDDNKLNELYKGV  521
                M  D++  F  +L   DW+   TK  A +K  +M   IGYP  +L+ ++LN  Y G+
Sbjct  729   TLRMTHDLQQAFRDILKTTDWLDDTTKQLAEEKVNAMSLKIGYPDFILNPSELNSKYAGI  788

Query  522   K-----------------------------------------------------FPAGIL  528
             +                                                     FPAGIL
Sbjct  789   EIYPEKYFENTLNVLLHTAKTEQAKLHERVNKTNWQTAPAIVNAYYSRNKNQIMFPAGIL  848

Query  529   QGVFFSNDRPRYMNYGAIGWVIGHEITHGFDDQGRQFDKEGNLVDWWEKATMKQYLDKAQ  588
             Q  F+    P+ +N+G IG VIGHE+THGFDD+GR FD+ GN+  WW  ++++ + ++A+
Sbjct  849   QPPFYHRHFPKSLNFGGIGVVIGHELTHGFDDKGRLFDRNGNIHKWWTDSSIRGFDERAR  908

Query  589   CIIWQYGNYTAPSVGLNLNGINTQGENIADNGGVKEAYRAYQKWVKQNGKE---KQLPGL  645
             CII QY NYT   VG+ LNG +TQGENIADNGG+++A+ AYQ+W+K++  E   + LPGL
Sbjct  909   CIIAQYSNYTVEEVGIVLNGESTQGENIADNGGLRQAFHAYQRWLKEHPSEVSDEILPGL  968

Query  646   PYSQNQLFWISAANVWCNTYRPETLKLRILTGVHSPGEFRVIGPFSNMPEFAKDFRCPAG  705
               +  QLF+++   VWC   RPE ++ ++ T +HSPG FRVIG  SN  +FA++F CP G
Sbjct  969   NMTGPQLFFLNFGQVWCGAMRPEAIRNKLNTAIHSPGRFRVIGTLSNSVDFAREFNCPLG  1028

Query  706   SRMNPNNKCRVW  717
             S MNP  KC VW
Sbjct  1029  SPMNPQKKCSVW  1040


 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 38/66 (58%), Gaps = 1/66 (2%)

Query  72   DGCVQTSADIM-RSVDKSKDPCDNFYEFACGGFVKTTTIPDDKTQMTTFGILSDKLDEQL  130
            +G   T A  M R +D   DPC +FY++ACG + +   IP DK    TF +L + LD  L
Sbjct  256  EGIRMTQAKTMKRYMDNKVDPCVDFYKYACGNWERLHPIPKDKAGFDTFEMLRESLDLVL  315

Query  131  RILVEQ  136
            R L+E+
Sbjct  316  RNLLEK  321


>NEPL2_CAEEL unnamed protein product
Length=736

 Score = 402 bits (1032),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 236/720 (33%), Positives = 358/720 (50%), Gaps = 97/720 (13%)

Query  64   DINDLCLTDGCVQTSADIMRSVDKSKDPCDNFYEFACGGFVKTTTIPDDKTQMTTFGILS  123
            D +D+CL+ GC++T++ I+ S++ S DPCD+FYEFACG ++K   IPDD   ++ F  L 
Sbjct  48   DSSDVCLSPGCIKTASVILSSMNSSVDPCDDFYEFACGQWIKGHPIPDDAPSVSNFENLG  107

Query  124  DKLDEQLRILVEQPVKDDEPVSFRL-----VKNLYKSCMNKTLIEQLGLDPLKNIVKELG  178
              L+  L+ L+++   +DEP  +        K  Y  C+N++ I          +VK  G
Sbjct  108  QDLEFALKELLDE---NDEPYDYETSAVGKAKYFYNLCLNESEILDNWRTTFDEVVKSFG  164

Query  179  GWPVVEGDQWDPSRFDWRQSVYKFRRMGYSVDYFLDFSVTTDVKNSTRRIIDIDQPSLGL  238
            GWP + G Q  P      + +Y      +  D     +V  D KNS R ++ IDQP L L
Sbjct  165  GWPSL-GHQMKPDAS--IEMLYADMVAKFKADSLFKATVQPDDKNSQRHVLLIDQPQLNL  221

Query  239  SREYILRGPEDKDVKSYLNYQVRLAQLLGADVDRARKELREVLDFEIKLANFSLPREERR  298
                     E+++  +YL     +  LL AD  RA  + +E++DFE  LAN ++  E R 
Sbjct  222  FARDFYVAAENEERMAYLQLIRDVLILLDADRTRATLDAKEIIDFETALANITMADEHRH  281

Query  299  NASKLYNPMTIEELGRRYPSIPWMEYINNLLPE-----GMKVGIDET--VIVDVPPYVRS  351
            + ++LY  +T+ E+ R  P   W  + N +  +     G ++  D+   V+V    ++R 
Sbjct  282  DIAELYTKITLGEMRRSLPHFNWPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRR  341

Query  352  FEKLISETDKRIQGNYVLWRAVAASVSYTTEEARRIQL-DYSSALTGRAAREPRWKECVG  410
             + LI + D R+  NY+ W     ++     +   + +  +   L     ++ RW  CV 
Sbjct  342  LDVLIPQYDNRLIVNYLEWCWFFKTMLRDLPDPFALTIFKFYKTLNIMNVQKVRWHGCVT  401

Query  411  VVSGRYSGTQSSLTDVLAKFREGDESEYGSLANAVGALYVRNHFREDARQNAQDMVRDIR  470
             ++                           +  A  A+YV+NHF  +A+Q  ++M+  I 
Sbjct  402  RINSL-------------------------MPMATSAIYVKNHFDHEAKQQVEEMISLIM  436

Query  471  AEFLQMLDELDWMAGPTKSRARDKAQSMDTHIGYPIELLDDNKLNELYKGVK--------  522
              F+ +L   DW+   TK  A+ K   M   IGYP  L D   +N  YK  K        
Sbjct  437  ESFVDLLLSEDWLTKETKQTAKQKVNEMKRKIGYPDYLNDPAAVNNEYKTFKVYPGHYYQ  496

Query  523  ---------------------------------------------FPAGILQGVFFSNDR  537
                                                         FPAGILQ VF+S D 
Sbjct  497  TKFSFYEQYQRDVLERITEAVDRERWVAGAALVNAFYSPNTNEIIFPAGILQPVFYSKDF  556

Query  538  PRYMNYGAIGWVIGHEITHGFDDQGRQFDKEGNLVDWWEKATMKQYLDKAQCIIWQYGNY  597
            P  MN+G IG VIGHEITHGFDD+GR +D  GN+  WW+ AT+ ++  KAQCI  QY +Y
Sbjct  557  PSSMNFGGIGVVIGHEITHGFDDRGRLYDNLGNIRQWWDNATISKFEHKAQCIEKQYSSY  616

Query  598  TAPSVGLNLNGINTQGENIADNGGVKEAYRAYQKWVKQNGKEKQLPGLPYSQNQLFWISA  657
                + + +NG +T+GENIADNGG+K+AYRAY+K+ K++ +  +LPG+  + +QLF+++ 
Sbjct  617  VLDQINMQINGKSTKGENIADNGGLKQAYRAYKKYEKRHSRPPRLPGVNLTHDQLFFLNY  676

Query  658  ANVWCNTYRPETLKLRILTGVHSPGEFRVIGPFSNMPEFAKDFRCPAGSRMNPNNKCRVW  717
            A +WC T   +    ++ T  HSPG  RV GP SN  +FAK + C  GS+MNP  KCRVW
Sbjct  677  AQIWCGTMNDKEAIRKLRTSEHSPGPIRVKGPLSNSYDFAKAYNCEPGSQMNPREKCRVW  736



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000009-PA

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

R4TUW8_ANGCA  unnamed protein product                                 306     5e-100
Q388L3_TRYB2  unnamed protein product                                 73.9    3e-14 
Q17461_CAEEL  unnamed protein product                                 30.8    2.6   


>R4TUW8_ANGCA unnamed protein product
Length=446

 Score = 306 bits (784),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/407 (39%), Positives = 239/407 (59%), Gaps = 7/407 (2%)

Query  41   IWAVLVAGSNTWGNYRHQADICHAYQVVSSHGIPDENIIVMMYDDIAKNEENPTPGIIIN  100
            I  +LVAGSN W NYRHQADI HAY ++ ++GIP+ NIIVMMYDDIA + +NP PG + N
Sbjct  34   IHVLLVAGSNGWWNYRHQADIAHAYHLMRNNGIPESNIIVMMYDDIANDPDNPYPGKLFN  93

Query  101  KPNGTDVYKGVINDYTGEDVNPNNFISVLTGDEKAVKGIGSGRVLKSGPNDHVFVNFADH  160
            KP+G DVY GV  DY G+ VNP NF+SVL G    V G G+GRVL S  ND VFV FADH
Sbjct  94   KPHGPDVYHGVKIDYKGDSVNPKNFLSVLQGKSNGVSG-GNGRVLNSTANDRVFVYFADH  152

Query  161  GGVGILAFPSEYLYVQDFIAAIKTMHSKNMYGKLVFYVEACESGSMFENVLPNDINVYTT  220
            G  G++ FP++     D   A++ MH K  YG+LVFY+EACESGSMFE  L   +N+Y  
Sbjct  153  GSDGLICFPNDIWSKHDLNKALQEMHEKKQYGQLVFYLEACESGSMFEGTLDKKMNIYAV  212

Query  221  TAASPDESSFACY-WDDKRGTFLGDVYSVKWMEDSDKEDLQQETLKQQYLTVKQETTTSH  279
            TAA+  ESS+  Y ++D     LGD++SV W+EDS+  ++  ETL +Q+  VK+ T  SH
Sbjct  213  TAANAVESSWGTYCYNDMNLPCLGDLFSVNWIEDSETHNINVETLMKQFDDVKKLTNLSH  272

Query  280  VQQYGQVNISDMTVSEYQGRKEPSKMTKSNKSVKITE-----AIPSREVPKVTLQRKLLA  334
            V  YG + I+   V  ++G  + + +  +     +       + P+R++  + LQ+    
Sbjct  273  VMHYGNLKIATEPVRWFEGEVQTTVVPTTTTYDNVEGQYPKVSWPARDIELMHLQKLQET  332

Query  335  AKDDKTRMEISEKLLALEAGRQLVQETVMRIVDGVTNNEHLSRQMLGEKMRLFDLRCHQA  394
              +      + +++  +   RQ ++     +V  +  N    +Q++  +  + DL+CH  
Sbjct  333  TNNALVSTALKQRITKIHEDRQKIEVVFKSLVANLLPNAEDRKQVMDGRNPVKDLKCHND  392

Query  395  LTAHFSNKCFNLAKNPYSTSYLQVLVNMCEAGYTASSVMATMDSVCA  441
            +   F + C ++ K  Y+  Y+ +L N+C     A  ++++M   C+
Sbjct  393  VVKAFDSICIDVNKFDYALKYIYMLNNLCVKVGDAEKIISSMHPTCS  439


>Q388L3_TRYB2 unnamed protein product
Length=319

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 83/187 (44%), Gaps = 8/187 (4%)

Query  42   WAVLVAGSNTWGNYRHQADICHAYQVVSSHGIPDENIIVMMYDDIAKNEENPTPGIIINK  101
            WAV+++ S  + N RH  +    Y +   HG+ D++I+V + D  A +   P P  I   
Sbjct  30   WAVILSSSRYFFNLRHTTNALAMYHLCRKHGMDDDHILVFLSDSYACDPRKPNPATIYGA  89

Query  102  P---NGTDVYKGVIN-DYTGEDVNPNNFISVLTGDEKAVKGIGSGRVLKSGPNDHVFVNF  157
            P      ++Y   I  DY   DV    F+ VL G  +  +     R L +  N ++ +  
Sbjct  90   PAQAEQPNLYGCNIRVDYASYDVGVRRFLGVLQG--RYDENTPPSRRLDTDENSNIIIYA  147

Query  158  ADHGGVGILAFP-SEYLYVQDFIAAIKTMHSKNMYGKLVFYVEACESGSM-FENVLPNDI  215
            A H       F  SE++   D    +  M  +  Y KLVF V+ C + S+  E   PN +
Sbjct  148  AGHSAEKFFKFQDSEFMSSTDIADTLMMMWEQRRYRKLVFLVDTCRALSLCLEIKAPNVV  207

Query  216  NVYTTTA  222
             + ++ A
Sbjct  208  CLASSEA  214


>Q17461_CAEEL unnamed protein product
Length=774

 Score = 30.8 bits (68),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 4/67 (6%)

Query  350  ALEAGRQLVQE--TVMRIVDGVTNNEHLSRQMLGEKMRLF--DLRCHQALTAHFSNKCFN  405
             ++ G  LV     +++ V G  N       +L EKM  F   +R H  + A+ SN+C N
Sbjct  195  VMDKGAMLVSRFRALLQNVSGPMNKVKKMLLVLDEKMTKFVDIMRRHYRVIANLSNQCRN  254

Query  406  LAKNPYS  412
            + K PY+
Sbjct  255  MLKTPYT  261



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000010-PA

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRS8_DROME  unnamed protein product                                   709     0.0  
Q38A02_TRYB2  unnamed protein product                                 543     0.0  
Q9NC95_9TRYP  unnamed protein product                                 536     0.0  


>PRS8_DROME unnamed protein product
Length=405

 Score = 709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/349 (99%), Positives = 348/349 (99%), Gaps = 0/349 (0%)

Query  1    MLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNSRVALR  60
            MLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPN RVALR
Sbjct  57   MLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALR  116

Query  61   NDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDA  120
            N+SYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDA
Sbjct  117  NESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDA  176

Query  121  LGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVM  180
            LGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVM
Sbjct  177  LGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVM  236

Query  181  AREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNR  240
            AREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNR
Sbjct  237  AREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNR  296

Query  241  IDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGA  300
            IDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGA
Sbjct  297  IDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGA  356

Query  301  EVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK  349
            EVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Sbjct  357  EVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK  405


>Q38A02_TRYB2 unnamed protein product
Length=408

 Score = 543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/351 (75%), Positives = 310/351 (88%), Gaps = 3/351 (1%)

Query  2    LREELQLLQEQGSYVGEVVKPMDKKKVLVKVHP-EGKFVVDLDKNIDINDVTPNSRVALR  60
            L+EE+QLLQE GS V +VV+ M K KVLV V   +GK VVD++K ++I+D++ N RVALR
Sbjct  58   LKEEVQLLQESGSIVADVVRVMSKGKVLVNVSSSQGKLVVDVEKTVNIDDLSRNVRVALR  117

Query  61   NDSYTLHKILPNKVDPLVSLMMVEKV-PDSTYEMVGGLDKQIKEIKEVIELPVKHPELFD  119
            + ++ +H ILP KVDPLVSLM VE    +STY+ +GGL +Q+KEIKEVIEL VKHPELF+
Sbjct  118  SGTFAIHYILPTKVDPLVSLMKVENAGSESTYDEIGGLSRQVKEIKEVIELSVKHPELFE  177

Query  120  ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFV  179
            ALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSG+ELVQK+IGEG+R+VRELFV
Sbjct  178  ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGAELVQKYIGEGARLVRELFV  237

Query  180  MAREHAPSIIFMDEIDSIGSSRIE-SGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMAT  238
            MAREH+PSIIFMDEIDSIGS+R+E +G GGDSEVQRTMLELLNQLDGFE+T++IKVIMAT
Sbjct  238  MAREHSPSIIFMDEIDSIGSTRLENTGRGGDSEVQRTMLELLNQLDGFESTQSIKVIMAT  297

Query  239  NRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGAS  298
            NR+DILD ALLRPGRIDRKIEFP P+E AR +ILKIHSRKMNLTRGINLR +AE     S
Sbjct  298  NRVDILDEALLRPGRIDRKIEFPAPDEPARFEILKIHSRKMNLTRGINLRTVAEKTNQCS  357

Query  299  GAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK  349
            GAE+K VCTEAGM+ALRERRVH+TQEDFE+AVAK+M KD +K++S+KK+WK
Sbjct  358  GAELKAVCTEAGMFALRERRVHITQEDFELAVAKIMHKDQDKSVSLKKMWK  408


>Q9NC95_9TRYP unnamed protein product
Length=408

 Score = 536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/351 (74%), Positives = 307/351 (87%), Gaps = 3/351 (1%)

Query  2    LREELQLLQEQGSYVGEVVKPMDKKKVLVKVHP-EGKFVVDLDKNIDINDVTPNSRVALR  60
            L+EE+QLLQE GS V +VV+ M K KVLV V   +GK VVD++K ++I+D++ N RVALR
Sbjct  58   LKEEVQLLQESGSIVADVVRVMSKGKVLVNVSSSQGKLVVDVEKTVNIDDLSRNVRVALR  117

Query  61   NDSYTLHKILPNKVDPLVSLMMVEKV-PDSTYEMVGGLDKQIKEIKEVIELPVKHPELFD  119
            + ++ +H ILP KVDPLVSLM VE    +STY+ +GGL +Q+KEIKEVIEL VKHPELF+
Sbjct  118  SGTFAIHYILPTKVDPLVSLMKVENAGSESTYDEIGGLSRQVKEIKEVIELSVKHPELFE  177

Query  120  ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFV  179
            ALGIAQPKGVLLYGPPGTGKTLLARAVAHHT+CTFIRVSG+ELVQK+IGEG+R+VRELFV
Sbjct  178  ALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGAELVQKYIGEGARLVRELFV  237

Query  180  MAREHAPSIIFMDEIDSIGSSRIE-SGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMAT  238
            MAREH+PSIIFMDEIDSIGS+R+E +G GGDSEVQRTMLELLNQLDGFE+T++IKVIMAT
Sbjct  238  MAREHSPSIIFMDEIDSIGSTRLENTGRGGDSEVQRTMLELLNQLDGFESTQSIKVIMAT  297

Query  239  NRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGAS  298
            NR+DILD ALLRPGRIDRKIEF  P+E AR +ILKI+SRKMNLTRGINLR +AE     S
Sbjct  298  NRVDILDEALLRPGRIDRKIEFSAPDEPARFEILKINSRKMNLTRGINLRTVAEKTNQCS  357

Query  299  GAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK  349
            GA  K VCTEAGM+ALRERRVH+TQEDFE+AVAK+M KD +K++S+KK+WK
Sbjct  358  GAAYKAVCTEAGMFALRERRVHITQEDFELAVAKIMHKDQDKSVSLKKMWK  408



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000011-PA

Length=116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHX8_DROME  unnamed protein product                                   179     3e-53
MOG5_CAEEL  unnamed protein product                                   153     3e-44
Q38AN5_TRYB2  unnamed protein product                                 91.3    2e-22


>DHX8_DROME unnamed protein product
Length=1242

 Score = 179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 94/129 (73%), Gaps = 31/129 (24%)

Query  9     MGIMDRHKLDVVSCGKNTV-------------------------------VYIHPSSALF  37
             +GIMDRHKLDVVS GKN+V                               VYIHPSSALF
Sbjct  1104  LGIMDRHKLDVVSAGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALF  1163

Query  38    NRQSEWVVYHELVLTTKEYMREVTTIDPKGLVEFAPAFFRFSDPTKLSKFQKNQRLEPLY  97
             NRQ EWV+YHELV TTKEYMREVTTIDPK LVEFAP+FFRFSDPTKLSKF+KNQRLEPLY
Sbjct  1164  NRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLY  1223

Query  98    NKYEEPNAW  106
             NKYEEPNAW
Sbjct  1224  NKYEEPNAW  1232


>MOG5_CAEEL unnamed protein product
Length=1200

 Score = 153 bits (386),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 92/137 (67%), Gaps = 31/137 (23%)

Query  9     MGIMDRHKLDVVSCGKNTV-------------------------------VYIHPSSALF  37
             +GIMDRHKL +VSCG++                                 VYIHPSSA F
Sbjct  1058  LGIMDRHKLLMVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACF  1117

Query  38    NRQSEWVVYHELVLTTKEYMREVTTIDPKGLVEFAPAFFRFSDPTKLSKFQKNQRLEPLY  97
              +Q EWVVYHELV+TTKEYMREVT IDPK LVEFAP+FF+  D TKLS F++NQ+++PL+
Sbjct  1118  QQQPEWVVYHELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLF  1177

Query  98    NKYEEPNAWRISRVRRR  114
             +KY + NAWRI+RV++R
Sbjct  1178  DKYADANAWRITRVKKR  1194


>Q38AN5_TRYB2 unnamed protein product
Length=1062

 Score = 91.3 bits (225),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 63/88 (72%), Gaps = 0/88 (0%)

Query  28    VYIHPSSALFNRQSEWVVYHELVLTTKEYMREVTTIDPKGLVEFAPAFFRFSDPTKLSKF  87
             VY+HPSS L +   ++++Y+E+ LT++EYMRE+  I+P+ LVE APAF+      KL+K 
Sbjct  975   VYVHPSSCLRDTPPKYLLYNEVQLTSREYMREILAIEPRWLVELAPAFYSKPRKGKLTKE  1034

Query  88    QKNQRLEPLYNKYEEPNAWRISRVRRRR  115
             Q+ +RL P+   +E  N+WRIS+ RRRR
Sbjct  1035  QRAERLNPILRAWESGNSWRISKQRRRR  1062



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000012-PA

Length=1265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHX8_DROME  unnamed protein product                                   1706    0.0  
MOG5_CAEEL  unnamed protein product                                   1394    0.0  
Q9VIZ3_DROME  unnamed protein product                                 812     0.0  


>DHX8_DROME unnamed protein product
Length=1242

 Score = 1706 bits (4418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 818/956 (86%), Positives = 891/956 (93%), Gaps = 8/956 (1%)

Query  260   EPEVGTIYSGKVSNLVPFGCFVQLEGLRRRWEGLVHISQLRREGRVTNVSDVVTRGQKVK  319
             +PE G IYSGK++N+VPFGCFVQL GLR+RWEGLVHISQLR EGRVT+V++VVTR Q VK
Sbjct  281   DPEAGKIYSGKIANIVPFGCFVQLFGLRKRWEGLVHISQLRAEGRVTDVTEVVTRNQTVK  340

Query  320   VKVLSFTGQKMSLSMKDVDQDTGEDLNPTSHEMVKPQDKGEEEAHRNPDRP----TSLLD  375
             VKV+S TGQK+SLSMK+VDQD+G+DLNP SH    P+D  E    RNPD P    TS+L+
Sbjct  341   VKVMSITGQKVSLSMKEVDQDSGKDLNPLSH---APEDD-ESLRDRNPDGPFSSSTSMLN  396

Query  376   LHTSLAEEEETTSRKRVHRISSPEKWEIKQMLAANCIDRSELPEFDEETGLLPKAEEEEE  435
             L  +  E +E  SRKRV RISSPE+WEIKQM+++  +DRSE+P+FDEETGLLPK E++E 
Sbjct  397   LQGNGMEGDEHESRKRVTRISSPERWEIKQMISSGVLDRSEMPDFDEETGLLPKDEDDEA  456

Query  436   DIEIELVEEEPPFLKGHGRVTHDLSPVRIVKNPDGSLAQAAMMQSALAKERREQKMQLRE  495
             DIEIE+VEEEPPFL GHGR  HDLSPVRIVKNPDGSLAQAAMMQSAL+KERREQKM  RE
Sbjct  457   DIEIEIVEEEPPFLSGHGRALHDLSPVRIVKNPDGSLAQAAMMQSALSKERREQKMLQRE  516

Query  496   QEMDSIPVGLNKHWIDPMPDADGRTLAANMRGIGLAAQDLPEWKKHVIGGKKSSFGKKTN  555
             QE++++P  LNK+WIDP+P+ + R+LAANMRG+  A  ++PEWKKHVIGGKKSSFGKKT+
Sbjct  517   QEIEAMPTSLNKNWIDPLPEDESRSLAANMRGMAAAPPEVPEWKKHVIGGKKSSFGKKTD  576

Query  556   MSILEQRQSLPIYKLKDELVKAVTDNQILIVIGETGSGKTTQITQYLAEAGFTARGKIGC  615
             ++++EQRQSLPIYKL+D+L+KAVTDNQILIVIGETGSGKTTQITQYL E GFTARGKIGC
Sbjct  577   LTLVEQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGC  636

Query  616   TQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLLDLD  675
             TQPRRVAAMSVAKRVAEE+GCRLGQEVGYTIRFEDCTSPET+IKYMTDGMLLRECL++ +
Sbjct  637   TQPRRVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAE  696

Query  676   LKAYSVIMLDEAHERTIHTDVLFGLLKQAVRKRTELKLIVTSATLDAIKFSQYFFEAPIF  735
             LK+YSVIMLDEAHERTIHTDVLFGLLK AV+KR ELKLIVTSATLDA+KFSQYFF+APIF
Sbjct  697   LKSYSVIMLDEAHERTIHTDVLFGLLKTAVQKRPELKLIVTSATLDAVKFSQYFFKAPIF  756

Query  736   TIPGRTFPVEILYTKEPETDYLDASLITVMQIHLNEPPGDVLLFLTGQEEIDTACEILYE  795
             TIPGRTFPVE+LYTKEPETDYLDASLITVMQIHL EPPGD+LLFLTGQEEIDTACEILYE
Sbjct  757   TIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACEILYE  816

Query  796   RMKSLGPDVPELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDGIYYVV  855
             RMKSLGPDVPELIILPVYSALPSEMQTRIF+PAP GSRKVVIATNIAETSLTIDGI+YVV
Sbjct  817   RMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVV  876

Query  856   DPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLPT  915
             DPGFVKQKVYNSKTGMDSLVVTPISQA AKQRAGRAGRTGPGK YRLYTERAYRDEMLPT
Sbjct  877   DPGFVKQKVYNSKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPT  936

Query  916   PVPEIQRTNLASTVLQLKAMGINDLLNFDFMDAPPVESLIMALEQLHSLSALDDEGLLTR  975
             PVPEIQRTNLA+TVLQLK MGINDLL+FDFMDAPPVESL+MALEQLHSLSALDDEGLLTR
Sbjct  937   PVPEIQRTNLATTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGLLTR  996

Query  976   LGRRMAEFPLEPNPAKQLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKKAKF  1035
             LGRRMAEFPLEPN +K LIMSV LQCSDE+LTIVSMLSVQNVFYRPKDKQALADQKKAKF
Sbjct  997   LGRRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQKKAKF  1056

Query  1036  NQPEGDHLTLLAVYNSWKNNKFSNAWCYENFIQIRTLKRAQDVRKQLLGIMDRHKLDVVS  1095
             NQ EGDHLTLLAVYNSWKNNKFSNAWCYENF+QIRTLKR+QDVRKQLLGIMDRHKLDVVS
Sbjct  1057  NQAEGDHLTLLAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLLGIMDRHKLDVVS  1116

Query  1096  CGKNTVRVQKVICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVVYHELV  1155
              GKN+VR+QK ICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWV+YHELV
Sbjct  1117  AGKNSVRIQKAICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVIYHELV  1176

Query  1156  LTTKEYMREVTTIDPKWLVEFAPAFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAW  1211
              TTKEYMREVTTIDPKWLVEFAP+FFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAW
Sbjct  1177  QTTKEYMREVTTIDPKWLVEFAPSFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAW  1232


 Score = 110 bits (274),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%), Gaps = 0/50 (0%)

Query  1215  RNVFYRPKDKQALADQKKAKFNQPEGDHLTLLAVYNSWKNNNFSNAWCYE  1264
             +NVFYRPKDKQALADQKKAKFNQ EGDHLTLLAVYNSWKNN FSNAWCYE
Sbjct  1036  QNVFYRPKDKQALADQKKAKFNQAEGDHLTLLAVYNSWKNNKFSNAWCYE  1085


>MOG5_CAEEL unnamed protein product
Length=1200

 Score = 1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/963 (69%), Positives = 805/963 (84%), Gaps = 13/963 (1%)

Query  262   EVGTIYSGKVSNLVPFGCFVQLEGLRRRWEGLVHISQLRREGRVTNVSDVVTRGQKVKVK  321
             E+G IY G+V+++  FG F+ LEG R++ EGLVHISQ+R E RV  V+DV+ RG+ VKVK
Sbjct  232   EIGKIYDGRVNSIQSFGAFITLEGFRQKQEGLVHISQIRNE-RVQTVADVLKRGENVKVK  290

Query  322   VLSFTGQKMSLSMKDVDQDTGEDLNPTSHEMVKPQDKGEEEAHRNPDRPTSLLDLHTSLA  381
             V      K+SLSMK+VDQ++GEDLNP   ++  P   G       P   +S ++   S  
Sbjct  291   VNKIENGKISLSMKEVDQNSGEDLNPRETDL-NPDAIGVR-PRTPPASTSSWMNPEASGV  348

Query  382   EEEETTS----RKRVHRISSPEKWEIKQMLAANCIDRSELPEFDEETGLLPKAEEEE--E  435
              +  +TS    + RV RIS+PE+WE++QM  A  +  +++P+FDEE G+L   ++E   E
Sbjct  349   GQGPSTSIGGGKARV-RISTPERWELRQMQGAGVLTATDMPDFDEEMGVLRNYDDESDGE  407

Query  436   DIEIELVEEEPPFLKGHGRVTHDLSPVRIVKNPDGSLAQAAMMQSALAKERREQKMQL-R  494
             DIEIELVE+EP FL+G+G+   ++ PV++VKNPDGSLAQAA+MQ AL+KER+E K+Q  R
Sbjct  408   DIEIELVEDEPDFLRGYGKGGAEIEPVKVVKNPDGSLAQAALMQGALSKERKETKIQAQR  467

Query  495   EQEMDSIP-VGLNKHWIDPMPDADGRTLAAN-MRGIGLAAQDLPEWKKHVIGGKKSSFGK  552
             E++MD+      N   +DPM        +A+  +      +++PEW KHV  G K+++G+
Sbjct  468   ERDMDTQKGFSSNARILDPMSGNQSTAWSADESKDRNNKMKEMPEWLKHVTAGGKATYGR  527

Query  553   KTNMSILEQRQSLPIYKLKDELVKAVTDNQILIVIGETGSGKTTQITQYLAEAGFTARGK  612
             +TN+S++EQR+SLPI+ LK  L++A+ DNQIL+V+GETGSGKTTQ+TQY  EAG   RGK
Sbjct  528   RTNLSMVEQRESLPIFALKKNLMEAMIDNQILVVVGETGSGKTTQMTQYAIEAGLGRRGK  587

Query  613   IGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLL  672
             IGCTQPRRVAAMSVAKRVAEE+GC+LG +VGYTIRFEDCTS +T+IKYMTDGMLLRECL+
Sbjct  588   IGCTQPRRVAAMSVAKRVAEEYGCKLGTDVGYTIRFEDCTSQDTIIKYMTDGMLLRECLI  647

Query  673   DLDLKAYSVIMLDEAHERTIHTDVLFGLLKQAVRKRTELKLIVTSATLDAIKFSQYFFEA  732
             D DL  YS+IMLDEAHERTIHTDVLFGLLK A RKR ELKLI+TSATLD++KFS+YF EA
Sbjct  648   DPDLSGYSLIMLDEAHERTIHTDVLFGLLKAAARKRPELKLIITSATLDSVKFSEYFLEA  707

Query  733   PIFTIPGRTFPVEILYTKEPETDYLDASLITVMQIHLNEPPGDVLLFLTGQEEIDTACEI  792
             PIFTIPGRTFPVEILYT+EPE+DYL+A+ ITVMQIHL EPPGDVL+FLTGQEEIDT+CE+
Sbjct  708   PIFTIPGRTFPVEILYTREPESDYLEAAHITVMQIHLTEPPGDVLVFLTGQEEIDTSCEV  767

Query  793   LYERMKSLGPDVPELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDGIY  852
             LYERMKS+GPDVPELIILPVY ALPSEMQTRIF+PAP G RKVVIATNIAETSLTIDGI+
Sbjct  768   LYERMKSMGPDVPELIILPVYGALPSEMQTRIFDPAPAGKRKVVIATNIAETSLTIDGIF  827

Query  853   YVVDPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEM  912
             YVVDPGFVKQK+YN K+GMDSLVVTPISQA AKQR+GRAGRTGPGKCYRLYTERA+RDEM
Sbjct  828   YVVDPGFVKQKIYNPKSGMDSLVVTPISQAAAKQRSGRAGRTGPGKCYRLYTERAFRDEM  887

Query  913   LPTPVPEIQRTNLASTVLQLKAMGINDLLNFDFMDAPPVESLIMALEQLHSLSALDDEGL  972
             LPTPVPEIQRTNLAST+LQLKAMGIN+L++FDFMDAPP++S+I AL  LH+LSALD +GL
Sbjct  888   LPTPVPEIQRTNLASTLLQLKAMGINNLIDFDFMDAPPLDSMITALNTLHTLSALDGDGL  947

Query  973   LTRLGRRMAEFPLEPNPAKQLIMSVHLQCSDEVLTIVSMLSVQNVFYRPKDKQALADQKK  1032
             LT+LGRRMAEFPLEP+ +K LIMSV L CS+EVLTIV+ML+VQN+FYRPK+KQ  ADQKK
Sbjct  948   LTKLGRRMAEFPLEPSLSKLLIMSVDLGCSEEVLTIVAMLNVQNIFYRPKEKQDHADQKK  1007

Query  1033  AKFNQPEGDHLTLLAVYNSWKNNKFSNAWCYENFIQIRTLKRAQDVRKQLLGIMDRHKLD  1092
             AKF+QPEGDHLTLLAVYNSWKN+ FS  WC+ENFIQ+R++KRAQD+RKQLLGIMDRHKL 
Sbjct  1008  AKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFENFIQVRSMKRAQDIRKQLLGIMDRHKLL  1067

Query  1093  VVSCGKNTVRVQKVICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWVVYH  1152
             +VSCG++  RVQK ICSGFFRNAAK+DPQEGYRTL D Q VYIHPSSA F +QPEWVVYH
Sbjct  1068  MVSCGRDVSRVQKAICSGFFRNAAKRDPQEGYRTLTDGQNVYIHPSSACFQQQPEWVVYH  1127

Query  1153  ELVLTTKEYMREVTTIDPKWLVEFAPAFFRFSDPTKLSKFKKNQRLEPLYNKYEEPNAWR  1212
             ELV+TTKEYMREVT IDPKWLVEFAP+FF+  D TKLS FK+NQ+++PL++KY + NAWR
Sbjct  1128  ELVMTTKEYMREVTAIDPKWLVEFAPSFFKIGDSTKLSTFKRNQKIDPLFDKYADANAWR  1187

Query  1213  ISR  1215
             I+R
Sbjct  1188  ITR  1190


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 46/50 (92%), Gaps = 0/50 (0%)

Query  1215  RNVFYRPKDKQALADQKKAKFNQPEGDHLTLLAVYNSWKNNNFSNAWCYE  1264
             +N+FYRPK+KQ  ADQKKAKF+QPEGDHLTLLAVYNSWKN++FS  WC+E
Sbjct  990   QNIFYRPKEKQDHADQKKAKFHQPEGDHLTLLAVYNSWKNHHFSQPWCFE  1039


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 73/120 (61%), Gaps = 10/120 (8%)

Query  6    KLEHLSLVSKVCTELENHLGLNDKDLAEFIIDLAQKNDTFDSFKKSLDDNGA--EFSESF  63
            +LEHLSLVSKV +E+ENH G+ +KD+AEF+I LAQ+N TFD  KK+LD  G   +F +S 
Sbjct  3    QLEHLSLVSKVLSEVENHFGVVEKDVAEFVIHLAQENPTFDKLKKALDSQGLGDQFDDSL  62

Query  64   TANLLRIIQHMQP-KDRIWSGGDGSSSRGPKTE-------KEKLTEKFPFLALPNECQAK  115
            TA +LRI+Q M   K +   GGD         +       KE++  + P LA+ N  + K
Sbjct  63   TATILRIVQSMTAVKKKNKKGGDSKEDIKDSHKITLISDAKEEIKARLPALAMANTAKEK  122


>Q9VIZ3_DROME unnamed protein product
Length=894

 Score = 812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/633 (59%), Positives = 491/633 (78%), Gaps = 2/633 (0%)

Query  552   KKTNMSILEQRQSLPIYKLKDELVKAVTDNQILIVIGETGSGKTTQITQYLAEAGFTARG  611
             ++  +++ E R+SLP+Y  K++L+ AV ++Q+LI+ GETGSGKTTQ+ QYL EAGFT   
Sbjct  239   ERKRLTLDETRRSLPVYPFKEDLIAAVKEHQVLIIEGETGSGKTTQVPQYLVEAGFTKDK  298

Query  612   K-IGCTQPRRVAAMSVAKRVAEEFGCRLGQEVGYTIRFEDCTSPETVIKYMTDGMLLREC  670
             K IGCTQPRRVAAMSVA RVAEE G +LG EVGY+IRFEDCTS  T++KYMTDG L RE 
Sbjct  299   KMIGCTQPRRVAAMSVAARVAEEMGVKLGNEVGYSIRFEDCTSDRTILKYMTDGTLHREF  358

Query  671   LLDLDLKAYSVIMLDEAHERTIHTDVLFGLLKQAVRKRTELKLIVTSATLDAIKFSQYFF  730
             L + DL +YSV+++DEAHERT+HTD+LFGL+K   R R ELKL+++SATLDA KFS +F 
Sbjct  359   LSEPDLASYSVMIIDEAHERTLHTDILFGLVKDIARFRPELKLLISSATLDAEKFSAFFD  418

Query  731   EAPIFTIPGRTFPVEILYTKEPETDYLDASLITVMQIHLNEPPGDVLLFLTGQEEIDTAC  790
             +APIF IPGR +PV+I YTK PE DY+DA  ++V+QIH  +P GD+L+FLTGQ+EI+T  
Sbjct  419   DAPIFRIPGRRYPVDIFYTKAPEADYIDACCVSVLQIHATQPLGDILVFLTGQDEIETCQ  478

Query  791   EILYERMKSLGPDVPELIILPVYSALPSEMQTRIFEPAPPGSRKVVIATNIAETSLTIDG  850
             E+L++R+K LG  + ELI++PVY+ LPS+MQ +IFEP PP +RKV++ATNIAETSLTID 
Sbjct  479   EVLHDRVKRLGSKIRELIVIPVYANLPSDMQAKIFEPTPPNARKVILATNIAETSLTIDN  538

Query  851   IYYVVDPGFVKQKVYNSKTGMDSLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRD  910
             I YV+DPGF KQ  +NS+TGM+SL+V PIS+A A QRAGRAGRT PGKC+RLYT  AY+ 
Sbjct  539   IIYVIDPGFAKQNNFNSRTGMESLMVVPISKASANQRAGRAGRTAPGKCFRLYTAWAYKH  598

Query  911   EMLPTPVPEIQRTNLASTVLQLKAMGINDLLNFDFMDAPPVESLIMALEQLHSLSALDDE  970
             E+    VPEIQR NL + VL LKA+GINDL++FDF+D PP E+L++ALEQL++L AL+  
Sbjct  599   ELEDNTVPEIQRINLGNAVLMLKALGINDLIHFDFLDPPPHETLVLALEQLYALGALNHH  658

Query  971   GLLTRLGRRMAEFPLEPNPAKQLIMSVHLQCSDEVLTIVSMLSVQN-VFYRPKDKQALAD  1029
             G LT+LGRRMAEFP++P   K L+ S   +CS+E++TI +MLSV + +FYRPKDK   AD
Sbjct  659   GELTKLGRRMAEFPVDPMMGKMLLASEKYKCSEEMVTIAAMLSVNSAIFYRPKDKIIHAD  718

Query  1030  QKKAKFNQPEGDHLTLLAVYNSWKNNKFSNAWCYENFIQIRTLKRAQDVRKQLLGIMDRH  1089
               +  FN   GDHL+LL VYN W    +S  WCYENFIQ R++KRA+DVR+QL+G+M R 
Sbjct  719   TARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYENFIQYRSMKRARDVREQLVGLMQRV  778

Query  1090  KLDVVSCGKNTVRVQKVICSGFFRNAAKKDPQEGYRTLVDSQVVYIHPSSALFNRQPEWV  1149
             ++D+VSC   TV V+K   +G+F + A+      Y+T+  +Q V IHP+S+LF   P WV
Sbjct  779   EIDMVSCLPETVNVRKAATAGYFYHVARLSKGGHYKTIKHNQTVMIHPNSSLFEELPRWV  838

Query  1150  VYHELVLTTKEYMREVTTIDPKWLVEFAPAFFR  1182
             +YHELV T+KEYMR+V  I+ KWL+E AP +++
Sbjct  839   LYHELVFTSKEYMRQVIEIESKWLLEVAPHYYK  871


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%), Gaps = 0/52 (0%)

Query  1213  ISRNVFYRPKDKQALADQKKAKFNQPEGDHLTLLAVYNSWKNNNFSNAWCYE  1264
             ++  +FYRPKDK   AD  +  FN   GDHL+LL VYN W   ++S  WCYE
Sbjct  702   VNSAIFYRPKDKIIHADTARKNFNHMHGDHLSLLQVYNQWAETDYSTQWCYE  753



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000013-PA

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ICMT_DICDI  unnamed protein product                                   175     3e-54
Q38DE5_TRYB2  unnamed protein product                                 113     2e-30
PYX_DROME  unnamed protein product                                    32.0    0.49 


>ICMT_DICDI unnamed protein product
Length=237

 Score = 175 bits (443),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 123/194 (63%), Gaps = 1/194 (1%)

Query  51   FLAPESWRPFGYYTCVMAFFHYSEYLTTALINPHSLALDSFLLNHSREYCIAAVASWCEF  110
            F+  ++ R FG Y   +  FH  EY+   + +P  L+  SFLLNHS ++ +A + S+ EF
Sbjct  44   FIFSQTLRGFGIYLAGLCTFHMWEYIWVTMYHPDKLSSKSFLLNHSPQFNMALLISFIEF  103

Query  111  WLERWLYPGMKEHSYVSIIGVLMCVVGEFLRKLAMLTAKSNFNHVIQSVRADGHTLVTHG  170
            W+E + +P +K  S +  +G +  V G+ +R +AM TA SNF H++Q  + D H LVT+G
Sbjct  104  WIEWYFFPSLKTFS-LWWVGAICMVFGQIVRSVAMDTAGSNFTHLVQEEKRDDHVLVTNG  162

Query  171  VYGYFRHPSYVGWFYWSIGTQVILCNPLCVVAYTLASWQFFRERIHVEEVTLLNFFGDEY  230
            +Y Y RHPSY GWF WS+ TQVIL NP+ ++ +  ASW FF +RI  EE  L+ FFG  Y
Sbjct  163  IYQYMRHPSYFGWFVWSVSTQVILMNPISIIGFGWASWSFFSQRIENEEDYLIQFFGKSY  222

Query  231  YYYQKKVGTGLPFI  244
              Y+K V +G+P I
Sbjct  223  KDYKKSVWSGIPGI  236


>Q38DE5_TRYB2 unnamed protein product
Length=245

 Score = 113 bits (283),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/201 (33%), Positives = 102/201 (51%), Gaps = 17/201 (8%)

Query  61   GYYTCVMAFFHYSEYLTTALINPHSLALDSFLLNHSREYCIAAVASWCEFWLE-------  113
             Y    +  FH SE+L       H     +F++ HSREY +A  A+W EF+ E       
Sbjct  46   AYVISSIVLFHMSEFLVAVYFLRHDAHPGAFMIFHSREYTVAGAAAWLEFFTELFFCSEG  105

Query  114  -------RWLYPGMKEHSYVSIIGVLMCVVGEFLRKLAMLTAKSNFNHVIQSVRADGHTL  166
                   RW +     ++ V+   VL  +    +R   M     NF+ +I++ R   H L
Sbjct  106  WKVSATSRWGWLFRLNYTMVNCAAVLT-IFFYLVRVCGMAHCGCNFSLLIETRRRSNHVL  164

Query  167  VTHGVYGYFRHPSYVGWFYWSIGTQVILCNPLCVVAYTLASWQFFRERIHVEEVTL--LN  224
            VT G+Y   RHP+Y G+F+ ++ +Q++L NP C +AY +   +FF+ERI  EE  L  + 
Sbjct  165  VTDGIYSILRHPAYFGYFWTALFSQLVLANPFCFMAYAIVLIRFFKERITYEETVLSSVE  224

Query  225  FFGDEYYYYQKKVGTGLPFIQ  245
            FFG+ Y  Y+     G+PFI+
Sbjct  225  FFGESYMKYKAGTWVGIPFIR  245


>PYX_DROME unnamed protein product
Length=956

 Score = 32.0 bits (71),  Expect = 0.49, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 19/29 (66%), Gaps = 2/29 (7%)

Query  167  VTHGVYGYFRHPSYVGWFYWSIGTQVILC  195
            + HG+ GY ++  +  W  W+IGT V+LC
Sbjct  553  MAHGLRGYAKY--WENWLQWTIGTGVLLC  579



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000014-PA

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEP2_DROME  unnamed protein product                                   359     1e-114
NEP4_DROME  unnamed protein product                                   358     1e-111
NEPL2_CAEEL  unnamed protein product                                  338     9e-107


>NEP2_DROME unnamed protein product
Length=774

 Score = 359 bits (922),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 201/571 (35%), Positives = 303/571 (53%), Gaps = 57/571 (10%)

Query  43   LDQPTLGLDRSFFNATSSKRPVLEAYRRLCEGVWNVVGALFDIPHERLQNMVNETLDFEA  102
            LDQ +L L R +     ++  V   Y+ + +     +  LF    +  +  +  +L+FE 
Sbjct  247  LDQSSLALSREYLVKGFNETLVTAYYKYMVD-----IAVLFGANRDLAKTELLLSLEFEM  301

Query  103  QLAKITTPQEFRRNKTHMYNPMTVAELQLFTDSVDISEGKAVENDDEQWQPKFTQHSRIV  162
             LA I+ P E RRN + +YN  T A+LQ                           +  + 
Sbjct  302  ALANISWPNEKRRNSSELYNLRTPAQLQ-------------------------AAYPYVQ  336

Query  163  WTEYFSTMFGSLAKIRRDEVIIVQEVDFLRRLAVLLAKTPSHVIANYLRWRMLLDIGPET  222
            W +Y + +      +  DE+I +    F   L  LLAKTP  VIANY+ WR+        
Sbjct  337  WVDYMNALLPEGLNVAEDEMINLSVPSFFEDLGKLLAKTPKRVIANYMFWRIHGFSVGFL  396

Query  223  SEALGMQFFFFAREITGVQFPEPRWKVCAEKVNHF-----------LGMAVGSKYVRKHF  271
            SE    +   +A  ++G Q  E RWK C +                LG++VGS YV KHF
Sbjct  397  SEEFRKRQLQYATALSGRQEQEARWKECVDIATSSMDEVCEDDFDSLGISVGSLYVGKHF  456

Query  272  NSSKKPEVVQLVKDLQAAFRAQVDSAEWMDHRTKVAAKKKAAAMREFMAFPDWVLDSEKL  331
            +   K   +++V +++  F   +D   WMD +TK  AK K  +M   + +PD +LD+EKL
Sbjct  457  HKDSKANALEMVNEIRNVFNDILDEVNWMDAKTKKEAKLKLHSMATHIGYPDEMLDNEKL  516

Query  332  EKYYDGLRLFREDHFASLYSVGAWWIRKELEELRKPTDRKKWI--AGPSVVNAFYAPNYN  389
              YY  L +  + +F S   +  +       +LR P ++  W+  A P++VNAFY+   N
Sbjct  517  AAYYAKLDIDPDKYFESFLGMNIFGTDYSFNKLRLPVNKTDWVRHARPAIVNAFYSSLEN  576

Query  390  SITFPAGILQLPFY-GHPLRSLNYGAIGMVIGHEITHGFDDQGRQFDEDGDLSQWWSQRT  448
            SI FPAGILQ  F+     + +N+GAIG VIGHEITHGFDDQGRQFD  G+L  WW   T
Sbjct  577  SIQFPAGILQGHFFNAQRPKYMNFGAIGYVIGHEITHGFDDQGRQFDVKGNLRDWWHPDT  636

Query  449  LANYIQKAQCFQRQYDNFKVKEVEQLPGNNGTTTVKSRVNGLTTLGENMADNGGIRQAFR  508
               Y+ KA+C   QY N+     E+  G N        +NG+ T GEN+ADNGG+++++ 
Sbjct  637  QKAYLAKAKCIIEQYGNY----TERATGLN--------LNGINTQGENIADNGGVKESYI  684

Query  509  AFKSYTARKGPEPRLPGLEEFSPEQLFFISFANVWCSASTPGRLQQQLMTGAHSPGRFRV  568
            A++ +  + GPE +LPGL +++PEQ+F+++    WC+      L+ ++ TG HSP  FRV
Sbjct  685  AYRRWAEKHGPEAKLPGL-DYTPEQMFWVAAGQTWCAKYRKESLKMRITTGVHSPSEFRV  743

Query  569  IGSLQNFQEFARVWRCRQGTPMNPGKKCVLW  599
            +GSL N ++FA+ + C +G+PMNP +KC +W
Sbjct  744  LGSLSNMKDFAKDFHCPEGSPMNPVQKCEVW  774


>NEP4_DROME unnamed protein product
Length=1040

 Score = 358 bits (919),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 202/566 (36%), Positives = 312/566 (55%), Gaps = 58/566 (10%)

Query  43    LDQPTLGLDRSFFNATSSKRPVLEAYRRLCEGVWNVVGALFDIPHERLQNMVNETLDFEA  102
              DQ  LGL    +    S    L+AY+R    V + +GA         Q + +E + FE 
Sbjct  524   FDQTGLGLPTREYFLQPSNAKYLQAYQRYMAEVMHKMGA----SKADAQRVASELVAFET  579

Query  103   QLAKITTPQEFRRNKTHMYNPMTVAELQLFTDSVDISEGKAVENDDEQWQPKFTQHSRIV  162
             QLA IT P E R N T +Y  MT+ +LQ                              I 
Sbjct  580   QLAGITAPAEQRLNVTKLYKRMTLDQLQAVV-------------------------PEIK  614

Query  163   WTEYFSTMFGSLAKIRRDEVIIVQEVDFLRRLAVLLAKTPSHVIANYLRWRML---LDIG  219
             W  Y  ++     ++   E +++  V+++ +L  LL +T    ++NY+ WR +   ++  
Sbjct  615   WRAYLQSLQDR--EVLGTEEVVIYAVEYMSKLVTLLDETDPRTVSNYMMWRFVRHRINNV  672

Query  220   PETSEALGMQFF--FFAREITGVQFPEPRWKVCAEKVNHFLGMAVGSKYVRKHFNSSKKP  277
              +  + +   F+   F RE    + P+ RWKVC  +VN  +GMAVGS +V ++F+++ K 
Sbjct  673   DDRFDDIKQSFYHALFGRE----ESPQ-RWKVCIAQVNTNMGMAVGSMFVSRYFDNNSKR  727

Query  278   EVVQLVKDLQAAFRAQVDSAEWMDHRTKVAAKKKAAAMREFMAFPDWVLDSEKLEKYYDG  337
             + +++  DLQ AFR  + + +W+D  TK  A++K  AM   + +PD++L+  +L   Y G
Sbjct  728   DTLRMTHDLQQAFRDILKTTDWLDDTTKQLAEEKVNAMSLKIGYPDFILNPSELNSKYAG  787

Query  338   LRLFREDHFASLYSVGAWWIRKELEELRKPTDRKKWIAGPSVVNAFYAPNYNSITFPAGI  397
             + ++ E +F +  +V     + E  +L +  ++  W   P++VNA+Y+ N N I FPAGI
Sbjct  788   IEIYPEKYFENTLNVLLHTAKTEQAKLHERVNKTNWQTAPAIVNAYYSRNKNQIMFPAGI  847

Query  398   LQLPFYG-HPLRSLNYGAIGMVIGHEITHGFDDQGRQFDEDGDLSQWWSQRTLANYIQKA  456
             LQ PFY  H  +SLN+G IG+VIGHE+THGFDD+GR FD +G++ +WW+  ++  + ++A
Sbjct  848   LQPPFYHRHFPKSLNFGGIGVVIGHELTHGFDDKGRLFDRNGNIHKWWTDSSIRGFDERA  907

Query  457   QCFQRQYDNFKVKEVEQLPGNNGTTTVKSRVNGLTTLGENMADNGGIRQAFRAFKSYTAR  516
             +C   QY N+ V+EV  +            +NG +T GEN+ADNGG+RQAF A++ +   
Sbjct  908   RCIIAQYSNYTVEEVGIV------------LNGESTQGENIADNGGLRQAFHAYQRWLKE  955

Query  517   KGPEPR---LPGLEEFSPEQLFFISFANVWCSASTPGRLQQQLMTGAHSPGRFRVIGSLQ  573
                E     LPGL    P QLFF++F  VWC A  P  ++ +L T  HSPGRFRVIG+L 
Sbjct  956   HPSEVSDEILPGLNMTGP-QLFFLNFGQVWCGAMRPEAIRNKLNTAIHSPGRFRVIGTLS  1014

Query  574   NFQEFARVWRCRQGTPMNPGKKCVLW  599
             N  +FAR + C  G+PMNP KKC +W
Sbjct  1015  NSVDFAREFNCPLGSPMNPQKKCSVW  1040


>NEPL2_CAEEL unnamed protein product
Length=736

 Score = 338 bits (866),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 189/572 (33%), Positives = 300/572 (52%), Gaps = 62/572 (11%)

Query  42   ILDQPTLGL-DRSFFNATSSKRPVLEAYRRLCEGVWNVVGALFDIPHERLQNMVNETLDF  100
            ++DQP L L  R F+ A  ++  +  AY +L   V      L D    R      E +DF
Sbjct  213  LIDQPQLNLFARDFYVAAENEERM--AYLQLIRDVL----ILLDADRTRATLDAKEIIDF  266

Query  101  EAQLAKITTPQEFRRNKTHMYNPMTVAELQLFTDSVDISEGKAVENDDEQWQPKFTQHSR  160
            E  LA IT   E R +   +Y  +T+ E++                   +  P F     
Sbjct  267  ETALANITMADEHRHDIAELYTKITLGEMR-------------------RSLPHFN----  303

Query  161  IVWTEYFSTMFGSL-----AKIRRDE--VIIVQEVDFLRRLAVLLAKTPSHVIANYLRW-  212
              W  +F+ MF  L      +I  D+   ++V   +FLRRL VL+ +  + +I NYL W 
Sbjct  304  --WPLFFNRMFKDLHEKNGKRITFDDNTEVVVYGYEFLRRLDVLIPQYDNRLIVNYLEWC  361

Query  213  ----RMLLDIGPETSEALGMQFFFFAREITGVQFPEPRWKVCAEKVNHFLGMAVGSKYVR  268
                 ML D+     +   +  F F + +  +   + RW  C  ++N  + MA  + YV+
Sbjct  362  WFFKTMLRDL----PDPFALTIFKFYKTLNIMNVQKVRWHGCVTRINSLMPMATSAIYVK  417

Query  269  KHFNSSKKPEVVQLVKDLQAAFRAQVDSAEWMDHRTKVAAKKKAAAMREFMAFPDWVLDS  328
             HF+   K +V +++  +  +F   + S +W+   TK  AK+K   M+  + +PD++ D 
Sbjct  418  NHFDHEAKQQVEEMISLIMESFVDLLLSEDWLTKETKQTAKQKVNEMKRKIGYPDYLNDP  477

Query  329  EKLEKYYDGLRLFREDHFASLYSVGAWWIRKELEELRKPTDRKKWIAGPSVVNAFYAPNY  388
              +   Y   +++   ++ + +S    + R  LE + +  DR++W+AG ++VNAFY+PN 
Sbjct  478  AAVNNEYKTFKVYPGHYYQTKFSFYEQYQRDVLERITEAVDRERWVAGAALVNAFYSPNT  537

Query  389  NSITFPAGILQLPFYGHPL-RSLNYGAIGMVIGHEITHGFDDQGRQFDEDGDLSQWWSQR  447
            N I FPAGILQ  FY      S+N+G IG+VIGHEITHGFDD+GR +D  G++ QWW   
Sbjct  538  NEIIFPAGILQPVFYSKDFPSSMNFGGIGVVIGHEITHGFDDRGRLYDNLGNIRQWWDNA  597

Query  448  TLANYIQKAQCFQRQYDNFKVKEVEQLPGNNGTTTVKSRVNGLTTLGENMADNGGIRQAF  507
            T++ +  KAQC ++QY ++ + ++              ++NG +T GEN+ADNGG++QA+
Sbjct  598  TISKFEHKAQCIEKQYSSYVLDQINM------------QINGKSTKGENIADNGGLKQAY  645

Query  508  RAFKSYTARKGPEPRLPGLEEFSPEQLFFISFANVWCSASTPGRLQQQLMTGAHSPGRFR  567
            RA+K Y  R    PRLPG+   + +QLFF+++A +WC         ++L T  HSPG  R
Sbjct  646  RAYKKYEKRHSRPPRLPGV-NLTHDQLFFLNYAQIWCGTMNDKEAIRKLRTSEHSPGPIR  704

Query  568  VIGSLQNFQEFARVWRCRQGTPMNPGKKCVLW  599
            V G L N  +FA+ + C  G+ MNP +KC +W
Sbjct  705  VKGPLSNSYDFAKAYNCEPGSQMNPREKCRVW  736



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000015-PA

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INT11_DROME  unnamed protein product                                  952     0.0   
CPSF3_DROME  unnamed protein product                                  330     2e-104
Q581U7_TRYB2  unnamed protein product                                 315     4e-98 


>INT11_DROME unnamed protein product
Length=597

 Score = 952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/581 (75%), Positives = 511/581 (88%), Gaps = 2/581 (0%)

Query  1    MPEIKVTPLGAGQDVGRSCILLTIGGKNIMLDCGMHMGYNDERKFPDFSYITKDGDLSAH  60
            MP+IK+TPLGAGQDVGRSC+LL++GGKNIMLDCGMHMGYNDER+FPDFSYI  +G +++H
Sbjct  1    MPDIKITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYIVPEGPITSH  60

Query  61   IDCVIISHFHLDHCGALPFMTEMVGYNGPIYMTHPTKAICPILLEDMRKVSVERKGETNF  120
            IDCVIISHFHLDHCGALP+M+E+VGY GPIYMTHPTKAI PILLEDMRKV+VERKGE+NF
Sbjct  61   IDCVIISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNF  120

Query  121  FTSQMIKDCMKKVVAVTLHQTVAVDSELELKAYYAGHVLGAAMFRVKVGSESVVYTGDYN  180
            FT+QMIKDCMKKV+ VTLHQ++ VD++LE+KAYYAGHVLGAAMF +KVGS+SVVYTGDYN
Sbjct  121  FTTQMIKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYN  180

Query  181  MTPDRHLGAAWIDRCRPDLLISESTYATTIRDSKRCRERDFLKKVHDCVDRGGKVLIPVF  240
            MTPDRHLGAAWID+CRPDLLISESTYATTIRDSKRCRERDFLKKVH+CV +GGKVLIPVF
Sbjct  181  MTPDRHLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVF  240

Query  241  ALGRAQELCILLETYWERMNLKVPIYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMF  300
            ALGRAQELCILLETYWERMNLK PIYFALGLTEKAN YYKMFITWTNQKIRKTFV RNMF
Sbjct  241  ALGRAQELCILLETYWERMNLKYPIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMF  300

Query  301  DFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLHIFRKWAPNENNMVIMPGYCVQGTVG  360
            DFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSL IF+KWAPNENNMVIMPGYCVQGTVG
Sbjct  301  DFKHIKPFDKAYIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVG  360

Query  361  HKVLNGAKRVELETKQIIEVKLSVQYMSFSAHADAKGIMQLVQYCEPRNVLLVHGEAEKM  420
            +K+L GAK+VE E +Q++EVK++V+YMSFSAHADAKGIMQL+Q CEP+NV+LVHGEA KM
Sbjct  361  NKILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQNCEPKNVMLVHGEAGKM  420

Query  421  RFLRQKIRQEFGVQCYMPANGETCTVPTTQAIPVDVSLPLLRREAVKYDQEPPDPKRARV  480
            +FLR KI+ EF ++ YMPANGETC + T   IPVD S+ LL+ EA  Y+ +PPDPKR R+
Sbjct  421  KFLRSKIKDEFNLETYMPANGETCVISTPVKIPVDASVSLLKAEARSYNAQPPDPKRRRL  480

Query  481  MHGVLVMKDNSLCLMDVEDACKEAGVVHHQVRFSSTVVLQDPGPTSQTIIKIKQRLQSNL  540
            +HGVLVMKDN + L ++ DA KE G+  H +RF+S V + D GP  +T  ++K  L+  L
Sbjct  481  IHGVLVMKDNRIMLQNLTDALKEIGINRHVMRFTSKVKMDDSGPVIRTSERLKTLLEEKL  540

Query  541  EDWTLQVME-GGISVESVLVQIQGSD-DEDRKGVVVSWGLQ  579
              WT+ + E G I++ESV V+++  + D  +K +++SW  Q
Sbjct  541  AGWTVTMQENGSIAIESVEVKVEEDEKDPKQKNILISWTNQ  581


>CPSF3_DROME unnamed protein product
Length=684

 Score = 330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 174/446 (39%), Positives = 259/446 (58%), Gaps = 16/446 (4%)

Query  4    IKVTPLGAGQDVGRSCILLTIGGKNIMLDCGMHMGYNDERKFPDFSYITKDGDLSAHIDC  63
            +++ PLGAGQ+VGRSCI+L   GK IMLDCG+H G +     P    I  D      ID 
Sbjct  18   LQIKPLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALPYVDLIEAD-----EIDL  72

Query  64   VIISHFHLDHCGALPFMTEMVGYNGPIYMTHPTKAICPILLEDMRKVSVERKGETNFFTS  123
            + ISHFHLDHCGALP+      + G  +MTH TKAI   +L D  K+S     E   +T 
Sbjct  73   LFISHFHLDHCGALPWFLMKTSFKGRCFMTHATKAIYRWMLSDYIKIS-NISTEQMLYTE  131

Query  124  QMIKDCMKKVVAVTLHQTVAVDSELELKAYYAGHVLGAAMFRVKVGSESVVYTGDYNMTP  183
              ++  M+K+  +  H+   V   +   AY AGHVLGAAMF +++    ++YTGD++   
Sbjct  132  ADLEASMEKIETINFHEERDVMG-VRFCAYIAGHVLGAAMFMIEIAGIKILYTGDFSRQE  190

Query  184  DRHLGAAWIDRCRPDLLISESTYATTIRDSKRCRERDFLKKVHDCVDRGGKVLIPVFALG  243
            DRHL AA +   +PD+LI+ESTY T I + +  RE  F   V   V +GG+ LIPVFALG
Sbjct  191  DRHLMAAEVPPMKPDVLITESTYGTHIHEKREDRENRFTSLVQKIVQQGGRCLIPVFALG  250

Query  244  RAQELCILLETYWERMN--LKVPIYFALGLTEKANNYYKMFITWTNQKIRKTFVQRNMFD  301
            RAQEL ++L+ +W +     ++PIY+A  L +K    Y+ +I   N +IR+     N F 
Sbjct  251  RAQELLLILDEFWSQNPDLHEIPIYYASSLAKKCMAVYQTYINAMNDRIRRQIAVNNPFV  310

Query  302  FKHIKPFDKA-YIDNPGAMVVFATPGMLHAGLSLHIFRKWAPNENNMVIMPGYCVQGTVG  360
            F+HI       + ++ G  V+ A+PGM+ +GLS  +F  W  +  N VI+ GYCV+GT+ 
Sbjct  311  FRHISNLKGIDHFEDIGPCVIMASPGMMQSGLSRELFESWCTDPKNGVIIAGYCVEGTLA  370

Query  361  HKVLNGAKRVELETKQIIEVKLSVQYMSFSAHADAKGIMQLVQYCEPRNVLLVHGEAEKM  420
              VL+  + +   + Q + + +SV Y+SFSAH D +   + ++  +P +V+LVHGE  +M
Sbjct  371  KAVLSEPEEITTLSGQKLPLNMSVDYISFSAHTDYQQTSEFIRLLKPTHVVLVHGEQNEM  430

Query  421  RFLRQKIRQEF------GVQCYMPAN  440
              L+  +++E+       ++ Y P N
Sbjct  431  SRLKLALQREYEADASTDIKFYNPRN  456


>Q581U7_TRYB2 unnamed protein product
Length=770

 Score = 315 bits (808),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 175/495 (35%), Positives = 279/495 (56%), Gaps = 28/495 (6%)

Query  3    EIKVTPLGAGQDVGRSCILLTIGGKNIMLDCGMHMGYNDERKFPDFSYITKDGDLSAHID  62
            E+++ P+G+G +VGRSC+++   G+++MLDCG H   +     P F  I  D      ID
Sbjct  38   EVEILPIGSGGEVGRSCVVVRYKGRSVMLDCGNHPAKSGLDSLPFFDSIRCD-----EID  92

Query  63   CVIISHFHLDHCGALPFMTEMVGYNGPIYMTHPTKAICPILLEDMRKVSVERKGETNFFT  122
             V+I+HFHLDHCGALP+  E   + G I+MT  TKA   +++ D  ++    +   N   
Sbjct  93   LVLITHFHLDHCGALPYFCEQTSFRGRIFMTSATKAFYKMVMNDFLRIGASAEDIVN---  149

Query  123  SQMIKDCMKKVVAVTLHQTVAVDSELELKAYYAGHVLGAAMFRVKVGSESVVYTGDYNMT  182
            ++ ++  ++K+  V  H+ V V+  +  + + AGHVLGAA+F V +    ++YTGD++  
Sbjct  150  NEWLQSTIEKIETVEYHEEVTVNG-IHFQPFNAGHVLGAALFMVDIAGMKLLYTGDFSRV  208

Query  183  PDRHLGAAWIDRCRPDLLISESTYATTIRDSKRCRERDFLKKVHDCVDRGGKVLIPVFAL  242
            PDRHL  A +    PD+LI+EST      +S+  RE  F   VHD V  GG+ L+PVFAL
Sbjct  209  PDRHLLGAEVPPYSPDILIAESTNGIRELESREERESLFTTWVHDVVKGGGRCLVPVFAL  268

Query  243  GRAQELCILLETYWERMN--LKVPIYFALGLTEKANNYYKMFITWTNQKIRKTFV-QRNM  299
            GRAQEL ++LE YWE       +PIY+A  L ++    Y+ F++  N +++K     RN 
Sbjct  269  GRAQELLLILEEYWEAHKELQHIPIYYASSLAQRCMKLYQTFVSAMNDRVKKQHENHRNP  328

Query  300  FDFKHIKP-FDKAYIDNPGAMVVFATPGMLHAGLSLHIFRKWAPNENNMVIMPGYCVQGT  358
            F FK+I+   D    ++ G  VV A+PGML +G+SL +F +W  ++ N +I+ GYCV GT
Sbjct  329  FVFKYIQSLLDTRSFEDTGPCVVLASPGMLQSGISLELFERWCGDKRNGIIVAGYCVDGT  388

Query  359  VGHKVLNGAKRVELETKQIIEVKL-SVQYMSFSAHADAKGIMQLVQYC-EPRNVLLVHGE  416
            +   +L+  + +     +++ +++ ++Q +SFSAH+D +     +Q   + ++V+LVHG 
Sbjct  389  IAKDILSKPREITKPDGKVLPLRMRTIQSVSFSAHSDGRQTRDFIQALPKTKHVILVHGN  448

Query  417  AEKMRFLRQKIRQEF---GVQCYMPANGETCTVPTTQAIPVDVSLPLLRREAVKYDQEPP  473
               M  L+ K++Q+F   GVQ Y   N E   +P +      V   L R           
Sbjct  449  VGAMGQLKNKLQQDFADRGVQVYATKNQEAIRIPFSVQRTAKVLGTLARNP---------  499

Query  474  DPKRARVMHGVLVMK  488
             P+    + GVL+M 
Sbjct  500  -PRDGEFISGVLLMS  513



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000016-PA

Length=914
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2JCM1_DROME  unnamed protein product                                 277     2e-77
M9MRX4_DROME  unnamed protein product                                 277     2e-77
A8JNM7_DROME  unnamed protein product                                 276     5e-77


>X2JCM1_DROME unnamed protein product
Length=11634

 Score = 277 bits (709),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 237/835 (28%), Positives = 371/835 (44%), Gaps = 93/835 (11%)

Query  76   TPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLVPNINV  135
            T   RA R G+ + V   L++  DIN  + N    LH+AS +  +H    LL     ++ 
Sbjct  13   TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDS  72

Query  136  TDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDS  195
              + G T+LH A+  G  ++V LLL + A VN   +     ++ AA   H+ VVR+LL +
Sbjct  73   ATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSN  132

Query  196  GA-----------------------------EMNARDKEEYTALHAASASGKLRAVQSIL  226
            GA                             E + R K    ALH A+    ++A   +L
Sbjct  133  GANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL  192

Query  227  DYGAEFDMPNAYGNTCLHTACLNGHEF---------ADLNAASKDGRTPLHMTALHGRFT  277
            D     D+ +  G T LH A   G++          AD+N ++K   +PLH+ A  G+  
Sbjct  193  DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTN  252

Query  278  RAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCS  337
                L+++G  I A  +DG T LH AA  GHE +V  LL  G     K   G+ PLHM +
Sbjct  253  MVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAA  312

Query  338  QSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKL  397
            Q   V+  R  L     +D       T LH+ +  G V   +LL    AD       G  
Sbjct  313  QGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFT  372

Query  398  PLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA----CADDTEGRCVDYLLKHRS  453
            PLH AC ++  + +  L+  G+ I+A   SG TPLH A    C +      V YLL+H +
Sbjct  373  PLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN-----IVIYLLQHDA  427

Query  454  NPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHG  513
            +P V   +G +P++ A  +   + + +LL+           +     +  TPLH+A+  G
Sbjct  428  SPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQTPLHIASRLG  480

Query  514  HREILEIILPHLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPT  573
            + +I+ ++L H A V+    +  TAL +A  +G  E   +L+ +GA +           T
Sbjct  481  NVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF---T  537

Query  574  SVHLAAMNGHLECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELL  633
             +HL A  GH++   LLL+         K A VDA    G TPL +A    + +    LL
Sbjct  538  PLHLTAKYGHIKVAQLLLQ---------KEADVDAQGKNGVTPLHVACHYNNQQVALLLL  588

Query  634  KHGASPDLVDKDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIP  693
            + GASP    K+  + L         ++ + LL  GA    + + G +PLHL+S  GH  
Sbjct  589  EKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAE  648

Query  694  VLEVLLQRSPPGLVDSLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVN  753
            +  +L++      V+        TP+H      +    E          +L   G+ I +
Sbjct  649  ISNLLIEHK--AAVNHPAK-NGLTPMHLCAQEDNVNVAE----------ILEKNGANI-D  694

Query  754  LQDHRGRSPLHVAAHHGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVL  813
            +    G +PLHVA+H G    +  LL + A+++A      TPL   A+ G   ++    L
Sbjct  695  MATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVN---L  751

Query  814  LLDRRGGSEAVDLPNSRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPA  868
            LL+ +  + A  +    G+TPLH+A + G + V   L       + + KE  T A
Sbjct  752  LLEHKANANAQTV---NGQTPLHIARKLGYISVLDSL-------KTITKEDETAA  796


 Score = 256 bits (655),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 226/798 (28%), Positives = 346/798 (43%), Gaps = 97/798 (12%)

Query  48   AAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNW  107
            AA  G+   V   + N   +N+ +   +  LH A + G    V+ LLR  A +++  +  
Sbjct  18   AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKG  77

Query  108  QTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVN  167
             T LH+AS        + LL    ++NV  + G T L+ AA   H  +V LLLSNGA  +
Sbjct  78   NTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQS  137

Query  168  SVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILD  227
               +     +  A   GH++VV +LL+S    + R K    ALH A+    ++A   +LD
Sbjct  138  LATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLD  193

Query  228  YGAEFDMPNAYGNTCLHTACLNGHEF---------ADLNAASKDGRTPLHMTALHGRFTR  278
                 D+ +  G T LH A   G++          AD+N ++K   +PLH+ A  G+   
Sbjct  194  NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM  253

Query  279  AKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQ  338
               L+++G  I A  +DG T LH AA  GHE +V  LL  G     K   G+ PLHM +Q
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ  313

Query  339  SGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLP  398
               V+  R  L     +D       T LH+ +  G V   +LL    AD       G  P
Sbjct  314  GEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP  373

Query  399  LHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA----CADDTEGRCVDYLLKHRSN  454
            LH AC ++  + +  L+  G+ I+A   SG TPLH A    C +      V YLL+H ++
Sbjct  374  LHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN-----IVIYLLQHDAS  428

Query  455  PVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGH  514
            P V   +G +P++ A  +   + + +LL+           +     +  TPLH+A+  G+
Sbjct  429  PDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQTPLHIASRLGN  481

Query  515  REILEIILPHLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTS  574
             +I+ ++L H A V+    +  TAL +A  +G  E   +L+ +GA +           T 
Sbjct  482  VDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF---TP  538

Query  575  VHLAAMNGHLECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLK  634
            +HL A  GH++   LLL+         K A VDA    G TPL +A    + +    LL+
Sbjct  539  LHLTAKYGHIKVAQLLLQ---------KEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  635  HGASPDLVDKDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPV  694
             GASP    K+  + L         ++ + LL  GA    + + G +PLHL+S  GH  +
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI  649

Query  695  LEVLLQRSPP-------GLVDSLLDCQQ-----------------------YTPLHWACY  724
              +L++           GL    L  Q+                       YTPLH A +
Sbjct  650  SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH  709

Query  725  NGHEACLEY------------------------HGSEQCVELLLAHYGSGIVNLQDHRGR  760
             G    + +                         G    V LLL H  +   N Q   G+
Sbjct  710  FGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA--NAQTVNGQ  767

Query  761  SPLHVAAHHGNMECLHQL  778
            +PLH+A   G +  L  L
Sbjct  768  TPLHIARKLGYISVLDSL  785


 Score = 242 bits (618),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 209/715 (29%), Positives = 317/715 (44%), Gaps = 62/715 (9%)

Query  24   VQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACR  83
            V++LL+    VN Q  +  +PL+ AA      +V LL+ NGA  +       TPL  A +
Sbjct  93   VKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQ  152

Query  84   TGSEDAVNSLLR-------------------------------HQADINARDRNWQTPLH  112
             G +  V  LL                                H  D+ ++  +  TPLH
Sbjct  153  QGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSK--SGFTPLH  210

Query  113  VASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKR  172
            +AS     + A  L+    ++N + +   + LH AA  G  +MV+LLL  G  + +  + 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRD  270

Query  173  ERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEF  232
                +H AA  GHE+VV MLL+ GA ++A+ K     LH A+    + A + +L + A  
Sbjct  271  GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV  330

Query  233  DMPNAYGNTCLHTACLNGH---------EFADLNAASKDGRTPLHMTALHGRFTRAKTLM  283
            D       T LH A   GH           AD NA + +G TPLH+     R    + L+
Sbjct  331  DEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLL  390

Query  284  DRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVE  343
              GA I+AT + G T LH+AAF G   +V  LL     P     +G TPLH+ +++   +
Sbjct  391  RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTD  450

Query  344  CCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLPLHYAC  403
              R  L  G ++DAR    +T LH+ S  G+V+ + LL   GA            LH A 
Sbjct  451  IIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA  510

Query  404  SRSHFQCIFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYLLKHRSNPVVADAQGF  463
                 +    L+  G+ ++A    G TPLH   A     +    LL+  ++       G 
Sbjct  511  KEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNGV  569

Query  464  SPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGHREILEIILP  523
            +P++ A    N++   LLL+   S    P +  +N     TPLH+AA     +I   +L 
Sbjct  570  TPLHVACHYNNQQVALLLLEKGAS----PHATAKNGH---TPLHIAARKNQMDIATTLLE  622

Query  524  HLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGH  583
            + A  N     G T L L++ +G+ E   LL+ H A V  P  + L   T +HL A   +
Sbjct  623  YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGL---TPMHLCAQEDN  679

Query  584  LECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVD  643
            +    +L         E   A +D     G TPL +A+  G    V  LL++GA+ D   
Sbjct  680  VNVAEIL---------EKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT  730

Query  644  KDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVL  698
                + L +    GH  +V+LLL   A+   Q   G++PLH+A   G+I VL+ L
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL  785


 Score = 219 bits (558),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 209/714 (29%), Positives = 309/714 (43%), Gaps = 57/714 (8%)

Query  180  AAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYG  239
            AA  G+ E V   L +  ++N  +     ALH AS  G +  V  +L  GA  D     G
Sbjct  18   AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKG  77

Query  240  NTCLHTACLNGHE---------FADLNAASKDGRTPLHMTALHGRFTRAKTLMDRGALIN  290
            NT LH A L G E          A +N  S++G TPL+M A        + L+  GA  +
Sbjct  78   NTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQS  137

Query  291  ATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLS  350
               +DG T L +A   GH+ +V  LL +  D R  G   +  LH+ ++   V+     L 
Sbjct  138  LATEDGFTPLAVAMQQGHDKVVAVLLES--DTR--GKVRLPALHIAAKKDDVKAATLLLD  193

Query  351  AGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLPLHYACSRSHFQC  410
                 D     G T LH+ S  G+     LL   GAD      +   PLH A        
Sbjct  194  NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM  253

Query  411  IFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYLLKHRSNPVVADAQ-GFSPVYYA  469
            +  L+  G +I A+   G TPLH A     E + VD LL+ R  P+ A  + G +P++ A
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHE-QVVDMLLE-RGAPISAKTKNGLAPLHMA  311

Query  470  VVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGHREILEIILPHLASVN  529
                + +A  +LL            +       +T LH+AA+ GH  + +++L   A  N
Sbjct  312  AQGEHVDAARILL-------YHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADAN  364

Query  530  DPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHLECLSL  589
                 G T L +A  K   + V LLL HGA +    +  L   T +H+AA  G +  +  
Sbjct  365  ARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGL---TPLHVAAFMGCMNIVIY  421

Query  590  LLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDKDARSA  649
            LL+           A  D    +G TPL +AA       +  LL++GA  D   ++ ++ 
Sbjct  422  LLQHD---------ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTP  472

Query  650  LFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPPGLVDS  709
            L      G+ ++V LLL  GA      +   + LH+A+  G   V  VL++    G    
Sbjct  473  LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIEN---GAALD  529

Query  710  LLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLHVAAHH  769
                + +TPLH     GH          +  +LLL       V+ Q   G +PLHVA H+
Sbjct  530  AATKKGFTPLHLTAKYGHI---------KVAQLLLQKEAD--VDAQGKNGVTPLHVACHY  578

Query  770  GNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAVDLPNS  829
             N +    LL   AS  A      TPL +AAR  Q   ++ A  LL+    + A    + 
Sbjct  579  NNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQ---MDIATTLLEYGALANA---ESK  632

Query  830  RGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPALACAP--NAEVADCL  881
             G TPLH+++++G   ++  L++  A V    K G TP   CA   N  VA+ L
Sbjct  633  AGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL  686


 Score = 213 bits (543),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 163/551 (30%), Positives = 249/551 (45%), Gaps = 50/551 (9%)

Query  11   PLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSK  70
            PL  A   G    V +LL++  ++  +  D  +PLH AA  G   +VD+L+  GA +++K
Sbjct  241  PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAK  300

Query  71   DNKWVTPLHRACRTGSEDAVNSLLRHQA--------------------------------  98
                + PLH A +    DA   LL H+A                                
Sbjct  301  TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRN  360

Query  99   -DINARDRNWQTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVA  157
             D NAR  N  TPLH+A   N L     LL    +I+ T  +G T LH AA+ G  ++V 
Sbjct  361  ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVI  420

Query  158  LLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASG  217
             LL + A  +    R    +H AA     +++R+LL +GA+++AR +E+ T LH AS  G
Sbjct  421  YLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLG  480

Query  218  KLRAVQSILDYGAEFDMPNAYGNTCLHTACLNGHE---------FADLNAASKDGRTPLH  268
             +  V  +L +GA+ D       T LH A   G +          A L+AA+K G TPLH
Sbjct  481  NVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLH  540

Query  269  MTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQ  328
            +TA +G    A+ L+ + A ++A  K+G T LH+A  Y ++ +   LL  G  P      
Sbjct  541  LTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN  600

Query  329  GMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADF  388
            G TPLH+ ++   ++     L  G   +A    G T LHL S  G  E   LL    A  
Sbjct  601  GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV  660

Query  389  RLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYL  448
                  G  P+H      +      L   G++I+    +G TPLH A +   +   V +L
Sbjct  661  NHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA-SHFGQANMVRFL  719

Query  449  LKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHL  508
            L++ +N   A + G++P++     G+   + LLL+   +A               TPLH+
Sbjct  720  LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA-------NAQTVNGQTPLHI  772

Query  509  AAYHGHREILE  519
            A   G+  +L+
Sbjct  773  ARKLGYISVLD  783


 Score = 213 bits (541),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 153/493 (31%), Positives = 234/493 (47%), Gaps = 15/493 (3%)

Query  25   QVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACRT  84
            ++LL  +  V+   +D  + LH AA  G   +  LL+   A  N++     TPLH AC+ 
Sbjct  321  RILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKK  380

Query  85   GSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSL  144
                 V  LLRH A I+A   +  TPLHVA+    ++    LL    + +V    G T L
Sbjct  381  NRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPL  440

Query  145  HHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDK  204
            H AA     D++ +LL NGA V++  + ++  +H A+  G+ ++V +LL  GA+++A  K
Sbjct  441  HLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK  500

Query  205  EEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACLNGH---------EFAD  255
            + YTALH A+  G+      +++ GA  D     G T LH     GH         + AD
Sbjct  501  DMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD  560

Query  256  LNAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTL  315
            ++A  K+G TPLH+   +     A  L+++GA  +AT K+G T LHIAA      +  TL
Sbjct  561  VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL  620

Query  316  LATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSV  375
            L  G     +   G TPLH+ SQ G  E     +     ++     G T +HLC+   +V
Sbjct  621  LEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV  680

Query  376  ECLELLASSGADFRLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA  435
               E+L  +GA+  +    G  PLH A        +  L+  G++++A    G TPLH  
Sbjct  681  NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQT  740

Query  436  CADDTEGRC--VDYLLKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGS-AVLTP  492
                 +G C  V+ LL+H++N       G +P++ A   G    L+ L            
Sbjct  741  A---QQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAA  797

Query  493  PSIGRNKTKVVTP  505
            PS    K +VV P
Sbjct  798  PSQAEEKYRVVAP  810


 Score = 191 bits (484),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 189/639 (30%), Positives = 279/639 (44%), Gaps = 67/639 (10%)

Query  257  NAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLL  316
            N A  DG T     A  G   R    +     IN ++ +G  ALH+A+  GH  +V  LL
Sbjct  5    NGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELL  64

Query  317  ATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVE  376
              G        +G T LH+ S +G  E  +  L     ++ +   G T L++ +      
Sbjct  65   RRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDA  124

Query  377  CLELLASSGADFRLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYAC  436
             + LL S+GA+  L    G  PL  A  + H + +  L  L SD   +       LH A 
Sbjct  125  VVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL--LESDTRGK--VRLPALHIAA  180

Query  437  ADDTEGRCVDYLLKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAV-------  489
              D + +    LL +  NP V    GF+P++ A   GN+    LL++  G+ V       
Sbjct  181  KKD-DVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQ-KGADVNYSAKHN  238

Query  490  LTPPSIGRN--KTKVV------------------TPLHLAAYHGHREILEIILPHLASVN  529
            ++P  +     KT +V                  TPLH AA  GH ++++++L   A ++
Sbjct  239  ISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPIS  298

Query  530  DPDGEGRTALDLATFKGNH-ECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHLECLS  588
                 G   L +A  +G H +  R+LL H A V   ++  +   T++H+AA  GH+    
Sbjct  299  AKTKNGLAPLHMAA-QGEHVDAARILLYHRAPV---DEVTVDYLTALHVAAHCGHVRVAK  354

Query  589  LLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDKDARS  648
            LLL         D+ A  +A    G TPL +A     +K VE LL+HGAS     +   +
Sbjct  355  LLL---------DRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLT  405

Query  649  ALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPPGLVD  708
             L      G   +V  LL   ASP +    G++PLHLA+ +    ++ +LL+      VD
Sbjct  406  PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG--AQVD  463

Query  709  SLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLHVAAH  768
            +    QQ TPLH A            G+   V LLL H        +D    + LH+AA 
Sbjct  464  ARAREQQ-TPLHIA---------SRLGNVDIVMLLLQHGAQVDATTKDM--YTALHIAAK  511

Query  769  HGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAVDLPN  828
             G  E    L+ + A+L+A   +  TPL + A+ G    ++ A LLL +      VD   
Sbjct  512  EGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH---IKVAQLLLQKEAD---VDAQG  565

Query  829  SRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTP  867
              G TPLHVA       V   LL+KGA   A  K GHTP
Sbjct  566  KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTP  604


 Score = 162 bits (409),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 116/382 (30%), Positives = 183/382 (48%), Gaps = 9/382 (2%)

Query  11   PLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSK  70
            PL  A F+G +  V  LLQ     +   +   +PLH AA      ++ +L+ NGA+V+++
Sbjct  406  PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR  465

Query  71   DNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLV  130
              +  TPLH A R G+ D V  LL+H A ++A  ++  T LH+A+       A  L+   
Sbjct  466  AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENG  525

Query  131  PNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVR  190
              ++   + G T LH  A  GH  +  LLL   A V++  K     +H A    +++V  
Sbjct  526  AALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVAL  585

Query  191  MLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACLNG  250
            +LL+ GA  +A  K  +T LH A+   ++    ++L+YGA  +  +  G T LH +   G
Sbjct  586  LLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEG  645

Query  251  H-EFADL--------NAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALH  301
            H E ++L        N  +K+G TP+H+ A       A+ L   GA I+   K G T LH
Sbjct  646  HAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLH  705

Query  302  IAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDI  361
            +A+ +G   +V  LL  G +       G TPLH  +Q G        L      +A+   
Sbjct  706  VASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN  765

Query  362  GRTCLHLCSLSGSVECLELLAS  383
            G+T LH+    G +  L+ L +
Sbjct  766  GQTPLHIARKLGYISVLDSLKT  787


 Score = 139 bits (351),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 97/334 (29%), Positives = 151/334 (45%), Gaps = 24/334 (7%)

Query  9    EPPLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVN  68
            + PL  A  +G++  V +LLQ    V+    D  + LH AA  G   +  +L+ NGA ++
Sbjct  470  QTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALD  529

Query  69   SKDNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLP  128
            +   K  TPLH   + G       LL+ +AD++A+ +N  TPLHVA   N    A  LL 
Sbjct  530  AATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  129  LVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEV  188
               + + T + G T LH AA     D+   LL  GA+ N+  K     +H ++  GH E+
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI  649

Query  189  VRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACL  248
              +L++  A +N   K   T +H  +    +   + +   GA  DM              
Sbjct  650  SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------------  695

Query  249  NGHEFADLNAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGH  308
                      A+K G TPLH+ +  G+    + L+  GA ++A    G T LH  A  GH
Sbjct  696  ----------ATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGH  745

Query  309  ELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFV  342
              +V  LL    +   +   G TPLH+  + G++
Sbjct  746  CHIVNLLLEHKANANAQTVNGQTPLHIARKLGYI  779


 Score = 119 bits (297),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 106/361 (29%), Positives = 166/361 (46%), Gaps = 37/361 (10%)

Query  525  LASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHL  584
            + + N   G+G T+   A   GN E V   L +   +   N + L    ++HLA+ +GH+
Sbjct  1    MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGL---NALHLASKDGHI  57

Query  585  ECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDK  644
              +S LL          + A+VD+   KG T L +A+  G  + V+ LL+H AS ++  +
Sbjct  58   HVVSELLR---------RGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQ  108

Query  645  DARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPP  704
            +  + L+      H  +V LLL  GA+ ++    G +PL +A   GH  V+ VLL+    
Sbjct  109  NGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR  168

Query  705  GLVDSLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLH  764
            G V       +   LH A               +   LLL +  +   ++    G +PLH
Sbjct  169  GKV-------RLPALHIAAKKD---------DVKAATLLLDNDHNP--DVTSKSGFTPLH  210

Query  765  VAAHHGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAV  824
            +A+H+GN    + L+   A +        +PL VAA+ G+  ++    LLL++ G  EA 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVS---LLLEKGGNIEA-  266

Query  825  DLPNSRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPALACAPNAEVADCLSMI  884
                  G TPLH AAR G   V   LL++GA + A  K G  P L  A   E  D   ++
Sbjct  267  --KTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAP-LHMAAQGEHVDAARIL  323

Query  885  L  885
            L
Sbjct  324  L  324


>M9MRX4_DROME unnamed protein product
Length=13559

 Score = 277 bits (709),  Expect = 2e-77, Method: Composition-based stats.
 Identities = 237/835 (28%), Positives = 371/835 (44%), Gaps = 93/835 (11%)

Query  76   TPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLVPNINV  135
            T   RA R G+ + V   L++  DIN  + N    LH+AS +  +H    LL     ++ 
Sbjct  13   TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDS  72

Query  136  TDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDS  195
              + G T+LH A+  G  ++V LLL + A VN   +     ++ AA   H+ VVR+LL +
Sbjct  73   ATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSN  132

Query  196  GA-----------------------------EMNARDKEEYTALHAASASGKLRAVQSIL  226
            GA                             E + R K    ALH A+    ++A   +L
Sbjct  133  GANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL  192

Query  227  DYGAEFDMPNAYGNTCLHTACLNGHEF---------ADLNAASKDGRTPLHMTALHGRFT  277
            D     D+ +  G T LH A   G++          AD+N ++K   +PLH+ A  G+  
Sbjct  193  DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTN  252

Query  278  RAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCS  337
                L+++G  I A  +DG T LH AA  GHE +V  LL  G     K   G+ PLHM +
Sbjct  253  MVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAA  312

Query  338  QSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKL  397
            Q   V+  R  L     +D       T LH+ +  G V   +LL    AD       G  
Sbjct  313  QGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFT  372

Query  398  PLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA----CADDTEGRCVDYLLKHRS  453
            PLH AC ++  + +  L+  G+ I+A   SG TPLH A    C +      V YLL+H +
Sbjct  373  PLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN-----IVIYLLQHDA  427

Query  454  NPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHG  513
            +P V   +G +P++ A  +   + + +LL+           +     +  TPLH+A+  G
Sbjct  428  SPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQTPLHIASRLG  480

Query  514  HREILEIILPHLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPT  573
            + +I+ ++L H A V+    +  TAL +A  +G  E   +L+ +GA +           T
Sbjct  481  NVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF---T  537

Query  574  SVHLAAMNGHLECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELL  633
             +HL A  GH++   LLL+         K A VDA    G TPL +A    + +    LL
Sbjct  538  PLHLTAKYGHIKVAQLLLQ---------KEADVDAQGKNGVTPLHVACHYNNQQVALLLL  588

Query  634  KHGASPDLVDKDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIP  693
            + GASP    K+  + L         ++ + LL  GA    + + G +PLHL+S  GH  
Sbjct  589  EKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAE  648

Query  694  VLEVLLQRSPPGLVDSLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVN  753
            +  +L++      V+        TP+H      +    E          +L   G+ I +
Sbjct  649  ISNLLIEHK--AAVNHPAK-NGLTPMHLCAQEDNVNVAE----------ILEKNGANI-D  694

Query  754  LQDHRGRSPLHVAAHHGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVL  813
            +    G +PLHVA+H G    +  LL + A+++A      TPL   A+ G   ++    L
Sbjct  695  MATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVN---L  751

Query  814  LLDRRGGSEAVDLPNSRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPA  868
            LL+ +  + A  +    G+TPLH+A + G + V   L       + + KE  T A
Sbjct  752  LLEHKANANAQTV---NGQTPLHIARKLGYISVLDSL-------KTITKEDETAA  796


 Score = 256 bits (654),  Expect = 2e-70, Method: Composition-based stats.
 Identities = 226/798 (28%), Positives = 346/798 (43%), Gaps = 97/798 (12%)

Query  48   AAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNW  107
            AA  G+   V   + N   +N+ +   +  LH A + G    V+ LLR  A +++  +  
Sbjct  18   AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKG  77

Query  108  QTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVN  167
             T LH+AS        + LL    ++NV  + G T L+ AA   H  +V LLLSNGA  +
Sbjct  78   NTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQS  137

Query  168  SVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILD  227
               +     +  A   GH++VV +LL+S    + R K    ALH A+    ++A   +LD
Sbjct  138  LATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLD  193

Query  228  YGAEFDMPNAYGNTCLHTACLNGHEF---------ADLNAASKDGRTPLHMTALHGRFTR  278
                 D+ +  G T LH A   G++          AD+N ++K   +PLH+ A  G+   
Sbjct  194  NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM  253

Query  279  AKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQ  338
               L+++G  I A  +DG T LH AA  GHE +V  LL  G     K   G+ PLHM +Q
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ  313

Query  339  SGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLP  398
               V+  R  L     +D       T LH+ +  G V   +LL    AD       G  P
Sbjct  314  GEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP  373

Query  399  LHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA----CADDTEGRCVDYLLKHRSN  454
            LH AC ++  + +  L+  G+ I+A   SG TPLH A    C +      V YLL+H ++
Sbjct  374  LHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN-----IVIYLLQHDAS  428

Query  455  PVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGH  514
            P V   +G +P++ A  +   + + +LL+           +     +  TPLH+A+  G+
Sbjct  429  PDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQTPLHIASRLGN  481

Query  515  REILEIILPHLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTS  574
             +I+ ++L H A V+    +  TAL +A  +G  E   +L+ +GA +           T 
Sbjct  482  VDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF---TP  538

Query  575  VHLAAMNGHLECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLK  634
            +HL A  GH++   LLL+         K A VDA    G TPL +A    + +    LL+
Sbjct  539  LHLTAKYGHIKVAQLLLQ---------KEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  635  HGASPDLVDKDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPV  694
             GASP    K+  + L         ++ + LL  GA    + + G +PLHL+S  GH  +
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI  649

Query  695  LEVLLQRSPP-------GLVDSLLDCQQ-----------------------YTPLHWACY  724
              +L++           GL    L  Q+                       YTPLH A +
Sbjct  650  SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH  709

Query  725  NGHEACLEY------------------------HGSEQCVELLLAHYGSGIVNLQDHRGR  760
             G    + +                         G    V LLL H  +   N Q   G+
Sbjct  710  FGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA--NAQTVNGQ  767

Query  761  SPLHVAAHHGNMECLHQL  778
            +PLH+A   G +  L  L
Sbjct  768  TPLHIARKLGYISVLDSL  785


 Score = 242 bits (618),  Expect = 7e-66, Method: Composition-based stats.
 Identities = 209/715 (29%), Positives = 317/715 (44%), Gaps = 62/715 (9%)

Query  24   VQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACR  83
            V++LL+    VN Q  +  +PL+ AA      +V LL+ NGA  +       TPL  A +
Sbjct  93   VKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQ  152

Query  84   TGSEDAVNSLLR-------------------------------HQADINARDRNWQTPLH  112
             G +  V  LL                                H  D+ ++  +  TPLH
Sbjct  153  QGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSK--SGFTPLH  210

Query  113  VASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKR  172
            +AS     + A  L+    ++N + +   + LH AA  G  +MV+LLL  G  + +  + 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRD  270

Query  173  ERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEF  232
                +H AA  GHE+VV MLL+ GA ++A+ K     LH A+    + A + +L + A  
Sbjct  271  GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV  330

Query  233  DMPNAYGNTCLHTACLNGH---------EFADLNAASKDGRTPLHMTALHGRFTRAKTLM  283
            D       T LH A   GH           AD NA + +G TPLH+     R    + L+
Sbjct  331  DEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLL  390

Query  284  DRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVE  343
              GA I+AT + G T LH+AAF G   +V  LL     P     +G TPLH+ +++   +
Sbjct  391  RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTD  450

Query  344  CCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLPLHYAC  403
              R  L  G ++DAR    +T LH+ S  G+V+ + LL   GA            LH A 
Sbjct  451  IIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA  510

Query  404  SRSHFQCIFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYLLKHRSNPVVADAQGF  463
                 +    L+  G+ ++A    G TPLH   A     +    LL+  ++       G 
Sbjct  511  KEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNGV  569

Query  464  SPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGHREILEIILP  523
            +P++ A    N++   LLL+   S    P +  +N     TPLH+AA     +I   +L 
Sbjct  570  TPLHVACHYNNQQVALLLLEKGAS----PHATAKNGH---TPLHIAARKNQMDIATTLLE  622

Query  524  HLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGH  583
            + A  N     G T L L++ +G+ E   LL+ H A V  P  + L   T +HL A   +
Sbjct  623  YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGL---TPMHLCAQEDN  679

Query  584  LECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVD  643
            +    +L         E   A +D     G TPL +A+  G    V  LL++GA+ D   
Sbjct  680  VNVAEIL---------EKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT  730

Query  644  KDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVL  698
                + L +    GH  +V+LLL   A+   Q   G++PLH+A   G+I VL+ L
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL  785


 Score = 219 bits (558),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 209/714 (29%), Positives = 309/714 (43%), Gaps = 57/714 (8%)

Query  180  AAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYG  239
            AA  G+ E V   L +  ++N  +     ALH AS  G +  V  +L  GA  D     G
Sbjct  18   AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKG  77

Query  240  NTCLHTACLNGHE---------FADLNAASKDGRTPLHMTALHGRFTRAKTLMDRGALIN  290
            NT LH A L G E          A +N  S++G TPL+M A        + L+  GA  +
Sbjct  78   NTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQS  137

Query  291  ATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLS  350
               +DG T L +A   GH+ +V  LL +  D R  G   +  LH+ ++   V+     L 
Sbjct  138  LATEDGFTPLAVAMQQGHDKVVAVLLES--DTR--GKVRLPALHIAAKKDDVKAATLLLD  193

Query  351  AGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLPLHYACSRSHFQC  410
                 D     G T LH+ S  G+     LL   GAD      +   PLH A        
Sbjct  194  NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM  253

Query  411  IFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYLLKHRSNPVVADAQ-GFSPVYYA  469
            +  L+  G +I A+   G TPLH A     E + VD LL+ R  P+ A  + G +P++ A
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHE-QVVDMLLE-RGAPISAKTKNGLAPLHMA  311

Query  470  VVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGHREILEIILPHLASVN  529
                + +A  +LL            +       +T LH+AA+ GH  + +++L   A  N
Sbjct  312  AQGEHVDAARILL-------YHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADAN  364

Query  530  DPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHLECLSL  589
                 G T L +A  K   + V LLL HGA +    +  L   T +H+AA  G +  +  
Sbjct  365  ARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGL---TPLHVAAFMGCMNIVIY  421

Query  590  LLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDKDARSA  649
            LL+           A  D    +G TPL +AA       +  LL++GA  D   ++ ++ 
Sbjct  422  LLQHD---------ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTP  472

Query  650  LFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPPGLVDS  709
            L      G+ ++V LLL  GA      +   + LH+A+  G   V  VL++    G    
Sbjct  473  LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIEN---GAALD  529

Query  710  LLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLHVAAHH  769
                + +TPLH     GH          +  +LLL       V+ Q   G +PLHVA H+
Sbjct  530  AATKKGFTPLHLTAKYGHI---------KVAQLLLQKEAD--VDAQGKNGVTPLHVACHY  578

Query  770  GNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAVDLPNS  829
             N +    LL   AS  A      TPL +AAR  Q   ++ A  LL+    + A    + 
Sbjct  579  NNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQ---MDIATTLLEYGALANA---ESK  632

Query  830  RGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPALACAP--NAEVADCL  881
             G TPLH+++++G   ++  L++  A V    K G TP   CA   N  VA+ L
Sbjct  633  AGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL  686


 Score = 213 bits (543),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 163/551 (30%), Positives = 249/551 (45%), Gaps = 50/551 (9%)

Query  11   PLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSK  70
            PL  A   G    V +LL++  ++  +  D  +PLH AA  G   +VD+L+  GA +++K
Sbjct  241  PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAK  300

Query  71   DNKWVTPLHRACRTGSEDAVNSLLRHQA--------------------------------  98
                + PLH A +    DA   LL H+A                                
Sbjct  301  TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRN  360

Query  99   -DINARDRNWQTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVA  157
             D NAR  N  TPLH+A   N L     LL    +I+ T  +G T LH AA+ G  ++V 
Sbjct  361  ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVI  420

Query  158  LLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASG  217
             LL + A  +    R    +H AA     +++R+LL +GA+++AR +E+ T LH AS  G
Sbjct  421  YLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLG  480

Query  218  KLRAVQSILDYGAEFDMPNAYGNTCLHTACLNGHE---------FADLNAASKDGRTPLH  268
             +  V  +L +GA+ D       T LH A   G +          A L+AA+K G TPLH
Sbjct  481  NVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLH  540

Query  269  MTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQ  328
            +TA +G    A+ L+ + A ++A  K+G T LH+A  Y ++ +   LL  G  P      
Sbjct  541  LTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN  600

Query  329  GMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADF  388
            G TPLH+ ++   ++     L  G   +A    G T LHL S  G  E   LL    A  
Sbjct  601  GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV  660

Query  389  RLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYL  448
                  G  P+H      +      L   G++I+    +G TPLH A +   +   V +L
Sbjct  661  NHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA-SHFGQANMVRFL  719

Query  449  LKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHL  508
            L++ +N   A + G++P++     G+   + LLL+   +A               TPLH+
Sbjct  720  LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA-------NAQTVNGQTPLHI  772

Query  509  AAYHGHREILE  519
            A   G+  +L+
Sbjct  773  ARKLGYISVLD  783


 Score = 213 bits (541),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 153/493 (31%), Positives = 234/493 (47%), Gaps = 15/493 (3%)

Query  25   QVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACRT  84
            ++LL  +  V+   +D  + LH AA  G   +  LL+   A  N++     TPLH AC+ 
Sbjct  321  RILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKK  380

Query  85   GSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSL  144
                 V  LLRH A I+A   +  TPLHVA+    ++    LL    + +V    G T L
Sbjct  381  NRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPL  440

Query  145  HHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDK  204
            H AA     D++ +LL NGA V++  + ++  +H A+  G+ ++V +LL  GA+++A  K
Sbjct  441  HLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK  500

Query  205  EEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACLNGH---------EFAD  255
            + YTALH A+  G+      +++ GA  D     G T LH     GH         + AD
Sbjct  501  DMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD  560

Query  256  LNAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTL  315
            ++A  K+G TPLH+   +     A  L+++GA  +AT K+G T LHIAA      +  TL
Sbjct  561  VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL  620

Query  316  LATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSV  375
            L  G     +   G TPLH+ SQ G  E     +     ++     G T +HLC+   +V
Sbjct  621  LEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV  680

Query  376  ECLELLASSGADFRLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA  435
               E+L  +GA+  +    G  PLH A        +  L+  G++++A    G TPLH  
Sbjct  681  NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQT  740

Query  436  CADDTEGRC--VDYLLKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGS-AVLTP  492
                 +G C  V+ LL+H++N       G +P++ A   G    L+ L            
Sbjct  741  A---QQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAA  797

Query  493  PSIGRNKTKVVTP  505
            PS    K +VV P
Sbjct  798  PSQAEEKYRVVAP  810


 Score = 191 bits (484),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 189/639 (30%), Positives = 279/639 (44%), Gaps = 67/639 (10%)

Query  257  NAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLL  316
            N A  DG T     A  G   R    +     IN ++ +G  ALH+A+  GH  +V  LL
Sbjct  5    NGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELL  64

Query  317  ATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVE  376
              G        +G T LH+ S +G  E  +  L     ++ +   G T L++ +      
Sbjct  65   RRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDA  124

Query  377  CLELLASSGADFRLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYAC  436
             + LL S+GA+  L    G  PL  A  + H + +  L  L SD   +       LH A 
Sbjct  125  VVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL--LESDTRGK--VRLPALHIAA  180

Query  437  ADDTEGRCVDYLLKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAV-------  489
              D + +    LL +  NP V    GF+P++ A   GN+    LL++  G+ V       
Sbjct  181  KKD-DVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQ-KGADVNYSAKHN  238

Query  490  LTPPSIGRN--KTKVV------------------TPLHLAAYHGHREILEIILPHLASVN  529
            ++P  +     KT +V                  TPLH AA  GH ++++++L   A ++
Sbjct  239  ISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPIS  298

Query  530  DPDGEGRTALDLATFKGNH-ECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHLECLS  588
                 G   L +A  +G H +  R+LL H A V   ++  +   T++H+AA  GH+    
Sbjct  299  AKTKNGLAPLHMAA-QGEHVDAARILLYHRAPV---DEVTVDYLTALHVAAHCGHVRVAK  354

Query  589  LLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDKDARS  648
            LLL         D+ A  +A    G TPL +A     +K VE LL+HGAS     +   +
Sbjct  355  LLL---------DRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLT  405

Query  649  ALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPPGLVD  708
             L      G   +V  LL   ASP +    G++PLHLA+ +    ++ +LL+      VD
Sbjct  406  PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG--AQVD  463

Query  709  SLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLHVAAH  768
            +    QQ TPLH A            G+   V LLL H        +D    + LH+AA 
Sbjct  464  ARAREQQ-TPLHIA---------SRLGNVDIVMLLLQHGAQVDATTKDM--YTALHIAAK  511

Query  769  HGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAVDLPN  828
             G  E    L+ + A+L+A   +  TPL + A+ G    ++ A LLL +      VD   
Sbjct  512  EGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH---IKVAQLLLQKEAD---VDAQG  565

Query  829  SRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTP  867
              G TPLHVA       V   LL+KGA   A  K GHTP
Sbjct  566  KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTP  604


 Score = 162 bits (409),  Expect = 5e-40, Method: Composition-based stats.
 Identities = 116/382 (30%), Positives = 183/382 (48%), Gaps = 9/382 (2%)

Query  11   PLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSK  70
            PL  A F+G +  V  LLQ     +   +   +PLH AA      ++ +L+ NGA+V+++
Sbjct  406  PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR  465

Query  71   DNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLV  130
              +  TPLH A R G+ D V  LL+H A ++A  ++  T LH+A+       A  L+   
Sbjct  466  AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENG  525

Query  131  PNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVR  190
              ++   + G T LH  A  GH  +  LLL   A V++  K     +H A    +++V  
Sbjct  526  AALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVAL  585

Query  191  MLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACLNG  250
            +LL+ GA  +A  K  +T LH A+   ++    ++L+YGA  +  +  G T LH +   G
Sbjct  586  LLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEG  645

Query  251  H-EFADL--------NAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALH  301
            H E ++L        N  +K+G TP+H+ A       A+ L   GA I+   K G T LH
Sbjct  646  HAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLH  705

Query  302  IAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDI  361
            +A+ +G   +V  LL  G +       G TPLH  +Q G        L      +A+   
Sbjct  706  VASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN  765

Query  362  GRTCLHLCSLSGSVECLELLAS  383
            G+T LH+    G +  L+ L +
Sbjct  766  GQTPLHIARKLGYISVLDSLKT  787


 Score = 139 bits (351),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 97/334 (29%), Positives = 151/334 (45%), Gaps = 24/334 (7%)

Query  9    EPPLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVN  68
            + PL  A  +G++  V +LLQ    V+    D  + LH AA  G   +  +L+ NGA ++
Sbjct  470  QTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALD  529

Query  69   SKDNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLP  128
            +   K  TPLH   + G       LL+ +AD++A+ +N  TPLHVA   N    A  LL 
Sbjct  530  AATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  129  LVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEV  188
               + + T + G T LH AA     D+   LL  GA+ N+  K     +H ++  GH E+
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI  649

Query  189  VRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACL  248
              +L++  A +N   K   T +H  +    +   + +   GA  DM              
Sbjct  650  SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------------  695

Query  249  NGHEFADLNAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGH  308
                      A+K G TPLH+ +  G+    + L+  GA ++A    G T LH  A  GH
Sbjct  696  ----------ATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGH  745

Query  309  ELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFV  342
              +V  LL    +   +   G TPLH+  + G++
Sbjct  746  CHIVNLLLEHKANANAQTVNGQTPLHIARKLGYI  779


 Score = 119 bits (297),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 106/361 (29%), Positives = 166/361 (46%), Gaps = 37/361 (10%)

Query  525  LASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHL  584
            + + N   G+G T+   A   GN E V   L +   +   N + L    ++HLA+ +GH+
Sbjct  1    MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGL---NALHLASKDGHI  57

Query  585  ECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDK  644
              +S LL          + A+VD+   KG T L +A+  G  + V+ LL+H AS ++  +
Sbjct  58   HVVSELLR---------RGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQ  108

Query  645  DARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPP  704
            +  + L+      H  +V LLL  GA+ ++    G +PL +A   GH  V+ VLL+    
Sbjct  109  NGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR  168

Query  705  GLVDSLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLH  764
            G V       +   LH A               +   LLL +  +   ++    G +PLH
Sbjct  169  GKV-------RLPALHIAAKKD---------DVKAATLLLDNDHNP--DVTSKSGFTPLH  210

Query  765  VAAHHGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAV  824
            +A+H+GN    + L+   A +        +PL VAA+ G+  ++    LLL++ G  EA 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVS---LLLEKGGNIEA-  266

Query  825  DLPNSRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPALACAPNAEVADCLSMI  884
                  G TPLH AAR G   V   LL++GA + A  K G  P L  A   E  D   ++
Sbjct  267  --KTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAP-LHMAAQGEHVDAARIL  323

Query  885  L  885
            L
Sbjct  324  L  324


>A8JNM7_DROME unnamed protein product
Length=4114

 Score = 276 bits (705),  Expect = 5e-77, Method: Composition-based stats.
 Identities = 237/835 (28%), Positives = 371/835 (44%), Gaps = 93/835 (11%)

Query  76   TPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLVPNINV  135
            T   RA R G+ + V   L++  DIN  + N    LH+AS +  +H    LL     ++ 
Sbjct  13   TSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDS  72

Query  136  TDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDS  195
              + G T+LH A+  G  ++V LLL + A VN   +     ++ AA   H+ VVR+LL +
Sbjct  73   ATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSN  132

Query  196  GA-----------------------------EMNARDKEEYTALHAASASGKLRAVQSIL  226
            GA                             E + R K    ALH A+    ++A   +L
Sbjct  133  GANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLL  192

Query  227  DYGAEFDMPNAYGNTCLHTACLNGHEF---------ADLNAASKDGRTPLHMTALHGRFT  277
            D     D+ +  G T LH A   G++          AD+N ++K   +PLH+ A  G+  
Sbjct  193  DNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTN  252

Query  278  RAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCS  337
                L+++G  I A  +DG T LH AA  GHE +V  LL  G     K   G+ PLHM +
Sbjct  253  MVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAA  312

Query  338  QSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKL  397
            Q   V+  R  L     +D       T LH+ +  G V   +LL    AD       G  
Sbjct  313  QGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFT  372

Query  398  PLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA----CADDTEGRCVDYLLKHRS  453
            PLH AC ++  + +  L+  G+ I+A   SG TPLH A    C +      V YLL+H +
Sbjct  373  PLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN-----IVIYLLQHDA  427

Query  454  NPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHG  513
            +P V   +G +P++ A  +   + + +LL+           +     +  TPLH+A+  G
Sbjct  428  SPDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQTPLHIASRLG  480

Query  514  HREILEIILPHLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPT  573
            + +I+ ++L H A V+    +  TAL +A  +G  E   +L+ +GA +           T
Sbjct  481  NVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF---T  537

Query  574  SVHLAAMNGHLECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELL  633
             +HL A  GH++   LLL+         K A VDA    G TPL +A    + +    LL
Sbjct  538  PLHLTAKYGHIKVAQLLLQ---------KEADVDAQGKNGVTPLHVACHYNNQQVALLLL  588

Query  634  KHGASPDLVDKDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIP  693
            + GASP    K+  + L         ++ + LL  GA    + + G +PLHL+S  GH  
Sbjct  589  EKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAE  648

Query  694  VLEVLLQRSPPGLVDSLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVN  753
            +  +L++      V+        TP+H      +    E          +L   G+ I +
Sbjct  649  ISNLLIEHK--AAVNHPAK-NGLTPMHLCAQEDNVNVAE----------ILEKNGANI-D  694

Query  754  LQDHRGRSPLHVAAHHGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVL  813
            +    G +PLHVA+H G    +  LL + A+++A      TPL   A+ G   ++    L
Sbjct  695  MATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVN---L  751

Query  814  LLDRRGGSEAVDLPNSRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPA  868
            LL+ +  + A  +    G+TPLH+A + G + V   L       + + KE  T A
Sbjct  752  LLEHKANANAQTV---NGQTPLHIARKLGYISVLDSL-------KTITKEDETAA  796


 Score = 255 bits (651),  Expect = 4e-70, Method: Composition-based stats.
 Identities = 226/798 (28%), Positives = 346/798 (43%), Gaps = 97/798 (12%)

Query  48   AAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNW  107
            AA  G+   V   + N   +N+ +   +  LH A + G    V+ LLR  A +++  +  
Sbjct  18   AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKG  77

Query  108  QTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVN  167
             T LH+AS        + LL    ++NV  + G T L+ AA   H  +V LLLSNGA  +
Sbjct  78   NTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQS  137

Query  168  SVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILD  227
               +     +  A   GH++VV +LL+S    + R K    ALH A+    ++A   +LD
Sbjct  138  LATEDGFTPLAVAMQQGHDKVVAVLLES----DTRGKVRLPALHIAAKKDDVKAATLLLD  193

Query  228  YGAEFDMPNAYGNTCLHTACLNGHEF---------ADLNAASKDGRTPLHMTALHGRFTR  278
                 D+ +  G T LH A   G++          AD+N ++K   +PLH+ A  G+   
Sbjct  194  NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM  253

Query  279  AKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQ  338
               L+++G  I A  +DG T LH AA  GHE +V  LL  G     K   G+ PLHM +Q
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ  313

Query  339  SGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLP  398
               V+  R  L     +D       T LH+ +  G V   +LL    AD       G  P
Sbjct  314  GEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP  373

Query  399  LHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA----CADDTEGRCVDYLLKHRSN  454
            LH AC ++  + +  L+  G+ I+A   SG TPLH A    C +      V YLL+H ++
Sbjct  374  LHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN-----IVIYLLQHDAS  428

Query  455  PVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGH  514
            P V   +G +P++ A  +   + + +LL+           +     +  TPLH+A+  G+
Sbjct  429  PDVPTVRGETPLHLAARANQTDIIRILLR-------NGAQVDARAREQQTPLHIASRLGN  481

Query  515  REILEIILPHLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTS  574
             +I+ ++L H A V+    +  TAL +A  +G  E   +L+ +GA +           T 
Sbjct  482  VDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGF---TP  538

Query  575  VHLAAMNGHLECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLK  634
            +HL A  GH++   LLL+         K A VDA    G TPL +A    + +    LL+
Sbjct  539  LHLTAKYGHIKVAQLLLQ---------KEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  635  HGASPDLVDKDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPV  694
             GASP    K+  + L         ++ + LL  GA    + + G +PLHL+S  GH  +
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI  649

Query  695  LEVLLQRSPP-------GLVDSLLDCQQ-----------------------YTPLHWACY  724
              +L++           GL    L  Q+                       YTPLH A +
Sbjct  650  SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASH  709

Query  725  NGHEACLEY------------------------HGSEQCVELLLAHYGSGIVNLQDHRGR  760
             G    + +                         G    V LLL H  +   N Q   G+
Sbjct  710  FGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA--NAQTVNGQ  767

Query  761  SPLHVAAHHGNMECLHQL  778
            +PLH+A   G +  L  L
Sbjct  768  TPLHIARKLGYISVLDSL  785


 Score = 241 bits (615),  Expect = 1e-65, Method: Composition-based stats.
 Identities = 209/715 (29%), Positives = 317/715 (44%), Gaps = 62/715 (9%)

Query  24   VQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACR  83
            V++LL+    VN Q  +  +PL+ AA      +V LL+ NGA  +       TPL  A +
Sbjct  93   VKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQ  152

Query  84   TGSEDAVNSLLR-------------------------------HQADINARDRNWQTPLH  112
             G +  V  LL                                H  D+ ++  +  TPLH
Sbjct  153  QGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSK--SGFTPLH  210

Query  113  VASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKR  172
            +AS     + A  L+    ++N + +   + LH AA  G  +MV+LLL  G  + +  + 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRD  270

Query  173  ERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEF  232
                +H AA  GHE+VV MLL+ GA ++A+ K     LH A+    + A + +L + A  
Sbjct  271  GLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPV  330

Query  233  DMPNAYGNTCLHTACLNGH---------EFADLNAASKDGRTPLHMTALHGRFTRAKTLM  283
            D       T LH A   GH           AD NA + +G TPLH+     R    + L+
Sbjct  331  DEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLL  390

Query  284  DRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVE  343
              GA I+AT + G T LH+AAF G   +V  LL     P     +G TPLH+ +++   +
Sbjct  391  RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTD  450

Query  344  CCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLPLHYAC  403
              R  L  G ++DAR    +T LH+ S  G+V+ + LL   GA            LH A 
Sbjct  451  IIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA  510

Query  404  SRSHFQCIFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYLLKHRSNPVVADAQGF  463
                 +    L+  G+ ++A    G TPLH   A     +    LL+  ++       G 
Sbjct  511  KEGQDEVAAVLIENGAALDAATKKGFTPLHLT-AKYGHIKVAQLLLQKEADVDAQGKNGV  569

Query  464  SPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGHREILEIILP  523
            +P++ A    N++   LLL+   S    P +  +N     TPLH+AA     +I   +L 
Sbjct  570  TPLHVACHYNNQQVALLLLEKGAS----PHATAKNGH---TPLHIAARKNQMDIATTLLE  622

Query  524  HLASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGH  583
            + A  N     G T L L++ +G+ E   LL+ H A V  P  + L   T +HL A   +
Sbjct  623  YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGL---TPMHLCAQEDN  679

Query  584  LECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVD  643
            +    +L         E   A +D     G TPL +A+  G    V  LL++GA+ D   
Sbjct  680  VNVAEIL---------EKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAAT  730

Query  644  KDARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVL  698
                + L +    GH  +V+LLL   A+   Q   G++PLH+A   G+I VL+ L
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL  785


 Score = 218 bits (555),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 209/714 (29%), Positives = 309/714 (43%), Gaps = 57/714 (8%)

Query  180  AAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYG  239
            AA  G+ E V   L +  ++N  +     ALH AS  G +  V  +L  GA  D     G
Sbjct  18   AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKG  77

Query  240  NTCLHTACLNGHE---------FADLNAASKDGRTPLHMTALHGRFTRAKTLMDRGALIN  290
            NT LH A L G E          A +N  S++G TPL+M A        + L+  GA  +
Sbjct  78   NTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQS  137

Query  291  ATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLS  350
               +DG T L +A   GH+ +V  LL +  D R  G   +  LH+ ++   V+     L 
Sbjct  138  LATEDGFTPLAVAMQQGHDKVVAVLLES--DTR--GKVRLPALHIAAKKDDVKAATLLLD  193

Query  351  AGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADFRLVDSYGKLPLHYACSRSHFQC  410
                 D     G T LH+ S  G+     LL   GAD      +   PLH A        
Sbjct  194  NDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNM  253

Query  411  IFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYLLKHRSNPVVADAQ-GFSPVYYA  469
            +  L+  G +I A+   G TPLH A     E + VD LL+ R  P+ A  + G +P++ A
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHE-QVVDMLLE-RGAPISAKTKNGLAPLHMA  311

Query  470  VVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHLAAYHGHREILEIILPHLASVN  529
                + +A  +LL            +       +T LH+AA+ GH  + +++L   A  N
Sbjct  312  AQGEHVDAARILL-------YHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADAN  364

Query  530  DPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHLECLSL  589
                 G T L +A  K   + V LLL HGA +    +  L   T +H+AA  G +  +  
Sbjct  365  ARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGL---TPLHVAAFMGCMNIVIY  421

Query  590  LLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDKDARSA  649
            LL+           A  D    +G TPL +AA       +  LL++GA  D   ++ ++ 
Sbjct  422  LLQHD---------ASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTP  472

Query  650  LFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPPGLVDS  709
            L      G+ ++V LLL  GA      +   + LH+A+  G   V  VL++    G    
Sbjct  473  LHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIEN---GAALD  529

Query  710  LLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLHVAAHH  769
                + +TPLH     GH          +  +LLL       V+ Q   G +PLHVA H+
Sbjct  530  AATKKGFTPLHLTAKYGHI---------KVAQLLLQKEAD--VDAQGKNGVTPLHVACHY  578

Query  770  GNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAVDLPNS  829
             N +    LL   AS  A      TPL +AAR  Q   ++ A  LL+    + A    + 
Sbjct  579  NNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQ---MDIATTLLEYGALANA---ESK  632

Query  830  RGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPALACAP--NAEVADCL  881
             G TPLH+++++G   ++  L++  A V    K G TP   CA   N  VA+ L
Sbjct  633  AGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEIL  686


 Score = 213 bits (541),  Expect = 3e-56, Method: Composition-based stats.
 Identities = 163/551 (30%), Positives = 249/551 (45%), Gaps = 50/551 (9%)

Query  11   PLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSK  70
            PL  A   G    V +LL++  ++  +  D  +PLH AA  G   +VD+L+  GA +++K
Sbjct  241  PLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAK  300

Query  71   DNKWVTPLHRACRTGSEDAVNSLLRHQA--------------------------------  98
                + PLH A +    DA   LL H+A                                
Sbjct  301  TKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRN  360

Query  99   -DINARDRNWQTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSLHHAAYNGHPDMVA  157
             D NAR  N  TPLH+A   N L     LL    +I+ T  +G T LH AA+ G  ++V 
Sbjct  361  ADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVI  420

Query  158  LLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDKEEYTALHAASASG  217
             LL + A  +    R    +H AA     +++R+LL +GA+++AR +E+ T LH AS  G
Sbjct  421  YLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLG  480

Query  218  KLRAVQSILDYGAEFDMPNAYGNTCLHTACLNGHE---------FADLNAASKDGRTPLH  268
             +  V  +L +GA+ D       T LH A   G +          A L+AA+K G TPLH
Sbjct  481  NVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLH  540

Query  269  MTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLLATGGDPRRKGFQ  328
            +TA +G    A+ L+ + A ++A  K+G T LH+A  Y ++ +   LL  G  P      
Sbjct  541  LTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN  600

Query  329  GMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVECLELLASSGADF  388
            G TPLH+ ++   ++     L  G   +A    G T LHL S  G  E   LL    A  
Sbjct  601  GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV  660

Query  389  RLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYACADDTEGRCVDYL  448
                  G  P+H      +      L   G++I+    +G TPLH A +   +   V +L
Sbjct  661  NHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVA-SHFGQANMVRFL  719

Query  449  LKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAVLTPPSIGRNKTKVVTPLHL  508
            L++ +N   A + G++P++     G+   + LLL+   +A               TPLH+
Sbjct  720  LQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANA-------NAQTVNGQTPLHI  772

Query  509  AAYHGHREILE  519
            A   G+  +L+
Sbjct  773  ARKLGYISVLD  783


 Score = 212 bits (539),  Expect = 4e-56, Method: Composition-based stats.
 Identities = 153/493 (31%), Positives = 234/493 (47%), Gaps = 15/493 (3%)

Query  25   QVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSKDNKWVTPLHRACRT  84
            ++LL  +  V+   +D  + LH AA  G   +  LL+   A  N++     TPLH AC+ 
Sbjct  321  RILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKK  380

Query  85   GSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLVPNINVTDRAGRTSL  144
                 V  LLRH A I+A   +  TPLHVA+    ++    LL    + +V    G T L
Sbjct  381  NRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPL  440

Query  145  HHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVRMLLDSGAEMNARDK  204
            H AA     D++ +LL NGA V++  + ++  +H A+  G+ ++V +LL  GA+++A  K
Sbjct  441  HLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTK  500

Query  205  EEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACLNGH---------EFAD  255
            + YTALH A+  G+      +++ GA  D     G T LH     GH         + AD
Sbjct  501  DMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEAD  560

Query  256  LNAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTL  315
            ++A  K+G TPLH+   +     A  L+++GA  +AT K+G T LHIAA      +  TL
Sbjct  561  VDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTL  620

Query  316  LATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSV  375
            L  G     +   G TPLH+ SQ G  E     +     ++     G T +HLC+   +V
Sbjct  621  LEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNV  680

Query  376  ECLELLASSGADFRLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYA  435
               E+L  +GA+  +    G  PLH A        +  L+  G++++A    G TPLH  
Sbjct  681  NVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQT  740

Query  436  CADDTEGRC--VDYLLKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGS-AVLTP  492
                 +G C  V+ LL+H++N       G +P++ A   G    L+ L            
Sbjct  741  A---QQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLKTITKEDETAAA  797

Query  493  PSIGRNKTKVVTP  505
            PS    K +VV P
Sbjct  798  PSQAEEKYRVVAP  810


 Score = 189 bits (481),  Expect = 6e-49, Method: Composition-based stats.
 Identities = 189/639 (30%), Positives = 279/639 (44%), Gaps = 67/639 (10%)

Query  257  NAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGHELLVGTLL  316
            N A  DG T     A  G   R    +     IN ++ +G  ALH+A+  GH  +V  LL
Sbjct  5    NGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELL  64

Query  317  ATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDIGRTCLHLCSLSGSVE  376
              G        +G T LH+ S +G  E  +  L     ++ +   G T L++ +      
Sbjct  65   RRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDA  124

Query  377  CLELLASSGADFRLVDSYGKLPLHYACSRSHFQCIFTLVSLGSDINAQDCSGCTPLHYAC  436
             + LL S+GA+  L    G  PL  A  + H + +  L  L SD   +       LH A 
Sbjct  125  VVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVL--LESDTRGK--VRLPALHIAA  180

Query  437  ADDTEGRCVDYLLKHRSNPVVADAQGFSPVYYAVVSGNKEALELLLKCLGSAV-------  489
              D + +    LL +  NP V    GF+P++ A   GN+    LL++  G+ V       
Sbjct  181  KKD-DVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQ-KGADVNYSAKHN  238

Query  490  LTPPSIGRN--KTKVV------------------TPLHLAAYHGHREILEIILPHLASVN  529
            ++P  +     KT +V                  TPLH AA  GH ++++++L   A ++
Sbjct  239  ISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPIS  298

Query  530  DPDGEGRTALDLATFKGNH-ECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHLECLS  588
                 G   L +A  +G H +  R+LL H A V   ++  +   T++H+AA  GH+    
Sbjct  299  AKTKNGLAPLHMAA-QGEHVDAARILLYHRAPV---DEVTVDYLTALHVAAHCGHVRVAK  354

Query  589  LLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDKDARS  648
            LLL         D+ A  +A    G TPL +A     +K VE LL+HGAS     +   +
Sbjct  355  LLL---------DRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLT  405

Query  649  ALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPPGLVD  708
             L      G   +V  LL   ASP +    G++PLHLA+ +    ++ +LL+      VD
Sbjct  406  PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNG--AQVD  463

Query  709  SLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLHVAAH  768
            +    QQ TPLH A            G+   V LLL H        +D    + LH+AA 
Sbjct  464  ARAREQQ-TPLHIA---------SRLGNVDIVMLLLQHGAQVDATTKDM--YTALHIAAK  511

Query  769  HGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAVDLPN  828
             G  E    L+ + A+L+A   +  TPL + A+ G    ++ A LLL +      VD   
Sbjct  512  EGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH---IKVAQLLLQKEAD---VDAQG  565

Query  829  SRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTP  867
              G TPLHVA       V   LL+KGA   A  K GHTP
Sbjct  566  KNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTP  604


 Score = 161 bits (407),  Expect = 6e-40, Method: Composition-based stats.
 Identities = 116/382 (30%), Positives = 183/382 (48%), Gaps = 9/382 (2%)

Query  11   PLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVNSK  70
            PL  A F+G +  V  LLQ     +   +   +PLH AA      ++ +L+ NGA+V+++
Sbjct  406  PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDAR  465

Query  71   DNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLPLV  130
              +  TPLH A R G+ D V  LL+H A ++A  ++  T LH+A+       A  L+   
Sbjct  466  AREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENG  525

Query  131  PNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEVVR  190
              ++   + G T LH  A  GH  +  LLL   A V++  K     +H A    +++V  
Sbjct  526  AALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVAL  585

Query  191  MLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACLNG  250
            +LL+ GA  +A  K  +T LH A+   ++    ++L+YGA  +  +  G T LH +   G
Sbjct  586  LLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEG  645

Query  251  H-EFADL--------NAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALH  301
            H E ++L        N  +K+G TP+H+ A       A+ L   GA I+   K G T LH
Sbjct  646  HAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLH  705

Query  302  IAAFYGHELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFVECCRRFLSAGVELDARDDI  361
            +A+ +G   +V  LL  G +       G TPLH  +Q G        L      +A+   
Sbjct  706  VASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN  765

Query  362  GRTCLHLCSLSGSVECLELLAS  383
            G+T LH+    G +  L+ L +
Sbjct  766  GQTPLHIARKLGYISVLDSLKT  787


 Score = 139 bits (350),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 97/334 (29%), Positives = 151/334 (45%), Gaps = 24/334 (7%)

Query  9    EPPLVKAIFIGDILQVQVLLQQKEDVNCQDLDRRSPLHAAAFRGDPHMVDLLVMNGARVN  68
            + PL  A  +G++  V +LLQ    V+    D  + LH AA  G   +  +L+ NGA ++
Sbjct  470  QTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALD  529

Query  69   SKDNKWVTPLHRACRTGSEDAVNSLLRHQADINARDRNWQTPLHVASANNALHCARSLLP  128
            +   K  TPLH   + G       LL+ +AD++A+ +N  TPLHVA   N    A  LL 
Sbjct  530  AATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  129  LVPNINVTDRAGRTSLHHAAYNGHPDMVALLLSNGAMVNSVDKRERRAVHWAAFGGHEEV  188
               + + T + G T LH AA     D+   LL  GA+ N+  K     +H ++  GH E+
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEI  649

Query  189  VRMLLDSGAEMNARDKEEYTALHAASASGKLRAVQSILDYGAEFDMPNAYGNTCLHTACL  248
              +L++  A +N   K   T +H  +    +   + +   GA  DM              
Sbjct  650  SNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDM--------------  695

Query  249  NGHEFADLNAASKDGRTPLHMTALHGRFTRAKTLMDRGALINATDKDGCTALHIAAFYGH  308
                      A+K G TPLH+ +  G+    + L+  GA ++A    G T LH  A  GH
Sbjct  696  ----------ATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGH  745

Query  309  ELLVGTLLATGGDPRRKGFQGMTPLHMCSQSGFV  342
              +V  LL    +   +   G TPLH+  + G++
Sbjct  746  CHIVNLLLEHKANANAQTVNGQTPLHIARKLGYI  779


 Score = 118 bits (295),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 106/361 (29%), Positives = 166/361 (46%), Gaps = 37/361 (10%)

Query  525  LASVNDPDGEGRTALDLATFKGNHECVRLLLSHGAQVFVPNDHELGRPTSVHLAAMNGHL  584
            + + N   G+G T+   A   GN E V   L +   +   N + L    ++HLA+ +GH+
Sbjct  1    MVTENGAQGDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGL---NALHLASKDGHI  57

Query  585  ECLSLLLEDAETSGNEDKVAVVDATDAKGRTPLMMAAAGGHMKCVEELLKHGASPDLVDK  644
              +S LL          + A+VD+   KG T L +A+  G  + V+ LL+H AS ++  +
Sbjct  58   HVVSELLR---------RGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQ  108

Query  645  DARSALFRGVVNGHQELVSLLLCRGASPAIQDRGGKSPLHLASASGHIPVLEVLLQRSPP  704
            +  + L+      H  +V LLL  GA+ ++    G +PL +A   GH  V+ VLL+    
Sbjct  109  NGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTR  168

Query  705  GLVDSLLDCQQYTPLHWACYNGHEACLEYHGSEQCVELLLAHYGSGIVNLQDHRGRSPLH  764
            G V       +   LH A               +   LLL +  +   ++    G +PLH
Sbjct  169  GKV-------RLPALHIAAKKD---------DVKAATLLLDNDHNP--DVTSKSGFTPLH  210

Query  765  VAAHHGNMECLHQLLSHEASLEAVDWRKRTPLLVAARSGQKAVLEAAVLLLDRRGGSEAV  824
            +A+H+GN    + L+   A +        +PL VAA+ G+  ++    LLL++ G  EA 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVS---LLLEKGGNIEA-  266

Query  825  DLPNSRGETPLHVAARQGLVGVTQRLLDKGADVRAVDKEGHTPALACAPNAEVADCLSMI  884
                  G TPLH AAR G   V   LL++GA + A  K G  P L  A   E  D   ++
Sbjct  267  --KTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAP-LHMAAQGEHVDAARIL  323

Query  885  L  885
            L
Sbjct  324  L  324



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000017-PA

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CDK5_CAEEL  unnamed protein product                                   419     2e-149
CDK5_DROME  unnamed protein product                                   411     2e-146
CDK5_DICDI  unnamed protein product                                   331     1e-114


>CDK5_CAEEL unnamed protein product
Length=292

 Score = 419 bits (1076),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 195/290 (67%), Positives = 236/290 (81%), Gaps = 34/290 (12%)

Query  1    MQKYEKLEKIGEGTYGTVFKAKNRESHEIVALKRVRLDDEDEGVPSSALREICLLKELKH  60
            M  Y+K+EKIGEGTYGTVFKA+N+ S EIVALKRVRLDD+DEGVPSSALREIC+L+ELKH
Sbjct  1    MLNYDKMEKIGEGTYGTVFKARNKNSGEIVALKRVRLDDDDEGVPSSALREICILRELKH  60

Query  61   KNIVRLYDVLHSEKKLTLVFEHCDQDLKKYFDSLNGEIDP--------------------  100
            +N+VRLYDV+HSE KLTLVFE+CDQDLKK+FDSLNG +D                     
Sbjct  61   RNVVRLYDVVHSENKLTLVFEYCDQDLKKFFDSLNGYMDAQTARSLMLQLLRGLSFCHAH  120

Query  101  --------------DVNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYT  146
                          + NG LKLADFGLARAFG+PV+C+SAEVVTLWYRPPDVLFGAKLY 
Sbjct  121  HVLHRDLKPQNLLINTNGTLKLADFGLARAFGVPVRCFSAEVVTLWYRPPDVLFGAKLYN  180

Query  147  TSIDIWSAGCIFAELANAGRPLFPGSDVDDQLKRIFKLLGTPTEESWTGMTQLPDYKPFP  206
            TSID+WSAGCIFAE++NAGRPLFPG+DVDDQLKRIFK LG+P+E++W  +TQLPDYKP+P
Sbjct  181  TSIDMWSAGCIFAEISNAGRPLFPGADVDDQLKRIFKQLGSPSEDNWPSITQLPDYKPYP  240

Query  207  LYHPSMSFSQVVPKLNTKGKDLLQRLLVCNPSVRISAEDAMIHTYFSDLS  256
            +YHP++++SQ+VP LN++G+DLLQ+LLVCNP+ RI A+ A+ H YF+D S
Sbjct  241  IYHPTLTWSQIVPNLNSRGRDLLQKLLVCNPAGRIDADAALRHAYFADTS  290


>CDK5_DROME unnamed protein product
Length=294

 Score = 411 bits (1056),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 204/292 (70%), Positives = 231/292 (79%), Gaps = 34/292 (12%)

Query  1    MQKYEKLEKIGEGTYGTVFKAKNRESHEIVALKRVRLDDEDEGVPSSALREICLLKELKH  60
            MQKY+K+EKIGEGTYGTVFK +NR++ EIVALKRVRLD++DEGVPSSALREICLLKELKH
Sbjct  1    MQKYDKMEKIGEGTYGTVFKGRNRDTMEIVALKRVRLDEDDEGVPSSALREICLLKELKH  60

Query  61   KNIVRLYDVLHSEKKLTLVFEHCDQDLKKYFDSLNGEIDPDV------------------  102
            KNIVRL DVLHS+KKLTLVFEHCDQDLKKYFDSLNGEID  V                  
Sbjct  61   KNIVRLIDVLHSDKKLTLVFEHCDQDLKKYFDSLNGEIDMAVCRSFMLQLLRGLAFCHSH  120

Query  103  ----------------NGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYT  146
                            NGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYT
Sbjct  121  NVLHRDLKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYT  180

Query  147  TSIDIWSAGCIFAELANAGRPLFPGSDVDDQLKRIFKLLGTPTEESWTGMTQLPDYKPFP  206
            TSID+WSAGCI AELA+AGRPLFPGSDV DQL +IF++LGTP E+SW G++ L DY   P
Sbjct  181  TSIDMWSAGCILAELADAGRPLFPGSDVLDQLMKIFRVLGTPNEDSWPGVSHLSDYVALP  240

Query  207  LYHPSMSFSQVVPKLNTKGKDLLQRLLVCNPSVRISAEDAMIHTYFSDLSPA  258
             +    S+SQ+VP+LN+KG+DLLQ+LL+C P+ RISAE AM H YF+D S +
Sbjct  241  SFPAITSWSQLVPRLNSKGRDLLQKLLICRPNQRISAEAAMQHPYFTDSSSS  292


>CDK5_DICDI unnamed protein product
Length=292

 Score = 331 bits (848),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 172/292 (59%), Positives = 207/292 (71%), Gaps = 37/292 (13%)

Query  1    MQKYEKLEKIGEGTYGTVFKAKNRESHEIVALKRVRLDDEDEGVPSSALREICLLKELKH  60
            M+KY K+EK+GEGTYG V+KAKNRE+ EIVALKR+RLD EDEGVP +A+REI LLKELKH
Sbjct  1    MEKYSKIEKLGEGTYGIVYKAKNRETGEIVALKRIRLDSEDEGVPCTAIREISLLKELKH  60

Query  61   KNIVRLYDVLHSEKKLTLVFEHCDQDLKKYFDSLNGEID-PDVN----------------  103
             NIVRL+DV+H+E+KLTLVFE+ DQDLKKY D   GEI  P +                 
Sbjct  61   PNIVRLHDVIHTERKLTLVFEYLDQDLKKYLDECGGEISKPTIKSFMYQLLKGVAFCHDH  120

Query  104  -----------------GELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYT  146
                             GELKLADFGLARAFGIPV+ YS EVVTLWYR PDVL G++ Y+
Sbjct  121  RVLHRDLKPQNLLINRKGELKLADFGLARAFGIPVRTYSHEVVTLWYRAPDVLMGSRKYS  180

Query  147  TSIDIWSAGCIFAELANAGRPLFPGSDVDDQLKRIFKLLGTPTEESWTGMTQLPDYKP-F  205
            T IDIWSAGCIFAE+A +GRPLFPGS   DQL RIFK+LGTP EESW  +T+LP+YK  F
Sbjct  181  TPIDIWSAGCIFAEMA-SGRPLFPGSGTSDQLFRIFKILGTPNEESWPSITELPEYKTDF  239

Query  206  PLYHPSMSFSQVVPKLNTKGKDLLQRLLVCNPSVRISAEDAMIHTYFSDLSP  257
            P+ HP+   S +V  L+ KG +LL ++L  +P+ RI+A  A+ H YF  L P
Sbjct  240  PV-HPAHQLSSIVHGLDEKGLNLLSKMLQYDPNQRITAAAALKHPYFDGLEP  290



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000018-PA

Length=439
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAP60_DROME  unnamed protein product                                  703     0.0   
Q09646_CAEEL  unnamed protein product                                 493     2e-173
O02101_CAEEL  unnamed protein product                                 437     3e-151


>BAP60_DROME unnamed protein product
Length=515

 Score = 703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/386 (88%), Positives = 362/386 (94%), Gaps = 3/386 (1%)

Query  55   LADKILPQKVRDLVPESQAYMDLLAFERKLDATIMRKRLDIQEALKRPMKQKRKLRIFIS  114
            LA+KILPQKVRDLVPESQAYMDLL FERKLDATIMRKRLDIQEALKRPMKQKRKLRIFIS
Sbjct  130  LAEKILPQKVRDLVPESQAYMDLLTFERKLDATIMRKRLDIQEALKRPMKQKRKLRIFIS  189

Query  115  NTFYPAKEPA-EGEDGSVASWELRVEGRLLEDGKNDPN-KVKRKFSSFFKSLVIELDKDL  172
            NTFYP+KEP  +GE+G+VASWELRVEGRLLEDGK DPN K+KRKFSSFFKSLVIELDK+L
Sbjct  190  NTFYPSKEPTNDGEEGAVASWELRVEGRLLEDGKGDPNTKIKRKFSSFFKSLVIELDKEL  249

Query  173  YGPDNHLVEWHRTPTTQETDGFQVKRPGDKNVACTILLLLDYQPLQFKLDSRLARLLGVH  232
            YGPDNHLVEWHRT TTQETDGFQVKRPGD+NV CTILLLLDYQPLQFKLD RLARLLGVH
Sbjct  250  YGPDNHLVEWHRTHTTQETDGFQVKRPGDRNVRCTILLLLDYQPLQFKLDPRLARLLGVH  309

Query  233  TQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFACHRMKFAEIPQRLNPLLHPP  292
            TQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIF+C RMKFAEIPQRLNPLLHPP
Sbjct  310  TQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFSCQRMKFAEIPQRLNPLLHPP  369

Query  293  DPIVINHVISVEGAEQKKTACYDIDVEVDDTLKTQMNNFLLSTASQQEIQSLDNKIHETV  352
            DPIVINH I   GAE K+TACYDIDVEVDDTLK QMN+FL+STASQQEIQ LD KIHETV
Sbjct  370  DPIVINHFIE-SGAENKQTACYDIDVEVDDTLKNQMNSFLMSTASQQEIQGLDTKIHETV  428

Query  353  ETINQLKTHREFFLSFAKDPQQFIQKWLISQTRDLKTITDVVGNPEEERRADFFFQPWSQ  412
            +TINQ+KT+REFFLSFAKDPQ FI +W+IS+TRDLK +TDV GNPEEERRA+F++QPW+ 
Sbjct  429  DTINQMKTNREFFLSFAKDPQMFIHRWIISETRDLKLMTDVAGNPEEERRAEFYYQPWTH  488

Query  413  EAVCRYFYTKVQQKRAELEQALGIRN  438
            EAV RYF+TKV QKRAELEQALGIRN
Sbjct  489  EAVSRYFFTKVNQKRAELEQALGIRN  514


>Q09646_CAEEL unnamed protein product
Length=446

 Score = 493 bits (1269),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 245/402 (61%), Positives = 306/402 (76%), Gaps = 8/402 (2%)

Query  46   PKSSKKKKKLADKILPQKVRDLVPESQAYMDLLAFERKLDATIMRKRLDIQEALKRPMKQ  105
            P+  KKKK+ ADK++  KVR+LVPESQAYMDLLAFE+KLD+TI RK++D+QEALKRP K 
Sbjct  45   PQPPKKKKRYADKLIQPKVRELVPESQAYMDLLAFEQKLDSTITRKKIDVQEALKRPQKI  104

Query  106  KRKLRIFISNTFYPAKEP-AEGEDGSVASWELRVEGRLLED------GKNDPNKVKRKFS  158
            K++LRI+IS+TF   KEP  EG+D SV  WELRVEGRLL+D      G N     KRKFS
Sbjct  105  KKRLRIYISHTFIAGKEPEKEGDDASVPMWELRVEGRLLDDMQHPTVGANPRPAPKRKFS  164

Query  159  SFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQVKRPGDKNVACTILLLLDYQPLQ  218
            SFFKSLVIELDKD+YGPDNHLVEWHRTP T ETDGFQVKRPGD+ V CTILLLLDYQP++
Sbjct  165  SFFKSLVIELDKDIYGPDNHLVEWHRTPQTNETDGFQVKRPGDRPVKCTILLLLDYQPMK  224

Query  219  FKLDSRLARLLGVHTQTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFACHRMKF  278
            FKL  RLA++LG+  +TRP II ALWQYIKTHKLQD  +R+ IN D +LEQ F   +M+F
Sbjct  225  FKLHPRLAKVLGIAAETRPRIIEALWQYIKTHKLQDPQDRDTINNDLFLEQCFGVSKMRF  284

Query  279  AEIPQRLNPLLHPPDPIVINHVISV-EGAEQKKTACYDIDVEVDDTLKTQMNNFLLSTAS  337
             EIPQRL+ LL  PDP+V+NH+I   +  + K +ACYDIDVE++D +K QM NF+ +  +
Sbjct  285  MEIPQRLHQLLQQPDPLVLNHIIQRPDDGQDKTSACYDIDVELEDPVKQQMANFVHNQTN  344

Query  338  QQEIQSLDNKIHETVETINQLKTHREFFLSFAKDPQQFIQKWLISQTRDLKTITDVVGNP  397
              +IQ LD KI + V+ IN++K  R+FFL F+ +P  FI+KW++SQ  DLKT+T+  G+ 
Sbjct  345  ANDIQLLDQKIFDLVDQINEMKLRRDFFLRFSNEPSGFIKKWVVSQNSDLKTLTESSGDG  404

Query  398  EEERRADFFFQPWSQEAVCRYFYTKVQQKRAELEQALGIRNT  439
            E +R A  +    + E V RY Y K+QQKRAELEQ+LGIRN 
Sbjct  405  ESDRYATTYSTTDTDEGVSRYMYQKIQQKRAELEQSLGIRNN  446


>O02101_CAEEL unnamed protein product
Length=449

 Score = 437 bits (1124),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 234/448 (52%), Positives = 303/448 (68%), Gaps = 18/448 (4%)

Query  5    PGPSMMPRPPQQPPYGPM--RPGPMGGQPGGKRPADSRPPQQQPKSSK--KKKKLADKIL  60
            P P M   P   P   P   RPG   GQP    P    P    P ++   KKKK ADK +
Sbjct  7    PNPQMNRHPYGTPGSAPQMRRPGGFAGQP----PQMHGPRMVAPPAAPLPKKKKYADKCI  62

Query  61   PQKVRDLVPESQAYMDLLAFERKLDATIMRKRLDIQEALKRPMKQKRKLRIFISNTFYPA  120
              K+R+L P+++ YM LLA E+KLD+T+ RK+LDIQEALKRP K K++LRI+IS+TF   
Sbjct  63   HPKIRELEPDAENYMALLASEQKLDSTLSRKKLDIQEALKRPSKVKKRLRIYISHTFIEE  122

Query  121  KEPAEGED-GSVASWELRVEGRLLEDGKNDPN------KVKRKFSSFFKSLVIELDKDLY  173
            K+P +  D  S+  WELRVEGRLL++    P         KRKFSSFFKSLVIELDK++Y
Sbjct  123  KQPEKDTDEASLPMWELRVEGRLLDEQPPAPAIPGQRPVPKRKFSSFFKSLVIELDKEMY  182

Query  174  GPDNHLVEWHRTPTTQETDGFQVKRPGDKNVACTILLLLDYQPLQFKLDSRLARLLGVHT  233
            GPD HLVEWHRTP T ETDGFQVKR GD+ V C ILLLLD  P +FKL  RLA++LG+ T
Sbjct  183  GPDQHLVEWHRTPQTNETDGFQVKRAGDRPVKCRILLLLDNHPAKFKLHPRLAKVLGIAT  242

Query  234  QTRPVIISALWQYIKTHKLQDAHEREYINCDKYLEQIFACHRMKFAEIPQRLNPLLHPPD  293
            +TRP II ALWQYIKTH LQD  ER+ INCD +L Q F  +RM+F E+P +L+ LL   D
Sbjct  243  ETRPKIIEALWQYIKTHGLQDPQERDIINCDTFLSQCFGVNRMRFMEVPNKLHQLLQQTD  302

Query  294  PIVINHVIS--VEGAEQKKTACYDIDVEVDDTLKTQMNNFLLSTASQQEIQSLDNKIHET  351
            P+  NH+I    EG EQ  T CYDIDVE++D +K  M+ F+ S     +IQ+LD K ++ 
Sbjct  303  PLEFNHIIQRPKEGQEQVST-CYDIDVEMEDPVKQFMHTFVHSPGLANDIQTLDQKCYDI  361

Query  352  VETINQLKTHREFFLSFAKDPQQFIQKWLISQTRDLKTITDVVGNPEEERRADFFFQPWS  411
            +E IN+LKT R+F+  F  +P +FI+ W++SQ  DLKT+ ++ G+ E ER A+ + +P +
Sbjct  362  IEQINELKTRRDFYARFYTEPAEFIKSWVMSQNSDLKTMNELSGDLEAERFAESYVRPET  421

Query  412  QEAVCRYFYTKVQQKRAELEQALGIRNT  439
            +E V RY + KV QKR ELEQ+LG+R+ 
Sbjct  422  EEGVQRYMFQKVNQKRHELEQSLGVRSN  449



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000019-PA

Length=319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JVP2_DROME  unnamed protein product                                 459     4e-164
M9PF85_DROME  unnamed protein product                                 447     2e-159
Q18224_CAEEL  unnamed protein product                                 400     2e-140


>Q7JVP2_DROME unnamed protein product
Length=304

 Score = 459 bits (1180),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 218/267 (82%), Positives = 245/267 (92%), Gaps = 2/267 (1%)

Query  34   EREKIYQWITELSNPDTRESALLELSKKRESVPELAPMLWHSFGTIAALLQEIINIYPAV  93
            E+EK+YQWI EL++PDTRE+ALLELSKKRE+  +LAPMLW+SFGT  ALLQEI+NIYP++
Sbjct  25   EQEKVYQWINELAHPDTRETALLELSKKRET--DLAPMLWNSFGTACALLQEIVNIYPSI  82

Query  94   NPATLTAHQSNRVCNALALLQCVASHQETRSAFLQAHIPLFLYPFLNTVSKTRPFEYLRL  153
             P TLTAHQSNRVCNALALLQCVASH ETR+AFLQA IPL+LYPFL+T SKTRPFEYLRL
Sbjct  83   TPPTLTAHQSNRVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRL  142

Query  154  TSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDNGLS  213
            TSLGVIGALVKTDEQEVI FLLTTEI+PLCL IM+SGSELSKTVATFI+QKILLD++GLS
Sbjct  143  TSLGVIGALVKTDEQEVITFLLTTEIVPLCLSIMDSGSELSKTVATFIIQKILLDESGLS  202

Query  214  YICQTYDRFSHVAMILGKMVLSLAKDPSARLLKHVIRCYLRLSDNPRAREALRQCLPDQL  273
            YICQTY+RFSHVA+ LGKMV+ LAKDP ARLLKHV+RCYLRLSDN RAR+AL QCLPDQL
Sbjct  203  YICQTYERFSHVAITLGKMVIQLAKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQL  262

Query  274  KDNTFANCLKDDKSTKHWLTQLLKNLE  300
            +D TFA CL++DKSTK WL  LLKNLE
Sbjct  263  RDGTFALCLQEDKSTKQWLQMLLKNLE  289


>M9PF85_DROME unnamed protein product
Length=301

 Score = 447 bits (1150),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 216/267 (81%), Positives = 242/267 (91%), Gaps = 5/267 (2%)

Query  34   EREKIYQWITELSNPDTRESALLELSKKRESVPELAPMLWHSFGTIAALLQEIINIYPAV  93
            E+EK   WI EL++PDTRE+ALLELSKKRE+  +LAPMLW+SFGT  ALLQEI+NIYP++
Sbjct  25   EQEK---WINELAHPDTRETALLELSKKRET--DLAPMLWNSFGTACALLQEIVNIYPSI  79

Query  94   NPATLTAHQSNRVCNALALLQCVASHQETRSAFLQAHIPLFLYPFLNTVSKTRPFEYLRL  153
             P TLTAHQSNRVCNALALLQCVASH ETR+AFLQA IPL+LYPFL+T SKTRPFEYLRL
Sbjct  80   TPPTLTAHQSNRVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRL  139

Query  154  TSLGVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDNGLS  213
            TSLGVIGALVKTDEQEVI FLLTTEI+PLCL IM+SGSELSKTVATFI+QKILLD++GLS
Sbjct  140  TSLGVIGALVKTDEQEVITFLLTTEIVPLCLSIMDSGSELSKTVATFIIQKILLDESGLS  199

Query  214  YICQTYDRFSHVAMILGKMVLSLAKDPSARLLKHVIRCYLRLSDNPRAREALRQCLPDQL  273
            YICQTY+RFSHVA+ LGKMV+ LAKDP ARLLKHV+RCYLRLSDN RAR+AL QCLPDQL
Sbjct  200  YICQTYERFSHVAITLGKMVIQLAKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQL  259

Query  274  KDNTFANCLKDDKSTKHWLTQLLKNLE  300
            +D TFA CL++DKSTK WL  LLKNLE
Sbjct  260  RDGTFALCLQEDKSTKQWLQMLLKNLE  286


>Q18224_CAEEL unnamed protein product
Length=330

 Score = 400 bits (1027),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 198/297 (67%), Positives = 231/297 (78%), Gaps = 24/297 (8%)

Query  36   EKIYQWITELSNPDTRESALLELSKKRESVPELAPMLWHSFGTIAALLQEIINIYPAVNP  95
            ++I QWI +L +P  RE+ALLELSKKR+SVP+L   LWHSFGT++ALLQE++ IYPA+ P
Sbjct  28   DEIMQWIIDLRDPPKREAALLELSKKRDSVPDLPIWLWHSFGTMSALLQEVVAIYPAIMP  87

Query  96   ATLTAHQSNRVCNALALLQCVASHQETRSAFLQAHIPLFLYPFLNTVSKTRPFEYLRLTS  155
            A LTA QSNRVCNALAL+QCVASH++TR  FL AHIPL+LYPFL+T   +R FEYLRLTS
Sbjct  88   ANLTAAQSNRVCNALALMQCVASHRDTRGPFLHAHIPLYLYPFLHTTKVSRSFEYLRLTS  147

Query  156  LGVIGALVKTDEQE----VINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDNG  211
            LGVIGALVKTD++E    VINFLL+TEIIPLCLRIME G+ELSKTVATFILQKILLDD G
Sbjct  148  LGVIGALVKTDDKEQLLIVINFLLSTEIIPLCLRIMEQGTELSKTVATFILQKILLDDTG  207

Query  212  LSYICQTYDRFSHVAMILGKMVLSLAKDPSARLLKHVIRCYLRLSDNP------------  259
            L YICQTY+RFSHV +ILGKMV+ L ++PS RLLKHV+RCY RLSDNP            
Sbjct  208  LLYICQTYERFSHVVLILGKMVMKLTREPSVRLLKHVVRCYSRLSDNPTLTIDAPRGQGA  267

Query  260  --------RAREALRQCLPDQLKDNTFANCLKDDKSTKHWLTQLLKNLETTGPTVGD  308
                    RA  AL+QCLPDQLKD TF + LK+D ST +WL QLL  LE  G  + D
Sbjct  268  APGQIVKMRASLALKQCLPDQLKDLTFKSLLKEDPSTMNWLRQLLTTLEIDGTILHD  324



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= CAQU000020-PA

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8L3_DROME  unnamed protein product                                 336     6e-106
Q9VTX2_DROME  unnamed protein product                                 331     5e-104
Q95RZ8_DROME  unnamed protein product                                 300     4e-93 


>A1Z8L3_DROME unnamed protein product
Length=660

 Score = 336 bits (862),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 225/709 (32%), Positives = 356/709 (50%), Gaps = 94/709 (13%)

Query  9    TKKEGFFKDFVGYVREQSGPDL---VFRFSQLKSDEERFRFC----WLLPAAHSLSLRPI  61
            ++K GFF ++   +++Q+GP+    + + S  KSDEER  +     W+     +L +   
Sbjct  6    SQKTGFFAEYYLKLKDQAGPNCESDIAKLSACKSDEERVAYVEKLPWVQAGDANLVVNQE  65

Query  62   FKPKDIAEAERKKEAGNAAFQRKDYRQALLLYSQSVVRAPYSSISEYKCNNATMYADSNL  121
            F  K+ + A   KE   +AF+ K + +A++LY++S V  P  +++E              
Sbjct  66   FAGKNASLAAEIKERATSAFKAKKWLEAMMLYTRSYVALPSENVAE--------------  111

Query  122  LVASINGTTEDGTHVLSLSLANRSAALLHLKDPSSCLQDIQLSLRENYPLSLRHKLFERM  181
                           + + LANRSA L H++    CL DI+ +L  +Y   L +KL+ER 
Sbjct  112  ---------------IRVVLANRSATLYHMQKYQECLIDIKRALDLSYSKDLIYKLYERQ  156

Query  182  GRCYQQLQSPAKARVAFQLAIRSLEDSSMGAQKQKEKAAMLKKEVDRLGSPPPESGLQ--  239
             RCY  L+       +F+  I +++DS++ + K+ +        +  L + P  +  +  
Sbjct  157  ARCYMALKDYPHTIDSFKKCITAMDDSTLASDKRAKLNLDAMTMIKMLQNDPRTAKQEAK  216

Query  240  -----------KQALTDDIHRANCVAVQYDPESGRYAVAAEDVKTGDILVEEKPYAACLL  288
                       K    ++   +  V +  + + GR+A A+ DVK G+ L+ E+P+ + LL
Sbjct  217  QQKQKIALDQAKPVKLENEFVSPLVRIDSNRQEGRFARASADVKPGEELLVERPFVSVLL  276

Query  289  PDKFGTHCHHCFARYPLFRPTQFSRTIIKLKAPVGCIWCSGVVFCSAQCKDVACGTYHRY  348
                 THC +CF R           T++    PV C  C+ V++CS QC++ A   YH+Y
Sbjct  277  EKFAKTHCENCFMR-----------TVV----PVACPRCADVLYCSEQCREEASKKYHKY  321

Query  349  ECPLMDLLIGSGMSILCHVALRMLTQSGLEFFKEMAPELKYNPTDTRIQLDTPSNQYLHV  408
            EC ++ ++  SG SI  H+ALR++    L++F ++ P +    T  ++ +  P + +  V
Sbjct  322  ECGIVPIIWRSGASINNHIALRIIASKPLDYFLKLKPTIDEELTPEQL-ISLPKDDFRRV  380

Query  409  FSLVTLQDKRCPDDFLDRSLMAVFLLQCLRKTTFFGEEESQEGMNLSDNEVLIGRLLLHH  468
              L   Q +R P +F    LMA FL  CLR   +FG E         D   +I  L+L  
Sbjct  381  AQLERHQGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPK------PDEVSIICSLVLRS  434

Query  469  LQFLQFNAHEVHE-YQMASPGHFKGSKSVYIGVALYPTVACFNHSCYPGVTRYFNGTHIV  527
            LQF+QFN HEV E ++ +S G     KS++IG A+YPT+A FNHSC PGV RYF GT I 
Sbjct  435  LQFIQFNTHEVAELHKFSSSGR---EKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIH  491

Query  528  IRAIRPIKQGEMIAENYGPIFTHKRRSERLKSLSSRYWFNCLCPACMEDWGLFEDLAASD  587
            I ++RPI+ G  I ENYGP++T   RSER   L   YWF C C AC+++W  F+DL   D
Sbjct  492  INSVRPIEAGLPINENYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKFDDL-PRD  550

Query  588  RIYARCLCCPRGQVALVGRPCS------KCGTCPDPGWVT------RRMEDARTHYQEGL  635
             I  RC   P    A++  P S      KC TC   G +T      + M+D     +   
Sbjct  551  VIRFRCD-APNNCSAVIEVPPSCNDFMVKCVTC---GEITNILKGLKVMQDTEMMTRTAK  606

Query  636  DCMDRGE--EAIAQFCKYIDEMDLLVSAPYNELHLSQQALRMCMASDGS  682
               + GE  +A+A+F   I  M  +++ P+ +   SQQ L+ C  + G+
Sbjct  607  RLYETGEYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHLKDCFLNLGN  655


>Q9VTX2_DROME unnamed protein product
Length=663

 Score = 331 bits (848),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 228/710 (32%), Positives = 363/710 (51%), Gaps = 91/710 (13%)

Query  1    MCSSITLQTKKEGFFKDFVGYVREQSGPD-LVFRFSQLKSDEERFRFCW-----LLPAAH  54
            +CS+ T+Q+++ GFF +F   VR+  G   L   F +LKS+  R    +       P   
Sbjct  10   ICSAQTVQSERRGFFNEFCVDVRDACGDKWLRNYFGKLKSNAARVLSIFSDREVCDPVLG  69

Query  55   SLS-LRPIFKPKD-IAEAERKKEA---------GNAAFQRKDYRQALLLYSQSVVRAPYS  103
             L  ++P+FK KD +  A+R+ +A         G+    R+  +QAL+  + +V+RAP  
Sbjct  70   VLEHVQPVFKQKDALFSAQRRAQADKLYLMSGSGDGEESRELLQQALMAANLAVMRAPD-  128

Query  104  SISEYKCNNATMYADSNLLVASINGTTEDGTHVLSLSLANRSAALLHLKDPSSCLQDIQL  163
                    NA    D  L               L+L+  +R++ L+ L +  + L D++L
Sbjct  129  -------RNADPVLDEGL--------------TLALAYRSRASILIRLGEGEAALNDLKL  167

Query  164  SLRENYPLSLRHKL--FERMGRCYQQLQSPAKARVAFQLAIRSLE-DSSMGAQKQKEKAA  220
            ++  N+ L L+  +  + +M + Y  +  PA+A ++ ++A +    D++  A  +KE ++
Sbjct  168  AI--NFGLELKSSVDYYLKMAKAYAVMGEPARAEISLKIAEKMPGCDATHIALCRKELSS  225

Query  221  MLKKEVDRLGSPPPESGLQKQALTDDIHRANCVAVQYDPESGRYAVAAEDVKTGDILVEE  280
            +  K  +      P+    + A  + +  +  V +    + GR+ VA E ++TGD+L+ E
Sbjct  226  VKPKPKEATSEQVPQLAHGESA--ELVGASKVVRLVETKDKGRFVVANEGLRTGDVLLFE  283

Query  281  KPYAACLLPDKFGTHCHHCFARYPLFRPTQFSRTIIKLKAPVGCIWCSGVVFCSAQCKDV  340
            +P AACL P  FGTHCHHCF R               L  PV C+ CSG+ FCSAQC   
Sbjct  284  EPVAACLEPSYFGTHCHHCFKR---------------LHTPVSCLHCSGIAFCSAQCMGE  328

Query  341  ACGTYHRYECPLMDLLIGSGMSILCHVALRMLTQSGLEFFKEMAPELKYNPTDTRIQLDT  400
            AC +YHR+EC  MDL+IGSGMSILC +ALR+ TQ         AP L+         L T
Sbjct  329  ACSSYHRFECEYMDLMIGSGMSILCFIALRIFTQ---------APSLEQG-------LAT  372

Query  401  PSNQYLHVFSLVTLQDKRCPDDFLDRSLMAVFLLQCLRKTTFFGEEESQEGMNLSDNEVL  460
             +  + H   L + ++ R PDD+L R+LM+ FLL+ L+K+ +FG  ++ EG+N +  E+ 
Sbjct  373  ANLLFEH---LCSHEEDRQPDDYLRRALMSGFLLRILQKSLYFGRRKT-EGVNPTAVELQ  428

Query  461  IGRLLLHHLQFLQFNAHEVHEYQMASPGHFKGSKSVYIGVALYPTVACFNHSCYPGVTRY  520
            +   LL  LQ LQ+NAH++++ Q+     F GSK+VY+   LY T + FNH C+P    +
Sbjct  429  VATALLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACH  488

Query  521  FNGTHIVIRAIRPIKQGEMIAENYGPIFTHKRRSERLKSLSSRYWFNCLCPACMEDWGLF  580
            F G  +V+ A RP +  E++A NYGPIF      ER +SL  RY F+C C AC E+W L 
Sbjct  489  FVGKKLVLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMACQENWPLL  548

Query  581  EDLAASDRIYARCLCC------PRGQVALVGRPCSKCGTCPDPGWVTRRMEDARTHYQEG  634
            + L    R +     C      P+     V   C +C           +M      Y+E 
Sbjct  549  QKLDKQVRFWCTSANCSNLLKFPKDLAKDV--RCPRCRKNISLKESVAKMIKIEELYREA  606

Query  635  LDCMD--RGEEAIAQFCKYIDEMDLLVSAPYNELHLSQQALRMCMASDGS  682
               M+  +  EAI  F + +D    + + P+ +  ++QQ+L  C++  G+
Sbjct  607  ARAMEAQKTVEAIELFKESLDMFFQVAALPHKDTIVAQQSLHKCLSDTGT  656


>Q95RZ8_DROME unnamed protein product
Length=567

 Score = 300 bits (767),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 194/574 (34%), Positives = 297/574 (52%), Gaps = 58/574 (10%)

Query  137  LSLSLANRSAALLHLKDPSSCLQDIQLSLRENYPLSLRHKLFERMGRCYQQLQSPAKARV  196
            + + LANRSA L H++    CL DI+ +L  +Y   L +KL+ER  RCY  L+       
Sbjct  19   IRVVLANRSATLYHMQKYQECLIDIKRALDLSYSKDLIYKLYERQARCYMALKDYPHTID  78

Query  197  AFQLAIRSLEDSSMGAQKQKEKAAMLKKEVDRLGSPPPESGLQ-------------KQAL  243
            +F+  I +++DS++ + K+ +        +  L + P  +  +             K   
Sbjct  79   SFKKCITAMDDSTLASDKRAKLNLDAMTMIKMLQNDPRTAKQEAKQQKQKIALDQAKPVK  138

Query  244  TDDIHRANCVAVQYDPESGRYAVAAEDVKTGDILVEEKPYAACLLPDKFGTHCHHCFARY  303
             ++   +  V +  + + GR+A A+ DVK G+ L+ E+P+ + LL     THC +CF R 
Sbjct  139  LENEFVSPLVRIDSNRQEGRFARASADVKPGEELLVERPFVSVLLEKFAKTHCENCFMR-  197

Query  304  PLFRPTQFSRTIIKLKAPVGCIWCSGVVFCSAQCKDVACGTYHRYECPLMDLLIGSGMSI  363
                      T++    PV C  C+ V++CS QC++ A   YH+YEC ++ ++  SG SI
Sbjct  198  ----------TVV----PVACPRCADVLYCSEQCREEASKKYHKYECGIVPIIWRSGASI  243

Query  364  LCHVALRMLTQSGLEFFKEMAPELKYNPTDTRIQLDTPSNQYLHVFSLVTLQDKRCPDDF  423
              H+ALR++    L++F ++ P +    T  ++ +  P + +  V  L   Q +R P +F
Sbjct  244  NNHIALRIIASKPLDYFLKLKPTIDEELTPEQL-ISLPKDDFRRVAQLERHQGERQPSNF  302

Query  424  LDRSLMAVFLLQCLRKTTFFGEEESQEGMNLSDNEVLIGRLLLHHLQFLQFNAHEVHE-Y  482
                LMA FL  CLR   +FG E         D   +I  L+L  LQF+QFN HEV E +
Sbjct  303  FQHVLMARFLTNCLRAGGYFGSEPK------PDEVSIICSLVLRSLQFIQFNTHEVAELH  356

Query  483  QMASPGHFKGSKSVYIGVALYPTVACFNHSCYPGVTRYFNGTHIVIRAIRPIKQGEMIAE  542
            + +S G     KS++IG A+YPT+A FNHSC PGV RYF GT I I ++RPI+ G  I E
Sbjct  357  KFSSSGR---EKSIFIGGAIYPTLALFNHSCDPGVVRYFRGTTIHINSVRPIEAGLPINE  413

Query  543  NYGPIFTHKRRSERLKSLSSRYWFNCLCPACMEDWGLFEDLAASDRIYARCLCCPRGQVA  602
            NYGP++T   RSER   L   YWF C C AC+++W  F+DL   D I  RC   P    A
Sbjct  414  NYGPMYTQDERSERQARLKDLYWFECSCDACIDNWPKFDDL-PRDVIRFRCD-APNNCSA  471

Query  603  LVGRPCS------KCGTCPDPGWVT------RRMEDARTHYQEGLDCMDRGE--EAIAQF  648
            ++  P S      KC TC   G +T      + M+D     +      + GE  +A+A+F
Sbjct  472  VIEVPPSCNDFMVKCVTC---GEITNILKGLKVMQDTEMMTRTAKRLYETGEYPKALAKF  528

Query  649  CKYIDEMDLLVSAPYNELHLSQQALRMCMASDGS  682
               I  M  +++ P+ +   SQQ L+ C  + G+
Sbjct  529  VDLIRIMYEVLAPPFPDFCESQQHLKDCFLNLGN  562



Lambda      K        H
   0.323    0.140    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  12:13 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000021-PA

Length=137
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381G1_TRYB2  unnamed protein product                                 29.3    1.2  
Q22666_CAEEL  unnamed protein product                                 28.1    2.2  
PELET_DROME  unnamed protein product                                  28.1    3.1  


>Q381G1_TRYB2 unnamed protein product
Length=606

 Score = 29.3 bits (64),  Expect = 1.2, Method: Composition-based stats.
 Identities = 16/60 (27%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query  77   RRVLQEAREANDLHH-----VACNFRKIPGHTYHLYQRESGQRYTQTGTRFVVDIRGKDG  131
            +R+++E  +A          V  +F  +  H  HLY++  G R + T TR +++I   +G
Sbjct  142  KRIMEEDVDATTYQGTRSALVYASFTGMWEHAIHLYKKHPGMRQSITDTRSLINILSSNG  201


>Q22666_CAEEL unnamed protein product
Length=335

 Score = 28.1 bits (61),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 39/86 (45%), Gaps = 13/86 (15%)

Query  32   RTKCIPPNLVELAQEIQRADVTVRATACGKLQ-------VIVEQVRFLQEQARRVLQEAR  84
            RT+     L EL + +Q+A+   R  AC K++       + VEQ++   +   + + E R
Sbjct  70   RTEEAKSKLEELCRGLQKANHQTREEACAKMKKLEVERGLAVEQLKVTLKDIEKTMAEGR  129

Query  85   E-----ANDLHHVACNFRKIPGHTYH  105
                  A D   ++  F +I GH Y 
Sbjct  130  SKSDSLAEDNKKLSEKFSEI-GHQYE  154


>PELET_DROME unnamed protein product
Length=751

 Score = 28.1 bits (61),  Expect = 3.1, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 3/50 (6%)

Query  67   EQVRFLQEQARRVLQEAREANDLHHVACNFRKIPGHTYHLYQRESGQRYT  116
            E++R L+ + RR+ Q+ RE+  L     + RKI   T     +  GQR T
Sbjct  110  EKIRTLEYEMRRLEQQLRESQQLEE---SLRKIFTDTQIRILKNGGQRAT  156



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000022-PA

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VMS1_CAEEL  unnamed protein product                                   194     5e-54
Q584Z4_TRYB2  unnamed protein product                                 49.3    5e-06
Q8MQG0_CAEEL  unnamed protein product                                 42.4    0.001


>VMS1_CAEEL unnamed protein product
Length=618

 Score = 194 bits (494),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 169/626 (27%), Positives = 275/626 (44%), Gaps = 95/626 (15%)

Query  16   CGIAFDGREDQRGHYKLDWHRYNLKRRMMGEPPVTEATFDQIADGVSSISGSES-----E  70
            C + F  R     HY+  +HR N  R+       TE  F+ I +  + ++ S++      
Sbjct  66   CPVDFGDRAVLLEHYQSLFHRTNTLRKARNMTVYTEEDFEGIENSENDLTSSQTTIGLES  125

Query  71   SEEEATPPPTPIRRRHAKVFFQNEAGEILSLYRCIL-LGKNGPDDADFSK-LACDVAQTN  128
             +EE      P  R     F +N  G + S+ R IL +G+       F +   C      
Sbjct  126  DDEEFDALLLPANR---SFFIKN--GSVFSVPRNILHVGERDVSSVTFLRPFDC------  174

Query  129  QQWALVMMGGGHFAAAVFCGADVLVHKTFHSYTVRAKQGGSQGARDGKSGTSHPKSAGAS  188
               A+ +  GGHFAAA+F    + V K+FH Y  RAKQGG Q   D   G    KSAGA 
Sbjct  175  ---AIFLWNGGHFAAAMFENDKMTVQKSFHRYVARAKQGGVQSQHDS-GGKGAAKSAGAQ  230

Query  189  LRRYNEAALTQHVQEILEAWSAHIAKCDLIFVRAVGYNRSALFGGKNPPLNKQDPRIRTL  248
            LRRYNE  + + +Q I+ +W + + K  L+F+R   Y+R+  F   +  +  +D RIRT+
Sbjct  231  LRRYNEQKMKEEIQSIMSSWKSRLQKTPLLFIRCAAYHRNIFFEA-DAGIETRDDRIRTI  289

Query  249  PFPTKRATYSEIQRVYKLLSMVEVYGNSEDFAAMYPQSPHRPLRQHDVKPEKKSRQRSEA  308
            PF TKR    EI   ++ L  V  +G   DF A             +V+ ++K   R  A
Sbjct  290  PFETKRPNIDEISDCWQRLQQVSEHGAESDFRA----------EMLEVREKRKKLARKVA  339

Query  309  QKKNRSKARSSPSRQLPDYVTALAEEAPAIENGDDDVTLESVEVELDLVTSLEEFQVDFG  368
             KK +              +  + E +   EN D     ++  +++  +   EE  V + 
Sbjct  340  GKKRKDGG-----------MQMICEWSDDDENEDISKEKKTHHIKVRTIKKPEETVVQWP  388

Query  369  KASPVRRRRKKSSSDKENPGEWKERAELRNKLYTACRVGDVNLLNENMAIALSLQTDQLD  428
            +                   EW      R K Y   R   V  L E++A   SL  D   
Sbjct  389  RLD----------------DEW------RQKTYNYVRQDSVEALKEHLA---SLNED---  420

Query  429  GAESSPHYPILNETFGESSLTMLHVAAKSGHPEVIMALM-ELGADPTIPDKRGRPPYCLS  487
               S  +  + N     +  T LHV+A +   + +   + E+  D +  D  G PPY  S
Sbjct  421  -VTSEANDYLRNAKIPPNRSTFLHVSAANDARKCLKYFLEEVNCDSSTKDGAGLPPYSSS  479

Query  488  ADRETRDSFRRFRGRNPDKFDYEKGQVPQGITK-EMEEHRAERRKEQRKAKKDRE-----  541
            A+ + +  F  +R +N    ++ +  +P+   K E+ E +   + E++K KK R+     
Sbjct  480  ANSDVKSIFIDYRVKNETAGNWARTHIPEPKKKVELTEEQEREQAERKKEKKARQKEKEK  539

Query  542  ------KDRKKEDADKKRFLTLSDREKRAVAAESRFLKQLNDSGVSAPVLARCFQCGVDI  595
                  K   +E  ++++++ +S+REKRA+A + R            P + RC QCGV +
Sbjct  540  LKKEIAKRDVEEMEERQKYVNMSEREKRALAVDRRL--------AGLPPILRCHQCGVQL  591

Query  596  TGKVPFEYNDFRFCTVQCLKTHRQSH  621
                PF+Y+ + FC+  C+  HR+++
Sbjct  592  P-PTPFQYSHYNFCSTSCVAEHRKAN  616


>Q584Z4_TRYB2 unnamed protein product
Length=366

 Score = 49.3 bits (116),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (63%), Gaps = 2/51 (4%)

Query  13  CSLCGIAFDGREDQRGHYKLDWHRYNLKRRMMGEPPVTEATFDQ--IADGV  61
           C  CG+AFD  E  R HY+ D+H +N++ R+ G+ PVT   +    IA+G+
Sbjct  8   CGACGVAFDSIEASRKHYQSDFHVHNVRMRVEGKRPVTAQEYKHMRIAEGI  58


>Q8MQG0_CAEEL unnamed protein product
Length=1841

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query  441  ETFGESSLTMLHVAAKSGHPEVIMALMELGADPTIPDKRGRPPYCLSADRETRDSFRRFR  500
            E   ES LT LHVAA  G   +++ L++ GA+P +   RG  P  L+A R  +    R  
Sbjct  419  EATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAA-RANQTDVVRVL  477

Query  501  GRNPDKFDYE  510
             RN  K D +
Sbjct  478  IRNGAKVDAQ  487


 Score = 36.2 bits (82),  Expect = 0.089, Method: Compositional matrix adjust.
 Identities = 27/94 (29%), Positives = 44/94 (47%), Gaps = 18/94 (19%)

Query  395  ELRNKLYTACRVGDVNLLNENMAIALSLQTDQLDGAESSPHYPILNETFGESSLTMLHVA  454
            EL+  L+ A R+G+ ++      + L LQ      A +  +Y            + LH+A
Sbjct  490  ELQTPLHIASRLGNTDI------VILLLQAGANSNATTRDNY------------SPLHIA  531

Query  455  AKSGHPEVIMALMELGADPTIPDKRGRPPYCLSA  488
            AK G  EV   L++  AD T+  K+G  P  L++
Sbjct  532  AKEGQEEVAGILLDHNADKTLLTKKGFTPLHLAS  565


 Score = 33.9 bits (76),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 19/52 (37%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  448  LTMLHVAAKSGHPEVIMALMELGADPTIPDKRGRPPYCLSADRETRDSFRRF  499
            LT LH AA+SGH +V+  L+  GA  +   K G  P  ++A  +  D+ R  
Sbjct  294  LTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTL  345


 Score = 31.6 bits (70),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 21/40 (53%), Gaps = 0/40 (0%)

Query  449  TMLHVAAKSGHPEVIMALMELGADPTIPDKRGRPPYCLSA  488
            T LH+AAK    E+   L++  ADP    + G  P  LSA
Sbjct  625  TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSA  664


 Score = 31.2 bits (69),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (51%), Gaps = 3/61 (5%)

Query  444  GESSLTMLHVAAKSGHPEVIMALMELGADPTIPDKRGRPPYCLSADR---ETRDSFRRFR  500
            G++ +T LHVAA   + +V M L+E GA      K G  P  ++A +   E   +  +F+
Sbjct  587  GKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFK  646

Query  501  G  501
             
Sbjct  647  A  647


 Score = 30.0 bits (66),  Expect = 8.3, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 37/91 (41%), Gaps = 24/91 (26%)

Query  400  LYTACRVGDVNL---LNENMAIALSLQTDQLDGAESSPHYPILNETFGESSLTMLHVAAK  456
            L+ AC  G +N+   L EN A          D  E +            +S T LH AA+
Sbjct  726  LHVACHFGQLNMVKFLVENGA----------DVGEKT-----------RASYTPLHQAAQ  764

Query  457  SGHPEVIMALMELGADPTIPDKRGRPPYCLS  487
             GH   +  L+E GA P      G+ P  ++
Sbjct  765  QGHNNCVRYLLENGASPNEQTATGQTPLSIA  795


 Score = 29.6 bits (65),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 0/56 (0%)

Query  418  IALSLQTDQLDGAESSPHYPILNETFGESSLTMLHVAAKSGHPEVIMALMELGADP  473
            + ++ Q D +D A +  ++    +      LT LHVAA  GH  V   L++  ADP
Sbjct  330  LHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADP  385



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000023-PA

Length=1302
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YH2M_CAEEL  unnamed protein product                                   830     0.0  
F5GUA7_CAEEL  unnamed protein product                                 824     0.0  
Q54X63_DICDI  unnamed protein product                                 621     0.0  


>YH2M_CAEEL unnamed protein product
Length=1256

 Score = 830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/1235 (40%), Positives = 683/1235 (55%), Gaps = 153/1235 (12%)

Query  37    EDQMEIYGYCQSTLYTFVTWVCIVGTAGLLRLVFHWYPHLMLYATHKQCKLDKAEKILAI  96
             +  + ++ Y      T + +   V T G+ RL+ HW     +      C  + AE I  I
Sbjct  7     DHTLTLFAYRTGPFRTILFYALTVLTLGIFRLILHWKQKWDVKMRMVPCTFEAAEYIYII  66

Query  97    ENYQDKHLKYHVKDIFTLSTDDMESLIQVNKGIKPDDEIWSEQKVDELKAACSGKLSIPG  156
             +N+    L+  ++                                           +IP 
Sbjct  67    DNHNVSELQPVLR---------------------------------------KSNATIPT  87

Query  157   PNGEYQTVSGVNMFQCKKLKYLWNEELGEFHKLQGLDHHVST-----------------A  199
              NGE + V  +  F  +KL+Y+W ++L     +  +  + +                  A
Sbjct  88    ENGEMRKVPELRWFVYRKLEYVWIDDLNSDESVDEISDNDNCWKTSFEIANRIPCRSLLA  147

Query  200   TLHMHQGLNFVEQAQRRLVYGGNEITVEVKGVVKLLFLEILNPFYVFQIYSICLWFGYQY  259
                 + GL   E ++R   YG NEI V+++ ++ LL +E++ PFYVFQI+S+ +W+  +Y
Sbjct  148   VSESNFGLTLSEISRRLEFYGRNEIVVQLRPILYLLVMEVITPFYVFQIFSVTVWYNDEY  207

Query  260   YYYATAIIIMSLWGIVSTIIQTRQNQKNLRSTIHSSDVVTVWLGGDSYETMATEQLVPGD  319
              YYA+ I+I+SL  IV  + Q R  +  LRS +HS++ V V   G    T+ ++QLVPGD
Sbjct  208   AYYASLIVILSLGSIVMDVYQIRTQEIRLRSMVHSTESVEVIREGTEM-TIGSDQLVPGD  266

Query  320   VIVIPSHGCIMHCDAALLKGNCIVNESMLTGESVPVTKTPLPNQP-DMMFDSKEHARNTL  378
             +++IP HGC+M CD+ L+ G  IVNES+LTGESVP+TK  L ++  D +F+ +++++N L
Sbjct  267   ILLIPPHGCLMQCDSVLMNGTVIVNESVLTGESVPITKVALTDETNDSVFNIEKNSKNVL  326

Query  379   FCGTKVIQTRFYGREKVKAVVLRTGFLTSKGNLVRSIMYPPPVDFKFERDSYRFVGVLAG  438
             FCGT+V+QTRFY  +KVKA+VLRT + T KG LVRSIMYP PVDF+F +D ++F+  LA 
Sbjct  327   FCGTQVLQTRFYRGKKVKAIVLRTAYSTLKGQLVRSIMYPKPVDFRFTKDLFKFILFLAC  386

Query  439   IAAIGFIYTVVTKASTLAYIIFSFIPYFRGIAGSIIALESLDLITIVVPPALPAAMTVGR  498
             I+  GFIYT++             +   RG     I + SLD+ITI VPPALPAAM+VG 
Sbjct  387   ISGCGFIYTII-------------VMIMRGNTLRRIIVRSLDIITITVPPALPAAMSVGI  433

Query  499   YYAQSRLKQKNIYCISPRAINVAGSIDCVCFDKTGTLTEDGLDMWGVVPVH---NQKFQ-  554
               AQ RLK+K I+CISP  IN  G+I+ VCFDKTGTLTEDGLD   V PV    NQ+ Q 
Sbjct  434   INAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTLTEDGLDFHVVRPVMSAVNQEIQK  493

Query  555   ---------------VPVKTMETLPKEA-LLLGMASCHSLTVIGGEICGDPLDLKMFEST  598
                              + +   LP +  L+  +A+CHSLT I G + GDPLDL +F+ T
Sbjct  494   VKLEKSNRTEFMGEMTELTSRNGLPFDGDLVKAIATCHSLTRINGVLHGDPLDLILFQKT  553

Query  599   GWVL----EEPNVDDSAKFDIITPTVVKPQRPDVVESAENVELAPHLEVGIIRQFPFSSG  654
             GW +    E    +++ +FD + P+++KP      +SA         E  +IRQF FSS 
Sbjct  554   GWTMEEGIEGDIEEETQRFDNVQPSIIKPTDD---KSA---------EYSVIRQFTFSSS  601

Query  655   LQRMSVIT---RTLGAPHFELYCKGSPEMIASLCHQNTVPSNFESVLQEYTQEGYRVIAV  711
             LQRMSVI    R     +  LY KGSPEMI SLC  NTVP ++   +  Y Q G+R+IAV
Sbjct  602   LQRMSVIVFDPREDRPDNMMLYSKGSPEMILSLCDPNTVPEDYLLQVNSYAQHGFRLIAV  661

Query  712   GYRVLGKASYAKVQRLAREEVERDLIFSGLLVMENRLKPETPAALQTLREACVRSVMVTG  771
               R L   ++ K  ++ R+ VE DL   GL+VMENR+KP T   +  L  A +R+VMVTG
Sbjct  662   ARRPL-DLNFNKASKVKRDAVECDLEMLGLIVMENRVKPVTLGVINQLNRANIRTVMVTG  720

Query  772   DNMLTAISVARDCDMVGPGERVVIVNAEP---------------------ETIGKPASLQ  810
             DN+LT +SVAR+C ++ P +R  +V   P                     E I   AS+ 
Sbjct  721   DNLLTGLSVARECGIIRPSKRAFLVEHVPGELDEYGRTKIFVKQSVSSSDEVIEDDASVS  780

Query  811   FSHAEAPL----------PKNGSVISDLTVLSGDLTMLTDIRIDFDTTERYHFAVSGKSF  860
              S   +            P N  V +   V +  L  L            YH A+SG +F
Sbjct  781   ISMCSSTWKGSSEGDGFSPTNTEVETPNPVTADSLGHL--------IASSYHLAISGPTF  832

Query  861   AVLRDSFPSLLPRIAVRGTVFARMSPDQKQQLVQALQDLGYCVGMCGDGANDCGALKAAH  920
             AV+   +P L+ ++     VFARM+PDQKQ LV+ LQ + Y V MCGDGANDC ALKAAH
Sbjct  833   AVIVHEYPELVDQLCSVCDVFARMAPDQKQSLVEQLQQIDYTVAMCGDGANDCAALKAAH  892

Query  921   AGVSLSEAEASVASPFTSKENNISCVPELIREGRAALVTSFGIFKYMAAYSLTQFVTVIM  980
             AG+SLS+AEAS+A+PFTSK  +I CVP +I EGRAALVTSFGIFKYMA YSLTQFVTV+ 
Sbjct  893   AGISLSDAEASIAAPFTSKVPDIRCVPTVISEGRAALVTSFGIFKYMAGYSLTQFVTVMH  952

Query  981   LYSIDSNLTDPQFLYIDLFLITLFAFFFGKTCAYSGTLVPRPPEASLTTVAPVVSILLQT  1040
             LY I + LTD QF+YID+FLIT+FA  FG T A+   L   PP   L ++A + S++ Q 
Sbjct  953   LYWISNILTDGQFMYIDMFLITMFALLFGNTPAFY-RLAHTPPPTRLLSIASMTSVVGQL  1011

Query  1041  VVVIVFQAAAFVLVQYQPWFIPFVANGGDADEDHGCHQNYILFAVSSFQYIILAAVFSKG  1100
             +++ V Q   F     QPWF P+     D  ED    Q   LF VS FQYIILA V+SKG
Sbjct  1012  IIIGVVQFIVFFSTSQQPWFTPYQPPVDDEVEDKRSMQGTALFCVSMFQYIILALVYSKG  1071

Query  1101  KPYRREMWSNGGLLGSMLAMTVFTCYLIIYPCSWLVHQFTFVLPPDVLFRAALVGIAVLN  1160
              P+R  +WSN  +    +  T+   +++I+P   ++     V  P + FR  +V +  +N
Sbjct  1072  PPFRGNLWSNKPMCALTIFATLLCLFIVIWPTELVLKTLGNVELPSLTFRIFIVIVGAVN  1131

Query  1161  LALSLGAEIL-ADRIGECCWKRSGSKGREYMAVED  1194
              A+S G E L  D      W+R   K R   A+ D
Sbjct  1132  AAVSYGFETLFVDFFLLGYWERY-KKKRSIEAIID  1165


>F5GUA7_CAEEL unnamed protein product
Length=1207

 Score = 824 bits (2128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/1138 (42%), Positives = 657/1138 (58%), Gaps = 115/1138 (10%)

Query  135   IWSEQKVDELKAAC-SGKLSIPGPNGEYQTVSGVNMFQCKKLKYLWNEELGEFHKLQGLD  193
             I     V EL+        +IP  NGE + V  +  F  +KL+Y+W ++L     +  + 
Sbjct  16    IIDNHNVSELQPVLRKSNATIPTENGEMRKVPELRWFVYRKLEYVWIDDLNSDESVDEIS  75

Query  194   HHVST-----------------ATLHMHQGLNFVEQAQRRLVYGGNEITVEVKGVVKLLF  236
              + +                  A    + GL   E ++R   YG NEI V+++ ++ LL 
Sbjct  76    DNDNCWKTSFEIANRIPCRSLLAVSESNFGLTLSEISRRLEFYGRNEIVVQLRPILYLLV  135

Query  237   LEILNPFYVFQIYSICLWFGYQYYYYATAIIIMSLWGIVSTIIQTRQNQKNLRSTIHSSD  296
             +E++ PFYVFQI+S+ +W+  +Y YYA+ I+I+SL  IV  + Q R  +  LRS +HS++
Sbjct  136   MEVITPFYVFQIFSVTVWYNDEYAYYASLIVILSLGSIVMDVYQIRTQEIRLRSMVHSTE  195

Query  297   VVTVWLGGDSYETMATEQLVPGDVIVIPSHGCIMHCDAALLKGNCIVNESMLTGESVPVT  356
              V V   G    T+ ++QLVPGD+++IP HGC+M CD+ L+ G  IVNES+LTGESVP+T
Sbjct  196   SVEVIREGTEM-TIGSDQLVPGDILLIPPHGCLMQCDSVLMNGTVIVNESVLTGESVPIT  254

Query  357   KTPLPNQP-DMMFDSKEHARNTLFCGTKVIQTRFYGREKVKAVVLRTGFLTSKGNLVRSI  415
             K  L ++  D +F+ +++++N LFCGT+V+QTRFY  +KVKA+VLRT + T KG LVRSI
Sbjct  255   KVALTDETNDSVFNIEKNSKNVLFCGTQVLQTRFYRGKKVKAIVLRTAYSTLKGQLVRSI  314

Query  416   MYPPPVDFKFERDSYRFVGVLAGIAAIGFIYTVVTKASTLAYIIFSFIPYFRGIAGSIIA  475
             MYP PVDF+F +D ++F+  LA I+  GFIYT++             +   RG     I 
Sbjct  315   MYPKPVDFRFTKDLFKFILFLACISGCGFIYTII-------------VMIMRGNTLRRII  361

Query  476   LESLDLITIVVPPALPAAMTVGRYYAQSRLKQKNIYCISPRAINVAGSIDCVCFDKTGTL  535
             + SLD+ITI VPPALPAAM+VG   AQ RLK+K I+CISP  IN  G+I+ VCFDKTGTL
Sbjct  362   VRSLDIITITVPPALPAAMSVGIINAQLRLKKKEIFCISPSTINTCGAINVVCFDKTGTL  421

Query  536   TEDGLDMWGVVPVH---NQKFQ----------------VPVKTMETLPKEA-LLLGMASC  575
             TEDGLD   V PV    NQ+ Q                  + +   LP +  L+  +A+C
Sbjct  422   TEDGLDFHVVRPVMSAVNQEIQKVKLEKSNRTEFMGEMTELTSRNGLPFDGDLVKAIATC  481

Query  576   HSLTVIGGEICGDPLDLKMFESTGWVL----EEPNVDDSAKFDIITPTVVKPQRPDVVES  631
             HSLT I G + GDPLDL +F+ TGW +    E    +++ +FD + P+++KP      +S
Sbjct  482   HSLTRINGVLHGDPLDLILFQKTGWTMEEGIEGDIEEETQRFDNVQPSIIKPTDD---KS  538

Query  632   AENVELAPHLEVGIIRQFPFSSGLQRMSVIT---RTLGAPHFELYCKGSPEMIASLCHQN  688
             A         E  +IRQF FSS LQRMSVI    R     +  LY KGSPEMI SLC  N
Sbjct  539   A---------EYSVIRQFTFSSSLQRMSVIVFDPREDRPDNMMLYSKGSPEMILSLCDPN  589

Query  689   TVPSNFESVLQEYTQEGYRVIAVGYRVLGKASYAKVQRLAREEVERDLIFSGLLVMENRL  748
             TVP ++   +  Y Q G+R+IAV  R L   ++ K  ++ R+ VE DL   GL+VMENR+
Sbjct  590   TVPEDYLLQVNSYAQHGFRLIAVARRPL-DLNFNKASKVKRDAVECDLEMLGLIVMENRV  648

Query  749   KPETPAALQTLREACVRSVMVTGDNMLTAISVARDCDMVGPGERVVIVNAEP--------  800
             KP T   +  L  A +R+VMVTGDN+LT +SVAR+C ++ P +R  +V   P        
Sbjct  649   KPVTLGVINQLNRANIRTVMVTGDNLLTGLSVARECGIIRPSKRAFLVEHVPGELDEYGR  708

Query  801   -------------ETIGKPASLQFSHAEAPL----------PKNGSVISDLTVLSGDLTM  837
                          E I   AS+  S   +            P N  V +   V +  L  
Sbjct  709   TKIFVKQSVSSSDEVIEDDASVSISMCSSTWKGSSEGDGFSPTNTEVETPNPVTADSLGH  768

Query  838   LTDIRIDFDTTERYHFAVSGKSFAVLRDSFPSLLPRIAVRGTVFARMSPDQKQQLVQALQ  897
             L            YH A+SG +FAV+   +P L+ ++     VFARM+PDQKQ LV+ LQ
Sbjct  769   L--------IASSYHLAISGPTFAVIVHEYPELVDQLCSVCDVFARMAPDQKQSLVEQLQ  820

Query  898   DLGYCVGMCGDGANDCGALKAAHAGVSLSEAEASVASPFTSKENNISCVPELIREGRAAL  957
              + Y V MCGDGANDC ALKAAHAG+SLS+AEAS+A+PFTSK  +I CVP +I EGRAAL
Sbjct  821   QIDYTVAMCGDGANDCAALKAAHAGISLSDAEASIAAPFTSKVPDIRCVPTVISEGRAAL  880

Query  958   VTSFGIFKYMAAYSLTQFVTVIMLYSIDSNLTDPQFLYIDLFLITLFAFFFGKTCAYSGT  1017
             VTSFGIFKYMA YSLTQFVTV+ LY I + LTD QF+YID+FLIT+FA  FG T A+   
Sbjct  881   VTSFGIFKYMAGYSLTQFVTVMHLYWISNILTDGQFMYIDMFLITMFALLFGNTPAFY-R  939

Query  1018  LVPRPPEASLTTVAPVVSILLQTVVVIVFQAAAFVLVQYQPWFIPFVANGGDADEDHGCH  1077
             L   PP   L ++A + S++ Q +++ V Q   F     QPWF P+     D  ED    
Sbjct  940   LAHTPPPTRLLSIASMTSVVGQLIIIGVVQFIVFFSTSQQPWFTPYQPPVDDEVEDKRSM  999

Query  1078  QNYILFAVSSFQYIILAAVFSKGKPYRREMWSNGGLLGSMLAMTVFTCYLIIYPCSWLVH  1137
             Q   LF VS FQYIILA V+SKG P+R  +WSN  +    +  T+   +++I+P   ++ 
Sbjct  1000  QGTALFCVSMFQYIILALVYSKGPPFRGNLWSNKPMCALTIFATLLCLFIVIWPTELVLK  1059

Query  1138  QFTFVLPPDVLFRAALVGIAVLNLALSLGAEIL-ADRIGECCWKRSGSKGREYMAVED  1194
                 V  P + FR  +V +  +N A+S G E L  D      W+R   K R   A+ D
Sbjct  1060  TLGNVELPSLTFRIFIVIVGAVNAAVSYGFETLFVDFFLLGYWERY-KKKRSIEAIID  1116


>Q54X63_DICDI unnamed protein product
Length=1158

 Score = 621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/1172 (35%), Positives = 620/1172 (53%), Gaps = 117/1172 (10%)

Query  37    EDQMEI---YGYCQSTLYTFVTWVCIVGTAGLLRLVFHWYPHLMLYATHKQCKLDKAEKI  93
              D +EI    GY  +TL   + +  I+ +AGLL LV+HW P   +    K+CKL+ A   
Sbjct  23    NDPLEIDYMRGYQTTTLSNILHYGLIILSAGLLLLVYHWVPRWGIKMRFKECKLNDA---  79

Query  94    LAIENYQDKHLKYHVKDIFTLSTDDMESLIQVNKGI--KPDDEIWSEQKVDELKAACSGK  151
                 NY           ++  + D    L QV   +  K D E    +K D+        
Sbjct  80    ----NY-----------VYVKAKDKKYELSQVKHVLIGKKDLEFSESEKKDK--------  116

Query  152   LSIPGPNGEYQTVSGVNMFQCKKLKYLWNEELGEFHK-LQGLDHHVSTATLHMHQGLNFV  210
                                + K  +  +N E   F + +   D+H S     +  GL+  
Sbjct  117   -----------------YIEFKFTRLFYNVEKDLFIRPISNTDYHRSKINELVKTGLSMN  159

Query  211   EQAQRRLVYGGNEITVEVKGVVKLLFLEILNPFYVFQIYSICLWFGYQYYYYATAIIIMS  270
             +  + R ++G N I+V +K +  LL  EIL+PF++FQIYSI LW    YY YA AI+ ++
Sbjct  160   KYQEGRDLFGPNLISVPLKSIPSLLLDEILHPFFIFQIYSIILWCTEDYYVYAGAILFIA  219

Query  271   LWGIVSTIIQTRQNQKNLRSTIHSSDVVTVWLGGDSYETMATEQLVPGDVIVIPSHGCIM  330
             L   + T+ +TR N   L         VTV   G   + +++E LVPGD+I I     ++
Sbjct  220   LVTAIFTLRETRNNLLRLNEIATYRCDVTVLRDG-KLQVVSSETLVPGDIIEI-QKSLVL  277

Query  331   HCDAALLKGNCIVNESMLTGESVPVTKTPLP--NQPDMMFDSKEHARNTLFCGTKVIQTR  388
              CD  LL G  I+NESMLTGES+PVTK  L   +   +  D   + R  +  GTKV++T+
Sbjct  278   PCDFCLLTGTVILNESMLTGESIPVTKYSLEECSGDQLSVDPLVNKRCAMSGGTKVVKTQ  337

Query  389   FYGRE-KVKAVVLRTGFLTSKGNLVRSIMYPPPVDFKFERDSYRFVGVLAGIAAIGF---  444
                ++ K+ A+V  T +LT+KG LV S++YP    FKF   S +F+GVL  IA IGF   
Sbjct  338   AKEKDAKIFAMVTNTSWLTTKGGLVLSMLYPKESHFKFFEQSLKFLGVLCFIALIGFGVS  397

Query  445   IYTVVTKASTLAYIIFSFIPYFRGIAGSIIALESLDLITIVVPPALPAAMTVGRYYAQSR  504
             ++ ++     L+ ++                 ++LDLITIVVPPALP A +VG  ++  R
Sbjct  398   VWRLIKAGEQLSEVV----------------TKALDLITIVVPPALPMAQSVGTGFSIVR  441

Query  505   LKQKNIYCISPRAINVAGSIDCVCFDKTGTLTEDGLDMWGVVPVHNQK-----FQVPVKT  559
             LK   I+CISP  +N+AG ++  CFDKTGTLTEDGLD++GV+P H        F   +KT
Sbjct  442   LKANKIFCISPPRVNMAGKVEVYCFDKTGTLTEDGLDLFGVLPSHQDSNNSGGFGTVIKT  501

Query  560   METLPKEALLLGMASCHSLTVIGGEICGDPLDLKMFESTGWVLEEPNVDDSAKFDIITPT  619
                     L L MA+CH+L  I  ++ GDPL+ K+F +T        ++D+ +F      
Sbjct  502   DLNRMTGPLFLTMATCHTLAHIDEQVSGDPLEEKIFTATN-----AKLNDNGEFGFCAS-  555

Query  620   VVKPQRPDVVESAEN------VELAPHLEVGIIRQFPFSSGLQRMSVITRTLGAPHFEL-  672
              ++  + D +           V++    ++ ++ +F F S LQRMSV+ R + A      
Sbjct  556   -IQLSKVDNISMVHQEYPISTVDVETSDQIALVERFEFQSALQRMSVVIRGIRATDGSTQ  614

Query  673   ------YCKGSPEMIASLCHQNTVPSNFESVLQEYTQEGYRVIAVGYRVLGKA-SYAKVQ  725
                     KGSPEMI  L +  ++PS+FE VL  YT++GYRV+  GY+    + S  K +
Sbjct  615   SSKDLAIVKGSPEMIKKLSNPTSIPSDFEHVLSTYTKKGYRVLGCGYKEWDPSDSIGKTK  674

Query  726   RLAREEVERDLIFSGLLVMENRLKPETPAALQTLREACVRSVMVTGDNMLTAISVARDCD  785
                R  VERDL+F G ++MEN++KPET  AL+ L++A +R +MVTGDN+LTA+SV+R+C 
Sbjct  675   DEIRSMVERDLMFLGFIIMENKIKPETAGALKVLKDANIRIIMVTGDNVLTAVSVSRECG  734

Query  786   MVGPGERVV---IVNAEPETIGKPASLQFSHAEAPLPKNGSVISDLTVLSGDLTMLTDIR  842
             +V   + +    +VN +P T GKP  +++    +P       +   T+       + +  
Sbjct  735   LVTKEKTIFSSQLVN-DPVT-GKPTMVEWFDVTSPEESIPFTLDPYTL------TINNAG  786

Query  843   IDFDTTERYHFAVSGKSFAVLRDSF-----PSL-LPRIAVRGTVFARMSPDQKQQLVQAL  896
                +  + Y  AV+G  +    D F     P++   +I  +G VFARM+PDQKQ L++ L
Sbjct  787   GGSNYDDEYSLAVTGDVWKYYYDQFKANGQPTICFNQILRKGQVFARMTPDQKQNLIEEL  846

Query  897   QDLGYCVGMCGDGANDCGALKAAHAGVSLSEAEASVASPFTSKENNISCVPELIREGRAA  956
             Q LG  VGMCGDGANDCGALKAAH G+SLS+AEAS+A+PFTS   N++C   LI+EGRA+
Sbjct  847   QVLGLYVGMCGDGANDCGALKAAHVGISLSQAEASIAAPFTSTITNVTCTYNLIKEGRAS  906

Query  957   LVTSFGIFKYMAAYSLTQFVTVIMLYSIDSNLTDPQFLYIDLFLITLFAFFFGKTCAYSG  1016
             L  SF +F+++  YSL QF  VI+LY   S L + Q+LY DL++I     F G+T   S 
Sbjct  907   LTVSFKLFQFIGMYSLIQFCQVILLYFDGSVLNNYQYLYQDLWVIFPLVIFMGRTEPCSK  966

Query  1017  TLVPRPPEASLTTVAPVVSILLQTVVVIVFQAAAFVLVQYQPWFIPFVANGGDADEDHGC  1076
               + R P + L +   + S+L    +  VFQ   ++ V+   W+        + +E    
Sbjct  967   LSIKR-PSSRLISSTVIGSLLSHVTLTFVFQLLVYIFVRRNSWYKDLPDTSSNENEPRLD  1025

Query  1077  HQNYILFAVSSFQYIILAAVFSKGKPYRREMWSNGGLLGSMLAMTVFTCYLIIYPCSWLV  1136
             H    LF   + QY ++  ++S GKP+ R +++N  L          +  L++ P S   
Sbjct  1026  HLLASLFIYGNMQYSVMCFIYSWGKPFLRPIYTNRALFIFFCVTLTTSSLLLLLPVSIRF  1085

Query  1137  HQFTFVLPPDVLFRAALVGIAVLNLALSLGAE  1168
                T+++   V +R  L+ + ++N AL++ AE
Sbjct  1086  FGTTWLMDLPVRWRVELLILFIINAALAMAAE  1117



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000024-PA

Length=858
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZI2_DROME  unnamed protein product                                 581     0.0  
SID3_CAEEL  unnamed protein product                                   328     1e-96
ACKL_DROME  unnamed protein product                                   269     2e-75


>Q9VZI2_DROME unnamed protein product
Length=1073

 Score = 581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/577 (50%), Positives = 391/577 (68%), Gaps = 42/577 (7%)

Query  9    WLYELLQDVQLEQFFARIRDELQVSRLSHFYCVEPEDLEKVGLSRPAAQRLLDAVKKRKT  68
            WL +LL++VQLEQF  RIRD+LQV+RL+HF  V P+DLE+ GL +PA +RL++AV+K+K 
Sbjct  17   WLEDLLREVQLEQFLDRIRDDLQVTRLAHFDYVLPDDLERCGLGKPAIRRLMEAVRKKKA  76

Query  69   QLWKKNLLNRILPSNSKNSGGKQRSSSTGSSSPEVST----LSLTCLIKEKDIVLGHKLG  124
              W+KN+L++++       GGKQ SS   SS+   S+      LTCLI EKDI +G KLG
Sbjct  77   HQWRKNILSKLI------GGGKQPSSKKQSSAARESSQGNGTQLTCLIHEKDITMGLKLG  130

Query  125  DGSFGVVCRGEWSM-PTGSTLPVAVKVLKQDTLSQPGVFEDFVKEVQSMHQLNHPNLIQL  183
            DGSFGVV RGEWS  P G  +PVAVKVLK D L+QPG+ +DF +EVQ+MH L+H NL++L
Sbjct  131  DGSFGVVRRGEWSASPAGKVIPVAVKVLKSDNLTQPGIIDDFFREVQAMHALDHANLVRL  190

Query  184  FGVVLSTPMMMITELAPLGSLLDYLRKQFEQTPISILWDYSVQVATGMAYLESKRFIHRD  243
            +GVVLS PMMMITELA  GSLLD LRKQ   T ++I+W++SVQ+ TGMAYLE KRF+HRD
Sbjct  191  YGVVLSQPMMMITELAERGSLLDTLRKQCRHTSLTIIWNWSVQIVTGMAYLEQKRFLHRD  250

Query  244  LACRNVLLSSANKVKIGDFGLMRALPQQEDCYVMTEHKKVPFPWCAPESLKSRQFSHASD  303
            LACRNVLL++ NK+KIGDFGLMRALPQ++DCYVM+EHKKVPFPWCAPESL+ RQFSHASD
Sbjct  251  LACRNVLLAAGNKIKIGDFGLMRALPQEDDCYVMSEHKKVPFPWCAPESLRFRQFSHASD  310

Query  304  TWMFGVTIWEMFTFGEEPWIALTGTQILHKIDQEGERLACPEACPPELYQIMLQSWAKVP  363
            TWMFGVT+WEMF+FGE+PW+ L G+QIL KID+EGERL  P+ACPP++Y +MLQ W K P
Sbjct  311  TWMFGVTLWEMFSFGEDPWVGLNGSQILRKIDREGERLHQPDACPPDVYAMMLQCWDKTP  370

Query  364  SERPTFGAIKAFLYESAPLVVKSTQKFEEAGKMGVEEGDTIVVVEGRPDHYWWRGQNQRT  423
            +ERPTF A+K +L   +P V+++++   E+  + +E GDTI +++GR +    +GQNQRT
Sbjct  371  AERPTFAALKEYLASMSPPVMRASRSHHESKGLQIEPGDTIAIIDGRHELKLIKGQNQRT  430

Query  424  FNIGKFPRCIVTPMRPKKGDDISRPLRNSFIHTGHGSVSGKSWGNPAYIDEVYLRNPMEP  483
            F+IG FPR ++   +     D+   +R+S  +    S  G  WG  A +     R     
Sbjct  431  FDIGIFPRNLLEQRKVGAAGDVV--MRSSVGNGSSSSPFGFCWGGAAAMANGDDRQ----  484

Query  484  PDVLGIPEDATSPQTPHLQDRHKRPPQPRAVLQSLQRPSTRQQFTYSRFKNEPLSASEQH  543
                   + A+    PH ++R               + ++ +QF Y++  N+  +  ++ 
Sbjct  485  ------RKCASMTNQPHAKER---------------KSTSSKQFAYNKLVNDSATGLQRR  523

Query  544  QSPLRGRRGSNPRCKSSVDCSMGPTSEGILIDLSDDL  580
             +     +                  EGILID+S D+
Sbjct  524  NAV----KHKGVVVGPQRPPPPQFQQEGILIDISPDM  556


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/62 (42%), Positives = 36/62 (58%), Gaps = 1/62 (2%)

Query  793   AAGEEEARRALSATDWDVDAAACLLKVDRLHRLGLTDSRADCQKALQQCQWDMNAAASQL  852
             +A E++ R AL A   DV  A    K+D+L RLG+   R  C++ALQQ  W +  AA  L
Sbjct  1011  SAVEQDVRNALRAASGDVGLATRHYKIDQLARLGVA-GRPQCEQALQQTNWSLEVAAELL  1069

Query  853   LD  854
             L+
Sbjct  1070  LN  1071


>SID3_CAEEL unnamed protein product
Length=1237

 Score = 328 bits (842),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 192/522 (37%), Positives = 273/522 (52%), Gaps = 69/522 (13%)

Query  10   LYELLQDVQLEQFFARIRDELQVSRLSHFYCVEPEDLEKVGLSRPAAQRLLDAVKKRKTQ  69
            + E+L+  QL+ F ++      V R  HF  V  +D+ ++G+ +   ++L + + K   +
Sbjct  13   VLEVLRKAQLDAFISQFVFLFNVRRFDHFSHVRDKDMLEIGMQQVQIRQLREQILKMSRE  72

Query  70   LWKKNLLNRILPSNSKNSGGKQRSSSTGSSSPEVSTLSLTCLIKEKDIVLGHKLGDGSFG  129
            +W +             S  KQ       S P  +++    LI  + I L   +G+GSF 
Sbjct  73   MWNR-------------SDPKQVYIQADQSMPAQNSIDEKALIPNEQIKLYELIGEGSFA  119

Query  130  VVCRGEWSMPTGSTLPVAVKVLKQDTLSQPGVFEDFVKEVQSMHQLNHPNLIQLFGVVLS  189
            VV RG W+   G+ + VAVK+L+  +   P + +D   E   + +L HP+LI+L+G+V  
Sbjct  120  VVKRGTWTQSNGTHVNVAVKILRDIS---PNIMDDLRVEASHLLKLQHPSLIRLYGIV-R  175

Query  190  TPMMMITELAPLGSLLDYLRKQFEQTP-ISILWDYSVQVATGMAYLESKRFIHRDLACRN  248
             P MM+ EL   GSLLD LR   +    +S L DY +Q+A  + +LESK  +HRD+A RN
Sbjct  176  QPAMMVFELCEGGSLLDRLRDDKKAILLVSRLHDYCMQIAKALQFLESKHCVHRDVAARN  235

Query  249  VLLSSANK-VKIGDFGLMRALPQQEDCYVMTEHKKVPFPWCAPESLKSRQFSHASDTWMF  307
            +LL+   + VKI DFGLMRAL + E  Y M   KKVPF WC PE+L+ R+FSHASD W +
Sbjct  236  ILLARDERTVKICDFGLMRALKENEQMYTMAPQKKVPFAWCPPEALRHRKFSHASDVWSY  295

Query  308  GVTIWEMFTFGEEPWIALTGTQILHKIDQEGERLACPEACPPELYQIMLQSWAKVPSERP  367
            GVTIWE+FTFGEEPW+      +L  ID  GERL  P+ C   +YQIM   W   P+ER 
Sbjct  296  GVTIWEVFTFGEEPWVGCRAIDVLKNID-AGERLEKPKYCSERIYQIMKNCWKFNPAERC  354

Query  368  TFGAIKAFLYESAPL--VVKSTQKFEEAGKMGVEEGDTIVVVEGRPDHYWWRGQNQRTFN  425
             FGAI+  L  +  L  V + T    + G + + +GD +VVVE       W GQN++   
Sbjct  355  KFGAIREDLVAAMFLDAVARETYNSIQPGALQLTKGDEVVVVENTGQD--WFGQNKKNQK  412

Query  426  IGKFPRCIV------------------TPMRPK--------------------------K  441
             G FPR +V                   P  P                           +
Sbjct  413  FGTFPRSVVFAQTNNAVAAATAVTPQKVPTAPTIRIPPSHPPPAPLKPLNNNTKTSLNDR  472

Query  442  GDDISRPLRNSFIHTGHGS-VSGKSWGNPAYIDEVYLRNPME  482
               IS P+  SFIHTGHG  + G+SWGNPA I ++YL+NP+ 
Sbjct  473  TSKISMPVAGSFIHTGHGDPLGGQSWGNPATIADMYLKNPVN  514


>ACKL_DROME unnamed protein product
Length=1337

 Score = 269 bits (687),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 179/513 (35%), Positives = 271/513 (53%), Gaps = 56/513 (11%)

Query  10   LYELLQDVQLEQFFARIRDELQVSRLSHFYCVEPEDLEKVGLSRPAAQRLLDAVKKR--K  67
            LYE L + +L+Q++  +++EL+++  + F     EDL  +GLSRP  +RL    +K    
Sbjct  8    LYEFLTESELQQYYNAVKNELKITNAAQFKYAADEDLRFIGLSRPEIRRLRKFYEKHFPH  67

Query  68   TQLWK-KNLL---NRILPSNSKNSGGKQRS-------------SSTGSSSPEVSTLSLTC  110
            + L K K LL     ++       GG Q +             +  G+SSP     +   
Sbjct  68   SYLSKIKRLLQAPGTMVKREEAPGGGSQVALDGSSASACSSLAAKNGASSPS-KVPNNKH  126

Query  111  LIKEKDIVLGHKLGDGSFGVVCRGEWSMPTGSTLPVAVKVLKQDTL-SQPGVFEDFVKEV  169
            +I    I +  +LG G FG+V +G WS      + VA+K L ++ + S P    +F+KE 
Sbjct  127  IIPADSISVNKQLGTGEFGIVQQGVWSN-GNERIQVAIKCLCRERMQSNP---MEFLKEA  182

Query  170  QSMHQLNHPNLIQLFGVVLST-PMMMITELAPLGSLLDYLRK---QFEQTPISILWDYSV  225
              MH + H N+++L+GVVL+T  +M++TELA L SLL+ L+    +     I  L ++++
Sbjct  183  AIMHSIEHENIVRLYGVVLATDSLMLVTELAHLRSLLECLKDSGLRVSFLTIPTLCEFAL  242

Query  226  QVATGMAYLESKRFIHRDLACRNVLLSSANKVKIGDFGLMRALPQQEDCYV--MTEHKKV  283
            Q+  GM YLE KR IHRDLA RN+L+ S +KVKI DFGL RAL   +D Y      + K+
Sbjct  243  QICNGMRYLEQKRLIHRDLAARNILVFSKDKVKISDFGLSRALGVGKDYYKTNFNVNLKL  302

Query  284  PFPWCAPESLKSRQFSHASDTWMFGVTIWEMFTFGEEPWIALTGTQILHKIDQEG-ERLA  342
            P  WCAPE +   +F++ASD W FGV +WEMF++G +PW ALTG QIL  ID    +RL 
Sbjct  303  PIAWCAPECINYLRFTNASDVWAFGVCLWEMFSYGFQPWAALTGLQILEAIDAPNYQRLE  362

Query  343  CPEACPPELYQIMLQSWAKVPSERPTFGAIKAFLYESAPLVVKSTQKFEEAGK--MGVEE  400
             P+ CP E Y +M++ W    ++RP FG I   L +  P  +K+     E  K  +   +
Sbjct  363  QPDCCPSEYYTLMMKCWQDDAAKRPRFGEIYDQLPDMKPEQLKAVVNCTEPKKDHLLYRQ  422

Query  401  GDTIVVVEGRPDHYWWRG------------QNQRTFNIG-------KFPRCIVTPMRPKK  441
            GD I V++      +W+G             N   F  G        F R     +  +K
Sbjct  423  GDIISVLDRNTGTPFWKGVLSTGKTGYFNPSNTVAFLEGLPSSTRDSFSRVSDHRISKRK  482

Query  442  --GDDISRPLRNSFIHTGHGSVSGKSWGNPAYI  472
               + IS+P +N F HTGH  + G ++G+ A++
Sbjct  483  LRTEMISKP-QNDFKHTGHVGIDGATFGDIAFL  514



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000025-PA

Length=188
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IDI3_PLAF7  unnamed protein product                                 30.8    0.73 
A0A0B4K7P4_DROME  unnamed protein product                             30.4    0.95 
A0A0B4K866_DROME  unnamed protein product                             30.4    0.96 


>Q8IDI3_PLAF7 unnamed protein product
Length=1318

 Score = 30.8 bits (68),  Expect = 0.73, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query  88   PKKKIHHVVVKVPEVHKIPYVVKVPEVKHVPVVHKIPEYHKVPVVHKIPV  137
            PK +   +V K+P++  +P  VKVP++K +     + +Y   PVV  IPV
Sbjct  760  PKIETVELVKKIPKIIDVPVPVKVPKIKVIDKPFYVNKYVDKPVV--IPV  807


 Score = 29.3 bits (64),  Expect = 2.1, Method: Composition-based stats.
 Identities = 16/52 (31%), Positives = 31/52 (60%), Gaps = 8/52 (15%)

Query  88   PKKKIHHVVVKVPEVHKIPYVVKVPEVKHVPVVHK-------IPEYHKVPVV  132
            P+      +V+VPE+ ++  +++ PE+K   +++K       IP+Y +VPVV
Sbjct  644  PELHYQDKIVEVPELQEVIKIIEKPEIKE-RIIYKNKIETKIIPKYIEVPVV  694


 Score = 29.3 bits (64),  Expect = 2.3, Method: Composition-based stats.
 Identities = 23/85 (27%), Positives = 44/85 (52%), Gaps = 2/85 (2%)

Query  67   HGHHEYSFGHEVKQESYEAPEPKKKIHHVVVKVPEVHKIPYVVKVPEVKHVPVVHKIPEY  126
            H  ++Y   +E+K+      +   K     ++VPE+H    +V+VPE++ V  + + PE 
Sbjct  611  HKVNKYVNKYEIKEVEKVVKKHINKYVETKIEVPELHYQDKIVEVPELQEVIKIIEKPEI  670

Query  127  HKVPVVHKIPVVHKVPYTVYQKVPV  151
             K  +++K  +  K+    Y +VPV
Sbjct  671  -KERIIYKNKIETKI-IPKYIEVPV  693


 Score = 28.9 bits (63),  Expect = 3.4, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 31/56 (55%), Gaps = 7/56 (13%)

Query  102  VHKIPYVVKVPEVKHVPVVHKIPEYHKVPVVHKIPVVHKV--PYTV--YQKVPVFI  153
            + KI YV   P+++ V +V KIP+   VPV  K+P +  +  P+ V  Y   PV I
Sbjct  753  IEKIRYV---PKIETVELVKKIPKIIDVPVPVKVPKIKVIDKPFYVNKYVDKPVVI  805


 Score = 27.7 bits (60),  Expect = 8.0, Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 32/62 (52%), Gaps = 3/62 (5%)

Query  97   VKVPEVHKIPYVVKVPEVKHVPVVHKIPEYHKVPVVHKIPVVHKVPYTVYQKVPVFIKEE  156
            +K+P+  ++  V K+ EV   PVVHK+ +Y     + ++  V K     Y +  + + E 
Sbjct  590  IKIPKYREVEIVEKIVEV---PVVHKVNKYVNKYEIKEVEKVVKKHINKYVETKIEVPEL  646

Query  157  HH  158
            H+
Sbjct  647  HY  648


>A0A0B4K7P4_DROME unnamed protein product
Length=1237

 Score = 30.4 bits (67),  Expect = 0.95, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 1/38 (3%)

Query  117  VPVVHKIPEYHKVPVVHKIPVVHKVPYTVYQKVPVFIK  154
            V V+   PE+H  PV   +  VH VP  V+ + P  IK
Sbjct  163  VVVLEPRPEFHNTPVNFSVSSVH-VPVNVFDRAPDVIK  199


>A0A0B4K866_DROME unnamed protein product
Length=1271

 Score = 30.4 bits (67),  Expect = 0.96, Method: Composition-based stats.
 Identities = 15/38 (39%), Positives = 20/38 (53%), Gaps = 1/38 (3%)

Query  117  VPVVHKIPEYHKVPVVHKIPVVHKVPYTVYQKVPVFIK  154
            V V+   PE+H  PV   +  VH VP  V+ + P  IK
Sbjct  163  VVVLEPRPEFHNTPVNFSVSSVH-VPVNVFDRAPDVIK  199



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000026-PA

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIA1_DICDI  unnamed protein product                                   30.4    1.0  
ADA17_CAEEL  unnamed protein product                                  28.5    4.5  
M9PCJ8_DROME  unnamed protein product                                 28.1    6.6  


>DIA1_DICDI unnamed protein product
Length=455

 Score = 30.4 bits (67),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 19/71 (27%), Positives = 29/71 (41%), Gaps = 2/71 (3%)

Query  82   CPRGQFCDHHYGVCQELLRQDQFC--REDYMCQKGMWCLFGRCQPRVRHGSEGSRCQKGS  139
            C  G  C+     CQE  + D      ED   Q G  C+   C P +      S+C++ S
Sbjct  39   CSAGLVCNQTLSSCQEYEKCDSSLPLAEDTCSQDGYICVSNVCLPFIGTQYPSSQCKQNS  98

Query  140  DCDRGMCCARL  150
            +C   +C   +
Sbjct  99   NCLMSLCAGNI  109


 Score = 29.3 bits (64),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 34/83 (41%), Gaps = 8/83 (10%)

Query  93   GVCQELLRQDQFCREDYMCQKGMWCLFGRCQPRVRHGSEGSRCQKG------SDCDRGMC  146
             VC   L+ +  C     CQ G+ C+   C P +  G+E + C  G      + CD G+ 
Sbjct  169  SVCTNRLQLNSQCSTSDSCQTGLACINSVCSP-IFSGAENATCFPGAIEPTKAACDVGLS  227

Query  147  CARLHGEKLCQRLLTKGQRCHVS  169
            C        C+  + + Q C  S
Sbjct  228  CLNGANGYSCKSYV-ENQSCDPS  249


>ADA17_CAEEL unnamed protein product
Length=686

 Score = 28.5 bits (62),  Expect = 4.5, Method: Composition-based stats.
 Identities = 30/105 (29%), Positives = 44/105 (42%), Gaps = 16/105 (15%)

Query  58   FQEVERLRRLQIDQKSGPCKNPRDCPRGQFCDHHYGVCQELLRQDQFCREDYMCQKGMWC  117
            F   ++  RL +  K  P  +    P  QF +  + VC  L      C+ D +C      
Sbjct  470  FNCCDKFCRLAVGAKCSPLNHICCTPTCQFHNSTH-VC--LPGDSLLCKADAVCNG----  522

Query  118  LFGRC--QPRVRHGSEGSRCQKGSDCDRGMC---CARLH-GEKLC  156
              G C   P VR G E   C +G +C  G+C   C ++  G+K C
Sbjct  523  FSGECPSAPPVRDGQE---CLEGGECLNGVCLPFCEKMSIGKKSC  564


>M9PCJ8_DROME unnamed protein product
Length=14825

 Score = 28.1 bits (61),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 20/43 (47%), Gaps = 0/43 (0%)

Query  74    GPCKNPRDCPRGQFCDHHYGVCQELLRQDQFCREDYMCQKGMW  116
             G CK+   CP+ QFC ++    +   R D  C ED  C    +
Sbjct  2601  GTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLSDAY  2643



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000027-PA

Length=1795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPB1_DROME  unnamed protein product                                   2721    0.0  
RPB1_CAEEL  unnamed protein product                                   2272    0.0  
RPB1_DICDI  unnamed protein product                                   1732    0.0  


>RPB1_DROME unnamed protein product
Length=1887

 Score = 2721 bits (7054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1287/1540 (84%), Positives = 1404/1540 (91%), Gaps = 19/1540 (1%)

Query  6     TDSKAPLRYVKRVQFGIISPDEIRRMSVTEGGIRFPEVYEGGRPKLGGLMDPRQGVIDRL  65
             TDSKAPLR VKRVQFGI+SPDEIRRMSVTEGG++F E  EGGRPKLGGLMDPRQGVIDR 
Sbjct  5     TDSKAPLRQVKRVQFGILSPDEIRRMSVTEGGVQFAETMEGGRPKLGGLMDPRQGVIDRT  64

Query  66    SRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTMKILRCVCIYCSKLLVSPNSPKIRE  125
             SRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKT+KILRCVC YCSK+LVSP++PKI+E
Sbjct  65    SRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTIKILRCVCFYCSKMLVSPHNPKIKE  124

Query  126   IMQKSKGQPRKRLSHVYDLCKGKTICEGGDEMDLGKEGLD-DPSIGGKKGGHGGCGRYQP  184
             I+ KS+GQPRKRL++VYDLCKGKTICEGG++MDL KE    DP+   KK GHGGCG YQP
Sbjct  125   IVMKSRGQPRKRLAYVYDLCKGKTICEGGEDMDLTKENQQPDPN---KKPGHGGCGHYQP  181

Query  185   SIRRNGLELTAEWKHVNEDAQEKKCILSAERVWDIFKHISEEECTILGMDPKYARPDWMI  244
             SIRR GL+LTAEWKH NED+QEKK ++SAERVW+I KHI++EEC ILGMDPKYARPDWMI
Sbjct  182   SIRRTGLDLTAEWKHQNEDSQEKKIVVSAERVWEILKHITDEECFILGMDPKYARPDWMI  241

Query  245   VTVLPVPPLCVRPAVVMYGSARNQDDLTHKLADIIKANNDLVRNEQAGAAAHIIAENIKM  304
             VTVLPVPPL VRPAVVM+G+A+NQDDLTHKL+DIIKANN+L +NE +GAAAH+I ENIKM
Sbjct  242   VTVLPVPPLAVRPAVVMFGAAKNQDDLTHKLSDIIKANNELRKNEASGAAAHVIQENIKM  301

Query  305   LQFHVATMVDNDMPGLPRAMQKSGRPLKALKARLKGKEGRIRGNLMGKRVDFSARTVITP  364
             LQFHVAT+VDNDMPG+PRAMQKSG+PLKA+KARLKGKEGRIRGNLMGKRVDFSARTVITP
Sbjct  302   LQFHVATLVDNDMPGMPRAMQKSGKPLKAIKARLKGKEGRIRGNLMGKRVDFSARTVITP  361

Query  365   DPNLRIDQVGVPRSIAQNLTFPEIVTPFNMDKMQELVRRGNSQYPGAKYIIRDNGERIDL  424
             DPNLRIDQVGVPRSIAQNLTFPE+VTPFN+D+MQELVRRGNSQYPGAKYI+RDNGERIDL
Sbjct  362   DPNLRIDQVGVPRSIAQNLTFPELVTPFNIDRMQELVRRGNSQYPGAKYIVRDNGERIDL  421

Query  425   RFHPKPSDLHLQCGYKVERHIRDGDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSVT  484
             RFHPK SDLHLQCGYKVERH+RD DLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLS T
Sbjct  422   RFHPKSSDLHLQCGYKVERHLRDDDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRMNLSCT  481

Query  485   SPYNADFDGDEMNLHVPQSMETRAEVENLHITTRQIITPQANKPVMGIVQDTLTAVRKMT  544
             SPYNADFDGDEMNLHVPQSMETRAEVEN+HIT RQIITPQANKPVMGIVQDTLTAVRKMT
Sbjct  482   SPYNADFDGDEMNLHVPQSMETRAEVENIHITPRQIITPQANKPVMGIVQDTLTAVRKMT  541

Query  545   KRDVFLEKEQMMNLLMHLPIWDGKMPQPAILKPKPLWTGKQLFSLIIPGNVNMIRTHSTH  604
             KRDVF+ +EQ+MNLLM LP WD KMPQP ILKP+PLWTGKQ+FSLIIPGNVNMIRTHSTH
Sbjct  542   KRDVFITREQVMNLLMFLPTWDAKMPQPCILKPRPLWTGKQIFSLIIPGNVNMIRTHSTH  601

Query  605   PDDEDDGPYKWISPGDTKVMVEHGDLVMGILCKKTLGTSAGSLLHICIVELGHEVCGQFY  664
             PD+ED+GPYKWISPGDTKVMVEHG+L+MGILCKK+LGTSAGSLLHIC +ELGH++ G+FY
Sbjct  602   PDEEDEGPYKWISPGDTKVMVEHGELIMGILCKKSLGTSAGSLLHICFLELGHDIAGRFY  661

Query  665   GNIQTVVNNWLLLEGHSIGIGDTIADPNTYLEIQKTIKKAKEDVIEVIQKAHNMELEPTP  724
             GNIQTV+NNWLL EGHSIGIGDTIADP TY EIQ+ IKKAK+DVI VIQKAHNMELEPTP
Sbjct  662   GNIQTVINNWLLFEGHSIGIGDTIADPQTYNEIQQAIKKAKDDVINVIQKAHNMELEPTP  721

Query  725   GNTLRQTFENQVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVG  784
             GNTLRQTFEN+VNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVG
Sbjct  722   GNTLRQTFENKVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQVIACVG  781

Query  785   QQNVEGKRIPFGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFFFHAMGGREGLID  844
             QQNVEGKRIP+GFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEF+FHAMGGREGLID
Sbjct  782   QQNVEGKRIPYGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFYFHAMGGREGLID  841

Query  845   TAVKTAETGYIQRRLIKAMESVMVHYDGTVRNSVGQLIQLRYGEDGLAGEDVEFQTLPTI  904
             TAVKTAETGYIQRRLIKAMESVMV+YDGTVRNSVGQLIQLRYGEDGL GE VEFQ +PT+
Sbjct  842   TAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSVGQLIQLRYGEDGLCGELVEFQNMPTV  901

Query  905   KLSNHAFEKKFKFDPTNERYLRRVFNEEVMKEVMGSGEVISGIEKEWEQLTRDRDVLRTI  964
             KLSN +FEK+FKFD +NER +++VF ++V+KE+  S E I  +E EW++L  DRD LR I
Sbjct  902   KLSNKSFEKRFKFDWSNERLMKKVFTDDVIKEMTDSSEAIQELEAEWDRLVSDRDSLRQI  961

Query  965   FPTGENKVVLPCNLQRMIWNVQKIFHIDKRAPTDLSPLRVIQGVQELMRKCVIVAGDDRL  1024
             FP GE+KVVLPCNLQRMIWNVQKIFHI+KR PTDLSP+RVI+GV+ L+ +CVIV G+DR+
Sbjct  962   FPNGESKVVLPCNLQRMIWNVQKIFHINKRLPTDLSPIRVIKGVKTLLERCVIVTGNDRI  1021

Query  1025  SKQANDNATLLFQCLVRSTLCTRRVAEEFRLSSEAFEWLIGEVETRFQQAQVQPGEMVGA  1084
             SKQAN+NATLLFQCL+RSTLCT+ V+EEFRLS+EAFEWL+GE+ETRFQQAQ  PGEMVGA
Sbjct  1022  SKQANENATLLFQCLIRSTLCTKYVSEEFRLSTEAFEWLVGEIETRFQQAQANPGEMVGA  1081

Query  1085  LAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGAAAR  1144
             LAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTG AAR
Sbjct  1082  LAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLTGGAAR  1141

Query  1145  DAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQNTVIAEDQEFVNVYYEMPDFDPTRISP  1204
             DAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQ TVI+EDQEFVNVYYEMPDFDPTRISP
Sbjct  1142  DAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQRTVISEDQEFVNVYYEMPDFDPTRISP  1201

Query  1205  WLLRIELDRKRMTDKKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNSDESKF  1264
             WLLRIELDRKRMTDKKLTMEQIAEKIN GFG+DLNCIFNDDNA+KLVLRIRIMN++E+KF
Sbjct  1202  WLLRIELDRKRMTDKKLTMEQIAEKINVGFGEDLNCIFNDDNADKLVLRIRIMNNEENKF  1261

Query  1265  QDEEEQVDKMEDDMFLRCIEANMLSDMTLQGIEAISKVYMHLPQTDSKKRIIVTDTGEYK  1324
             QDE+E VDKMEDDMFLRCIEANMLSDMTLQGIEAI KVYMHLPQTDSKKRI++T+TGE+K
Sbjct  1262  QDEDEAVDKMEDDMFLRCIEANMLSDMTLQGIEAIGKVYMHLPQTDSKKRIVITETGEFK  1321

Query  1325  AIPEWLLETDGTSLMKVLSERDVDP-------------VLGIEAVRKSVEKEMNMVLNFY  1371
             AI EWLLETDGTS+MKVLSERDVDP             VLGIEAVRKSVEKEMN VL FY
Sbjct  1322  AIGEWLLETDGTSMMKVLSERDVDPIRTSSNDICEIFQVLGIEAVRKSVEKEMNAVLQFY  1381

Query  1372  GLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAEQD  1431
             GLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAE D
Sbjct  1382  GLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAAHAETD  1441

Query  1432  PMRGVSENIIMGQLPRMGTGAFDLLLDSSKCKHGIEIPVNLGAGPQLSRTVYVAIHPIAS  1491
             PMRGVSENIIMGQLP+MGTG FDLLLD+ KC+ GIEIP  LG        +++      S
Sbjct  1442  PMRGVSENIIMGQLPKMGTGCFDLLLDAEKCRFGIEIPNTLGNSMLGGAAMFIGGGSTPS  1501

Query  1492  WSDVTIIQPIVSCICTNFSQPHTRIAKLLSSQPVIQPHIA  1531
              +    + P  +C    +  P   ++ +    P   P  A
Sbjct  1502  MTPP--MTPWANCNTPRYFSPPGHVSAMTPGGPSFSPSAA  1539


>RPB1_CAEEL unnamed protein product
Length=1856

 Score = 2272 bits (5887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1057/1489 (71%), Positives = 1277/1489 (86%), Gaps = 18/1489 (1%)

Query  1     MGTLCTDSKAPLRYVKRVQFGIISPDEIRRMSVTEGGIRFPEVYEGGRPKLGGLMDPRQG  60
             M  +  D +APLR V RVQFGI+ P+EI+RMSV    + FPEVYE G+PKLGGLMDPRQG
Sbjct  1     MALVGVDFQAPLRIVSRVQFGILGPEEIKRMSVAH--VEFPEVYENGKPKLGGLMDPRQG  58

Query  61    VIDRLSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTMKILRCVCIYCSKLLVSPNS  120
             VIDR  RC TCAGN+T+CPGHFGH++LAKPVFHIGF+TKT+KILRCVC YC +LL+  ++
Sbjct  59    VIDRRGRCMTCAGNLTDCPGHFGHLELAKPVFHIGFLTKTLKILRCVCFYCGRLLIDKSA  118

Query  121   PKIREIMQKSKGQPRKRLSHVYDLCKGKTICEGGDEMDLGKEGLDDPSIGGKKGGHGGCG  180
             P++ EI++K+    +KRL+ +YDLCK K++CEG  E + G     D  +   K   GGCG
Sbjct  119   PRVLEILKKTGTNSKKRLTMIYDLCKAKSVCEGAAEKEEGMPDDPDDPMNDGKKVAGGCG  178

Query  181   RYQPSIRRNGLELTAEWK-HVNEDAQEKKCILSAERVWDIFKHISEEECTILGMDPKYAR  239
             RYQPS RR G+++ AEWK +VNED QE+K +L+AERV ++F+ I++E+  ++GMDP++AR
Sbjct  179   RYQPSYRRVGIDINAEWKKNVNEDTQERKIMLTAERVLEVFQQITDEDILVIGMDPQFAR  238

Query  240   PDWMIVTVLPVPPLCVRPAVVMYGSARNQDDLTHKLADIIKANNDLVRNEQAGAAAHIIA  299
             P+WMI TVLPVPPL VRPAVV +GSA+NQDDLTHKL+DIIK N  L RNE  GAAAH++ 
Sbjct  239   PEWMICTVLPVPPLAVRPAVVTFGSAKNQDDLTHKLSDIIKTNQQLQRNEANGAAAHVLT  298

Query  300   ENIKMLQFHVATMVDNDMPGLPRAMQKSGRPLKALKARLKGKEGRIRGNLMGKRVDFSAR  359
             +++++LQFHVAT+VDN +PGLP A QK GRPLK++K RLKGKEGRIRGNLMGKRVDFSAR
Sbjct  299   DDVRLLQFHVATLVDNCIPGLPTATQKGGRPLKSIKQRLKGKEGRIRGNLMGKRVDFSAR  358

Query  360   TVITPDPNLRIDQVGVPRSIAQNLTFPEIVTPFNMDKMQELVRRGNSQYPGAKYIIRDNG  419
             TVIT DPNL ID VGVPR+IAQNLTFPEIVTPFN+DK+QELV RG++QYPGAKYIIR+NG
Sbjct  359   TVITADPNLPIDTVGVPRTIAQNLTFPEIVTPFNVDKLQELVNRGDTQYPGAKYIIRENG  418

Query  420   ERIDLRFHPKPSDLHLQCGYKVERHIRDGDLVIFNRQPTLHKMSMMGHRVKVLPWSTFRM  479
              R+DLR+HP+ +DLHLQ GY+VERH++DGD+++FNRQPTLHKMSMMGHRVK+LPWSTFRM
Sbjct  419   ARVDLRYHPRAADLHLQPGYRVERHMKDGDIIVFNRQPTLHKMSMMGHRVKILPWSTFRM  478

Query  480   NLSVTSPYNADFDGDEMNLHVPQSMETRAEVENLHITTRQIITPQANKPVMGIVQDTLTA  539
             NLSVTSPYNADFDGDEMNLH+PQS+ETRAE+E + +  RQ+ITPQANKPVMGIVQDTL A
Sbjct  479   NLSVTSPYNADFDGDEMNLHLPQSLETRAEIEEIAMVPRQLITPQANKPVMGIVQDTLCA  538

Query  540   VRKMTKRDVFLEKEQMMNLLMHLPIWDGKMPQPAILKPKPLWTGKQLFSLIIPGNVNMIR  599
             VR MTKRDVF++   MM+LLM+LP WDGK+PQPAILKPKPLWTGKQ+FSLIIPGNVN++R
Sbjct  539   VRMMTKRDVFIDWPFMMDLLMYLPTWDGKVPQPAILKPKPLWTGKQVFSLIIPGNVNVLR  598

Query  600   THSTHPDDEDDGPYKWISPGDTKVMVEHGDLVMGILCKKTLGTSAGSLLHICIVELGHEV  659
             THSTHPD ED GPYKWISPGDTKV++EHG+L+ GI+C KT+G SAG+LLH+  +ELG+E+
Sbjct  599   THSTHPDSEDSGPYKWISPGDTKVIIEHGELLSGIVCSKTVGKSAGNLLHVVTLELGYEI  658

Query  660   CGQFYGNIQTVVNNWLLLEGHSIGIGDTIADPNTYLEIQKTIKKAKEDVIEVIQKAHNME  719
                FY +IQTV+N WL+ EGH+IGIGDTIAD  TYL+IQ TI+KAK+DV++VI+KAHN +
Sbjct  659   AANFYSHIQTVINAWLIREGHTIGIGDTIADQATYLDIQNTIRKAKQDVVDVIEKAHNDD  718

Query  720   LEPTPGNTLRQTFENQVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNINISQV  779
             LEPTPGNTLRQTFEN+VN+ILNDARD+TG SA+KSL+E+NN K+MVVSGSKGS INISQV
Sbjct  719   LEPTPGNTLRQTFENKVNQILNDARDRTGSSAQKSLSEFNNFKSMVVSGSKGSKINISQV  778

Query  780   IACVGQQNVEGKRIPFGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFFFHAMGGR  839
             IACVGQQNVEGKRIPFGFR RTLPHFIKDDYGPES+GFVENSYLAGLTPSEFFFHAMGGR
Sbjct  779   IACVGQQNVEGKRIPFGFRHRTLPHFIKDDYGPESKGFVENSYLAGLTPSEFFFHAMGGR  838

Query  840   EGLIDTAVKTAETGYIQRRLIKAMESVMVHYDGTVRNSVGQLIQLRYGEDGLAGEDVEFQ  899
             EGLIDTAVKTAETGYIQRRLIKAMESVMV+YDGTVRNS+ Q++QLRYGEDGL G  VE Q
Sbjct  839   EGLIDTAVKTAETGYIQRRLIKAMESVMVNYDGTVRNSLAQMVQLRYGEDGLDGMWVENQ  898

Query  900   TLPTIKLSNHAFEKKFKFDPTNERYLRRVFNEEVMKEVMGSGEVISGIEKEWEQLTRDRD  959
              +PT+K +N  FE+ F+ D T+ ++LR+ ++E+V++E+  S + IS +E EW QL  DR 
Sbjct  899   NMPTMKPNNAVFERDFRMDLTDNKFLRKNYSEDVVREIQESEDGISLVESEWSQLEEDRR  958

Query  960   VLRTIFPTGENKVVLPCNLQRMIWNVQKIFHIDKRAPTDLSPLRVIQGVQELMRKCVIVA  1019
             +LR IFP G+ K+VLPCNLQR+IWN QKIF +D R P +LSPL VI GV+EL +K +IV+
Sbjct  959   LLRKIFPRGDAKIVLPCNLQRLIWNAQKIFKVDLRKPVNLSPLHVISGVRELSKKLIIVS  1018

Query  1020  GDDRLSKQANDNATLLFQCLVRSTLCTRRVAEEFRLSSEAFEWLIGEVETRFQQAQVQPG  1079
             G+D +SKQA  NATLL   L+RSTLCT+ +  + +L+SEAF+WL+GE+E+RFQQA  QPG
Sbjct  1019  GNDEISKQAQYNATLLMNILLRSTLCTKNMCTKSKLNSEAFDWLLGEIESRFQQAIAQPG  1078

Query  1080  EMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIINISKKPKAPSLTVFLT  1139
             EMVGALAAQSLGEPATQMTLNTFH+AGVS+KNVTLGVPRLKEIIN+SK  K PSLTVFLT
Sbjct  1079  EMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKEIINVSKTLKTPSLTVFLT  1138

Query  1140  GAAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQNTVIAEDQEFVNVYYEMPDFDP  1199
             GAAA+D EKAK+VLC+LEHTTL+KVT NTAIYYDPDP+NTVIAED+E+V+++YEMPD D 
Sbjct  1139  GAAAKDPEKAKDVLCKLEHTTLKKVTCNTAIYYDPDPKNTVIAEDEEWVSIFYEMPDHDL  1198

Query  1200  TRISPWLLRIELDRKRMTDKKLTMEQIAEKINAGFGDDLNCIFNDDNAEKLVLRIRIMNS  1259
             +R SPWLLRIELDRKRM DKKLTME IA++I+ GFG+D++ I+ DDNAEKLV R+RI   
Sbjct  1199  SRTSPWLLRIELDRKRMVDKKLTMEMIADRIHGGFGNDVHTIYTDDNAEKLVFRLRIAGE  1258

Query  1260  DESKFQDEEEQVDKMEDDMFLRCIEANMLSDMTLQGIEAISKVYMHLPQTDSKKRIIVTD  1319
             D+ + Q  EEQVDKMEDD+FLRCIEANMLSD+TLQGI AISKVYM+ P TD KKRII+T 
Sbjct  1259  DKGEAQ--EEQVDKMEDDVFLRCIEANMLSDLTLQGIPAISKVYMNQPNTDDKKRIIITP  1316

Query  1320  TGEYKAIPEWLLETDGTSLMKVLSERDVDP-------------VLGIEAVRKSVEKEMNM  1366
              G +K++ +W+LETDGT+L++VLSER +DP             VLGIEAVRK++E+EM+ 
Sbjct  1317  EGGFKSVADWILETDGTALLRVLSERQIDPVRTTSNDICEIFEVLGIEAVRKAIEREMDN  1376

Query  1367  VLNFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGALMRCSFEETVDVLMDAAA  1426
             V++F G YVNYRHLALLCDVMTAKGHLMAITRHGINRQ+ GALMRCSFEETVD+LM+AA 
Sbjct  1377  VISFDGSYVNYRHLALLCDVMTAKGHLMAITRHGINRQEVGALMRCSFEETVDILMEAAV  1436

Query  1427  HAEQDPMRGVSENIIMGQLPRMGTGAFDLLLDSSKCKHGIEIPVNLGAG  1475
             HAE+DP++GVSENI++GQL R GTG FDL+LD  KCK+G+EIP N+  G
Sbjct  1437  HAEEDPVKGVSENIMLGQLARCGTGCFDLVLDVEKCKYGMEIPQNVVMG  1485


>RPB1_DICDI unnamed protein product
Length=1727

 Score = 1732 bits (4487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 888/1502 (59%), Positives = 1103/1502 (73%), Gaps = 58/1502 (4%)

Query  1     MGTLCTDSKAPLRYVKRVQFGIISPDEIRRMSVTEGGIRFPEVYEGGRPKLGGLMDPRQG  60
             M      S A LR VKRVQFGI+SPDEIR MSV    +  PE YE G+PK GGL+DP  G
Sbjct  1     MAAFFPPSSAELRKVKRVQFGILSPDEIRNMSVAR--VEHPETYENGKPKAGGLLDPAMG  58

Query  61    VIDRLSRCQTCAGNMTECPGHFGHIDLAKPVFHIGFITKTMKILRCVCIYCSKLLVSPNS  120
              ID+  RCQTC+G M ECPGHFGHI+LAKPVFHIGFI   +KILRCVC +CSKLL   N 
Sbjct  59    TIDKTQRCQTCSGTMAECPGHFGHIELAKPVFHIGFIDTVLKILRCVCYHCSKLLTDTNE  118

Query  121   PKIREIMQKSKGQPRKRLSHVYDLCKGKTICEGG----DEMDLGK--EGLDDPSIGGKKG  174
                R+ + K + Q + RL+ V D CK K +C  G    +E DL K  E LD P       
Sbjct  119   HSFRQAL-KIRNQ-KHRLNAVVDCCKNKKVCAIGGEEEEEHDLSKTDEELDKPV------  170

Query  175   GHGGCGRYQPSIRRNGLELTAEWKHVNEDAQEKKCILSAERVWDIFKHISEEECTILGMD  234
              HGGCG   P I +  L++  E+K V +++ EKK +LSAERV +I K I +E+   +G++
Sbjct  171   KHGGCGNVLPKITKEDLKIIVEFKDVTDESIEKKSVLSAERVLNILKRIKDEDSRAMGIN  230

Query  235   PKYARPDWMIVTVLPVPPLCVRPAVVMYGSARNQDDLTHKLADIIKANNDLVRNEQAGAA  294
             P +AR DWMI TVLPVPP  VRP+++M  S R +DDLTHKLADI+KAN +L R E+ GA 
Sbjct  231   PDWARADWMIATVLPVPPPPVRPSIMMDTSTRGEDDLTHKLADIVKANRELQRQEKNGAP  290

Query  295   AHIIAENIKMLQFHVATMVDNDMPGLPRAMQKSGRPLKALKARLKGKEGRIRGNLMGKRV  354
             AHIIAE  + LQFHVAT VDN++PGLP+A Q+SGRPLK+++ RLKGKEGRIRGNLMGKRV
Sbjct  291   AHIIAEATQFLQFHVATYVDNEIPGLPQAQQRSGRPLKSIRQRLKGKEGRIRGNLMGKRV  350

Query  355   DFSARTVITPDPNLRIDQVGVPRSIAQNLTFPEIVTPFNMDKMQELVRRGNSQYPGAKYI  414
             DFSARTVIT DPNL IDQVGVPRSIA NLT+PE VTPFN+DKM+EL+R G S++PGAKYI
Sbjct  351   DFSARTVITADPNLSIDQVGVPRSIALNLTYPETVTPFNIDKMRELIRNGPSEHPGAKYI  410

Query  415   IRDNGERIDLRFHPKPSDLHLQCGYKVERHIRDGDLVIFNRQPTLHKMSMMGHRVKVLPW  474
             IR++G R DLRF  K SD HL+CGYKVERHI DGD+VIFNRQP+LHKMSMMGHR+KV+P+
Sbjct  411   IREDGTRFDLRFVKKVSDTHLECGYKVERHINDGDVVIFNRQPSLHKMSMMGHRIKVMPY  470

Query  475   STFRMNLSVTSPYNADFDGDEMNLHVPQSMETRAEVENLHITTRQIITPQANKPVMGIVQ  534
             STFR+NLSVTSPYNADFDGDEMNLHVPQ++ETRAEV  + +  RQI++PQ+N+PVMGIVQ
Sbjct  471   STFRLNLSVTSPYNADFDGDEMNLHVPQTLETRAEVIEIMMVPRQIVSPQSNRPVMGIVQ  530

Query  535   DTLTAVRKMTKRDVFLEKEQMMNLLMHLPIWDGKMPQPAILKPKPLWTGKQLFSLIIPGN  594
             DTL   R  TKRD F+EK+ +MN+LM LP WDGK+P PAILKPK LWTGKQLFSLIIP +
Sbjct  531   DTLLGSRLFTKRDCFMEKDLVMNILMWLPSWDGKVPPPAILKPKQLWTGKQLFSLIIP-D  589

Query  595   VNMIRTHSTHPDDEDDGPYKWISPGDTKVMVEHGDLVMGILCKKTLGTSAGSLLHICIVE  654
             +N+IR  STH D E +      S GDT+V++E G+L+ GILCK++LG + GS++H+ + E
Sbjct  590   INLIRFTSTHNDKEPNE----CSAGDTRVIIERGELLAGILCKRSLGAANGSIIHVVMNE  645

Query  655   LGHEVCGQFYGNIQTVVNNWLLLEGHSIGIGDTIADPNTYLEIQKTIKKAKEDVIEVIQK  714
              GH+ C  F    QTVVN+WL+  G ++GIGDTIAD  T  ++  TI  AK  V E+I K
Sbjct  646   HGHDTCRLFIDQTQTVVNHWLINRGFTMGIGDTIADSATMAKVTLTISSAKNQVKELIIK  705

Query  715   AHNMELEPTPGNTLRQTFENQVNRILNDARDKTGGSAKKSLTEYNNLKAMVVSGSKGSNI  774
             A N + E  PG ++ +TFE +VN++LN ARD  G SA+ SL+E NNLKAMV +GSKGS I
Sbjct  706   AQNKQFECQPGKSVIETFEQKVNQVLNKARDTAGSSAQDSLSEDNNLKAMVTAGSKGSFI  765

Query  775   NISQVIACVGQQNVEGKRIPFGFRKRTLPHFIKDDYGPESRGFVENSYLAGLTPSEFFFH  834
             NISQ++ACVGQQNVEGKRIPFGF+ RTLPHF KDDYGPESRGFVENSYL GLTP EFFFH
Sbjct  766   NISQMMACVGQQNVEGKRIPFGFQSRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFH  825

Query  835   AMGGREGLIDTAVKTAETGYIQRRLIKAMESVMVHYDGTVRNSVGQLIQLRYGEDGLAGE  894
             AMGGREGLIDTAVKT+ETGYIQRRL+KAME V + YD TVRNS+G +IQ  YGEDG+ G 
Sbjct  826   AMGGREGLIDTAVKTSETGYIQRRLVKAMEDVSIKYDATVRNSLGDVIQFAYGEDGIDGC  885

Query  895   DVEFQTLPTIKLSNHAFEKKFKFDPTNERYLRRVFNEEVMKEVMGSGEVISGIEKEWEQL  954
              VE Q++ +++  N   E+ ++       Y     +  V++ V         +EKE+E++
Sbjct  886   FVENQSIDSLRKDNTELERMYRHQVDKPDYGDGWMDPLVIEHVRNDSLTRDTLEKEFERI  945

Query  955   TRDRDVLRT-IFPTGENKVVLPCNLQRMIWNVQKIFHIDKRAPTDLSPLRVIQGVQELMR  1013
               DR +LR  I P+GE    LP NL+R+I N QK+F+ID R  +DL+P  V+  +++L+ 
Sbjct  946   KSDRSLLRNEIIPSGEANWPLPVNLRRLINNAQKLFNIDIRRVSDLNPAVVVLEIEKLVA  1005

Query  1014  KCVIVAGDDRLSKQAN---------DNATLLFQCLVRSTLCTRRVAEEFRLSSEAFEWLI  1064
             +  I+A  D      N          NAT+LF  LVRST  ++RV  EFRL+ +AF W+ 
Sbjct  1006  RLKIIATADTTEDDENFNRAWAEVYFNATMLFSILVRSTFASKRVLTEFRLTEKAFLWVC  1065

Query  1065  GEVETRFQQAQVQPGEMVGALAAQSLGEPATQMTLNTFHFAGVSSKNVTLGVPRLKEIIN  1124
             GE+E++F QA   PGEMVGALAAQS+GEPATQMTLNTFH+AGVSSKNVTLGVPRLKEIIN
Sbjct  1066  GEIESKFLQALAHPGEMVGALAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRLKEIIN  1125

Query  1125  ISKKPKAPSLTVFLTGAAARDAEKAKNVLCRLEHTTLRKVTANTAIYYDPDPQNTVIAED  1184
             I+K+ K PSLT++L    ARD ++AK V  +LE+TTL  VT+ T IYYDPDPQNT+I+ED
Sbjct  1126  IAKQVKTPSLTIYLKPHMARDMDRAKIVKSQLEYTTLANVTSATEIYYDPDPQNTIISED  1185

Query  1185  QEFVNVYYEMPD--FDPTRISPWLLRIELDRKRMTDKKLTMEQIAEKINAGFGDDLNCIF  1242
              EFVN Y+E+PD   D   +SPWLLRIELDR  +TDKKLTM  I + +   FG  LNCIF
Sbjct  1186  AEFVNSYFELPDEEIDVHSMSPWLLRIELDRGMVTDKKLTMADITQCVVRDFGLSLNCIF  1245

Query  1243  NDDNAEKLVLRIRIMNSDESKFQDEEEQVDKMEDDMFLRCIEANMLSDMTLQGIEAISKV  1302
             +DDNAEKL+LRIR++ S E+K  D +      +DD FLR IE+NMLS+M L+GI+ I KV
Sbjct  1246  SDDNAEKLILRIRMVESQETKGTDND------DDDQFLRRIESNMLSEMVLRGIKGIKKV  1299

Query  1303  YMHLPQTDSKKRIIVTDTGEYKAIPEWLLETDGTSLMKVLSERDVD-------------P  1349
             +M   +TD K    VT+ G +    EW+L+TDG SL++V+S  DVD              
Sbjct  1300  FM---RTDDKIP-KVTENGGFGVREEWILDTDGVSLLEVMSHPDVDHTRTTSNDIVEIIQ  1355

Query  1350  VLGIEAVRKSVEKEMNMVLNFYGLYVNYRHLALLCDVMTAKGHLMAITRHGINRQDTGAL  1409
             VLGIEAVR ++ KE+  V++F G YVNYRHLA+L DVMT +GHLMAITRHGINR +TG L
Sbjct  1356  VLGIEAVRNALLKELRAVISFDGSYVNYRHLAILADVMTYRGHLMAITRHGINRVETGPL  1415

Query  1410  MRCSFEETVDVLMDAAAHAEQDPMRGVSENIIMGQLPRMGTGAFDLLL--DSSKCKHGIE  1467
             MRCSFEETV++LMDAA  +E D ++GV+ENII+GQLP +GTG+F++ L  D  K  H I 
Sbjct  1416  MRCSFEETVEILMDAAMFSETDDVKGVTENIILGQLPPLGTGSFEVFLNQDMIKNAHSIA  1475

Query  1468  IP  1469
             +P
Sbjct  1476  LP  1477



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000028-PA

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHR0_DROME  unnamed protein product                                 176     5e-47
Q383Y2_TRYB2  unnamed protein product                                 76.6    9e-15
Q384B0_TRYB2  unnamed protein product                                 60.1    1e-09


>E1JHR0_DROME unnamed protein product
Length=673

 Score = 176 bits (447),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 102/134 (76%), Gaps = 6/134 (4%)

Query  8    RKKQDEKHLRTLREL-ASSVAQNKQCFDCHQRGPTYVNMTIGSFVCTSCSGILRGLSTPH  66
            RKKQD+K+L  LREL AS    N+QCFDC Q+GPTYVNMTIGSFVCT CSG+LRGL+ PH
Sbjct  5    RKKQDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPH  64

Query  67   RVKSISMASFTPEEIETIRSRGNEYCKRVWLGNYDGKVNLEADAKDEQHIRDFMVMKYEK  126
            RVKSISMA+FT +EI+ +RS GNE C + WLG +D K      A  +Q  R+ M+ KYE+
Sbjct  65   RVKSISMATFTQDEIDFLRSHGNELCAKTWLGLWDPK-----RAVHQQEQRELMMDKYER  119

Query  127  KRYYVDPAVAMRNV  140
            KRYY++PA  ++++
Sbjct  120  KRYYLEPASPLKSL  133


 Score = 33.9 bits (76),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 23/61 (38%), Positives = 29/61 (48%), Gaps = 2/61 (3%)

Query  389  SPPLGTTALTSPTP--QVASPPSEDRYAALKDLDSLFKTQTTDNNLWQAPAAPAANNNST  446
            S PL     TSP      A  PSEDRYAALKDLD   +      +  + P   + N  +T
Sbjct  491  SAPLQNGHTTSPPKGGNAAMAPSEDRYAALKDLDEQLRELKASESATETPTPTSGNVQAT  550

Query  447  N  447
            +
Sbjct  551  D  551


>Q383Y2_TRYB2 unnamed protein product
Length=353

 Score = 76.6 bits (187),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 55/101 (54%), Gaps = 5/101 (5%)

Query  29   NKQCFDCHQRGPTYVNMTIGSFVCTSCSGILRGLSTPHRVKSISMASFTPEEIETIRSRG  88
            N+ C +C  RGP YV +  G+FVC++C+ + R  +  H+VK I+M  FT EE+  ++  G
Sbjct  17   NRFCMNCRMRGPVYVVLDFGTFVCSACASLHR--NKQHKVKGITMTEFTDEEVARLKVCG  74

Query  89   NEYCKRVWLGNYDGKVNLEADAKDEQHIRDFMVMKYEKKRY  129
            N+  + VWL  + G+        ++  ++ F    Y  K +
Sbjct  75   NDRAESVWLHGFKGE---RPPVGNDFALQQFFSRVYVAKEF  112


>Q384B0_TRYB2 unnamed protein product
Length=291

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/181 (25%), Positives = 86/181 (48%), Gaps = 25/181 (14%)

Query  1    MASSSSSRKKQDEKHLRTLRELASSVAQNKQCFDCHQRGPTYVNMTIGSFVCTSCSGILR  60
            M+++++++K++ +  LR        + +NK CF+C +  P + +  +G F+C  C+G+ R
Sbjct  1    MSNANAAQKRRIDALLR--------LPENKVCFECLENQPRWASTNLGVFLCLRCAGLHR  52

Query  61   GLST-PHRVKSISMASFTPEEIETIRSRGNEYCKRVWLGNYDGKVNLEAD---AKDEQHI  116
               T   +V+S +M ++  E I    + GN   + ++  N    V   A    A  E+ I
Sbjct  53   SAGTHVSKVRSATMDTWEEEMIRCCENIGNARGRVLYEYNMPDSVRPNASTNGALAERLI  112

Query  117  RDFMVMKYEKKRYYVDPAVAMRNVTLSQSQVSTPGQSQSSQASSAASTPDSKPIGSIIAP  176
            R+    KYE++RY+     ++    +S+          +SQ SS         + S+ AP
Sbjct  113  RE----KYEQRRYFNVEYDSLLKKFMSEG---------ASQGSSTPKDEKRDVVASVPAP  159

Query  177  P  177
            P
Sbjct  160  P  160



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000029-PA

Length=391


***** No hits found *****



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000030-PA

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIGER_DROME  unnamed protein product                                  74.7    2e-14
TRA2_CAEEL  unnamed protein product                                   35.8    0.072
ZYG9_CAEEL  unnamed protein product                                   32.3    0.78 


>EIGER_DROME unnamed protein product
Length=415

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 60/94 (64%), Gaps = 4/94 (4%)

Query  308  VREPGLYYVYAQINYVDEHEVNGFKVYARDEPLLQCTSMGETHHGQRNKVNTCYTAGVTF  367
            V   GLYYVYAQI Y + H+ NGF V+  D P LQC +   T+    +KV+TC+T+G+  
Sbjct  324  VTNTGLYYVYAQICYNNSHDQNGFIVFQGDTPFLQCLNTVPTN--MPHKVHTCHTSGLIH  381

Query  368  LKAGDQVYIRDVEAMRYSIFLP--EKSFFGLFRI  399
            L+  ++++++D+   R ++      +S+FG+F++
Sbjct  382  LERNERIHLKDIHNDRNAVLREGNNRSYFGIFKV  415


>TRA2_CAEEL unnamed protein product
Length=1475

 Score = 35.8 bits (81),  Expect = 0.072, Method: Composition-based stats.
 Identities = 35/134 (26%), Positives = 52/134 (39%), Gaps = 16/134 (12%)

Query  151   ERRKTTTQGTPAIYDDEQYIYRSSPSSS--TPPPVLKRRSRVQMTDYPEGSRPHQRPPQP  208
             ++R  ++   P +  DE  I RSSP      PPP    + R + +D  E S P+Q  P  
Sbjct  1117  KQRLASSLDEPQVELDEFSIKRSSPPCRYYAPPPKYSCKKRSRSSDEDEDSDPNQPGPSN  1176

Query  209   HRVRHQTTTPPTGHGEILVRVYQPQEQGATATAPAP-QSKLTRSGPGAGGGGRRLRKGRG  267
              R      +P TG+  +       +  G       P + +L  SG   GG       G G
Sbjct  1177  RR------SPKTGNKRV-------RGNGDNTELYIPNRYELIVSGKSVGGNTSAAWNGPG  1223

Query  268   HRRNKNKGNLDSEF  281
                 +N   L+  F
Sbjct  1224  STLEQNMNALEECF  1237


>ZYG9_CAEEL unnamed protein product
Length=1415

 Score = 32.3 bits (72),  Expect = 0.78, Method: Composition-based stats.
 Identities = 16/38 (42%), Positives = 22/38 (58%), Gaps = 4/38 (11%)

Query  216  TTPPTGHGEILVRVYQPQEQGATATAPAPQSKLTRSGP  253
            T+PPTG  +ILV    PQ+QG+    PA +S+     P
Sbjct  875  TSPPTGGPKILV----PQQQGSVVRRPASRSRTREPEP  908



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000031-PA

Length=1524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UGGG_DROME  unnamed protein product                                   1359    0.0   
Q9GPA0_CAEEL  unnamed protein product                                 1206    0.0   
G5EF14_CAEEL  unnamed protein product                                 568     2e-177


>UGGG_DROME unnamed protein product
Length=1548

 Score = 1359 bits (3518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/1535 (46%), Positives = 999/1535 (65%), Gaps = 90/1535 (6%)

Query  5     GVVVVAACWLLCSAKSRPKSVTTLVDAKWPSTPILLEVAEYLAEESQAHFWGFVDSVSEF  64
              VV++A         S+   +TTL++AKW  TP+ LE+AEYLA+E    FW +V  V++ 
Sbjct  10    SVVLIALYTPTSGESSQSYPITTLINAKWTQTPLYLEIAEYLADEQAGLFWDYVSGVTKL  69

Query  65    EQDFIQHKTDQETYEFSLSEASRFISLGQLSFLKLSLSLRNYSVTVETHHQMALDRHLPE  124
             +    ++ T+ + Y  +L      +S  QL  L+L +S+ + +  ++TH Q+A +     
Sbjct  70    DTVLNEYDTESQQYNAALELVKSHVSSPQLPLLRLVVSMHSLTPRIQTHFQLAEELRSSG  129

Query  125   DC--LAVADINGKLTCDPSAVEVIVQAASKQGSIDKPEF-FLVDHRYSDGSEAEVGVVLY  181
              C     A +  +L C  + ++  ++    + S+D     +  DH +         VVLY
Sbjct  130   SCQSFTFAQVGSELACSFNELQKKLEVPLAKDSLDASVVTYSFDHIFPGSENNTRTVVLY  189

Query  182   GEIGTDKFKQFHQVLKPLAEDGKVDYILRHYLKNRPERKTRLSGYGVELQIKSTEYKAQD  241
             G++G+ +F+ +H++L+  A  G++ YILRH L  + +R  RLSGYGVEL +KSTEYK+QD
Sbjct  190   GDLGSSQFRTYHKLLEKEANAGRIRYILRHQLAKKDKRPVRLSGYGVELHLKSTEYKSQD  249

Query  242   DT-KVEGGEGREGDDDSQEEEEELEGYRFTRLKELYPDSRDALEKFKSHLIENSGEMAPL  300
             D  K E G      D+    E +++G+ F  LK+ +P  + AL++ +  L++ + E+A L
Sbjct  250   DAPKPEAGST---SDEDLANESDVQGFDFKVLKQKHPTLKRALDQLRQRLLQGNDEIAQL  306

Query  301   KVWQLQELSLQAAQRILSHPKEEAIKVLAQISQNFPVQARSLVKTVVPEELRDEIKQNRE  360
             K W+ Q+L LQAA  I     +E +++L   + NFP+ AR+L+   V + LR E+K N E
Sbjct  307   KAWEFQDLGLQAAAAIAEIQGDETLQILQYTAHNFPMLARTLLAHKVTDGLRAEVKHNTE  366

Query  361   YLMASMNLHPTDAAIFVNGMFYDAELTDVFTLVDALRQELKVLEGLHKIGVEEQHLSKLL  420
                 S+N+ P D A+F+NG+F+DA+  D+++L++ LR E++VLE LH   V     S LL
Sbjct  367   AFGRSLNVAPPDGALFINGLFFDADTMDLYSLIETLRSEMRVLESLHSNNVRGSLASSLL  426

Query  421   SLDMSGGASEDYAVDIRDSAVVYLNDIEQDKQYRRWPSSVMDMLRPSYPGMLKTIRRNMY  480
             +LD++  + +++A+DIRD+AV ++NDIE D QYRRWPSSVMD+LRP++PGML+ IR+N++
Sbjct  427   ALDLTASSKKEFAIDIRDTAVQWVNDIENDVQYRRWPSSVMDLLRPTFPGMLRNIRKNVF  486

Query  481   HLVLIVDPSKEESKPLLKMAEAFVVHNAPLRTGIVFAVNSDPTVSGMKDAGVAMLNAFNY  540
             +LVL+VD  +  ++ ++K++E+FV+H AP+R G+VF    D     + D  VA+  A+NY
Sbjct  487   NLVLVVDALQPTARSVIKLSESFVIHQAPIRLGLVFDAR-DANEDNLADY-VAITCAYNY  544

Query  541   VSEVRGERYHGLSFLTDVYAESKEGDVTVAQ--VKKLLKE--RHPEADIEDVLGEGSEYD  596
             VS+ +  R   LSFLTD+YA   E  V   +  VK+L KE      A  E+ L E S YD
Sbjct  545   VSQKKDAR-AALSFLTDIYAAVGETKVVTKKDIVKQLTKEFTSLSFAKAEEFLEEDSTYD  603

Query  597   VGRQLARDFVQRVGL--RRVPQALLNGVPLPEKDLEGER-FEEAVLTALVSQTSTLQRAV  653
              GR+LA +F+QR+G   +  PQALLNGVP+P   +  +  FEEA+ T +++ TS LQ+AV
Sbjct  604   YGRELAAEFIQRLGFGDKGQPQALLNGVPMPSNVVTADSDFEEAIFTEIMTHTSNLQKAV  663

Query  654   FKGELTDDDIVIDWLMGQPNVMPRLNERILYGKG-RFLDITGDPLPTL-DWSLFTGLSGR  711
             +KGELTD+D+ ID+LM QP+VMPRLN+RIL  +  ++LDI G     L +  +   LS R
Sbjct  664   YKGELTDNDVAIDYLMNQPHVMPRLNQRILSQEDVKYLDINGVAYKNLGNVGVLNRLSNR  723

Query  712   DMVATLTKHLNYVARKVATSIVP------VTNWIVTDVETPAGRELLRKAMDHMRETNQV  765
             DM ATL  +L Y   K +T ++       +T W+  D+ET  GR+LL  A+D+++    V
Sbjct  724   DMTATLMDNLKYFGGKKSTELIGRASLQFLTIWVFADLETDQGRDLLTHALDYVQSGESV  783

Query  766   RLSVIPN--PASPETPNILTHAVYSALESLPPDDGRDFVYKIIQEHVAKTIQDGSKQPED  823
             R++ IPN   +S  +   L   V++A++SLPP    + V K +            K+P++
Sbjct  784   RVAFIPNTESSSASSRRNLNRLVWAAMQSLPPTQATEQVLKWL------------KKPKE  831

Query  824   AAVGVRSLKSISPQREAFYTGINARVLNNRCDLHVLQGMDMAAFKTAFESSQTSRLLPAY  883
                    L+ I    E                LH                      L   
Sbjct  832   KIEIPTQLEDILGSTE----------------LH----------------------LKML  853

Query  884   RTLCQRVLQFRAGQRGVVSNGKVIGPLDDGEGFEEEDFNLLERLTLSSYGNQLVEDLKEM  943
             R   QRVL     QR V+ NG++ GPL   E F+  DF LL R +   Y +++ + LKE 
Sbjct  854   RVYSQRVLGLNKSQRLVIGNGRLYGPLSSDESFDSADFALLARFSSLQYSDKVRQVLKES  913

Query  944   EEEVDGGGDWGMSSEEDSDKAMKVAALLSAHPQAKSRSQVLFR-GEEHSVIHLQPKMPGQ  1002
              ++V+         E +SD  +K+ A L    Q K+R ++      +HSV+ L PK    
Sbjct  914   AQDVN--------EEFNSDTLLKLYASLLPR-QTKTRFKLPTDLKTDHSVVKLPPKQENL  964

Query  1003  PALEVVAILDPVSRGAQKLSTLLSVLQDVVNCRIRIFLNCLEKHSEMPLRSFYRFVLEPE  1062
             P  +V A+LDP SR AQKL+ +L +L+ V+NC++ ++L  + +HS+MP+++FYR+V+EPE
Sbjct  965   PHFDVAAVLDPASRAAQKLTPILILLRQVLNCQLNLYLIPVPQHSDMPVKNFYRYVVEPE  1024

Query  1063  LQFDSIGALVNGPIARFSNMPESPVLTQNLHVPEHWLTEVVRAAYDLDNIHLEEVDSVVH  1122
             +QF++ G   +GP+A+FS +P +P+LTQ L VPE+WL E VRA YDLDNI L ++   VH
Sbjct  1025  VQFEANGGRSDGPLAKFSGLPANPLLTQQLQVPENWLVEAVRAVYDLDNIKLTDIGGPVH  1084

Query  1123  SEYELEYLLVEGQCHEQSTGTPPRGLQITLGTAHDPVQVDTIVMANLGYLQLKAQPGAWV  1182
             SE++LEYLL+EG C + ++G PPRGLQ+ LGT   P  VDTIVMANLGY QLKA PGAW 
Sbjct  1085  SEFDLEYLLLEGHCFDAASGAPPRGLQLVLGTQSQPTLVDTIVMANLGYFQLKANPGAWS  1144

Query  1183  LRLRQGRSSDIYHIVSHENTDT--PVNSTDIRVVVSSFRSLVVKLKVAKRPGKEHTDLLY  1240
             LRLR+G+S+DIY I   E T+T     S++++V+++S RS VVKL+V+K+PG +  +LL 
Sbjct  1145  LRLREGKSADIYAISHIEGTNTHHSAGSSEVQVLITSLRSHVVKLRVSKKPGMQQAELLS  1204

Query  1241  DDDQGNGGGGIWNTITSSFGTKEGGEEGESEDNK-INIFSVASGHLYERLLRIMMLSVVK  1299
             DD++     G+WN+I SSFG     +    ED + INIFSVASGHLYERLLRIMM+S++K
Sbjct  1205  DDNEQAAQSGMWNSIASSFGGGSANQAATDEDTETINIFSVASGHLYERLLRIMMVSLLK  1264

Query  1300  HTKTPVKFWFLKNYLSPMFKDFLPHMAREYGFEYELVQYKWPRWLHQQTEKQRLIWGYKI  1359
             HTK+PVKFWFLKNYLSP F DFLPHMA EY F+YELVQYKWPRWLHQQTEKQR IWGYKI
Sbjct  1265  HTKSPVKFWFLKNYLSPQFTDFLPHMASEYNFQYELVQYKWPRWLHQQTEKQRTIWGYKI  1324

Query  1360  LFLDVLFPLDVRKIIFVDADQVVRADLKDLRDLDLGGAPYGYTPFCDSRKEMDGFRFWSQ  1419
             LFLDVLFPL+VRKIIFVDAD +VR D+K+L D+DLGGAPY YTPFCDSRKEM+GFRFW Q
Sbjct  1325  LFLDVLFPLNVRKIIFVDADAIVRTDIKELYDMDLGGAPYAYTPFCDSRKEMEGFRFWKQ  1384

Query  1420  GYWKSHLQGRKYHISALYVVDLRRFRRVAAGDRLRGQYQALSMDPNSLSNLDQDLPNNMI  1479
             GYW+SHL GR+YHISALYVVDL+RFR++AAGDRLRGQYQALS DPNSLSNLDQDLPNNMI
Sbjct  1385  GYWRSHLMGRRYHISALYVVDLKRFRKIAAGDRLRGQYQALSQDPNSLSNLDQDLPNNMI  1444

Query  1480  HQVAIKSLPQEWLWCETWCNDDSKKYAKTIDLVSS  1514
             HQVAIKSLP +WLWC+TWC+D + K AK IDL ++
Sbjct  1445  HQVAIKSLPDDWLWCQTWCSDSNFKTAKVIDLCNN  1479


>Q9GPA0_CAEEL unnamed protein product
Length=1493

 Score = 1206 bits (3121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/1520 (42%), Positives = 927/1520 (61%), Gaps = 90/1520 (6%)

Query  7     VVVAACWLLCSAKSRPKSVTTLVDAKWPSTPILLEVAEYLAEESQAHFWGFVDSVSEFEQ  66
             +++  C +   A    K V T + A W ST +L E +E++AEE++  F  F+D V++   
Sbjct  6     LLIFFCHIAVLAALEKKGVHTSLKANWDSTSLLAEASEFIAEENEKLFVKFIDIVNKDVG  65

Query  67    DFIQHK-TDQETYEFSLSEASRFISLGQLSFLKLSLSLRNYSVTVETHHQMALDRHLPED  125
                  K TD++ YE+++  A + +S   +  LK +L+LR YS  V++  Q+A++    E 
Sbjct  66    TLNWEKLTDEQKYEYTIKTAGKVLSTSSVDLLKFALALRQYSPRVQSFQQIAVE--YGEK  123

Query  126   CLAVADINGKLTCDPSAVEVIVQAASKQGSIDKPEFFLVDHRYSDGSEAEVGVVLYGEIG  185
             C     +  +++C+ + +E +++ A     + +      DH + +  + +   +LYGE+G
Sbjct  124   CDVFVVVGEQVSCEYTKLEKMIKDAKTNSQVLES-----DHIFGE-KDLKQAAILYGELG  177

Query  186   TDKFKQFHQVLKPLAEDGKVDYILRHYLKNRPERKTRLSGYGVELQIKSTEYKAQDDTKV  245
             T  F +  + L  L    K   I RH+ K        LSGYGVEL IK+TEYKA D    
Sbjct  178   TTSFAKAWEKLSKLQ---KTKLIFRHFSKKTDSHPVSLSGYGVELAIKNTEYKAVD----  230

Query  246   EGGEGREGDDDSQEEEEELEGYRFTRLKELYPDSRDALEKFKSHLIENSGEMAPLKVWQL  305
             E  E +    + +E+E +L G+    LKEL+PDS DA+E F+ +L E S E+ PLK W+L
Sbjct  231   ESSEKK----NVEEDEADLFGFNIKLLKELHPDSVDAIESFRVNLKE-SDELTPLKRWEL  285

Query  306   QELSLQAAQRILSHPKEEAIKVLAQISQNFPVQARSLVKTVVPEELRDEIKQNREYLMAS  365
             Q+LS QAAQ+I++    +AI  L + SQNFP  AR+L KT V + LR E+ QNR+ ++  
Sbjct  286   QDLSYQAAQKIVNAGPADAIGTLEEYSQNFPTHARALAKTSVSDLLRKEVLQNRK-MLEK  344

Query  366   MNLHPTDAAIFVNGMFYDAELTDVFTLVDALRQELKVLEGLHKIGVEEQHLSKLLSLDMS  425
              ++   + ++++NG+  D    D+F L D L+QE K+ +G H +G+  ++LS L+ +D S
Sbjct  345   ASIEVGETSLYINGINQDINSLDLFKLADLLKQENKLADGFHSMGINREYLSILVGMDTS  404

Query  426   GGASEDYAVDIRDSAVVYLNDIEQDKQYRRWPSSVMDMLRPSYPGMLKTIRRNMYHLVLI  485
                   YAVD R+    ++N+++ DK+Y++W +SV  ML+P YPGM++ I RN++ LV +
Sbjct  405   DDEKTTYAVDHREGYPFFINNLDTDKKYKQWGNSVKLMLQPYYPGMIRPIARNLFSLVFV  464

Query  486   VDPSKEESKPLLKMAEAFVVHNAPLRTGIVFAVNSDPTVSGMKDAGVAMLNAFNYVSEVR  545
             VDPS  E +  L++ + F  H+  +R G +FAVN D   SG  D GVA+LN FN+VS + 
Sbjct  465   VDPSTSEGRKFLRIGQTFNSHDIAMRIGYIFAVNQDTKASGETDLGVALLNLFNFVS-ID  523

Query  546   GERYHGLSFLTDVYAESKEGDVTVAQVKKLLKERHPEADIEDVLGEGSEYDVGRQLARDF  605
                   L  L +   + +  D T+  +K+  + +  +A   DV G  S+YD GR+   +F
Sbjct  524   SSNADALKVLNNFLDDYRSKDPTIEDIKEFFEAKFSDASFSDVFGVNSDYDKGRKHGFEF  583

Query  606   VQRVGLRRVPQALLNGVPLPEKDLEGERFEEAVLTALVSQTSTLQRAVFKGELTDDDIVI  665
             VQ+ GL   P+ LLNG  L ++ + G+  EE ++  ++  +  +QRA+ +G+LTD   V 
Sbjct  584   VQKTGLNSAPKVLLNGFILDDEGVRGDNIEETIMMEVMKISPKIQRAIMEGKLTDRMNVG  643

Query  666   DWLMGQPNVMPRLNERILYG--KGRFLDITGDPLPTLDWSLFTGLSGRDMVATLTKHLNY  723
             +W++ Q +VMPR+N+RIL    K  +++I G  +          LS  D    L +   Y
Sbjct  644   NWVLEQKDVMPRINKRILSAPSKKTYVEILG-SMDCKSLKDVENLSDSDKAGCLLQTTKY  702

Query  724   VARKVATSIVPVTNWIVTDVETPAGRELLRKAMDHMRETNQVRLSVIPNPASPETP---N  780
             + +  A SI+PVT W+V D E  +GR  +  ++  ++ +   R+ +I NP S E     N
Sbjct  703   LQKASADSILPVTLWVVADAEAASGRRFIYNSLQILKNSANSRVGIIFNPESVEKACESN  762

Query  781   ILTHAVYSALESLPPDDGRDFVYKIIQEHVAKTIQDGSKQPEDAAVGVRSLKSISPQREA  840
              ++  + +AL+ LP D  +  + K+  E  A     G    +D +VG             
Sbjct  763   SISSYIRAALDFLPMDQAKRLILKLSNEEYAADFISGKITFDDLSVG-------------  809

Query  841   FYTGINARVLNNRCDLHVLQGMDMAAF---KTAFESSQTSRLLPAYRTLCQRVLQFRAGQ  897
                                 GMD A F   K   +  +T RL      + ++VL   +G 
Sbjct  810   --------------------GMDTAKFLADKKKLDCERT-RL---ESQIVKKVLDISSGG  845

Query  898   RGVVSNGKVIGPLDDGEGFEEEDFNLLERLTLSSYGNQLVEDLKEMEEEVDGGGDWGMSS  957
             R VV N   +GPL+  E FE  DF LLE + LS     +   LK+ E +V  G       
Sbjct  846   RVVVGNALQVGPLESSEHFEAADFKLLESMLLSRGAEVISSHLKKWEFDVSNG-------  898

Query  958   EEDSDKAMKVAALLSAHPQAKSRSQVLFRGEEHSVIHLQPKMPGQPALEVVAILDPVSRG  1017
                S+    +A  +  H  ++ R+ V  +G+EHSV+ L      +PA++V+A++DP++  
Sbjct  899   -VGSNTVFSIAGHVGKHASSQKRTWVSIQGDEHSVVTLPADEMDRPAVDVLAVVDPLTME  957

Query  1018  AQKLSTLLSVLQDVVNCRIRIFLNCLEKHSEMPLRSFYRFVLEPELQFDSIGALVNGPIA  1077
             AQKL ++L +++ V NC I+I +N  +KHSE+PL+ FYR+    EL FD  G L N  + 
Sbjct  958   AQKLGSILHLIKKVTNCEIKIVMNPKDKHSELPLKRFYRYAAASELSFDHNGNL-NTNVV  1016

Query  1078  RFSNMPESPVLTQNLHVPEHWLTEVVRAAYDLDNIHLEEVDSVVHSEYELEYLLVEGQCH  1137
             RF N+P   +LT +L  P+ W+ E V A YDLDNI +E+ +  V +E+ L++LL++GQC 
Sbjct  1017  RFDNLPSKQLLTLSLQAPDSWIVEAVSAKYDLDNIKMEQANGDVTAEFALQHLLLDGQCF  1076

Query  1138  EQSTGTPPRGLQITLGTAHDPVQVDTIVMANLGYLQLKAQPGAWVLRLRQGRSSDIYHIV  1197
             ++ +G PPRGLQ TLGT  +P Q DTIVMANLGY QLKA PGAW L +R G+SS+IY I 
Sbjct  1077  DEVSGQPPRGLQFTLGTDKNPKQFDTIVMANLGYFQLKANPGAWKLEIRDGKSSEIYKIG  1136

Query  1198  SHENTDTPVNSTDIRVVVSSFRSLVVKLKVAKRPGKEHTDLLYDDDQGNGGGGIWNTITS  1257
             SH   +  +    ++VV+ SF    V+++V KR G E  +LL DD++G     +W+++++
Sbjct  1137  SHVGAE-KIGEDVLQVVIDSFTGKSVRVRVEKREGMEERNLLSDDEEG-----VWSSLSN  1190

Query  1258  SFGTKEGGEEGESEDNKINIFSVASGHLYERLLRIMMLSVVKHTKTPVKFWFLKNYLSPM  1317
                +KE  +E       IN+FS+ASGHLYER +RIM++SV+K+TK PVKFW LKNYLSP 
Sbjct  1191  LVSSKEKTQE------VINVFSLASGHLYERFMRIMIVSVMKNTKHPVKFWLLKNYLSPQ  1244

Query  1318  FKDFLPHMAREYGFEYELVQYKWPRWLHQQTEKQRLIWGYKILFLDVLFPLDVRKIIFVD  1377
             FK+ LP +A+ YGFEYEL++YKWPRWLHQQ EKQR++WG+KILFLDVLFPLDV+K+IFVD
Sbjct  1245  FKETLPTLAKHYGFEYELIEYKWPRWLHQQKEKQRIMWGFKILFLDVLFPLDVQKVIFVD  1304

Query  1378  ADQVVRADLKDLRDLDLGGAPYGYTPFCDSRKEMDGFRFWSQGYWKSHLQGRKYHISALY  1437
             ADQVVRADL +L   DLG APYGY PFC+SRKEMDGFRFW QGYW +HL GR+YHISALY
Sbjct  1305  ADQVVRADLMELMKFDLGNAPYGYVPFCESRKEMDGFRFWKQGYWANHLAGRRYHISALY  1364

Query  1438  VVDLRRFRRVAAGDRLRGQYQALSMDPNSLSNLDQDLPNNMIHQVAIKSLPQEWLWCETW  1497
             V+DL++FR++AAGDRLRGQYQ LS DPNSL+NLDQDLPNNMIHQV IKSLPQEWLWCETW
Sbjct  1365  VIDLQKFRQIAAGDRLRGQYQGLSGDPNSLANLDQDLPNNMIHQVKIKSLPQEWLWCETW  1424

Query  1498  CNDDSKKYAKTIDLVSSVVT  1517
             C+D SKK AKTIDL ++ +T
Sbjct  1425  CDDGSKKNAKTIDLCNNPLT  1444


>G5EF14_CAEEL unnamed protein product
Length=1381

 Score = 568 bits (1465),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 321/718 (45%), Positives = 433/718 (60%), Gaps = 67/718 (9%)

Query  819   KQPEDAAVGVRSLKSISPQREAFYTGI----NARVLNNRCDLHVLQGMDMAAFKTAFESS  874
             + P +     ++++SI+ Q+      I    ++R  +N C  +         F+    +S
Sbjct  669   ENPSNRLFATKAIRSIASQKNNKIALIPNPSSSRSNDNPCSFN---------FENVGPNS  719

Query  875   QTSRLLPAYRTLCQRVLQF-------RAGQRGVVSNGKVIGPLDD-GEGFEEEDFNLLER  926
               + +L    + C + +           G+  VVSNG +IGPL    E  + +DFN L+ 
Sbjct  720   DMT-ILSKIESFCMKNINLSPLDIGVNPGETVVVSNGLLIGPLAGRTELLKTDDFNYLDT  778

Query  927   LTLSSYGNQLVEDLKEMEEEVDGGGDWGMSSEEDSDKAMKVAALLSAHPQAKSRSQ----  982
                           KE      G         E++   + ++   S   + K   Q    
Sbjct  779   F------------WKE-----KGATKAATFFNENTVYDVTISFYCSIAKKFKEDQQRMDF  821

Query  983   --VLFRGEEHSVIHLQPKMPGQPALEVVAILDPVSRGAQKLSTLLSVLQDVVNCRIRIFL  1040
                +  G  +++I   P       + V  I +PVSR AQ++ +++ +LQ + N RI I  
Sbjct  822   DEFMESGNGNTII-FPPIDSTNSTITVTWIANPVSREAQQIISVVKILQRITNSRIEIIF  880

Query  1041  NCLEKHSEMPLRSFYRFVLEPELQFDSIGALVNGPIARFSNMPESPVLTQNLHVPEHWLT  1100
             N      EMP++ FYRFV   +L F+  G++ N  +  FSN+P+  +LT +L   + W+ 
Sbjct  881   NPSADIQEMPIKRFYRFVANEKLLFNEDGSMENHSVV-FSNLPQKQLLTMSLETNDAWMI  939

Query  1101  EVVRAAYDLDNIHLEEVDSVVHSEYELEYLLVEGQCHEQSTGTPPRGLQITLGTAHDPVQ  1160
             EV +A YDLDNI LE     V + Y LE++LVEG   + S G    GL++ L +      
Sbjct  940   EVKKAEYDLDNILLETASEDVEAVYSLEHILVEGTSRKMS-GEASDGLEVELSSGGK--N  996

Query  1161  VDTIVMANLGYLQLKAQPGAWVLRLRQGRSSDIYHIVSHENTDTPVNSTDIRVVVSSFRS  1220
              DTIVM NLGY QLKA+PG W L LR G S+D + IV+ ++   PV + DI++VV SF  
Sbjct  997   YDTIVMLNLGYFQLKAEPGVWNLHLRNGHSADEHKIVTIDSI--PVEN-DIQIVVDSFSG  1053

Query  1221  LVVKLKVAKRPGKEHTDLLYDDDQGNGGGGIWNTITSSFGTKEGGEEGESEDNKINIFSV  1280
               V+L V     +E T+    DD+      + N+  + F + E  E        IN+FS+
Sbjct  1054  KWVELSV-----EELTEPKESDDEL-SIESLLNSAKNYFASPEPSE-------VINVFSL  1100

Query  1281  ASGHLYERLLRIMMLSVVKHTKT-PVKFWFLKNYLSPMFKDFLPHMAREYGFEYELVQYK  1339
             ASGHLYER +RIMM SV+ +TKT  VKFW LKNYLSP FK+ +P +A  Y FE+ELV+YK
Sbjct  1101  ASGHLYERFMRIMMTSVLNNTKTQKVKFWLLKNYLSPKFKETIPKLAEFYKFEFELVEYK  1160

Query  1340  WPRWLHQQTEKQRLIWGYKILFLDVLFPLDVRKIIFVDADQVVRADLKDLRDLDLGGAPY  1399
             WP+WLH+QTEKQR++WGYKILFLDVLFPL+V KIIFVDADQVVRADL++L D +L GAPY
Sbjct  1161  WPKWLHKQTEKQRVMWGYKILFLDVLFPLNVDKIIFVDADQVVRADLQELMDFNLNGAPY  1220

Query  1400  GYTPFCDSRKEMDGFRFWSQGYWKSHLQGRKYHISALYVVDLRRFRRVAAGDRLRGQYQA  1459
             GY PFC+SR EMDGFRFW  GYWK+HL GRKYHISALYVVDL+ FR  +AGDRLRG+Y +
Sbjct  1221  GYVPFCESRTEMDGFRFWKSGYWKNHLMGRKYHISALYVVDLKAFREFSAGDRLRGRYDS  1280

Query  1460  LSMDPNSLSNLDQDLPNNMIHQVAIKSLPQEWLWCETWCNDDSKKYAKTIDLVSSVVT  1517
             LS DPNSLSNLDQDLPNNM+H+V IKSLPQEWLWCETWC+D SK+ AKTIDL ++ +T
Sbjct  1281  LSADPNSLSNLDQDLPNNMLHEVPIKSLPQEWLWCETWCDDGSKEKAKTIDLCNNPLT  1338


 Score = 240 bits (613),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 213/789 (27%), Positives = 367/789 (47%), Gaps = 129/789 (16%)

Query  12   CWLLCSAKSRPKSVTTLVDAKWPSTPILLEVAEYLAEESQAHFWGFVDSVSEFEQDFIQH  71
            CW          S+   ++AKW S+ IL E++EY+ +E+   FW FV+SV++ E D   +
Sbjct  16   CW-------NDNSINVRLNAKWRSSSILAEISEYIGKENPEAFWNFVNSVNQ-EIDETSN  67

Query  72   KTD--QETYEFSLSEASRFISLGQLSFLKLSLSLRNYSVTVETHHQMALDRHLPEDC-LA  128
            K D  +  Y+F +S A+  +   ++  L+ SL+ R+ S  V+ H Q+ ++   PE C  +
Sbjct  68   KNDSIRNKYDFGMSVANNILGPFEMKLLRFSLATRSISPRVQAHEQIGMEFK-PEKCSFS  126

Query  129  VADINGKLTCDPSAVEVIVQAASKQGSIDKPEFFLVDHRYSDGSEAEVGVVLYGEIGTDK  188
                 G+  C  S      +        +  + F  DH Y   S AE  +++YGE+GT +
Sbjct  127  FFVYGGQAGCQLS------ELNLNNYDDNNLKIFSFDHIYPVQSTAEKTILIYGELGTYE  180

Query  189  FKQFHQVLKPLAEDGK-VDYILRHYLKNRPERKTRLSGYGVELQIKSTEYKAQDDTKVEG  247
             K      + L E  K + +++RH+ +   ++K  LSGYGVEL +K+TEYKA D +    
Sbjct  181  LKNLLLEAQSLIEKHKNLRFVVRHFSR-FSDQKPSLSGYGVELALKNTEYKAVDSSST--  237

Query  248  GEGREGDDDSQEEEEELEGYRFTRLKELYPDSRDALEKFKSHLIENSGEMAPLKVWQLQE  307
                    +  +E E L G  F  LK  + + ++ LE  + +L E  GE+ PLK WQL++
Sbjct  238  --------NKLDEPENLHGLNFKILKNRHLELQNELESLRENL-EKQGEIVPLKQWQLKD  288

Query  308  LSLQAAQRILSHPKEEAIKVLAQISQNFPVQARSLVKTVVPEELRDEIKQNREYLMAS--  365
            L  +  Q++ S  +   +++L    Q+FP  AR      + E L+  I++ +E L A   
Sbjct  289  LGFKTCQKLKSLTEIREMEILL---QDFPTHARVTSHQNLNETLQRSIQKGQETLEAKGI  345

Query  366  ---MNLHPTDAAIFVNGMFYDAELTDVFTLVDALRQELKVL-EGLHKIG------VEEQH  415
                N+   +  +   G        D+F L++ + +E K++ E +   G       E  +
Sbjct  346  ESGTNILAINGRVIAKG----DSFVDLFALMEKVEEEKKMVNEFVKGFGNSETEEFERIN  401

Query  416  LSKLLSL-DMSGGASEDYAVDIRDSAVVYLNDIEQDKQYRRWPSSVMDMLRPSYPGMLKT  474
            + K+L+L D+S     ++A D   +  VYLND+E  +   +   S+M ML+P  PG ++ 
Sbjct  402  IPKMLTLVDLSSVKLSEHAFDYSIAEPVYLNDLESTRSPYK---SLMLMLQPFPPGQIRP  458

Query  475  IRRNMYHLVLIVDPSKEESKPLLKMAEAFVVHNAPLRTGIVFAVNSDPTVSGMKDAGVAM  534
            I RN+++L++ +DP   + +    +   F       +TGI            ++   V +
Sbjct  459  ISRNIFNLIMFLDPFDSDDRVFDDVIRNF-------QTGI-----------HIRFGFVPI  500

Query  535  LNAFNYVSEVRGERYHGLSFLTDVYAESKEGDVTVAQVKKLLKERHPEADIEDVLGEGSE  594
            L+   Y   +                E     + V   KK+  +   +  + + L +GS 
Sbjct  501  LDEAKYGKSI----------------EEAVDSMIVPPTKKVFWKS--KDSLINALKKGSR  542

Query  595  YDVGRQLARDFVQRVGLRRVPQALLNGVPLPEKDLEGERFEEAVLTALVSQTSTLQRAVF  654
                      FV   GL ++P  LLNG PL    +  ERFE ++   +  QT+ LQ A+ 
Sbjct  543  ----------FVAEAGLTQLPLVLLNGYPLDVTSI--ERFESSLTQNIQKQTTRLQLALL  590

Query  655  KGELTDDDIVID--WL--MGQPNVMPRLNERIL--YGKGRFLDITGDPLPTLDWSLFTGL  708
             G L +D + ID  W      P+++ RLN+RI   +    FL+I+   +  L        
Sbjct  591  HG-LIEDSVQIDRWWFEKKTNPDIIQRLNQRITTAFNNKEFLNISRRSIQFL--------  641

Query  709  SGRDMVATLTKHLNYVARKVATSI--VPVTNWIVTDVETPAGRELLRKAMDHMRETNQVR  766
                      K+++Y + +  T +    VT WI+ D E P+ R    KA+  +      +
Sbjct  642  ----------KNVHYFSEESDTVLANADVTTWIIADFENPSNRLFATKAIRSIASQKNNK  691

Query  767  LSVIPNPAS  775
            +++IPNP+S
Sbjct  692  IALIPNPSS  700



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000032-PA

Length=275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WNT1_CAEEL  unnamed protein product                                   154     2e-44
WNT2_CAEEL  unnamed protein product                                   154     2e-44
WNTG_DROME  unnamed protein product                                   152     9e-43


>WNT1_CAEEL unnamed protein product
Length=372

 Score = 154 bits (389),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 96/275 (35%), Positives = 135/275 (49%), Gaps = 50/275 (18%)

Query  8    AAHQTTLVCQQLFSDRRWNCSSVT-FAPTLTPD--LTSGTREQAYVYALSSAAAAYTIAR  64
            AAH     CQ  F  RRWNC+ +      + PD  L   TRE A+V+A+SSAA AY + R
Sbjct  72   AAHAE---CQFQFHKRRWNCTLIDPVTHEVIPDVFLYENTRESAFVHAISSAAVAYKVTR  128

Query  65   ACASGSLDQCTC-ASPPREPPHGDFQWGGCGDNLKVGLQVSRVFADAPDKVKKVRKT---  120
             CA G  ++C C  S         FQ+ GC DN+K G+ VS+ F D+  +   + K    
Sbjct  129  DCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNG  188

Query  121  ------------AMSAVNIHNNRAGRRAVEDSLQSQCKCHGVSGSCNVKTCWRALPRLME  168
                         M  +N+HNN+AGR+ +E SL+ +CKCHG+SGSC ++TCW +LP    
Sbjct  189  TSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRH  248

Query  169  VGERLKRKYVTATEVTHRRGSAPVLVVPIVGPPGLSIGALGTRSGIPRPLASQMLLPANR  228
            +G  +K K+          G+A V VV                 GI +P      +    
Sbjct  249  IGMAIKDKF---------DGAAEVKVVK--------------EDGIEKPR-----IVMKN  280

Query  229  AIIGPFSDRDLIYSAKSPDYCLKDARFGSLGTRGR  263
            +     ++ DL+Y   SPD+C  D   G LGT+GR
Sbjct  281  SQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGR  315


>WNT2_CAEEL unnamed protein product
Length=360

 Score = 154 bits (388),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 131/268 (49%), Gaps = 36/268 (13%)

Query  2    MPHLVKAAHQTTLVCQQLFSDRRWNCSSVTFAPTLTPDLTSGTREQAYVYALSSAAAAYT  61
            MP +   A      CQ+ F+  RWNCS+      L P     TRE A+ YA+ SA   + 
Sbjct  66   MPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSAGVTHE  125

Query  62   IARACASGSLDQCTCA--SPPREPPHGDFQWGGCGDNLKVGLQVSRVFADAPDKV---KK  116
            I R C  G L  C C+  + P+  P  D+ WGGCGDN++ G + SR F D  +K    K+
Sbjct  126  IGRRCKQGLLTSCGCSDETKPKNVP-TDWSWGGCGDNVEYGYKFSRDFIDIREKEHDPKR  184

Query  117  VRKTAMSAVNIHNNRAGRRAVEDSLQSQCKCHGVSGSCNVKTCWRALPRLMEVGERLKRK  176
                  S +N  NN AGR+ ++   + +CKCHGVSG+CN+KTCW  LP + +VG+ L+ K
Sbjct  185  NHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNK  244

Query  177  YVTATEV-THRRGSAPVLVVPIVGPPGLSIGALGTRSGIPRPLASQMLLPANRAIIGPFS  235
            Y  A  V  + RG+  +L                T+    R L +               
Sbjct  245  YDKAIRVQINDRGNLQLLADE------------ATKERKTRALPT---------------  277

Query  236  DRDLIYSAKSPDYCLKDARFGSLGTRGR  263
              DL++   SPDYC  D   G+LGT GR
Sbjct  278  --DLVFMDDSPDYCRFDRHSGTLGTEGR  303


>WNTG_DROME unnamed protein product
Length=468

 Score = 152 bits (383),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/264 (33%), Positives = 136/264 (52%), Gaps = 30/264 (11%)

Query  5    LVKAAHQTTLVCQQLFSDRRWNCSSVTFA---PTLTPDLTSGTREQAYVYALSSAAAAYT  61
            LVK A+     CQ  F +RRWNCS+  F+         +  G RE +++YA++SAA  ++
Sbjct  82   LVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRGCRETSFIYAITSAAVTHS  141

Query  62   IARACASGSLDQCTCA------SPPREPPHG------DFQWGGCGDNLKVGLQVSRVFAD  109
            IARAC+ G+++ CTC       SP      G      D++WGGC DN+  G + SR F D
Sbjct  142  IARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWGGCSDNIGFGFKFSREFVD  201

Query  110  APDKVKKVRKTAMSAVNIHNNRAGRRAVEDSLQSQCKCHGVSGSCNVKTCWRALPRLMEV  169
              ++ + +R+     +N+HNN AGR  V+  ++ +CKCHG+SGSC VKTCW  L     +
Sbjct  202  TGERGRNLREK----MNLHNNEAGRAHVQAEMRQECKCHGMSGSCTVKTCWMRLANFRVI  257

Query  170  GERLKRKYVTATEVTHRRGSAPVLVVPIVGPPGLSIGALGTRSGIPRPLASQMLLPANRA  229
            G+ LK ++  AT V           +  V P      ++G+           +++P +  
Sbjct  258  GDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNG---------LIIPQSGL  308

Query  230  IIGPFSDRDLIYSAKSPDYCLKDA  253
            + G   +R L  +   PD  L+++
Sbjct  309  VYGEEEERML--NDHMPDILLENS  330


 Score = 33.9 bits (76),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 0/31 (0%)

Query  233  PFSDRDLIYSAKSPDYCLKDARFGSLGTRGR  263
            P   +DL+Y   SP +C K+ R G LGT GR
Sbjct  381  PPGSKDLVYLEPSPSFCEKNLRQGILGTHGR  411



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000033-PA

Length=1467
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CO4A1_DROME  unnamed protein product                                  602     0.0   
CO4A2_CAEEL  unnamed protein product                                  593     0.0   
CO4A1_CAEEL  unnamed protein product                                  526     2e-159


>CO4A1_DROME unnamed protein product
Length=1779

 Score = 602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/736 (55%), Positives = 470/736 (64%), Gaps = 23/736 (3%)

Query  746   GPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKGERG  805
             GP G PG A+ +GQKGE G  GL G  G  G  G PG +G  G+A  GR GP G+KG++G
Sbjct  1052  GPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQG  1111

Query  806   PPGLSGFDGPPGEKGNMGLAGF---PGTKGDNGLPGQDGLPGPSGADGLPGPAGERGFPG  862
               G+ G DG  GEKG  GL G    PG KG  G PG  G PG  G  G  G  G  G+PG
Sbjct  1112  RSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPG  1171

Query  863   ENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTSGAPGQKGDPGIAQQ--------  914
             + G      DKG PGL G  GLKG+ GP GL G    +GAPG KG+ GI  Q        
Sbjct  1172  DRG------DKGEPGLSGLPGLKGETGPVGLQG---FTGAPGPKGERGIRGQPGLPATVP  1222

Query  915   ---GIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGER  971
                G KG  G  G+ G KG++G  G +G  G  G KGDRG  G PG  G  G  G+ G+ 
Sbjct  1223  DIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDI  1282

Query  972   GFPGTPGPAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGSPGEPGPIG  1031
             G  G  G  G+T KGEKGLPG PG +G  GL G PG  GE G  GL G  G  G PGPIG
Sbjct  1283  GPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIG  1342

Query  1032  LAGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSG  1091
              AG KGE G  G  G+PG DG PG PG  G  G  G KG++G  GF  +KGDKGDRG  G
Sbjct  1343  PAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQG  1402

Query  1092  LPGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTP  1151
               G PG+ G KGD G  GL G  GP G PG++G +G  G  G+ G  G  G KGEPG  P
Sbjct  1403  PSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLP  1462

Query  1152  PAGEKGDRGPPGIPGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPGLSGPPGSKGDRG  1211
             P G KG+ G PG  G  G+PG  G+ GL G  G  GEKG  GL G  G  G PG KGDRG
Sbjct  1463  PPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGDRG  1522

Query  1212  FNGAPGSDGLPGTVGPQGNPGRSCTQQPDYLTGILLVRHSQNTGVPACEPGHVKLWDGYS  1271
               G  G +G  G +G +G PG       DYLTGIL+ RHSQ+  VPAC  GH +LW GYS
Sbjct  1523  EPGERGYEGAIGLIGQKGEPGAPAPAALDYLTGILITRHSQSETVPACSAGHTELWTGYS  1582

Query  1272  LLYIEGNEKAHHQDLGFAGSCVRRFSTMPFLFCDLNNVCNYASRNDKSYWLSTNAPIPMM  1331
             LLY++GN+ AH+QDLG  GSCV RFST+P L C  NNVCNYASRNDK++WL+TNA IPMM
Sbjct  1583  LLYVDGNDYAHNQDLGSPGSCVPRFSTLPVLSCGQNNVCNYASRNDKTFWLTTNAAIPMM  1642

Query  1332  PVAETEIRQYISRCVVCEAPANVIAVHSQSNEIPSCPSGWSGLWIGYSFVMYTAAGAEGG  1391
             PV   EIRQYISRCVVCEAPANVIAVHSQ+ E+P CP+GW GLWIGYSF+M+TA G  GG
Sbjct  1643  PVENIEIRQYISRCVVCEAPANVIAVHSQTIEVPDCPNGWEGLWIGYSFLMHTAVGNGGG  1702

Query  1392  GQSLASPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLATIDDSLQFQRPESETLKSG  1451
             GQ+L SPGSCLEDFRATPFIECNGA+GTCH++    SFW+  ++ S  F+RP+ +T+K+G
Sbjct  1703  GQALQSPGSCLEDFRATPFIECNGAKGTCHFYETMTSFWMYNLESSQPFERPQQQTIKAG  1762

Query  1452  TLRTRVSRCQVCIKYA  1467
               ++ VSRCQVC+K +
Sbjct  1763  ERQSHVSRCQVCMKNS  1778


 Score = 223 bits (568),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 254/609 (42%), Positives = 294/609 (48%), Gaps = 134/609 (22%)

Query  741   TQEGQGPKGEPGFAAGRGQKGERGFPGLNGGPG--------APGADGIPGARGDKGVAGF  792
              Q  +G  G PG+   +G KGERGF G  G PG         PGA G PG +GD G    
Sbjct  494   IQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAG----  549

Query  793   GRPGPSGQKGERGPPGLSGFD------GPPGEKGNMGLAGFPGTKGDNGLPGQDGLPGPS  846
              RPG  GQKG+ G  G  G        GP G+KG  GL G PG  G  G PG+ G PG  
Sbjct  550   -RPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGER  608

Query  847   GADGL---PGPAGERG------FPGENGGPGLP------------GDKGFPGLPGSNGLK  885
             G DG+    GP GE+G       PG  G PG P            GDKG+PG PG+ G++
Sbjct  609   GHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQ  668

Query  886   GDRGPAGLPGGPG------------TSGAPGQKGDPG---------IAQQGIKGEPGRPG  924
             G +G  GLPG PG             SGAPG  G PG         I  Q IKGEPG  G
Sbjct  669   GFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQSIKGEPGFHG  728

Query  925   FAGVKGDKGGVGFSG----------------LPGPQGEKGDRGFPGSPGRDG------FT  962
               G KGDKG  G SG                  G +GE G  G PG PG DG      +T
Sbjct  729   RDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPGEDGSPGERGYT  788

Query  963   GAQGSPGERGFPGTPGPAGIT----RKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLP  1018
             G +G+ G +G PG  GP G+      KG +G  G+PG  G  GL G+PG  G+ G +G P
Sbjct  789   GLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGKDGLRGIPGRNGQPGPRGEP  848

Query  1019  GAS--GSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPG  1076
             G S  G  G PG  GL G+KG+ GP GP G PG DG+ G PG+ G  G PG     G PG
Sbjct  849   GISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGV---SGRPG  905

Query  1077  FASEKGDKGDRGPSGLPGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAG  1136
                EKGD G  GP+G+ G PG+PG+ G RG+DG        G PG  G  G+PG  G  G
Sbjct  906   IVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGA------KGEPGSPGLVGMPGNKGDRG  959

Query  1137  FDGRKGDKGEPGYTPPAGEKGDRGPPGIPGGPGQPGSSGQDGLPGS--------------  1182
               G  G KG  G T   G  G RGP GIPG  G  G  G  GL G+              
Sbjct  960   APGNDGPKGFAGVT---GAPGKRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPG  1016

Query  1183  ----------AGRPGEKGLSGLPGP------PGLSGPPGSKGD---RGFNGAPGSDGLPG  1223
                       AG PG++GL G+PG       PGL GPPG  GD   +G  G PG  GL G
Sbjct  1017  LMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRG  1076

Query  1224  TVGPQGNPG  1232
               GP G PG
Sbjct  1077  DTGPAGTPG  1085


 Score = 214 bits (546),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 253/622 (41%), Positives = 296/622 (48%), Gaps = 154/622 (25%)

Query  746   GPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAG-FGRPGPSGQKGER  804
             G KGEPG    +G+ G  G  GL+G     G  G+PG  GD+G  G FG PG +GQKG+R
Sbjct  301   GQKGEPGLVGRKGEPGPEGDTGLDG---QKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDR  357

Query  805   GPPGLSGFDGPPGEKGNMGLAG-------------------------------FPGTKGD  833
             G PGL+G  G PG+KG  G AG                               + G  G 
Sbjct  358   GEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGP  417

Query  834   NGLPGQDGLPGPSGADGLPGPAGERGFPGENGGP--------------------------  867
              GL G DGLPGP G +G  G AG  G PG  G P                          
Sbjct  418   QGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGP  477

Query  868   ----------GLP--------GDKGFPGLPGSNGLKGDRG-----------PAGLPGGPG  898
                       GLP        GD G PG PG  G KG+RG             G PG PG
Sbjct  478   PGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPG  537

Query  899   TSGAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGR  958
              +GAPGQKGD      G  G PG+ G  G+KGD GG   S   GP+G+KG  G PG PG+
Sbjct  538   AAGAPGQKGD-----AGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGK  592

Query  959   DGFTGAQGSPGERGFPGTPGPAGIT-------RKGEKGLPGLPGPSGTSGLP--------  1003
             D   GA+G PGERG+PG  G  GI         KGE G  GLPG +G  G P        
Sbjct  593   D---GARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLI  649

Query  1004  -------GLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGL  1056
                    G PG+ G  G QG  GA G PG PGP G  G KGE    G SG PG DG PG 
Sbjct  650   EPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGE---KGLSGAPGNDGTPGR  706

Query  1057  PGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGL-------------KG  1103
              G DG+PG PG+   +G PGF    G KGD+G  G  G  G PG              KG
Sbjct  707   AGRDGYPGIPGQS-IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKG  765

Query  1104  DRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPPG  1163
             + G+ G+PGP G  G PG++G +G+ G  G  G  G +G +G  G   P GEKG++G  G
Sbjct  766   EPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNG---PRGEKGNQGAVG  822

Query  1164  IPGGPGQPGSSGQDGLPGSAGRPGEKGLSGLP-----GPPGLSGPPGSKGDR------GF  1212
             +   PG PG  G  G+PG  G+PG +G  G+      GPPGL+G  G KGDR      GF
Sbjct  823   V---PGNPGKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGF  879

Query  1213  NGAPGSDGLPGTVGPQGNPGRS  1234
              GA GS G PG  G  G PG S
Sbjct  880   PGADGSVGYPGDRGDAGLPGVS  901


 Score = 195 bits (496),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 242/562 (43%), Positives = 284/562 (51%), Gaps = 101/562 (18%)

Query  749   GEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQ--------  800
             G PG    RG  GERG+PG  G  G  G  G PG +G+ G  G   PG +G+        
Sbjct  588   GIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGL--PGATGEPGKPALCD  645

Query  801   -------KGERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQDGLPGPSGADGLPG  853
                    KG++G PG  G  G  G KG  GL G PG KG+ G  G+ GL G  G DG PG
Sbjct  646   LSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPG  705

Query  854   PAGERGFPGENGGPGLPGD--KGFPGLPGSNGLKGDRGPAGLPGGPGTSG----------  901
              AG  G+PG      +PG   KG PG  G +G KGD+G  G  G  G  G          
Sbjct  706   RAGRDGYPG------IPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMP  759

Query  902   APGQKGDPGIAQQ----GIKGEPGRPGFAGVKGDKG-----GV-GFSGLPGPQGEKGDRG  951
             A G KG+PG        G  G PG  G+ G+KG+ G     GV G  GL GP+GEKG++G
Sbjct  760   AKGNKGEPGQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQG  819

Query  952   ---FPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLP---------GPSGT  999
                 PG+PG+DG    +G PG  G PG  G  GI+R G  G PGL          GP+G 
Sbjct  820   AVGVPGNPGKDGL---RGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGP  876

Query  1000  SGLPGLPGS---KGETGFQGLPGASGSP------GEPGPIGLAGQKGEPGPLGPSGRPGL  1050
              G PG  GS    G+ G  GLPG SG P      G+ GPIG AG  G PG  G  G  G 
Sbjct  877   IGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGR  936

Query  1051  DGAPGLPGNDGFPGTPGEKGDQGAP------GFASEKGDKGDRGPSGLPGSPGIPGLKGD  1104
             DGA G PG+ G  G PG KGD+GAP      GFA   G  G RGP+G+   PG+ G KGD
Sbjct  937   DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGI---PGVSGAKGD  993

Query  1105  RGKDGLPG---------PVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGE  1155
             +G  GL G         P G  G  G KG  G+ G PGQ G DG  G+KG  G+      
Sbjct  994   KGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFP-----  1048

Query  1156  KGDRGPPGIPGGP------GQPGSSGQDGLPGSAGRPGEKGLSGLPGPP--GLSGPPGSK  1207
              G  GPPG+PG        G+PG SG  G  G AG PG  G  GLPG    G +GPPG K
Sbjct  1049  -GLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEK  1107

Query  1208  GDRGFNGAPGSDGLPGTVGPQG  1229
             GD+G +G  G DG+ G  G QG
Sbjct  1108  GDQGRSGIDGRDGINGEKGEQG  1129


 Score = 191 bits (484),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 229/542 (42%), Positives = 267/542 (49%), Gaps = 65/542 (12%)

Query  745   QGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKGER  804
             +G  G PG+   +G KG+ G PG  G  G+ G  G  G  G  G +  GRPG  G  G  
Sbjct  484   KGDAGLPGYGI-QGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAP  542

Query  805   GPPGLSGFDGPPGEKGNMGLAGFPGTK------GDNGLPGQDGLPGPSGADGLPGPAGER  858
             G  G +G  G PG+KG+MG+ G  G K      G  G  G  GLPG  G DG  GP GER
Sbjct  543   GQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGER  602

Query  859   GFPGENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTSGAPGQKGDPGIAQ-----  913
             G+PGE G  G+ G  G PG       KG+ G  GLPG      A G+ G P +       
Sbjct  603   GYPGERGHDGINGQTGPPGE------KGEDGRTGLPG------ATGEPGKPALCDLSLIE  650

Query  914   --QGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGE---KGDRGFPGSPGRDGFTGAQGSP  968
               +G KG PG PG  GV+G KG  G  G+PGP+GE   KG++G  G+PG DG  G  G  
Sbjct  651   PLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAG--  708

Query  969   GERGFPGTPG------PAGITRKGEKGLPGLPGPSGTSGLPG--------LP-----GSK  1009
                G+PG PG      P    R G KG  G  G SG  G PG        +P     G  
Sbjct  709   -RDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEP  767

Query  1010  GETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTPGEK  1069
             G+TG  G PG  GSPGE G  GL G  G  GP G  G  GL+G  G  GN G  G PG  
Sbjct  768   GQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNP  827

Query  1070  GDQGAPGFASEKGDKGDRGPSGL--PGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSG  1127
             G  G  G     G  G RG  G+  PG  G PGL G +G+ G  GP GP GFPG  G+ G
Sbjct  828   GKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVG  887

Query  1128  IPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDR---GPPGIPGGPGQPGSSGQDGLPGSAG  1184
              PG  G AG  G  G    PG     GEKGD    GP G+ G PG PG  G  G  G+ G
Sbjct  888   YPGDRGDAGLPGVSG---RPGIV---GEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKG  941

Query  1185  RPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVGPQGNPGRSCTQQPDYLTG  1244
              PG  GL G+PG  G  G PG+ G +GF G  G+   PG  GP G PG S  +     TG
Sbjct  942   EPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGA---PGKRGPAGIPGVSGAKGDKGATG  998

Query  1245  IL  1246
             + 
Sbjct  999   LT  1000


 Score = 186 bits (471),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 236/606 (39%), Positives = 287/606 (47%), Gaps = 133/606 (22%)

Query  745   QGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKGER  804
             +G +G PG     G KGE GFPG+ G  G  G  G PG  G +           G KGER
Sbjct  88    KGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQR-----------GDKGER  136

Query  805   GPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQDGLPGPSGADGLPGP---------A  855
             G PGL G  G PG +G  G  G PG  G +G  GQDG+PG  G  G+PGP          
Sbjct  137   GSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSK  196

Query  856   GERGFPGENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTSGAPGQKGDPGIAQQG  915
             GE+G P +  G    G+KG PG  G+ GL G +G  G  G  G SG  G KG  G  + G
Sbjct  197   GEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRG--EHG  254

Query  916   IKGEPG-------RPGFAGVKGDKGGVGFS-------GLPGPQGEKGDRGFP------GS  955
             +KGE G       +PG  G+KG+KG    S        + GP+G+ G +G P      G 
Sbjct  255   LKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPGLVGRKGE  314

Query  956   PGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQ  1015
             PG +G TG  G  GE+G PG PG  G  R+G  G PG  G  G  G PGL G  G  G +
Sbjct  315   PGPEGDTGLDGQKGEKGLPGGPGDRG--RQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQK  372

Query  1016  GLPGASGSP-------------------------------GEPGPIGLAGQKGEPGPLGP  1044
             G PG +G+                                G PGP GL G  G PGP G 
Sbjct  373   GEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGY  432

Query  1045  SGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPG---------------FASEKGD------  1083
             +G+ G  G PG PGN+G PG  GEKG  G  G                  +KGD      
Sbjct  433   NGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGY  492

Query  1084  --KGDRGPSGLPGSPGIPGLKGDRG-----------KDGLPGPVGPSGFPGDKGTSGIPG  1130
               +G +G +G+PG PG+ G KG+RG           K G PG  G +G PG KG +G PG
Sbjct  493   GIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPG  552

Query  1131  GPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPPGIPGGPGQ------------PGSSGQDG  1178
              PGQ G  G KGD G    +  AG KGD+G  G+PG PG+            PG  G DG
Sbjct  553   TPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARGPPGERGYPGERGHDG  612

Query  1179  LPGSAGRPGEKGLSGLPGPPGLSGPPGS------------KGDRGFNGAPGSDGLPGTVG  1226
             + G  G PGEKG  G  G PG +G PG             KGD+G+ GAPG+ G+ G  G
Sbjct  613   INGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKG  672

Query  1227  PQGNPG  1232
              +G PG
Sbjct  673   AEGLPG  678


 Score = 186 bits (471),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 261/712 (37%), Positives = 306/712 (43%), Gaps = 223/712 (31%)

Query  745   QGPKGEPGFAAGRGQKGERGFPGLN------------GGPGAPGADGIPGARGDKGVAGF  792
             +G KG+PG    RG KGERG PGL+            G PGAPG +G  G  G  G+ G 
Sbjct  118   KGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGL  177

Query  793   ----GRPGPS------GQKGERGPPG------LSGFDGPPGEKGNMGLA---GFPGTKGD  833
                 G PGP       G KGE+G P         G  G PG +G  GLA   GFPG KG+
Sbjct  178   EGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGE  237

Query  834   NGLPGQDGLPGPSGADGL----------------PGPAGERGFP----------------  861
              G  G  G  GP G  GL                PG  GE+G P                
Sbjct  238   RGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPR  297

Query  862   ---GENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGG------------PGTSGAPGQK  906
                G+ G PGL G KG PG  G  GL G +G  GLPGG            PG++G  G +
Sbjct  298   GDMGQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDR  357

Query  907   GDPGI----AQQGIKGEPGRPG-------------------------------FAGVKGD  931
             G+PG+       G KGEPGR G                               + G  G 
Sbjct  358   GEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGP  417

Query  932   KGGVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGIT--------  983
             +G  G  GLPGPQG  G +G  G PGR G  G  G  GE+G  G  GP G          
Sbjct  418   QGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGHPGP  477

Query  984   -----RKGEKGLPGL-----PGPSGTSGLPGLPGSKGETGFQ--------------GLPG  1019
                  +KG+ GLPG       G +G  G PGL GSKGE GF+              G PG
Sbjct  478   PGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLGRPGTPG  537

Query  1020  ASGSPGEPGPIG------------------------LAGQKGEPGPLGPSGRPGLDGAPG  1055
             A+G+PG+ G  G                         AG KG+ G  G  G PG DGA G
Sbjct  538   AAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGARG  597

Query  1056  LPGNDGFPGT------------PGEKGDQGAPGFASEKGD---------------KGDRG  1088
              PG  G+PG             PGEKG+ G  G     G+               KGD+G
Sbjct  598   PPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKG  657

Query  1089  PSGLPGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGG---PGQAGFDGRKG---  1142
               G PG+ G+ G KG  G  G+PGP G  GF G+KG SG PG    PG+AG DG  G   
Sbjct  658   YPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPG  717

Query  1143  --DKGEPGYTPPAGEKGDRGPPGIPGGPGQPGSS----------------GQDGL---PG  1181
                KGEPG+    G KGD+G  G  G  G+PGS                 GQ G+   PG
Sbjct  718   QSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGPPG  777

Query  1182  SAGRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVGPQGNPGR  1233
               G PGE+G +GL G  G  GPPG +G RG NG  G  G  G VG  GNPG+
Sbjct  778   EDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNPGK  829


 Score = 183 bits (465),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 152/295 (52%), Positives = 177/295 (60%), Gaps = 28/295 (9%)

Query  1    MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGL  60
            MGFPG EG  G KG K +PGP G RG KG+RG    PG  G  G+PG QGP G  G PG+
Sbjct  106  MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGS---PGLHGQAGVPGVQGPAGNPGAPGI  162

Query  61   ---DGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNI-RGQKGEPGLDGV  116
               DGC+G DG+PG  G  G PGPRG  G  G KG KGEPA    +  +G+KGEPG  G 
Sbjct  163  NGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGT  222

Query  117  RGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGS--MGLSYEGAKGDKGDKGFQG  174
             G+ G  G PG +G  G  G  G  GP G+HG KG+KG+   G    GA G KG+KG   
Sbjct  223  AGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGE--  280

Query  175  PPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGM---  231
             P    P KP      T++GP      +GD G++GE G+ G    +GEPG EGD G+   
Sbjct  281  -PASSFPVKP----THTVMGP------RGDMGQKGEPGLVG---RKGEPGPEGDTGLDGQ  326

Query  232  KGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSV  286
            KGEKGLPG PG RGR G  GPPG  GQKGDRG  GL+GL G PG KGEPGR G+ 
Sbjct  327  KGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGAT  381


 Score = 149 bits (376),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 181/390 (46%), Positives = 203/390 (52%), Gaps = 54/390 (14%)

Query  745   QGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADG-------------IPGARGDKGVAG  791
             +G KGEPG +   G KGE G  GL G  GAPG  G             +P  RGDKG   
Sbjct  1173  RGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQ-  1231

Query  792   FGRPGPSGQKGERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQDGLPGPSGADGL  851
              G  G +G+KGE+G  GL+G  G  G KG+ GL G PG  G NG+PG  G  GP G  G 
Sbjct  1232  -GERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGY  1290

Query  852   PGPA--GERGFPGE---------NGGPGLPGDKGFPGLPGSNGL------------KGDR  888
             PG    GE+G PG           G PGL G++G PGL G  GL            KG+R
Sbjct  1291  PGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGER  1350

Query  889   GPAGLPGGPGTS---GAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGF---SGLPG  942
             G AG PG PG     GAPG KGD G   QG KGE G  GF G KGDKG  G    SGLPG
Sbjct  1351  GLAGSPGQPGQDGFPGAPGLKGDTG--PQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPG  1408

Query  943   PQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGPSGTSGL  1002
               G+KGD G+PG  G DG  GA   PGERGF G  G     R G  G PGLPG  G  G+
Sbjct  1409  LVGQKGDTGYPGLNGNDGPVGA---PGERGFTGPKG-----RDGRDGTPGLPGQKGEPGM  1460

Query  1003  PGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGNDGF  1062
                PG KGE G  G  G  G PG PG  GL G +GE G  G  G  G  G  G PG  G 
Sbjct  1461  LPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRPGPKGD  1520

Query  1063  PGTPGEKGDQGAPGFASEKGDKGDRGPSGL  1092
              G PGE+G +GA G   +KG+ G   P+ L
Sbjct  1521  RGEPGERGYEGAIGLIGQKGEPGAPAPAAL  1550


 Score = 148 bits (374),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 198/453 (44%), Positives = 227/453 (50%), Gaps = 48/453 (11%)

Query  730   LDFQDSQATRVTQEG-QGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGAD---GIPGARG  785
             +D +D       ++G QG  G+PG     G  G  G PG++G PGA GA    G PG RG
Sbjct  1115  IDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRG  1174

Query  786   DKGVAGFGRPGPSGQKGERGPPGLSGFDGPPGEKGNMGLAGFPG-------TKGDNGLPG  838
             DKG  G    G  G KGE GP GL GF G PG KG  G+ G PG        +GD G  G
Sbjct  1175  DKGEPGL--SGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQG  1232

Query  839   QDGLPGPSGAD---GLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGDR-------  888
             + G  G  G     GL GPAG  G  G+ G  G PG  G  G+PG+ G  G R       
Sbjct  1233  ERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPG  1292

Query  889   ----GPAGLPGGPGTSGAPGQKGDPGIAQQ----GIKGEPGRPGFAGVKGDKGGVGFSGL  940
                 G  GLPG PG +G  G  G PG+  +    G+ GEPG  G  G  G  G  G  GL
Sbjct  1293  VTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGL  1352

Query  941   PGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGPSGTS  1000
              G  G+ G  GFPG+PG  G TG QG  GERG  G  G     +KG+KG  GL GP   S
Sbjct  1353  AGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEG-----QKGDKGDRGLQGP---S  1404

Query  1001  GLPGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGND  1060
             GLPGL G KG+TG+ GL G  G  G PG  G           GP GR G DG PGLPG  
Sbjct  1405  GLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFT---------GPKGRDGRDGTPGLPGQK  1455

Query  1061  GFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGLKGDRGKDGLPGPVGPSGFP  1120
             G PG     G +G PG     G KG+ G  G  G  GI G +G++G+ GL G  G  G P
Sbjct  1456  GEPGMLPPPGPKGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLIGETGNVGRP  1515

Query  1121  GDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPA  1153
             G KG  G PG  G  G  G  G KGEPG   PA
Sbjct  1516  GPKGDRGEPGERGYEGAIGLIGQKGEPGAPAPA  1548


 Score = 139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 183/351 (52%), Gaps = 38/351 (11%)

Query  727   PDVLDFQDSQATRVTQEGQGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGA---DGIPGA  783
             PD+   + SQ  R     +G +GE G     G  G +G  GL G    PGA   +GIPGA
Sbjct  1222  PDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQG---PPGASGLNGIPGA  1278

Query  784   RGDKGVAG-FGRPGPSGQKGERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQDGL  842
             +GD G  G  G PG +  KGE+G PG       PG  G  GL G PG  G+ GLPG  G 
Sbjct  1279  KGDIGPRGEIGYPGVT-IKGEKGLPGR------PGRNGRQGLIGAPGLIGERGLPGLAGE  1331

Query  843   PGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTSGA  902
             PG  G  G  GPAG +G  G  G PG PG  GFPG P   GLKGD GP G  G  G +G 
Sbjct  1332  PGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAP---GLKGDTGPQGFKGERGLNGF  1388

Query  903   PGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDGFT  962
              GQKGD G   +G++G  G PG  G KGD G  G +G  GP G  G+RGF G  GRDG  
Sbjct  1389  EGQKGDKG--DRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRD  1446

Query  963   GAQGSPGERGFPGT-------PGPAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQ  1015
             G  G PG++G PG          P    R G KG PG P   G  GL G+ G +GE G +
Sbjct  1447  GTPGLPGQKGEPGMLPPPGPKGEPGQPGRNGPKGEPGRP---GERGLIGIQGERGEKGER  1503

Query  1016  GLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTP  1066
             GL G +G+ G PGP    G +GEP      G  G +GA GL G  G PG P
Sbjct  1504  GLIGETGNVGRPGP---KGDRGEP------GERGYEGAIGLIGQKGEPGAP  1545


 Score = 127 bits (319),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 186/406 (46%), Gaps = 119/406 (29%)

Query  911   IAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGE  970
             IA++G +G PG  G  G+KG+   +GF G+ GP G+KG +G PG  G+ G  G +GSPG 
Sbjct  85    IAEKGNRGLPGPLGPTGLKGE---MGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPG-  140

Query  971   RGFPGTPGPAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGSPGEPGPI  1030
                            G+ G+PG+ GP+G  G PG+ G  G  G  G+PG  G  G PGP 
Sbjct  141   -------------LHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPR  187

Query  1031  GLAGQ------KGEPG------PLGPSGRPGLDGAPGLPGNDGFPGTPGEKGDQG---AP  1075
             G AGQ      KGEP         G  G PG  G  GL G  GFPG  GE+GD G   A 
Sbjct  188   GYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAK  247

Query  1076  GFASEKGDKGDRGPSGL-PGSPGIPGLKGDRG----------------------------  1106
             G   E G KG++G S   P  PG PG+KG++G                            
Sbjct  248   GPRGEHGLKGEKGASCYGPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPG  307

Query  1107  ---KDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPPG  1163
                + G PGP G +G  G KG  G+PGGPG  G   R+G+ G PG T   G+KGDRG PG
Sbjct  308   LVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRG---RQGNFGPPGST---GQKGDRGEPG  361

Query  1164  IPGGPGQPGSSGQ-----------------------------------------------  1176
             + G PG PG  G+                                               
Sbjct  362   LNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGAPGPQGLN  421

Query  1177  --DGLPGSAGRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDG  1220
               DGLPG  G  G+KG +GLPG PG  GPPG KG++G  G  G  G
Sbjct  422   GVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKG  467


 Score = 124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 166/311 (53%), Gaps = 17/311 (5%)

Query  2    GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
            G PG +G+ G KG +  PG  GP+G  G +G+ G+ G PG  G PG  G  G  G+PG  
Sbjct  660  GAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPGQS  719

Query  62   GCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNI--RGQKGEPGLDGVRGV  119
                  G PG HG  G  G +G  G SGEKG  G  A+    +  +G KGEPG  G+ G 
Sbjct  720  ----IKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEPGQTGMPGP  775

Query  120  PGSPGLPGLQGPPGTKGD------PGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQ  173
            PG  G PG +G  G KG+      PG+ GP G +G +G+KG+ G    G  G+ G  G +
Sbjct  776  PGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAV--GVPGNPGKDGLR  833

Query  174  GPPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGN---PGERGEPGYEGDAG  230
            G PG  G   P      +  GP G PG  G +GE+G+RG +G    PG  G  GY GD G
Sbjct  834  GIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRG  893

Query  231  MKGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPG  290
              G  G+ G PG  G  G  GP GP G  G  G  G+DG+ GR G KGEPG  G VG+PG
Sbjct  894  DAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPG  953

Query  291  LPGPQGPPGDN  301
              G +G PG++
Sbjct  954  NKGDRGAPGND  964


 Score = 122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 150/379 (40%), Positives = 178/379 (47%), Gaps = 72/379 (19%)

Query  1     MGFPGTEGLPG------PKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGI--------P  46
              GFPG +G PG       KG K EPGP G RG  G  G  G PG  G+PG+        P
Sbjct  1045  QGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWPGEKGLPGLAVHGRAGPP  1104

Query  47    GTQGPTGPIGLPGLDGCNGTDGVPGTHGFPGDPGPRG------IPGPSG-----------  89
             G +G  G  G+ G DG NG  G  G  G  G PG +G      IPG  G           
Sbjct  1105  GEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAP  1164

Query  90    -------EKGVKGEPAIS-RPNIRGQKGEPGLDGVRGVPGSPGLPGLQGPPG-------T  134
                    ++G KGEP +S  P ++G+ G  GL G  G PG  G  G++G PG        
Sbjct  1165  GAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDI  1224

Query  135   KGDPGLSGPSGQHGRKGDKGSMGLSY-EGAKGDKGDKGFQGPPGPPG------------P  181
             +GD G  G  G  G KG++G  GL+   G  G KGD+G QGPPG  G            P
Sbjct  1225  RGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGP  1284

Query  182   DKPYFHANETIIGPTGEPGQKGDRG------------ERGERGMSGNPGERGEPGYEGDA  229
                  +   TI G  G PG+ G  G            ERG  G++G PG  G PG  G A
Sbjct  1285  RGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPA  1344

Query  230   GMKGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLP  289
             G KGE+GL G PG  G+DGF G PG  G  G +G+ G  GL G  G KG+ G  G  G  
Sbjct  1345  GSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPS  1404

Query  290   GLPGPQGPPGDNLVYPGLK  308
             GLPG  G  GD   YPGL 
Sbjct  1405  GLPGLVGQKGDT-GYPGLN  1422


 Score = 120 bits (301),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 187/604 (31%), Positives = 248/604 (41%), Gaps = 118/604 (20%)

Query  2     GFPGTEGLPGPKGNKA---------EPGPQGPRGVKG-------------DRGKMGMPGF  39
             G PG  GLPG KG             PGP+G RG++G             D+G  G  G+
Sbjct  1177  GEPGLSGLPGLKGETGPVGLQGFTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGY  1236

Query  40    PGIPGIPGTQGPTGPIGLPGLDGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKG-----VK  94
              G  G  G +G TGP G+ G  G  G  G PG  G  G PG +G  GP GE G     +K
Sbjct  1237  TGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIK  1296

Query  95    GEPAI-SRPNIRGQKG---EPGLDGVRGVPGSPGLPGLQG------PPGTKGDPGLSGPS  144
             GE  +  RP   G++G    PGL G RG+PG  G PGL G      P G+KG+ GL+G  
Sbjct  1297  GEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSP  1356

Query  145   GQHGR---------KGDKGSMGLS-------YEGAKGDKGDKGFQGPPGPPG-------P  181
             GQ G+         KGD G  G         +EG KGDKGD+G QGP G PG        
Sbjct  1357  GQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDT  1416

Query  182   DKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGY---------EGDAGMK  232
               P  + N+  +G  GE G  G +G  G  G  G PG++GEPG           G  G  
Sbjct  1417  GYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPGMLPPPGPKGEPGQPGRN  1476

Query  233   GEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPK---GEPGRDGSVGLP  289
             G KG PG PG RG  G     G  G+KG+RG  G  G  GRPGPK   GEPG  G  G  
Sbjct  1477  GPKGEPGRPGERGLIGIQ---GERGEKGERGLIGETGNVGRPGPKGDRGEPGERGYEGAI  1533

Query  290   GLPGPQGPPG----DNLVYPGLKDLEVTQDCMGLKV---WMAFQEIQVREVLLDLLAGQE  342
             GL G +G PG      L Y  L  + +T+      V        E+     LL  + G +
Sbjct  1534  GLIGQKGEPGAPAPAALDY--LTGILITRHSQSETVPACSAGHTELWTGYSLL-YVDGND  1590

Query  343   YQVSQVQKDQLDLKETRATRVWQVWTVHLGVMARGVKRETRAMQEPEVLRETPFREFLDL  402
             Y  +Q      DL  +  + V +  T  L V++ G           +       + F   
Sbjct  1591  YAHNQ------DLG-SPGSCVPRFST--LPVLSCGQNNVCNYASRND-------KTFW--  1632

Query  403   LDPPVQSVNEVEMVVLEGMVFLDFRDQRETEEADVQIAGLDLRAIREKGDNREPQGFKDF  462
                 + +   + M+ +E +    +  +    EA   +  +  + I        P G++  
Sbjct  1633  ----LTTNAAIPMMPVENIEIRQYISRCVVCEAPANVIAVHSQTIEVP---DCPNGWEGL  1685

Query  463   GDWMGLLEYLVPLEEKGKLDVLLSFHQTLLEDFQETREIVVFQDRMDHQVLLVCLVLRDL  522
               W+G    +      G     L    + LEDF+ T  I        +     C     +
Sbjct  1686  --WIGYSFLMHTAVGNGGGGQALQSPGSCLEDFRATPFIEC------NGAKGTCHFYETM  1737

Query  523   LDLW  526
                W
Sbjct  1738  TSFW  1741


 Score = 116 bits (290),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 131/319 (41%), Positives = 157/319 (49%), Gaps = 50/319 (16%)

Query  1     MGFPGTEGLPGPKGNKAE------PGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGP  54
             MG PG  GL G KG++        PG  G  G  GDRG  G+PG  G PGI G +G  GP
Sbjct  856   MGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGP  915

Query  55    IGLPGLDGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIRGQKGEPGLD  114
             IG  G+    G  GVPG  G  G  G +G PG  G         +  P  +G +G PG D
Sbjct  916   IGPAGV---AGPPGVPGIDGVRGRDGAKGEPGSPG--------LVGMPGNKGDRGAPGND  964

Query  115   GVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLS-------------YE  161
             G +G  G  G PG +GP G    PG+S      G KGDKG+ GL+               
Sbjct  965   GPKGFAGVTGAPGKRGPAGI---PGVS------GAKGDKGATGLTGNDGPVGGRGPPGAP  1015

Query  162   GAKGDKGDKGFQGPPGPPGPD-KPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGER  220
             G  G KGD+G  G PG  G D  P    N+   G  G PG  GD  E+G++G  G  G R
Sbjct  1016  GLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLR  1075

Query  221   GEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPK---  277
             G+ G  G  G  GEKGLPG+       G AGPPG  G +G  G DG DG+ G  G +   
Sbjct  1076  GDTGPAGTPGWPGEKGLPGL----AVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQ  1131

Query  278   ---GEPGRDGSVGLPGLPG  293
                G+PG  GSVG PG+PG
Sbjct  1132  GVWGQPGEKGSVGAPGIPG  1150


 Score = 115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 132/320 (41%), Positives = 162/320 (51%), Gaps = 57/320 (18%)

Query  2     GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
             G PG +GL G  G   +PGP+G  G+    G MG PG  G+ G  G +GPTGPIG PG D
Sbjct  825   GNPGKDGLRGIPGRNGQPGPRGEPGIS-RPGPMGPPGLNGLQGEKGDRGPTGPIGFPGAD  883

Query  62    GCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPG  121
             G         + G+PGD G  G+PG SG  G+ GE        +G  G  G  GV G PG
Sbjct  884   G---------SVGYPGDRGDAGLPGVSGRPGIVGE--------KGDVGPIGPAGVAGPPG  926

Query  122   SPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGP  181
              PG+ G++G  G KG+PG  G  G  G KGD+G        A G+ G KGF G  G PG 
Sbjct  927   VPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRG--------APGNDGPKGFAGVTGAPG-  977

Query  182   DKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGE------------RGEPGYEGDA  229
                         GP G PG  G +G++G  G++GN G              G  G +G A
Sbjct  978   ----------KRGPAGIPGVSGAKGDKGATGLTGNDGPVGGRGPPGAPGLMGIKGDQGLA  1027

Query  230   GMKGEKGLPGIPGGRGRDGFAGPPGPPG------QKGDRGYDGLDGLGGRPGPKGEPGRD  283
             G  G++GL G+PG +G  GF G  GPPG      +KG +G  G  GL G  GP G PG  
Sbjct  1028  GAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDTGPAGTPGWP  1087

Query  284   GSVGLPGLP--GPQGPPGDN  301
             G  GLPGL   G  GPPG+ 
Sbjct  1088  GEKGLPGLAVHGRAGPPGEK  1107


 Score = 115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 138/358 (39%), Positives = 172/358 (48%), Gaps = 67/358 (19%)

Query  1     MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGI---------------  45
              G  G +G  G  G K E G QG  G  G++G +G PG PG PG+               
Sbjct  1110  QGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVGY  1169

Query  46    PGTQGPTGPIGLPGLDGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAI--SRPN  103
             PG +G  G  GL GL G  G  G  G  GF       G PGP GE+G++G+P +  + P+
Sbjct  1170  PGDRGDKGEPGLSGLPGLKGETGPVGLQGF------TGAPGPKGERGIRGQPGLPATVPD  1223

Query  104   IRGQKG---------------EPGLDGVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHG  148
             IRG KG               E GL G  GV G+ G  GLQGPPG  G  G+ G  G  G
Sbjct  1224  IRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIG  1283

Query  149   RKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKG-----  203
              +G+ G  G++ +G KG  G  G  G  G  G   P       + G  GEPG  G     
Sbjct  1284  PRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIG--APGLIGERGLPGLAGEPGLVGLPGPI  1341

Query  204   -DRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGF-------------  249
                G +GERG++G+PG+ G+ G+ G  G+KG+ G  G  G RG +GF             
Sbjct  1342  GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQ  1401

Query  250   --AGPPGPPGQKGDRGYDGLDGLGGRPGPKGE------PGRDGSVGLPGLPGPQGPPG  299
               +G PG  GQKGD GY GL+G  G  G  GE       GRDG  G PGLPG +G PG
Sbjct  1402  GPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG  1459


 Score = 115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 139/343 (41%), Positives = 168/343 (49%), Gaps = 45/343 (13%)

Query  1    MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGL  60
            +G PGT G  G  G K + G  G  G KGD G  G  G        G +G  G  GLPG+
Sbjct  530  LGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGI  589

Query  61   DGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIRGQKGEPG--------  112
             G +G  G PG  G+PG+ G  GI G +G  G KGE    R  + G  GEPG        
Sbjct  590  PGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGE--DGRTGLPGATGEPGKPALCDLS  647

Query  113  ----LDGVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGL-SYEGAKGDK  167
                L G +G PG+PG  G+QG  G +G PG+ GP G+ G KG+KG  G    +G  G  
Sbjct  648  LIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGLSGAPGNDGTPGRA  707

Query  168  GDKGFQGPPGPPGPDKPYFHANETI---------IGPTGEPGQ----------KGDRGER  208
            G  G+ G PG     +P FH  +            G  GEPG           KG++GE 
Sbjct  708  GRDGYPGIPGQSIKGEPGFHGRDGAKGDKGSFGRSGEKGEPGSCALDEIKMPAKGNKGEP  767

Query  209  GERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQK------GDR  262
            G+ GM G PGE G PG  G  G+KG  G  G PG  G  G  GP G  G +      G+ 
Sbjct  768  GQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPGVEGPRGLNGPRGEKGNQGAVGVPGNP  827

Query  263  GYDGLDGLGGR---PGPKGEPG--RDGSVGLPGLPGPQGPPGD  300
            G DGL G+ GR   PGP+GEPG  R G +G PGL G QG  GD
Sbjct  828  GKDGLRGIPGRNGQPGPRGEPGISRPGPMGPPGLNGLQGEKGD  870


 Score = 113 bits (283),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 147/375 (39%), Positives = 176/375 (47%), Gaps = 78/375 (21%)

Query  26    GVKGDRGKMGMPGFPGIPGIPGTQGPT------GPIGLPGLDGCNGTDGVPGTHGFPGDP  79
             G+KGD+G  G PG  G+ G+PG +G        GP GLPG     G  G PG  G  GD 
Sbjct  1019  GIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGLPGDASEKGQKGEPGPSGLRGDT  1078

Query  80    GPRGIP-----------------GPSGEKGVKGEPAIS-RPNIRGQKGEPGLDGV-----  116
             GP G P                 GP GEKG +G   I  R  I G+KGE GL GV     
Sbjct  1079  GPAGTPGWPGEKGLPGLAVHGRAGPPGEKGDQGRSGIDGRDGINGEKGEQGLQGVWGQPG  1138

Query  117   ----RGVPGSPGLPGLQ------------GPPGTKGDPGLSGPSGQHGRKGDKGSMGLS-  159
                  G PG PG PG+             G PG +GD G  G SG  G KG+ G +GL  
Sbjct  1139  EKGSVGAPGIPGAPGMDGLPGAAGAPGAVGYPGDRGDKGEPGLSGLPGLKGETGPVGLQG  1198

Query  160   YEGAKGDKGDKGFQGPPGPPG--PDKPYFHANETIIGPTGEPGQKGDR---------GER  208
             + GA G KG++G +G PG P   PD      ++   G TGE G++G+R         G +
Sbjct  1199  FTGAPGPKGERGIRGQPGLPATVPDIRGDKGSQGERGYTGEKGEQGERGLTGPAGVAGAK  1258

Query  209   GERGMSGNPGE---RGEPGYEGDAG-----------MKGEKGLPGIPGGRGRDGFAGPPG  254
             G+RG+ G PG     G PG +GD G           +KGEKGLPG PG  GR G  G PG
Sbjct  1259  GDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPG  1318

Query  255   PPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGL---PGLPGPQGPPGDNLVYPGLKDLE  311
               G++G  G  G  GL G PGP G  G  G  GL   PG PG  G PG     PGLK   
Sbjct  1319  LIGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPG----APGLKGDT  1374

Query  312   VTQDCMGLKVWMAFQ  326
               Q   G +    F+
Sbjct  1375  GPQGFKGERGLNGFE  1389


 Score = 108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 142/395 (36%), Positives = 166/395 (42%), Gaps = 114/395 (29%)

Query  5    GTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGP----------  54
            G  G PG +G +   GP G  G KGDRG+ G+ G PG PG  G  G  G           
Sbjct  331  GLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPP  390

Query  55   ---------------------IGLPGLDGCNGTDGVPGTHGF---------PGDPGPRGI  84
                                 +G PG  G NG DG+PG  G+         PG PG  G 
Sbjct  391  GPPGGGRGTPGPPGPKGPRGYVGAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGP  450

Query  85   PGPSGE------------------------KGVKGEPAI---------------SRPNIR  105
            PG  GE                        +G KG+  +                 P ++
Sbjct  451  PGKKGEKGTAGLNGPKGSIGPIGHPGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGYPGLK  510

Query  106  GQKGEPGLDGVRGVPGS-----PGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSY  160
            G KGE G  G  G PG      PG PG  G PG KGD G  G  GQ G  G KG +G   
Sbjct  511  GSKGERGFKGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKC  570

Query  161  EGAK-GDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGE  219
               + G KGDKG  G PG PG D           GP GE G  G+RG  G  G +G PGE
Sbjct  571  SSCRAGPKGDKGTSGLPGIPGKD--------GARGPPGERGYPGERGHDGINGQTGPPGE  622

Query  220  RGE------PGYEGDAG------------MKGEKGLPGIPGGRGRDGFAGP---PGPPGQ  258
            +GE      PG  G+ G            +KG+KG PG PG +G  GF G    PG PG 
Sbjct  623  KGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGP  682

Query  259  KGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPG  293
            KG+ G+ G  GL G PG  G PGR G  G PG+PG
Sbjct  683  KGEFGFKGEKGLSGAPGNDGTPGRAGRDGYPGIPG  717


 Score = 106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 134/323 (41%), Positives = 158/323 (49%), Gaps = 43/323 (13%)

Query  8    GLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLDGCNGTD  67
            G PGP+G     G  GP+G  G +G  G+PG PG  G PG +G  G  GL G  G  G  
Sbjct  413  GAPGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPI  472

Query  68   GVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAI-SRPNIRGQKGEPGLDGVRGVPGS----  122
            G PG  G  G  G  G+PG  G +G KG+  I   P ++G KGE G  G  G PG     
Sbjct  473  GHPGPPGPEGQKGDAGLPG-YGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPGDSKLG  531

Query  123  -PGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAK-GDKGDKGFQGPPGPPG  180
             PG PG  G PG KGD G  G  GQ G  G KG +G      + G KGDKG  G PG PG
Sbjct  532  RPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPG  591

Query  181  PDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGERGE------PGYEGDAG----  230
             D           GP GE G  G+RG  G  G +G PGE+GE      PG  G+ G    
Sbjct  592  KD--------GARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPAL  643

Query  231  --------MKGEKGLPGIPGGRGRDGFAGP---PGPPGQKGDRGYDGLDGLGGRPGPKGE  279
                    +KG+KG PG PG +G  GF G    PG PG KG+ G+ G  GL       G 
Sbjct  644  CDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL------SGA  697

Query  280  PGRDGSVGLPGLPGPQGPPGDNL  302
            PG DG+ G  G  G  G PG ++
Sbjct  698  PGNDGTPGRAGRDGYPGIPGQSI  720


 Score = 101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 132/342 (39%), Positives = 164/342 (48%), Gaps = 57/342 (17%)

Query  1     MGFPGTEG---LPGPKGNKAEPGPQGPRGVKGDRGKMG------MPGFPGIPGIPGTQGP  51
             +GFPG +G    PG +G+   PG  G  G+ G++G +G      + G PG+PGI G +G 
Sbjct  877   IGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGR  936

Query  52    TGP---------IGLPGLDGCNGTDGVPGTHGF------PGDPGPRGIPGPSGEKGVKGE  96
              G          +G+PG  G  G  G  G  GF      PG  GP GIPG SG KG KG 
Sbjct  937   DGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGA  996

Query  97    PAISRPN----------------IRGQKGEPGLDGVRGVPGSPGLPGLQGPPGTKGDPGL  140
               ++  +                I+G +G  G  G +G+ G PG  G QG PG  G PGL
Sbjct  997   TGLTGNDGPVGGRGPPGAPGLMGIKGDQGLAGAPGQQGLDGMPGEKGNQGFPGLDGPPGL  1056

Query  141   SGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPG  200
              G + + G+KG+ G  GL        +GD G  G PG PG       A     GP GE G
Sbjct  1057  PGDASEKGQKGEPGPSGL--------RGDTGPAGTPGWPGEKGLPGLAVHGRAGPPGEKG  1108

Query  201   QKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPP------G  254
              +G  G  G  G++G  GE+G  G  G  G KG  G PGIPG  G DG  G        G
Sbjct  1109  DQGRSGIDGRDGINGEKGEQGLQGVWGQPGEKGSVGAPGIPGAPGMDGLPGAAGAPGAVG  1168

Query  255   PPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQG  296
              PG +GD+G  GL GL   PG KGE G  G  G  G PGP+G
Sbjct  1169  YPGDRGDKGEPGLSGL---PGLKGETGPVGLQGFTGAPGPKG  1207


 Score = 100 bits (250),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 137/385 (36%), Positives = 174/385 (45%), Gaps = 94/385 (24%)

Query  5    GTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLDGCN  64
            G +G PG  G K EPGP+G  G+ G +G+ G+PG PG  G  G  GP      PG  G  
Sbjct  301  GQKGEPGLVGRKGEPGPEGDTGLDGQKGEKGLPGGPGDRGRQGNFGP------PGSTGQK  354

Query  65   GTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPN-----------------IRGQ  107
            G  G PG +G PG+PG +G PG +G  G  G      P                    G 
Sbjct  355  GDRGEPGLNGLPGNPGQKGEPGRAGATGKPGLLGPPGPPGGGRGTPGPPGPKGPRGYVGA  414

Query  108  KGEPGLDGVRGVPGS------------PGLPGLQGPPGTKGDPGLSGPSGQHG-------  148
             G  GL+GV G+PG             PG PG +GPPG KG+ G +G +G  G       
Sbjct  415  PGPQGLNGVDGLPGPQGYNGQKGGAGLPGRPGNEGPPGKKGEKGTAGLNGPKGSIGPIGH  474

Query  149  --------RKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPG  200
                    +KGD G  G   +G+KGD G  G+           P    ++   G  G  G
Sbjct  475  PGPPGPEGQKGDAGLPGYGIQGSKGDAGIPGY-----------PGLKGSKGERGFKGNAG  523

Query  201  QKGDR--GERGERGMSGNPGERGE------PGYEGD---------------AGMKGEKGL  237
              GD   G  G  G +G PG++G+      PG +GD               AG KG+KG 
Sbjct  524  APGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGT  583

Query  238  PGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQGP  297
             G+PG  G+DG  GPPG  G  G+RG+DG++G  G PG KGE GR       GLPG  G 
Sbjct  584  SGLPGIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRT------GLPGATGE  637

Query  298  PGDNLVYPGLKDLEVTQDCMGLKVW  322
            PG     P L DL + +   G K +
Sbjct  638  PGK----PALCDLSLIEPLKGDKGY  658


 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 157/334 (47%), Gaps = 57/334 (17%)

Query  10   PGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLDGCNGTDGV  69
             G KG+   PG     G++G +G  G+PG+PG+ G  G +G  G  G PG D   G  G 
Sbjct  481  EGQKGDAGLPG----YGIQGSKGDAGIPGYPGLKGSKGERGFKGNAGAPG-DSKLGRPGT  535

Query  70   PGTHGFPGDPGPRGIPGPSGEKG-------VKGEPAISRPNIRGQKGEPGLDGVRGVPGS  122
            PG  G PG  G  G PG  G+KG       V G+ +  R   +G KG  GL G+ G  G+
Sbjct  536  PGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGA  595

Query  123  PGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGL------------------------  158
             G PG +G PG +G  G++G +G  G KG+ G  GL                        
Sbjct  596  RGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGD  655

Query  159  -SYEGAKGDKGDKGFQGP---PGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMS  214
              Y GA G KG +GF+G    PG PGP   +    E  +  +G PG  G  G  G  G  
Sbjct  656  KGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKGL--SGAPGNDGTPGRAGRDGYP  713

Query  215  GNPGE--RGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPG-------QKGDRGYD  265
            G PG+  +GEPG+ G  G KG+KG        GR G  G PG           KG++G  
Sbjct  714  GIPGQSIKGEPGFHGRDGAKGDKGS------FGRSGEKGEPGSCALDEIKMPAKGNKGEP  767

Query  266  GLDGLGGRPGPKGEPGRDGSVGLPGLPGPQGPPG  299
            G  G+ G PG  G PG  G  GL G  GPQGPPG
Sbjct  768  GQTGMPGPPGEDGSPGERGYTGLKGNTGPQGPPG  801


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 120/314 (38%), Positives = 145/314 (46%), Gaps = 75/314 (24%)

Query  979   PAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGE  1038
             P  I  KG +GLPG  GP+G  G  G PG +G +G +G        G+PGP G  G KGE
Sbjct  82    PKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKG------QKGDPGPYGQRGDKGE  135

Query  1039  PGPLGPSGRPGLDGAPGLP---------------------GNDGFPGTPGEKGDQGAPGF  1077
                    G PGL G  G+P                     G DG PG  G  G  G  G+
Sbjct  136   ------RGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGY  189

Query  1078  ASEKGDKGD---------------------RGPSGLPGSPGIPGLKGDRGKD---GLPGP  1113
             A + G KG+                     RG +GL G  G PG KG+RG     G  GP
Sbjct  190   AGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGP  249

Query  1114  VGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPA----------GEKGDRGPPG  1163
              G  G  G+KG S    GP + G  G KG+KGEP  + P           G+ G +G PG
Sbjct  250   RGEHGLKGEKGASCY--GPMKPGAPGIKGEKGEPASSFPVKPTHTVMGPRGDMGQKGEPG  307

Query  1164  IPGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPGLS---GPPGSKGDRGFNGAPGSDG  1220
             + G  G+PG  G  GL    G+ GEKGL G PG  G     GPPGS G +G  G PG +G
Sbjct  308   LVGRKGEPGPEGDTGL---DGQKGEKGLPGGPGDRGRQGNFGPPGSTGQKGDRGEPGLNG  364

Query  1221  LPGTVGPQGNPGRS  1234
             LPG  G +G PGR+
Sbjct  365   LPGNPGQKGEPGRA  378


 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 106/206 (51%), Gaps = 23/206 (11%)

Query  105  RGQKGEPGLDGVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAK  164
            +G +G PG  G  G+ G  G PG++GP G KG  G  GP GQ G KG++GS GL      
Sbjct  88   KGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGL-----H  142

Query  165  GDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMS---GNPGERG  221
            G  G  G QGP G PG   P  +  +   G  G PG +G  G  G RG +   G+ GE+G
Sbjct  143  GQAGVPGVQGPAGNPG--APGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKG  200

Query  222  EPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPG  281
            EP  E     KGEKG PG    RG  G AGP G PG+KG+RG  G  G     GP+GE G
Sbjct  201  EPAKENGDYAKGEKGEPGW---RGTAGLAGPQGFPGEKGERGDSGPYGA---KGPRGEHG  254

Query  282  RDGSVGL-------PGLPGPQGPPGD  300
              G  G        PG PG +G  G+
Sbjct  255  LKGEKGASCYGPMKPGAPGIKGEKGE  280


 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 83/161 (52%), Gaps = 30/161 (19%)

Query  1098  IPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKG  1157
             +P    ++G  GLPGP+GP+G  G+ G       PG  G  G KG KG+PG     G+KG
Sbjct  81    VPKCIAEKGNRGLPGPLGPTGLKGEMGF------PGMEGPSGDKGQKGDPGPYGQRGDKG  134

Query  1158  DRGPPGI------------PGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPGLSGPPG  1205
             +RG PG+             G PG PG +G+DG  G  G PG +GLSG+PGP G +G  G
Sbjct  135   ERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLG  194

Query  1206  SKGD------------RGFNGAPGSDGLPGTVGPQGNPGRS  1234
             SKG+            +G  G PG  G  G  GPQG PG  
Sbjct  195   SKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEK  235


 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 69/130 (53%), Gaps = 17/130 (13%)

Query  166  DKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGY  225
            +KG++G  GP GP G           + GP+G+ GQKGD G  G+R   G+ GERG PG 
Sbjct  87   EKGNRGLPGPLGPTGLKGEMGFPG--MEGPSGDKGQKGDPGPYGQR---GDKGERGSPGL  141

Query  226  EGDA---GMKGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGR  282
             G A   G++G  G PG PG  G+DG           G  G  GL+GL G PGP+G  G+
Sbjct  142  HGQAGVPGVQGPAGNPGAPGINGKDGC---------DGQDGIPGLEGLSGMPGPRGYAGQ  192

Query  283  DGSVGLPGLP  292
             GS G  G P
Sbjct  193  LGSKGEKGEP  202


 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 56/99 (57%), Gaps = 0/99 (0%)

Query  201  QKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQKG  260
            +KG+RG  G  G +G  GE G PG EG +G KG+KG PG  G RG  G  G PG  GQ G
Sbjct  87   EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAG  146

Query  261  DRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQGPPG  299
              G  G  G  G PG  G+ G DG  G+PGL G  G PG
Sbjct  147  VPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPG  185


 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query  218  GERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPK  277
            G RG PG  G  G+KGE G PG+ G  G  G  G PGP GQ+GD+G  G  GL G+ G  
Sbjct  89   GNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVP  148

Query  278  GEPGRDGSVGLPGLPGPQGPPGDNLVYPGLKDLE  311
            G  G  G+ G PG+ G  G  G + + PGL+ L 
Sbjct  149  GVQGPAGNPGAPGINGKDGCDGQDGI-PGLEGLS  181


 Score = 43.1 bits (100),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 70/144 (49%), Gaps = 5/144 (3%)

Query  1     MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGL  60
             +G  G  G PG  GN    G  G RG  G +G+ G  G PG+PG    +G  G +  PG 
Sbjct  1410  VGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQ---KGEPGMLPPPGP  1466

Query  61    DGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVP  120
              G  G  G  G  G PG PG RG+ G  GE+G KGE  +      G  G PG  G RG P
Sbjct  1467  KGEPGQPGRNGPKGEPGRPGERGLIGIQGERGEKGERGLI--GETGNVGRPGPKGDRGEP  1524

Query  121   GSPGLPGLQGPPGTKGDPGLSGPS  144
             G  G  G  G  G KG+PG   P+
Sbjct  1525  GERGYEGAIGLIGQKGEPGAPAPA  1548


>CO4A2_CAEEL unnamed protein product
Length=1758

 Score = 593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/759 (56%), Positives = 482/759 (64%), Gaps = 66/759 (9%)

Query  746   GPKGEPGFAAGRGQKGERGFPG---LNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKG  802
             G KGE G AA  GQKG+ G PG   L G  G  G  G+PG +G+ G+ G+G+PG  G+KG
Sbjct  1021  GEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQPGQPGEKG  1080

Query  803   ERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQDGLPGPSGADGLPGPAGERGFPG  862
               G PG +G  G PG  G  GL GFPG KG++G PGQDGLPG    DGLPG  G++G  G
Sbjct  1081  LPGIPGKAGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPG---RDGLPGVPGQKGDLG  1137

Query  863   ENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPG---TSGAPGQKGDPGIAQQGI---  916
             ++G PGL G  G  G PG  G++GD+G  GLPG PG     G PGQKG+ G   Q     
Sbjct  1138  QSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPG  1197

Query  917   ----KGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERG  972
                 KG  G PGF G+KG  G  G  GLPG  G KGD GFPG PG++G  G  G  G  G
Sbjct  1198  LGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSGEKGMGG  1257

Query  973   FPGTPGPAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGSPGEPGPIGL  1032
              PG PG  G +  G  G PG PG  G  G PGLPG KGE+G  GLPGA G  GE G  G 
Sbjct  1258  LPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGLPGQKGESGLSGLPGAPGLKGESGMPGF  1317

Query  1033  AGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGL  1092
              G KG+ G  G  G+ G DG PG+PG DG PG PG KG+ G                +GL
Sbjct  1318  PGAKGDLGANGIPGKRGEDGLPGVPGRDGQPGIPGLKGEVGG---------------AGL  1362

Query  1093  PGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPP  1152
             PG PG PG+ G +G+ GLPG      FPG KG +G PG PG  G+ G KGD G PG    
Sbjct  1363  PGQPGFPGIPGLKGEGGLPG------FPGAKGEAGFPGTPGVPGYAGEKGDGGLPGLPGR  1416

Query  1153  AG--------------------EKGDRGPPGIPGGPGQPGSSGQDGL------PGSAGRP  1186
              G                    E G++G PG+PG PG  G  G  GL       G  G P
Sbjct  1417  DGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGPPGNDGPPGLP  1476

Query  1187  GEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVGPQGNPGRSCTQQPDYLTGIL  1246
             G++G  G PG PGLSG    KG  G  G PG DG PG  G  G PG      P Y  G +
Sbjct  1477  GQRGNDGYPGAPGLSG---EKGMGGLPGFPGLDGQPGGPGAPGLPGAPGAAGPAYRDGFV  1533

Query  1247  LVRHSQNTGVPACEPGHVKLWDGYSLLYIEGNEKAHHQDLGFAGSCVRRFSTMPFLFCDL  1306
             LV+HSQ T VP C  G  KLWDGYSLLYIEGNEK+H+QDLG AGSC++RFSTMPFLFCD 
Sbjct  1534  LVKHSQTTEVPRCPEGQTKLWDGYSLLYIEGNEKSHNQDLGHAGSCLQRFSTMPFLFCDF  1593

Query  1307  NNVCNYASRNDKSYWLSTNAPIPMMPVAETEIRQYISRCVVCEAPANVIAVHSQSNEIPS  1366
             NNVCNYASRN+KSYWLST+  IPMMPV E EI  YISRC VCEAPAN IAVHSQ+ +IP+
Sbjct  1594  NNVCNYASRNEKSYWLSTSEAIPMMPVNEREIEPYISRCAVCEAPANTIAVHSQTIQIPN  1653

Query  1367  CPSGWSGLWIGYSFVMYTAAGAEGGGQSLASPGSCLEDFRATPFIECNGARGTCHYFANK  1426
             CP+GWS LWIGYSF M+T AGAEGGGQS +SPGSCLEDFRATPFIECNGARG+CHYFANK
Sbjct  1654  CPAGWSSLWIGYSFAMHTGAGAEGGGQSPSSPGSCLEDFRATPFIECNGARGSCHYFANK  1713

Query  1427  YSFWLATIDDSLQFQRPESETLKSGTLRTRVSRCQVCIK  1465
             +SFWL TID+  +F+ PES+TLKSG LRTRVSRCQVC+K
Sbjct  1714  FSFWLTTIDNDSEFKVPESQTLKSGNLRTRVSRCQVCVK  1752


 Score = 189 bits (481),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 249/583 (43%), Positives = 281/583 (48%), Gaps = 109/583 (19%)

Query  742   QEGQGPKGEPGFAAGRGQKGER------GFPGLNGGPGA-----------PGADGIPGAR  784
             + G G  G+PGF    G KG+       G PGL G PG            PG  G+PG  
Sbjct  680   EAGYGQPGQPGFP---GAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLP  736

Query  785   GDKGVAGF-GRPGPSGQKGERGPPGLS---------------------------GFDGPP  816
             G KG  G+ GRPG  GQ G  G PG+                            G  G P
Sbjct  737   GTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIP  796

Query  817   GEKGNMGLAGFPGTKGDNGLPGQDGLPGPSGADGLPGPAGERGFPGENGGPGLPGDKGFP  876
             G KG++G  G PG  G  G PG  G+PG  G+ G PG  G+ G PG  G PGL G +GFP
Sbjct  797   GPKGDVGNPGLPGLNGQKGEPGV-GVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFP  855

Query  877   GLPGSNGLKGDRGPAGLPGGPGTSGAPGQKGDPGI-AQQGIKGEPGRPGFAGVKGDKGGV  935
             G P   GLKG  G  GL G PG  G  G  G PG+  ++G  G PG+ G  GV G KG  
Sbjct  856   GAP---GLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGED  912

Query  936   GFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGIT------------  983
             G  GLPG  G KGD G PG  G  G  GA G PG +G  G PG  G              
Sbjct  913   GLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPGLN  972

Query  984   -RKGEKGLPGLPGPSGTS------------GLPGLPGSKGETGFQGLPGASGSP------  1024
               KGE G+PG+PG  G              GL G+PG KG+ GF GLPG  G        
Sbjct  973   GPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAARD  1032

Query  1025  GEPGPIGLAGQKGEPGPLGPSGRPGL---DGAPGLPGNDGFPGTPGEKGDQGAPGFASEK  1081
             G+ G  GL GQ G  GP GPSG PG+    G  GLPG  G PG PGEKG  G PG A  +
Sbjct  1033  GQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGY-GQPGQPGEKGLPGIPGKAGRQ  1091

Query  1082  GDKGDRGPSGLPGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRK  1141
             G  G  G  GLPG PG+ G  G  G+DGLPG  G  G PG KG  G  G PG +G  G  
Sbjct  1092  GAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLD  1151

Query  1142  GDKGEPGYTPPAGEKGDRGPPGIPGG------PGQPGSSG------------QDGLPGSA  1183
             G  G PG     G+KG  G PGIPG       PGQ G +G            + G  G+ 
Sbjct  1152  GQPGVPGIR---GDKGQGGLPGIPGDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTP  1208

Query  1184  GRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVG  1226
             G PG KG  G PG  GL G PG KGD GF G PG +GLPG  G
Sbjct  1209  GFPGLKGSPGYPGQDGLPGIPGLKGDSGFPGQPGQEGLPGLSG  1251


 Score = 188 bits (478),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 242/551 (44%), Positives = 287/551 (52%), Gaps = 122/551 (22%)

Query  759   QKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKGERGP---------PGL  809
             +KG+ G PGL+G    PG DG+PG  G+KG AG+G+PG  G  G +G          PGL
Sbjct  653   EKGDAGLPGLSG---KPGQDGLPGLPGNKGEAGYGQPGQPGFPGAKGDGGLPGLPGTPGL  709

Query  810   SGFDGPPGEK--------GNMGLAGFPGTKGDNGLPGQDGLPGPSGADGLPGPAGERGFP  861
              G  G P  +        G  GL G PGTKG+ G PG+ G  G  G  GLPG  G+ G P
Sbjct  710   QGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEVGQPGFPGLPGMKGDSGLP  769

Query  862   GENGGPGLPG---DKGFPGLPGSNGLKGDRGPAGLPGGPGTSGAPGQKGDPGIAQQGIKG  918
             G  G PG PG   DKGF G+PG  G+ G +G  G PG PG +G   QKG+PG+   G+ G
Sbjct  770   GPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNG---QKGEPGV---GVPG  823

Query  919   EPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPG  978
             +PG PGF G+KGD      +GLPG          PG+PG +G         +RGFPG PG
Sbjct  824   QPGSPGFPGLKGD------AGLPG---------LPGTPGLEG---------QRGFPGAPG  859

Query  979   PAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGSPGEPGPIGL------  1032
                   KG  GLPGL      SG PG PG KG+ G  G+PG  GSPG PG  GL      
Sbjct  860   -----LKGGDGLPGL------SGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGLPGVPGM  908

Query  1033  AGQKGEPGPLGPS------GRPGLDGAPGLPGNDGFPGTPGEKGDQGAPGF---------  1077
              G+ G PG  G +      G PG  GAPGLPG  G+PG  G  G  G PGF         
Sbjct  909   KGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGL  968

Query  1078  ASEKGDKGDRGPSGLPGSP------------------GIPGLKGDRGKDGLP---GPVGP  1116
                 G KG+ G  G+PG+P                  G+PG+KGDRG +GLP   G  GP
Sbjct  969   PGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGP  1028

Query  1117  SGFPGDKGTSGIPGGP---------GQAGFDGRKGDKGEPGYTPPAGEKGDRGPPGIPGG  1167
             +   G KG +G+PG P         G  G  G KG+ G PGY  P G+ G++G PGIPG 
Sbjct  1029  AARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGYGQP-GQPGEKGLPGIPGK  1087

Query  1168  PGQ---PGSSGQDGLPGSAGRPGEKGL---SGLPGPPGLSGPPGSKGDRGFNGAPGSDGL  1221
              G+   PGS GQDGLPG  G  GE G     GLPG  GL G PG KGD G +G PG  G 
Sbjct  1088  AGRQGAPGSPGQDGLPGFPGMKGESGYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGA  1147

Query  1222  PGTVGPQGNPG  1232
             PG  G  G PG
Sbjct  1148  PGLDGQPGVPG  1158


 Score = 188 bits (477),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 250/627 (40%), Positives = 292/627 (47%), Gaps = 152/627 (24%)

Query  746   GPKGEPGFAAGRGQK-----GERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQ  800
             GPKGEPG+    GQ      G+ G PGL+G PG  G +G+PG RG  G +  G PG  GQ
Sbjct  443   GPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGVRGPPGDSLNGLPGAPGQ  502

Query  801   KGERGPPGLSGFDG------PPGEKGNMG---LAGFPGTKGDNGLPGQDGLPGPSGADGL  851
             +G  GP G  G DG       PG KG+ G    A  PGTKG+ GLPG  G PGP G  GL
Sbjct  503   RGAPGPNGYDGRDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGL  562

Query  852   PGPAGERGFPGENG------------------GPGLPGDKG-------------FPGLPG  880
             PG  G  G  G++G                   PGLPG KG             +PGL G
Sbjct  563   PGMPGPVGDAGDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKG  622

Query  881   SNGLKG------------------------DRGPAGLPGGPGTSGAPGQKGDPGI---AQ  913
              NG  G                        ++G AGLPG    SG PGQ G PG+     
Sbjct  623   ENGFPGQPGVDGLPGPSGPVGPPGAPGYPGEKGDAGLPG---LSGKPGQDGLPGLPGNKG  679

Query  914   QGIKGEPGRPGFAGVKGDKGGV------GFSGLPG-----------PQGEKGDRGFPGSP  956
             +   G+PG+PGF G KGD G        G  G+PG           P G+ G  G PG+ 
Sbjct  680   EAGYGQPGQPGFPGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTK  739

Query  957   GRDGFTGAQGSPGERGFPGTPGPAGITRK-------------------GEKGLPGLPGPS  997
             G  G+ G  G  G+ GFPG PG  G +                     G  GLPG+PGP 
Sbjct  740   GEGGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPK  799

Query  998   GTSGLPGLPGSKGETG--------------FQGLPGASGSPGEPGPIGLAGQKGEPGPLG  1043
             G  G PGLPG  G+ G              F GL G +G PG PG  GL GQ+G PG   
Sbjct  800   GDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPG---  856

Query  1044  PSGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGLKG  1103
                 PGL G  GLPG  G PG PGEKGD G PG    +G  G  G  GL   PG+PG+KG
Sbjct  857   ---APGLKGGDGLPGLSGQPGYPGEKGDAGLPGVPGREGSPGFPGQDGL---PGVPGMKG  910

Query  1104  DRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGY---------TPPAG  1154
             + G  GLPG  G  G  G  G SG PG PG  G+ G KG+ G PG              G
Sbjct  911   EDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGVPGFKGDGGLPGLPG  970

Query  1155  EKGDRGPPGIPGGPGQPG---------SSGQDGLPGSAGRPGEKGLSGLPGPPGLSGPPG  1205
               G +G PG+PG PG PG           G+DGL G  G  G++G +GLPG  G +GP  
Sbjct  971   LNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGMKGDRGFNGLPGEKGEAGPAA  1030

Query  1206  SKGDRGFNGAPGSDGLPGTVGPQGNPG  1232
               G +G  G PG  GL G  GP G PG
Sbjct  1031  RDGQKGDAGLPGQPGLRGPQGPSGLPG  1057


 Score = 186 bits (471),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 236/567 (42%), Positives = 263/567 (46%), Gaps = 151/567 (27%)

Query  780   IPGARGDKGVAGF-GRPGPSGQKGERGPPGLS-----------GFDGPPGEKGNMGLAGF  827
             IPGA G  G +G  G PGP G+ G RG PG S           G DG PG          
Sbjct  426   IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGR---------  476

Query  828   PGTKGDNGLPGQDGLPGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGD  887
                KG+NGLPG  G PG S  +GLPG  G+RG PG N   G  G  G  GLPG+ G KGD
Sbjct  477   ---KGENGLPGVRGPPGDS-LNGLPGAPGQRGAPGPN---GYDGRDGVNGLPGAPGTKGD  529

Query  888   RGPAGLPGGPGTSGAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEK  947
             RG        GT  A            G KGE G PG++G  G +G  G  G+PGP G+ 
Sbjct  530   RG--------GTCSA---------CAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDA  572

Query  948   GDRG------------------FPGSPG----------RDGFTGAQGSPGERGFPGTPG-  978
             GD G                  FPG PG          R G  G  G  GE GFPG PG 
Sbjct  573   GDDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTLRPGPPGYPGLKGENGFPGQPGV  632

Query  979   ---------------PAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGS  1023
                            P     KG+ GLPGL G  G  GLPGLPG+KGE G+ G PG  G 
Sbjct  633   DGLPGPSGPVGPPGAPGYPGEKGDAGLPGLSGKPGQDGLPGLPGNKGEAGY-GQPGQPGF  691

Query  1024  PGEPGPI---------GLAGQKGEPGPL-----GPSGRPGLDGAPGLPGNDGFPGTPGEK  1069
             PG  G           GL G  GEP P       P G+PGL G PG  G  G+PG PGE 
Sbjct  692   PGAKGDGGLPGLPGTPGLQGMPGEPAPENQVNPAPPGQPGLPGLPGTKGEGGYPGRPGEV  751

Query  1070  GDQGAPGFASEKGDK---------------GDRGPSGLPGSPGIPGLKGDRGKDGL----  1110
             G  G PG    KGD                GD+G  G+PG PGIPG KGD G  GL    
Sbjct  752   GQPGFPGLPGMKGDSGLPGPPGLPGHPGVPGDKGFGGVPGLPGIPGPKGDVGNPGLPGLN  811

Query  1111  ----------PGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGD---------------KG  1145
                       PG  G  GFPG KG +G+PG PG  G +G++G                 G
Sbjct  812   GQKGEPGVGVPGQPGSPGFPGLKGDAGLPGLPGTPGLEGQRGFPGAPGLKGGDGLPGLSG  871

Query  1146  EPGYTPPAGEKGDRGPPGIPGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPGLSGPPG  1205
             +PGY    GEKGD G PG+PG  G PG  GQDGLPG  G  GE GL GLPG  GL G  G
Sbjct  872   QPGYP---GEKGDAGLPGVPGREGSPGFPGQDGLPGVPGMKGEDGLPGLPGVTGLKGDLG  928

Query  1206  SKGDRGFNGAPGSDGLPGTVGPQGNPG  1232
             + G  G  G PG+ G PG  G  G PG
Sbjct  929   APGQSGAPGLPGAPGYPGMKGNAGIPG  955


 Score = 111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 168/341 (49%), Gaps = 58/341 (17%)

Query  4     PGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLDGC  63
             PG  GLPG  G K E       G  G  G++G PGFPG+PG+ G  G  GP GLPG  G 
Sbjct  727   PGQPGLPGLPGTKGE------GGYPGRPGEVGQPGFPGLPGMKGDSGLPGPPGLPGHPGV  780

Query  64    NGTDGVPGTHGFPGDPGPRG---IPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVP  120
              G  G  G  G PG PGP+G    PG  G  G KGEP +  P   G  G PGL G  G+P
Sbjct  781   PGDKGFGGVPGLPGIPGPKGDVGNPGLPGLNGQKGEPGVGVPGQPGSPGFPGLKGDAGLP  840

Query  121   GSPGLPGLQ------GPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQG  174
             G PG PGL+      G PG KG  GL G SGQ G  G+KG  GL   G  G +G  GF G
Sbjct  841   GLPGTPGLEGQRGFPGAPGLKGGDGLPGLSGQPGYPGEKGDAGLP--GVPGREGSPGFPG  898

Query  175   PPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGM---  231
               G PG   P     + + G  G  G KGD G  G+ G  G PG  G PG +G+AG+   
Sbjct  899   QDGLPG--VPGMKGEDGLPGLPGVTGLKGDLGAPGQSGAPGLPGAPGYPGMKGNAGIPGV  956

Query  232   ------------------KGEKGLPGIPGGRG------------RDGFAGPPGPPGQKGD  261
                               KGE G+PG+PG  G            RDG +   G PG KGD
Sbjct  957   PGFKGDGGLPGLPGLNGPKGEPGVPGMPGTPGMKGNGGLPGLPGRDGLS---GVPGMKGD  1013

Query  262   RGYDGLDGLGGRPGPKGEPGRDGSVGLPGLP---GPQGPPG  299
             RG++GL G  G  GP    G+ G  GLPG P   GPQGP G
Sbjct  1014  RGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSG  1054


 Score = 105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 168/285 (59%), Gaps = 20/285 (7%)

Query  2    GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
            GFPG EGL GPKG K   GP GP G+KGDRG +G+PGFPG  G  G  G  GP G PG D
Sbjct  63   GFPGPEGLAGPKGLKGAQGPPGPVGIKGDRGAVGVPGFPGNDGGNGRPGEPGPPGAPGWD  122

Query  62   GCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPG  121
            GCNGTDG PG  G PG PG  G PGP G  G+KGEPAI      G+KG+ G+ G+ G+PG
Sbjct  123  GCNGTDGAPGIPGRPGPPGMPGFPGPPGMDGLKGEPAIGYAGAPGEKGDGGMPGMPGLPG  182

Query  122  SPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGP  181
              G  G  G  G +GD G +GP G  G  G  G+ G+   G KGD GD G  GPPGPPGP
Sbjct  183  PSGRDGYPGEKGDRGDTGNAGPRGPPGEAGSPGNPGIGSIGPKGDPGDLGSVGPPGPPGP  242

Query  182  DKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIP  241
             +  F  + +I+GP G PG+KGD+GE GE G  G PG  G  G  G  GMKGEKGL G  
Sbjct  243  RE--FTGSGSIVGPRGNPGEKGDKGEPGEGGQRGYPGNGGLSGQPGLPGMKGEKGLSGPA  300

Query  242  GGRGRDGFAGPPGPPG------------------QKGDRGYDGLD  268
            G RG++G  G  GPPG                  QKG+ GY G D
Sbjct  301  GPRGKEGRPGNAGPPGFKGDRGLDGLGGIPGLPGQKGEAGYPGRD  345


 Score = 104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 129/302 (43%), Positives = 154/302 (51%), Gaps = 55/302 (18%)

Query  10    PGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLDGCNGTDGV  69
              GPKG                      PG PG+PG PG +G  G  GLPG DG +G  G+
Sbjct  972   NGPKGE---------------------PGVPGMPGTPGMKGNGGLPGLPGRDGLSGVPGM  1010

Query  70    PGTHGFPGDPGPRGIPGPSGEKGVKGEPAI-SRPNIRGQKGEPGLDGVRGVPGSPGLPGL  128
              G  GF G PG +G  GP+   G KG+  +  +P +RG +G  GL GV G  G  GLPG 
Sbjct  1011  KGDRGFNGLPGEKGEAGPAARDGQKGDAGLPGQPGLRGPQGPSGLPGVPGFKGETGLPGY  1070

Query  129   QGP--PGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYF  186
               P  PG KG PG+ G +G+ G  G  G  GL   G  G KG+ G+ G  G PG D    
Sbjct  1071  GQPGQPGEKGLPGIPGKAGRQGAPGSPGQDGLP--GFPGMKGESGYPGQDGLPGRD----  1124

Query  187   HANETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGR  246
                    G  G PGQKGD G+ G+ G+SG PG  G+PG  G  G KG+ GLPGIPG RG 
Sbjct  1125  -------GLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIPGDRGM  1177

Query  247   DGFAGPPGPPGQKGDRGY------------DGLDGLGGRPGPKGEPGRDGSVGLPGLPGP  294
             DG+      PGQKG+ GY             G  G  G PG KG PG  G  GLPG+PG 
Sbjct  1178  DGY------PGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGL  1231

Query  295   QG  296
             +G
Sbjct  1232  KG  1233


 Score = 89.7 bits (221),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 177/672 (26%), Positives = 244/672 (36%), Gaps = 158/672 (24%)

Query  2     GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
             G+PG +GLPG  G    PG +G  G  G  G  G PG  G PG+PG +G  G  GLPG+ 
Sbjct  1113  GYPGQDGLPGRDGLPGVPGQKGDLGQSGQPGLSGAPGLDGQPGVPGIRGDKGQGGLPGIP  1172

Query  62    GCNGTDGVPG------------------------THGFPGDPGPRGIPGPSGEKGVKGEP  97
             G  G DG PG                        T GFPG  G  G PG  G  G+ G  
Sbjct  1173  GDRGMDGYPGQKGENGYPGQPGLPGLGGEKGFAGTPGFPGLKGSPGYPGQDGLPGIPGLK  1232

Query  98    AIS-RPNIRGQKGEPGLDGVR--------------------------GVPGSPGLPGLQG  130
               S  P   GQ+G PGL G +                          G+ G  G PGL  
Sbjct  1233  GDSGFPGQPGQEGLPGLSGEKGMGGLPGMPGQPGQSIAGPVGPPGAPGLQGKDGFPGL--  1290

Query  131   PPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANE  190
              PG KG+ GLSG  G  G KG+ G  G  + GAKGD G  G            P     +
Sbjct  1291  -PGQKGESGLSGLPGAPGLKGESGMPG--FPGAKGDLGANGI-----------PGKRGED  1336

Query  191   TIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFA  250
              + G  G  GQ G  G +GE G +G P   G+PG+ G  G+KGE GLPG PG +G  GF 
Sbjct  1337  GLPGVPGRDGQPGIPGLKGEVGGAGLP---GQPGFPGIPGLKGEGGLPGFPGAKGEAGFP  1393

Query  251   GPPGPPGQKGDR-----------------------------------GYDGLDGLGGRPG  275
             G PG PG  G++                                   G  GL GL G PG
Sbjct  1394  GTPGVPGYAGEKGDGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPG  1453

Query  276   PKGE---PGRD---------------GSVGLPGLPGPQGPPGDNLV--YPGLKDLEVTQD  315
              +GE   PG D               G+ G PG PG  G  G   +  +PGL        
Sbjct  1454  LRGEKGMPGLDGPPGNDGPPGLPGQRGNDGYPGAPGLSGEKGMGGLPGFPGLDGQPGGPG  1513

Query  316   CMGLKVWMAFQEIQVREVLLDLLAGQEYQVSQVQKDQLDLKETRATRVWQVWTVHL--GV  373
               GL           R+  + +   Q  +V +  + Q        T++W  +++    G 
Sbjct  1514  APGLPGAPGAAGPAYRDGFVLVKHSQTTEVPRCPEGQ--------TKLWDGYSLLYIEGN  1565

Query  374   MARGVKRETRAMQEPEVLRETPFR--EFLDLLDPPVQSVNEVEMVVLEGMVFLDFRDQRE  431
                  +    A    +     PF   +F ++ +   ++     +   E +  +   ++RE
Sbjct  1566  EKSHNQDLGHAGSCLQRFSTMPFLFCDFNNVCNYASRNEKSYWLSTSEAIPMMPV-NERE  1624

Query  432   TE---------EADVQIAGLDLRAIREKGDNREPQGFKDFGDWMGLLEYLVPLEEKGKLD  482
              E         EA      +  + I+       P G+     W+G    +          
Sbjct  1625  IEPYISRCAVCEAPANTIAVHSQTIQIP---NCPAGWSSL--WIGYSFAMHTGAGAEGGG  1679

Query  483   VLLSFHQTLLEDFQETREIVVFQDRMDHQVLLVCLVLRDLLDLWDSAAKRAAKVTVVSQD  542
                S   + LEDF+ T  I     R        C    +    W +     ++  V    
Sbjct  1680  QSPSSPGSCLEDFRATPFIECNGARGS------CHYFANKFSFWLTTIDNDSEFKVPESQ  1733

Query  543   WTEDQEIRDSLA  554
               +   +R  ++
Sbjct  1734  TLKSGNLRTRVS  1745


 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 92/243 (38%), Positives = 110/243 (45%), Gaps = 55/243 (23%)

Query  69   VPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPGSPGLPGL  128
            +PG  G  G  G  G+PGP GE G +G P  S P + G+ G+PGLDG  G  G  GLPG+
Sbjct  426  IPGAPGVSGPSGIPGLPGPKGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKGENGLPGV  485

Query  129  QGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHA  188
            +GPPG                         S  G  G  G +G  GP G        +  
Sbjct  486  RGPPGD------------------------SLNGLPGAPGQRGAPGPNG--------YDG  513

Query  189  NETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIP---GGRG  245
             + + G  G PG KGDRG        G  GE+G PGY G  G +G++GLPG+P   G  G
Sbjct  514  RDGVNGLPGAPGTKGDRGGTCSACAPGTKGEKGLPGYSGQPGPQGDRGLPGMPGPVGDAG  573

Query  246  RDGFAGP---------------PGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPG  290
             DG  GP               PG PGQKG+     L     RPGP G PG  G  G PG
Sbjct  574  DDGLPGPAGRPGSPGPPGQDGFPGLPGQKGEPTQLTL-----RPGPPGYPGLKGENGFPG  628

Query  291  LPG  293
             PG
Sbjct  629  QPG  631


 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 67/121 (55%), Gaps = 15/121 (12%)

Query  1118  GFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGY--TPPAGEKGDRGPPGIPGGPGQPGSSG  1175
             G PG  G SGIPG PG          KGEPGY  TP     G  G  G PG  G PG  G
Sbjct  428   GAPGVSGPSGIPGLPGP---------KGEPGYRGTPGQSIPGLPGKDGKPGLDGAPGRKG  478

Query  1176  QDGLPGSAGRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVGPQGNPGRSC  1235
             ++GLPG  G PG+  L+GLPG PG  G PG     G++G  G +GLPG  G +G+ G +C
Sbjct  479   ENGLPGVRGPPGDS-LNGLPGAPGQRGAPGP---NGYDGRDGVNGLPGAPGTKGDRGGTC  534

Query  1236  T  1236
             +
Sbjct  535   S  535


 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 72/180 (40%), Positives = 87/180 (48%), Gaps = 49/180 (27%)

Query  1056  LPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGLKGDRGKDGLPGPVG  1115
             LPG  G  G PGEKGD+G      + G+ G RGP G  GSPG PG+          G +G
Sbjct  180   LPGPSGRDGYPGEKGDRG------DTGNAGPRGPPGEAGSPGNPGI----------GSIG  223

Query  1116  PSGFPGDKGTSGIPGGPGQAGFDGRK---GDKGEPGYTPPAGEKGDRGPPGIPGGPGQPG  1172
             P G PGD G+ G PG PG   F G     G +G PG      EKGD+G         +PG
Sbjct  224   PKGDPGDLGSVGPPGPPGPREFTGSGSIVGPRGNPG------EKGDKG---------EPG  268

Query  1173  SSGQDGLPGSAGRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAP---GSDGLPGTVGPQG  1229
               GQ G PG+ G  G+ GL            PG KG++G +G     G +G PG  GP G
Sbjct  269   EGGQRGYPGNGGLSGQPGL------------PGMKGEKGLSGPAGPRGKEGRPGNAGPPG  316


 Score = 48.1 bits (113),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 76/170 (45%), Positives = 90/170 (53%), Gaps = 17/170 (10%)

Query  748  KGEP--GFAAGRGQKGERGFPGLNGGPGAPGADGIPGA---RGDKGVAGFGRPGPSGQKG  802
            KGEP  G+A   G+KG+ G PG+ G PG  G DG PG    RGD G A  G  GP G+ G
Sbjct  155  KGEPAIGYAGAPGEKGDGGMPGMPGLPGPSGRDGYPGEKGDRGDTGNA--GPRGPPGEAG  212

Query  803  ERGPPGLSGFDGPPGEKGNMGLAGFPGT------KGDNGLPGQDGLPGPSGADGLPGPAG  856
              G PG+ G  GP G+ G++G  G PG        G   + G  G PG  G  G PG  G
Sbjct  213  SPGNPGI-GSIGPKGDPGDLGSVGPPGPPGPREFTGSGSIVGPRGNPGEKGDKGEPGEGG  271

Query  857  ERGFPGENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTSGAPGQK  906
            +RG+PG     GL G  G PG+ G  GL G  GP G  G PG +G PG K
Sbjct  272  QRGYPGNG---GLSGQPGLPGMKGEKGLSGPAGPRGKEGRPGNAGPPGFK  318


 Score = 38.1 bits (87),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 83/164 (51%), Gaps = 36/164 (22%)

Query  744   GQGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGF-GRPGPSGQKG  802
             G G  G+PGF    G KGE G PG             PGA+G+ G  G  G PG +G+KG
Sbjct  1359  GAGLPGQPGFPGIPGLKGEGGLPGF------------PGAKGEAGFPGTPGVPGYAGEKG  1406

Query  803   ERGPPGLSGFDG--------------------PPGEKGNMGLAGFPGTKGDNGLPGQDGL  842
             + G PGL G DG                     PGEKG  GL G PG +G+ G+PG DG 
Sbjct  1407  DGGLPGLPGRDGLPGADGPVGPPGPSGPQNLVEPGEKGLPGLPGAPGLRGEKGMPGLDGP  1466

Query  843   PGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKG  886
             PG  G  GLPG  G  G+PG    PGL G+KG  GLPG  GL G
Sbjct  1467  PGNDGPPGLPGQRGNDGYPGA---PGLSGEKGMGGLPGFPGLDG  1507


>CO4A1_CAEEL unnamed protein product
Length=1759

 Score = 526 bits (1356),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 375/783 (48%), Positives = 450/783 (57%), Gaps = 94/783 (12%)

Query  746   GPKGEPGFAAGRGQKGERGFPGLNGGPGAPG------------------------ADGIP  781
             G  G+PGF    G+ GE G PG  G PG PG                         DG+P
Sbjct  1006  GADGQPGFV---GEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLP  1062

Query  782   GARGDKGVAGFGRPGPSGQKGERGPPGLSGFD------------GPPGEKGNMGLAGFPG  829
             G  G++G  G   PG  G  G+ G  G  G D            G PG KG  GL G PG
Sbjct  1063  GLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPG  1122

Query  830   TKGDNGLPGQDGLPGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGDRG  889
              +G++G+PGQ GL G  G DG PG  G+ G+PG+ G     G+KG+PG+PG NGL G RG
Sbjct  1123  RQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQG---REGEKGYPGIPGENGLPGLRG  1179

Query  890   PAGLPGGPGTSGAPGQKGDPGIA-QQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKG  948
               G PG  G +G  GQ G PG A Q G  G+ G PG  G  GD G  G  G PG +GE G
Sbjct  1180  QDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESG  1239

Query  949   DRGFPGSPGRDGFTGAQGSPGERGFPGTPG------PAGITRKGEKGLPGLPGPSGTSGL  1002
               G PG PGRDG  G  G PG+ G+PG PG      P    + G  GL GLPG  G +G 
Sbjct  1240  QPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGE  1299

Query  1003  PG------------------LPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGP  1044
             PG                  LPG  GE G  GL G  G  G PG  G+ G +G PG  G 
Sbjct  1300  PGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGLEGD  1359

Query  1045  SGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGLKGD  1104
              G  G  GAPG PG++G+P      G++G PG   ++G  GD   +G PG+PG PG+KG 
Sbjct  1360  CGEDGYPGAPGAPGSNGYP------GERGLPGVPGQQGRSGD---NGYPGAPGQPGIKGP  1410

Query  1105  RGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPPGI  1164
             RG DG PG  G  G PG  G  G+PG    A                P G+ G+ G PG 
Sbjct  1411  RGDDGFPGRDGLDGLPGRPGREGLPGPMAMA-------------VRNPPGQPGENGYPGE  1457

Query  1165  PGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGT  1224
              G PG PG +G  G PG AG PG  G  G PGPPGLSG PG  GD+GF GA G  G PG 
Sbjct  1458  KGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGL  1517

Query  1225  VGPQGNPGRSCTQQPDYLTGILLVRHSQNTGVPACEPGHVKLWDGYSLLYIEGNEKAHHQ  1284
              G  G PG      P    G    +HSQ T VP C PG  +LW+GYSLLY++GN +A  Q
Sbjct  1518  PGTPGYPGSPGGWAPS--RGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASGQ  1575

Query  1285  DLGFAGSCVRRFSTMPFLFCDLNNVCNYASRNDKSYWLSTNAPI-PMM-PVAETEIRQYI  1342
             DLG  GSC+ +F+TMPF+FC++N+VC+ +SRND S+WLST+ P+ PMM PV  T IR YI
Sbjct  1576  DLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPYI  1635

Query  1343  SRCVVCEAPANVIAVHSQSNEIPSCPSGWSGLWIGYSFVMYTAAGAEGGGQSLASPGSCL  1402
             SRC VCE P  +IAVHSQ   +P CP GWSG+W GYSFVM+TAAGAEG GQSL SPGSCL
Sbjct  1636  SRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSCL  1695

Query  1403  EDFRATPFIECNGARGTCHYFANKYSFWLATIDDSLQFQRPESETLKSGTLRTRVSRCQV  1462
             E+FRA PFIEC+G RGTC+Y+A  + FWL+ +D   QF++P S+TLK+G L+ RVSRCQV
Sbjct  1696  EEFRAVPFIECHG-RGTCNYYATNHGFWLSIVDQDKQFRKPMSQTLKAGGLKDRVSRCQV  1754

Query  1463  CIK  1465
             C+K
Sbjct  1755  CLK  1757


 Score = 179 bits (453),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 236/580 (41%), Positives = 279/580 (48%), Gaps = 115/580 (20%)

Query  748   KGEPGFAAGRGQKGERGFPGLNGGPGAPGADGI-----------------------PGAR  784
              GEPG    RGQ+GE GF G++G  G PG DG                        PG  
Sbjct  781   HGEPGM---RGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPN  837

Query  785   GDKGVAGFGRPGPSGQKGERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGL------PG  838
             GD G AG   PGP G  G  G PG  G+ G  G  G  G  G PG++G++GL       G
Sbjct  838   GDAGAAGL--PGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKG  895

Query  839   QDGLPGPSGADGLPGPAGERGFPGENG---GPGLPGDKGFPGLPGSNGLKGDRGPAGLPG  895
             +DG PG  G DG PG +GE G PG+NG    PG PGD+G+PG PG +G  G   P+G+PG
Sbjct  896   RDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPG---PSGIPG  952

Query  896   GPGTSGAPGQKGDPG-------------IAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPG  942
               G  G PG +G+ G                +G+ G PG PG  G  G        GLPG
Sbjct  953   EDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDG------LPGLPG  1006

Query  943   PQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPG-------PAGITRKGEKGLPGLPG  995
               G+ G  G  G PG  G+ G  G PG   +PG PG              G+ GLPGL G
Sbjct  1007  ADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNG  1066

Query  996   PSGTSG-----LPGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGL  1050
               G +G      PGL G  G+ G+ GL G  G PG PG  G+ G KGE G  G  GR G 
Sbjct  1067  ERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGN  1126

Query  1051  DGAPGLPG------NDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPG---SPGIPGL  1101
             DG PG PG       DGFPG+PG+ G  G  G   EKG  G  G +GLPG     G PGL
Sbjct  1127  DGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPGLRGQDGQPGL  1186

Query  1102  KGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGP  1161
             KG+ G DG PG  G +G  G  G  G PG PG+ G +G +G  G+PG    +G+ G  G 
Sbjct  1187  KGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGL  1246

Query  1162  PG---------------IPGGPGQ-----PGSSGQDGLPGSAGRPGEKGLSGLPGPPG--  1199
             PG                PG PGQ     PG +GQDG PG  G PG  GL+G PG PG  
Sbjct  1247  PGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQY  1306

Query  1200  -------------LSGPPGSKGDRGFNGAPGSDGLPGTVG  1226
                          L G PG +G  G +G  G DGLPG  G
Sbjct  1307  GMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGLPGAPG  1346


 Score = 178 bits (451),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 237/609 (39%), Positives = 277/609 (45%), Gaps = 127/609 (21%)

Query  749   GEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKGERGPPG  808
             G PG+   +G +GE G+PG  G PG PG  G  G  G+ G+ G+   GP G  G+ G  G
Sbjct  415   GMPGYTE-KGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDG  473

Query  809   LSGFDGPPGEKGNMGLAGFPGT-------KGDNGLPGQDGLPGPSGADGLPGPAGERG--  859
               G  G  G+ G  G  GFPGT        G  GLPG+ G+PG  G DG PGP G  G  
Sbjct  474   FPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGER  533

Query  860   ----------FPGENGGPGLP---------------GDKGFPGLPGSNGLKGDRGPAGLP  894
                        PG  G PG P               GD G PG PG  G  G  G +G P
Sbjct  534   GEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSP  593

Query  895   GGPGTSGAPGQKGD--------------PGI-AQQGIKGEPGRPG---------------  924
             G PG  G PG KG+              PG+    G+ G PGRPG               
Sbjct  594   GLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNG  653

Query  925   ---------FAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPG  975
                       AG+ G +G  G  G+PG QG  GD  FPG PG  G+ G +G+ G  G PG
Sbjct  654   FPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDS-FPGQPGTPGYKGERGADGLPGLPG  712

Query  976   TPGPAGIT-----------RKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGASGSP  1024
               GP GI            + G  G+PGLPG  G  GLPGLPG  G  G+ G PG  G  
Sbjct  713   AQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMD  772

Query  1025  GEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTP-----------GEKGDQG  1073
             G PG  GL G+ G  G  G  G  G+DG  G PG DG+PG P           G  G  G
Sbjct  773   GLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVG  832

Query  1074  APGFASEKGDKGDRGPSGLPGSPGIPGLKGDRGKDGLPGPVGPSGFPGDKGTSGIPGGPG  1133
              PG   + G  G  GP G PG  G+PG  G  G+ G+ G  G  G PG +G SG+ G  G
Sbjct  833   YPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDG  892

Query  1134  QAGFDGRKGDKGE---PGYTPPAGEKGDRGPPGIPGGPGQ---PGSSGQDGLPGSAGRPG  1187
             + G DG  G +G+   PGY+  AG  G  G  G PG PG    PGS GQDG PG +G PG
Sbjct  893   KKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPG  952

Query  1188  EKGLSGLP------------------------GPPGLSGPPGSKGDRGFNGAPGSDGLPG  1223
             E GL G P                        G  G+ G PG  G  G  G PG+DG PG
Sbjct  953   EDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPG  1012

Query  1224  TVGPQGNPG  1232
              VG  G PG
Sbjct  1013  FVGEAGEPG  1021


 Score = 177 bits (448),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 254/608 (42%), Positives = 295/608 (49%), Gaps = 108/608 (18%)

Query  746   GPKGEPGFAAGRGQKGERGFPGLN---------------GGPGAPGADGIPGA-----RG  785
             GP G  GF    G +G +G PG +               G PG PG DG+PG      RG
Sbjct  370   GPHGAQGF---DGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRG  426

Query  786   DKGVAGF-GRPGPSGQKGERGPP---GLSGFD--GPPGEKGNMGLAGFPGTKGDNGLP--  837
             + G  GF G PG  G+ G+ G P   GL G+D  GPPG  G  G  GFPG  GD G P  
Sbjct  427   EDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGY  486

Query  838   -GQDGLPGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGD---RGPAGL  893
              G+ G PG +G + + GP G  G PGE G PG  G  G+PG PG+NG +G+     P G+
Sbjct  487   SGEKGFPG-TGVNKV-GPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGV  544

Query  894   PGGP---------------------GTSGAPGQKGDPGIA-QQGIKGEPGRPGFAGVKGD  931
             PG                       G  G PG  G PG A   G+ G PG PG  G  G 
Sbjct  545   PGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGM  604

Query  932   KGGVGF--------SGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFP---GTPGPA  980
             KG  G         +G+PG +G+ G  G PG PG DG  G  G PG+ GFP   G PG A
Sbjct  605   KGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLA  664

Query  981   GIT----RKGEKGLPGLPGPSGTS--GLPGLPGSKGE---TGFQGLPGASGSPGEPGPIG  1031
             GI     R+G  G+PGL GP G S  G PG PG KGE    G  GLPGA G  G P P+ 
Sbjct  665   GIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLR  724

Query  1032  LAGQ-KGEPGPLGPSGRP---GLDGAPGLP---GNDGFPGTPGEKGDQGAPGFASEKGDK  1084
             +  Q  G+PG  G  G P   G DG PGLP   G DG+PGTPGE+G  G PGF    G+ 
Sbjct  725   IVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEP  784

Query  1085  GDRGPSGLPGSPGIPGLKGDRGKD-----------------GLPGPVGPSGFPGDKGTSG  1127
             G RG  G  G  GI G  G+ G D                 G PG V   G+PG  G +G
Sbjct  785   GMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQV---GYPGPNGDAG  841

Query  1128  IPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPPGIPGGPGQPGSSGQDGLPGSAGRPG  1187
               G PG  G+ GR G  G PGY   AG  G  G PG PG  G+ G  G DG  G  G PG
Sbjct  842   AAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPG  901

Query  1188  EKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVGPQGNPGRSCTQQPDYLTGILL  1247
              +G  G PG  G +G PG  G  G+ GAPG  G PG+ G  G PG S     D L G   
Sbjct  902   TRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPG  961

Query  1248  VR--HSQN  1253
             +R  H  N
Sbjct  962   LRGEHGDN  969


 Score = 174 bits (440),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 228/548 (42%), Positives = 268/548 (49%), Gaps = 109/548 (20%)

Query  745   QGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQKGER  804
             +G +G PGF    G+ G  G PG +G  GAPGA G+ GA GD     FG  G  G +G+R
Sbjct  45    KGERGNPGFG---GEPGHPGAPGQDGPEGAPGAPGMFGAEGD-----FGDMGSKGARGDR  96

Query  805   ------GPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQDGLPGPSGADGLPGPAGER  858
                   G PGL G DG PG KG  G+ G  GT G  G+PG  G PG SG +G PG  G  
Sbjct  97    GLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLS  156

Query  859   GFPGE-----------------NGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTSG  901
             G PGE                 +G PGLPG+ G+PGL    G KGD GP GLPG PG SG
Sbjct  157   GPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGL---KGAKGDPGPYGLPGFPGVSG  213

Query  902   APGQKGDPGIAQQGIKGEP----------------------------GRPGFAGVKGDKG  933
                 KG  G+   G+KGE                             G  G AGVKG+KG
Sbjct  214   L---KGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKG  270

Query  934   GVGFSGLPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGL  993
               G  G PG  G  G  G+PG  G+ G  G  G  G+RG  G PG       GEKG  G 
Sbjct  271   RDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPG-----NYGEKGSQGE  325

Query  994   PGPSGTSGLPGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGA  1053
              G  GT G PG  G  GE G+ G PG  G  G  GP+G     GE GP G  G  G+ G 
Sbjct  326   QGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEG--TGEAGPHGAQGFDGVQGG  383

Query  1054  PGLPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGL-----KGDRGKD  1108
              GLPG+DG PG  G +G  GAP               G PG PGI G+     KGDRG+D
Sbjct  384   KGLPGHDGLPGPVGPRGPVGAP---------------GAPGQPGIDGMPGYTEKGDRGED  428

Query  1109  GLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPPGIPGGP  1168
             G PG  G  G PG+ G  G PG  G  G+D     +G PG     G+ G  G PGIPG  
Sbjct  429   GYPGFAGEPGLPGEPGDCGYPGEDGLPGYD----IQGPPGLD---GQSGRDGFPGIPGDI  481

Query  1169  GQPGSSGQDGLPGS-AGRPGEKGLSGLPGPPGL---------SGPPGSKGDRGFNGAPGS  1218
             G PG SG+ G PG+   + G  G++GLPG PG+          GPPG+ G+RG +     
Sbjct  482   GDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCP  541

Query  1219  DGLPGTVG  1226
             DG+PG  G
Sbjct  542   DGVPGNAG  549


 Score = 171 bits (432),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 226/551 (41%), Positives = 262/551 (48%), Gaps = 92/551 (17%)

Query  780   IPGARGDKGVAGFG----RPGPSGQKGERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNG  835
              PG +G++G  GFG     PG  GQ G  G PG  G  G  G+ G+MG  G    +GD G
Sbjct  41    CPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKG---ARGDRG  97

Query  836   LPGQDGLPGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPG  895
             LPG  G PG  G DGLPG  GE G PG NG        GFPG+PG  G  G  G  G PG
Sbjct  98    LPGSPGHPGLQGLDGLPGLKGEEGIPGCNG------TDGFPGMPGLAGPPGQSGQNGNPG  151

Query  896   GPGTSGAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGS  955
              PG SG PG+ G     ++G+KGE GR G  G+ G+    G+ GL G +G+ G  G PG 
Sbjct  152   RPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNS---GYPGLKGAKGDPGPYGLPGF  208

Query  956   PGRDGFTGAQG------------------SPGERGFP------------GTPGPAGITRK  985
             PG  G  G  G                        +P            G  GPAG+  K
Sbjct  209   PGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGV--K  266

Query  986   GEKGLPGLPGPSGTSGL---PGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPL  1042
             GEKG  G  GP G  GL   PG PG KG+ G  G  G  G  G+ G  G  G+KG  G  
Sbjct  267   GEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQ  326

Query  1043  GPSGRPGLDGAPGLPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGLK  1102
             G  G PG  G  G  G  G+PG PG +GD G  G   E    G+ GP G  G  G+ G K
Sbjct  327   GLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEG--TGEAGPHGAQGFDGVQGGK  384

Query  1103  GDRGKDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFDGRKGDKGEPGYTPPAGEKGDRGPP  1162
             G  G DGLPGPVGP      +G  G PG PGQ G DG       PGYT    EKGDRG  
Sbjct  385   GLPGHDGLPGPVGP------RGPVGAPGAPGQPGIDGM------PGYT----EKGDRGED  428

Query  1163  GIPGGPGQPGSSGQDGLPGSAGRPGEKGLSG--LPGPPGLSGPPGSKGDRGFNGAPGSDG  1220
             G PG  G+PG  G+   PG  G PGE GL G  + GPPGL    G  G  GF G PG  G
Sbjct  429   GYPGFAGEPGLPGE---PGDCGYPGEDGLPGYDIQGPPGLD---GQSGRDGFPGIPGDIG  482

Query  1221  LPGTVGPQGNPGRSCTQQPDYLTGILLVRHSQNTGVPA--CEPGHVKLWDGYSLLYIEGN  1278
              PG  G +G PG          TG+  V     TG+P     PG + + DGY      GN
Sbjct  483   DPGYSGEKGFPG----------TGVNKVGPPGMTGLPGEPGMPGRIGV-DGYP--GPPGN  529

Query  1279  EKAHHQDLGFA  1289
                  +D G+ 
Sbjct  530   NGERGEDCGYC  540


 Score = 169 bits (427),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 248/658 (38%), Positives = 286/658 (43%), Gaps = 170/658 (26%)

Query  745   QGPKGEPGFAAGRGQKGERGFPG---LNGGPGAP------------------GADGIPGA  783
             QGP G  G    +G+ G  G PG   L+G PG P                  G DG+PG 
Sbjct  257   QGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGN  316

Query  784   RGDKGVAGF-------GRPGPSGQKGERGPPGLSGFDGP----------PGEKGNMGLAG  826
              G+KG  G        G PG  G  GE G PG  GF+G            GE G  G  G
Sbjct  317   YGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQG  376

Query  827   FPGTKGDNGLPGQDGLPGP-----------------------------SGADGLPGPAGE  857
             F G +G  GLPG DGLPGP                              G DG PG AGE
Sbjct  377   FDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGE  436

Query  858   RGFPGENGGPGLPGDKGFPG--LPGSNGLKGDRGPAGLPGGPGTSGAPGQKGDPGIAQQG  915
              G PGE G  G PG+ G PG  + G  GL G  G  G PG PG  G PG  G+ G    G
Sbjct  437   PGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTG  496

Query  916   IK--GEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDR---------GFPGSPGRDGFT--  962
             +   G PG  G  G  G  G +G  G PGP G  G+R         G PG+ G  GF   
Sbjct  497   VNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGM  556

Query  963   -------------GAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGPSGTSGL-------  1002
                          G  G PG  G PG+ G  G++  G  GLPG+PG  G  G        
Sbjct  557   NGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLS--GSPGLPGIPGYPGMKGEAGEIVGP  614

Query  1003  ----PGLPGSKGETGFQGLPGASGS---------------PGEPGPIGLAGQKGEPGPLG  1043
                  G+PG KG+ G  GLPG  GS               PG  G  GLAG  G+ G  G
Sbjct  615   MENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQG  674

Query  1044  PSGRPGLDGAPG--LPGNDGFPGTPGEKGDQGAPGFASEKGDKGDRGP-------SGLPG  1094
               G PGL G PG   PG  G PG  GE+G  G PG    +G +G   P       +G PG
Sbjct  675   SLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPG  734

Query  1095  SPGIPGLKGDRGKD---GLPGPVGPSGF---PGDKGTSGIPGGP------------GQAG  1136
               G+PGL GDRG D   GLPGPVGP G+   PG++G  G+PG P            G+ G
Sbjct  735   VDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVG  794

Query  1137  FDGRKGDKGEP--------------------GYTPPAGEKGDRGPPGIPGGPGQPGSSGQ  1176
             F+G  GD GEP                    G+    G  G  G  G  G PG  G  G+
Sbjct  795   FNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGR  854

Query  1177  DGLPGSAGRPGEKGLSGLPGPPGLSGPPGSKGDRGFNGAPGSDGLPGTVGPQGNPGRS  1234
             DGLPG+ G PGE G++G  G PG  G  G  G  G +G  G DG PGT G  G PG S
Sbjct  855   DGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGPGYS  912


 Score = 158 bits (400),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 242/666 (36%), Positives = 293/666 (44%), Gaps = 144/666 (22%)

Query  668   VSLVSLATRVNLAKEELTDYREKRETEDFLLLWDHLDPRVRQAFPEAKASKASPVFLENP  727
             +SL+ L   V L    L+ + + R   D         P      P  K  + +P F   P
Sbjct  4     LSLLGLTAAVVL----LSSFCQDRIHVDAAAACKGCAPPC--VCPGTKGERGNPGFGGEP  57

Query  728   DV--LDFQDSQATRVTQEGQ-GPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGAR  784
                    QD         G  G +G+ G    +G +G+RG PG  G PG  G DG+PG +
Sbjct  58    GHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLK  117

Query  785   GDKGVAGF----------GRPGPSGQKGERGPPGLSGFDGPPGEKGNM------------  822
             G++G+ G           G  GP GQ G+ G PG  G  GPPGE G              
Sbjct  118   GEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESG  177

Query  823   --------GLAGFPGTKGDNGLPGQDGLPGPSGADGLP----------------------  852
                     G +G+PG KG  G PG  GLPG  G  GL                       
Sbjct  178   RSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGP  237

Query  853   -----------------------GPA---GERGFPGENGGPGLPGDKGFPGLPGSNGLKG  886
                                    GPA   GE+G  G  G PG+ G  G PG PG  G KG
Sbjct  238   PGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKG  297

Query  887   DRGPAGLPGGPGTSGAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGE  946
             D G AG  G  G  G PG  G+ G   QG +G  G PG+ G KG  G  G+ G PG +G+
Sbjct  298   DLGDAGQRGKRGKDGVPGNYGEKG--SQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGD  355

Query  947   ----------KGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGP  996
                        G+ G  G+ G DG  G +G PG  G PG  GP     +G  G PG PG 
Sbjct  356   CGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGP-----RGPVGAPGAPGQ  410

Query  997   SGTSGLPGLP--GSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAP  1054
              G  G+PG    G +GE G+ G  G  G PGEPG  G  G+ G PG     G PGLDG  
Sbjct  411   PGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPG-YDIQGPPGLDGQ-  468

Query  1055  GLPGNDGFPGTPGEKGDQGAPGFASEKGDKG----DRGPSGLPGSPGIPGLKGDRGKDGL  1110
                G DGFPG PG+ GD   PG++ EKG  G      GP G+ G PG PG+ G  G DG 
Sbjct  469   --SGRDGFPGIPGDIGD---PGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGY  523

Query  1111  PGPVGPSGFPGDKGTSGIPGGPGQAGF--DGRKGDKGEPGY------TPPAGEKGDRGPP  1162
             PGP      PG+ G  G        G+  DG  G+ G+PG+        P G  GD G  
Sbjct  524   PGP------PGNNGERGE-----DCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDC  572

Query  1163  GIPGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPG-LSGP-------PGSKGDRGFNG  1214
             G+PG PG+PGS+G DGL GS G PG  G  G+ G  G + GP       PG KGD G  G
Sbjct  573   GMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPG  632

Query  1215  APGSDG  1220
              PG  G
Sbjct  633   LPGRPG  638


 Score = 148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 247/620 (40%), Positives = 288/620 (46%), Gaps = 123/620 (20%)

Query  741   TQEGQGPKGEPGFAAGRGQKGERGFPGLNGGPGAPGADGIPGARGDKGVAGFGRPGPSGQ  800
             +Q  +G KGE G +   G  G  G+PGL G  G PG  G+PG  G  G+ G      SG 
Sbjct  166   SQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGV  225

Query  801   KGE----------------------------RGPPGLSGF------DGPPGEKGNMGL--  824
             KGE                            +GP G +G       DGP G  G +GL  
Sbjct  226   KGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDG  285

Query  825   -AGFPGTKGDNGLPGQDGLPGPSGADGLPGPAGERGFPGEN---GGPGLPGDK---GFPG  877
               G+PG KG  G  G  G  G  G DG+PG  GE+G  GE    G PG PG K   G PG
Sbjct  286   PPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPG  345

Query  878   LPGSNGLKGDRGPAG-LPGGPGTSGAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVG  936
              PG  G +GD GP G L  G G +G  G +G  G+  QG KG PG  G  G  G +G VG
Sbjct  346   YPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGV--QGGKGLPGHDGLPGPVGPRGPVG  403

Query  937   FSGLPGPQG--------EKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEK  988
               G PG  G        EKGDRG  G P   GF G  G PGE G  G PG  G+     +
Sbjct  404   APGAPGQPGIDGMPGYTEKGDRGEDGYP---GFAGEPGLPGEPGDCGYPGEDGLPGYDIQ  460

Query  989   GLPGLPGPSGTSGLPGLPGSKGETGFQGL-------------PGASGSPGEPGPIGLAGQ  1035
             G PGL G SG  G PG+PG  G+ G+ G              PG +G PGEPG  G  G 
Sbjct  461   GPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGV  520

Query  1036  KGEPGPLGPSGRPGLDGA---PGLPGNDGFPG------------TPGEKGDQGAPGFASE  1080
              G PGP G +G  G D      G+PGN G PG              G+ GD G PG   +
Sbjct  521   DGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGK  580

Query  1081  KGDKGDRGPSGLPGSPGIPGLKGDRGKDG-LPGPV-GPSGFPGDKGTSGIPGGPGQAGFD  1138
              G  G  G SG PG PGIPG  G +G+ G + GP+  P+G PG KG  G+PG PG+ G D
Sbjct  581   PGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSD  640

Query  1139  GRK------------GDKGEPGYTPPAGEKGDRGPPGIPGGPGQPGSS--GQDGLPGSAG  1184
             G              G +GEPG     G++G +G  GIPG  G PG S  GQ G PG  G
Sbjct  641   GLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKG  700

Query  1185  RPGEKGLSGLPGP-------------------PGLSGPPGSKGDRGFNGAPGSDGLPGTV  1225
               G  GL GLPG                    PG+ G PG  GDRG +G P   GLPG V
Sbjct  701   ERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLP---GLPGPV  757

Query  1226  GPQGNPGRSCTQQPDYLTGI  1245
             GP G PG    +  D L G 
Sbjct  758   GPDGYPGTPGERGMDGLPGF  777


 Score = 125 bits (313),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 160/408 (39%), Positives = 188/408 (46%), Gaps = 101/408 (25%)

Query  884   LKGDRGPAGLPGGPGTSGAPGQKGDPGI----AQQGIKGEPGRPGFAGVKGDKGGVGFSG  939
              KG   P   PG  G  G PG  G+PG      Q G +G PG PG  G +GD G +G   
Sbjct  32    CKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGS--  89

Query  940   LPGPQGEKGDRGFPGSPGRDGFTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGPSGT  999
                 +G +GDRG PGSPG  G  G  G PG +G  G PG       G  G PG+P     
Sbjct  90    ----KGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPG-----CNGTDGFPGMP-----  135

Query  1000  SGLPGLPGSKGETGFQGLPGASGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGN  1059
              GL G PG  G+ G  G PG SG PGE G +   G+KG        G  G  G PGLPGN
Sbjct  136   -GLAGPPGQSGQNGNPGRPGLSGPPGE-GGVNSQGRKGV------KGESGRSGVPGLPGN  187

Query  1060  DGFPGTPGEKGDQGAPGFASEKGDKGDRGPSGLPGSPGIPGLKGDRG-------------  1106
              G+PG                KG KGD GP GLPG PG+ GLKG  G             
Sbjct  188   SGYPGL---------------KGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLP  232

Query  1107  --------------------KDGLPGPVGPSGFPGDKGTSGIPGGPGQAGFD---GRKGD  1143
                                  + L GPVGP+G  G+KG  G  G PG  G D   G  G 
Sbjct  233   GPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGL  292

Query  1144  KGEPGYTPPAGEKGDRGPPGIPGGPGQPGSSGQDGLPGSAGRPGEKGLSGLPGPPGL---  1200
             KG+ G    AG++G RG  G+PG  G+ GS G+ GL G+ G PG KG +G PG PG    
Sbjct  293   KGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGF  352

Query  1201  -------------SGPPGSKGDRGFNGA------PGSDGLPGTVGPQG  1229
                          +G  G  G +GF+G       PG DGLPG VGP+G
Sbjct  353   EGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRG  400


 Score = 112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 149/347 (43%), Positives = 172/347 (50%), Gaps = 26/347 (7%)

Query  724   LENPDVLDFQDSQATRVTQEGQGPKGEPGFAAGRGQKGERGFPG---LNGGPGAPGADGI  780
             L  P  + +  +         QG  G+PG     GQ G+ G PG     G  G PG DG 
Sbjct  1205  LGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGY  1264

Query  781   PGARGDKGVAGFGRPGPSGQKGERGPPGLSGFDGPPGEKGNMGLAGFPGTKGDNGLPGQD  840
             PGA G          GP GQ G+ G PGL G  G PG  G  G  G  G  G  G PG+ 
Sbjct  1265  PGAPGQDIY------GPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGES  1318

Query  841   GLPGPSGADGLPGPAGERGFPGENGGPGLPGDKGFPGLPGSNGLKGDRGPAGLPGGPGTS  900
             GLPG  G  GLPG  G+RG  G  G PG+PG +G PGL    G  G+ G  G PG PG++
Sbjct  1319  GLPGYPGERGLPGLDGKRGHDGLPGAPGVPGVEGVPGL---EGDCGEDGYPGAPGAPGSN  1375

Query  901   GAPGQKGDPGIAQQGIKGEPGRPGFAGVKGDKGGVGFSGLPGPQGEKGDRGFPGSPGRDG  960
             G PG++G PG+           PG  G  GD G  G  G PG +G +GD GF   PGRDG
Sbjct  1376  GYPGERGLPGV-----------PGQQGRSGDNGYPGAPGQPGIKGPRGDDGF---PGRDG  1421

Query  961   FTGAQGSPGERGFPGTPGPAGITRKGEKGLPGLPGPSGTSGLPGLPGSKGETGFQGLPGA  1020
               G  G PG  G PG    A     G+ G  G PG  G  GLPG  G  G  G  G PGA
Sbjct  1422  LDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGA  1481

Query  1021  SGSPGEPGPIGLAGQKGEPGPLGPSGRPGLDGAPGLPGNDGFPGTPG  1067
              G+ G PGP GL+G  G  G  G  G  G  G PGLPG  G+PG+PG
Sbjct  1482  PGTDGYPGPPGLSGMPGHGGDQGFQGAAGRTGNPGLPGTPGYPGSPG  1528


 Score = 111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 144/354 (41%), Positives = 167/354 (47%), Gaps = 70/354 (20%)

Query  2    GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
            G PG  G PG  G +  PG  G  G +GD G MG  G  G  G+PG+ G  G  GL GL 
Sbjct  55   GEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLP  114

Query  62   GCNGTDGVP---GTHGFPGDPGPRGIPGPSGEKGVKGEPAISRP---------NIRGQKG  109
            G  G +G+P   GT GFPG PG  G PG SG+ G  G P +S P           +G KG
Sbjct  115  GLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKG  174

Query  110  EPGLDGVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAK-----  164
            E G  GV G+PG+ G PGL+   G KGDPG  G  G  G  G KG MG+   G K     
Sbjct  175  ESGRSGVPGLPGNSGYPGLK---GAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGL  231

Query  165  --------------------------------GDKGDKGFQGPPGPPGPDKPYFHANETI  192
                                            G KG+KG  GP GPPG           +
Sbjct  232  PGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPG--------MLGL  283

Query  193  IGPTGEPGQK------GDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGR  246
             GP G PG K      GD G+RG+RG  G PG  GE G +G+ G+ G  G PG  GG G 
Sbjct  284  DGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGE  343

Query  247  DGFAGPPGPPGQKGDRGYDGLDGLG-GRPGPKGEPGRDGSVGLPGLPGPQGPPG  299
             G+   PG PG +GD G +G  G G G  GP G  G DG  G  GLPG  G PG
Sbjct  344  PGY---PGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPG  394


 Score = 111 bits (278),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 165/361 (46%), Gaps = 67/361 (19%)

Query  3     FPGTEGLPGPKGNKAE------PGPQGPRG----------VKGDRGKMGMPGFPG---IP  43
             FPG  G PG KG +        PG QGPRG          V G  G  GMPG PG     
Sbjct  689   FPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGAD  748

Query  44    GIPGTQGPTGPIGLPGLDGCNGTDGVPGTHGFPGDPGPRG---------IPGPSGEKGVK  94
             G+PG  GP GP G PG  G  G DG+PG  G  G+PG RG         I G  GE G+ 
Sbjct  749   GLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLD  808

Query  95    G------------EPAISRPNIRGQKGEPGLDGVRGVPGSPGLPGLQGPPGTKGDPGLSG  142
             G            E     P   G  G  G  G  G+PG  G PG  G PGT G PG +G
Sbjct  809   GYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAG  868

Query  143   PSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQK  202
              +GQ G  G  GS G S  G  G  G KG  G PG  G D    ++ E      G PGQ 
Sbjct  869   MNGQDGAPGQPGSRGES--GLVGIDGKKGRDGTPGTRGQDGGPGYSGE-----AGAPGQN  921

Query  203   GDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPP---------  253
             G  G  G  G  G PG  G+ GY G +G+ GE GL G PG RG  G  G P         
Sbjct  922   GMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEE  981

Query  254   ------GPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQGPPGD--NLVYP  305
                   G PG  G+ G DGL GL   PG  G+PG  G  G PG PG +G PG+  NL YP
Sbjct  982   GSRGLDGVPGYPGEHGTDGLPGL---PGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYP  1038

Query  306   G  306
             G
Sbjct  1039  G  1039


 Score = 111 bits (277),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 165/568 (29%), Positives = 215/568 (38%), Gaps = 141/568 (25%)

Query  1     MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPG---------------I  45
             +G PG  G PG  G   + G QG  G  G RG+ G PG PG+PG                
Sbjct  1205  LGTPGDVGYPGAPGENGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGY  1264

Query  46    PGTQGP--TGPIGLPGLDGCNGTDGVPGTHGFPGDPGPRG---------------IPGPS  88
             PG  G    GP G  G DG  G DG+PG  G  G+PG  G               +PG  
Sbjct  1265  PGAPGQDIYGPPGQAGQDGYPGLDGLPGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYP  1324

Query  89    GEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHG  148
             GE+G+        P + G++G  GL G  GVPG  G+PGL+G  G  G PG  G  G +G
Sbjct  1325  GERGL--------PGLDGKRGHDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNG  1376

Query  149   RKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPY----FHANETIIGPTGEPGQKG-  203
               G++G  G+   G +G  GD G+ G PG PG   P     F   + + G  G PG++G 
Sbjct  1377  YPGERGLPGVP--GQQGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGL  1434

Query  204   -------DRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPP  256
                     R   G+ G +G PGE+G PG  GD G+ G  G  G PG  G DG+ GPPG  
Sbjct  1435  PGPMAMAVRNPPGQPGENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLS  1494

Query  257   GQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPG-------------------PQGP  297
             G  G  G  G  G  GR    G PG  G+ G PG PG                   PQ P
Sbjct  1495  GMPGHGGDQGFQGAAGR---TGNPGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTAVPQCP  1551

Query  298   PGDNLVYPGL-------------KDLEVTQDCMGLKVWMAFQEIQVREVL----------  334
             PG + ++ G              +DL     C+     M F    +  V           
Sbjct  1552  PGASQLWEGYSLLYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSF  1611

Query  335   -----------------------LDLLAGQEYQVSQVQKDQLDLKETRATRVWQ-VWTVH  370
                                    +   A  E     +     D    +  + W  +WT +
Sbjct  1612  WLSTDEPMTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGMWTGY  1671

Query  371   LGVM--ARGVKRETRAMQEP----EVLRETPFREFLDLLDPPVQSVNEVEMVVLEGMVFL  424
               VM  A G +   +++Q P    E  R  PF E                        +L
Sbjct  1672  SFVMHTAAGAEGTGQSLQSPGSCLEEFRAVPFIE--------CHGRGTCNYYATNHGFWL  1723

Query  425   DFRDQ----RETEEADVQIAGLDLRAIR  448
                DQ    R+     ++  GL  R  R
Sbjct  1724  SIVDQDKQFRKPMSQTLKAGGLKDRVSR  1751


 Score = 104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 165/355 (46%), Gaps = 59/355 (17%)

Query  1     MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGI------PGTQGPTGP  54
              GFPG  G PGP G+    G  GP G  G  G  G PG+PG  G+      PG  G  G 
Sbjct  825   FGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGE  884

Query  55    IGLPGLDGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAI----SRPNIRGQKGE  110
              GL G+DG  G DG PGT G  G PG  G  G  G+ G+ G P        P   GQ G 
Sbjct  885   SGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGY  944

Query  111   PGLDGVRGVPGSPGLPGLQGPPGTKGDP------------GLSGPSGQHGRKGDKGSMGL  158
             PG  G+ G  G  G PGL+G  G  G P            GL G  G  G  G  G  GL
Sbjct  945   PGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGL  1004

Query  159   -------SYEGAKGDKGDKGFQGPPGPPG----PDKP------YFHANETIIGPTGEPGQ  201
                     + G  G+ G  G++G PG PG    P +P             + G  G PG 
Sbjct  1005  PGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGL  1064

Query  202   KGDRGERGER-----GMSGNPGERGEPGYE------------GDAGMKGEKGLPGIPGGR  244
              G+RG+ G+      G+SG PG+ G  G +            G  G+KGE GLPG+PG +
Sbjct  1065  NGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQ  1124

Query  245   GRDGFAGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQGPPG  299
             G DG    PG PG +G+ G DG  G  G+PG  G+ GR+G  G PG+PG  G PG
Sbjct  1125  GNDGI---PGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPG  1176


 Score = 102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 179/638 (28%), Positives = 234/638 (37%), Gaps = 120/638 (19%)

Query  2     GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
             G PG  GLPG +G   +PG      +KG+ G  G PG+PG  G  GT G  G  G PG +
Sbjct  1167  GIPGENGLPGLRGQDGQPG------LKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGEN  1220

Query  62    GCNGT---DGVPGTHGFPGDPGPRGIPG------------PSGEKGVKGEPAISRPNIRG  106
             G NG    DG PG  G  G PG  G+PG              G  G  G+     P   G
Sbjct  1221  GDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAG  1280

Query  107   QKGEPGLDGVRGVPGSPGLPG---------------------LQGPPGTKGDPGLSGPSG  145
             Q G PGLDG+   PG+PGL G                     L G PG +G PGL G  G
Sbjct  1281  QDGYPGLDGL---PGAPGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRG  1337

Query  146   QHGRKGDKGSMGLS-YEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKGD  204
               G  G  G  G+    G +GD G+ G+ G PG PG        +    G  G PG  G 
Sbjct  1338  HDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPG--------SNGYPGERGLPGVPGQ  1389

Query  205   RGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPG-----PPGQK  259
             +G  G+ G  G PG+ G  G  GD G  G  GL G+PG  GR+G  GP       PPGQ 
Sbjct  1390  QGRSGDNGYPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQP  1449

Query  260   GDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQGPPGDNLVYPGLKDLEVTQDCMGL  319
             G+ GY G  G  G PG  G  G  G  G PG PG  G PG     PGL  +       G 
Sbjct  1450  GENGYPGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGP----PGLSGMP------GH  1499

Query  320   KVWMAFQEIQVREVLLDLLAGQEYQVS--------------QVQKDQLDLKETRATRVWQ  365
                  FQ    R     L     Y  S                Q   +      A+++W+
Sbjct  1500  GGDQGFQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWE  1559

Query  366   VWTVHLGVMARGVKRETRAMQEPEVLRETPFREFLDLLDPPVQSVNEVE-----------  414
              +++ L V   G        Q    L +     F+      V  V+              
Sbjct  1560  GYSL-LYVQGNGRASGQDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEP  1618

Query  415   ----MVVLEGMVFLDFRDQRETEEADVQIAGLDLRAIREKGDNREPQGFKDFGDWMGLLE  470
                 M  + G     +  +    E   QI  +  +        + PQG+   G W G   
Sbjct  1619  MTPMMNPVTGTAIRPYISRCAVCEVPTQIIAVHSQDTSVP---QCPQGWS--GMWTGYSF  1673

Query  471   YLVPLEEKGKLDVLLSFHQTLLEDFQETREIVVFQDRMDHQVLLVCLVLRDLLDLWDSAA  530
              +            L    + LE+F+     V F   ++      C         W    
Sbjct  1674  VMHTAAGAEGTGQSLQSPGSCLEEFR----AVPF---IECHGRGTCNYYATNHGFW----  1722

Query  531   KRAAKVTVVSQDWTEDQEIRDSLADLVSKAQASRAMLV  568
                  +++V QD    + +  +L     K + SR  + 
Sbjct  1723  -----LSIVDQDKQFRKPMSQTLKAGGLKDRVSRCQVC  1755


 Score = 95.1 bits (235),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 127/318 (40%), Positives = 153/318 (48%), Gaps = 69/318 (22%)

Query  20   GPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLDGCNGTDGVPGTHGFPGDP  79
            GP GP GVKG++G+                GP GP G+ GLDG  G  G+ G  G  GD 
Sbjct  258  GPVGPAGVKGEKGR---------------DGPVGPPGMLGLDGPPGYPGLKGQKGDLGDA  302

Query  80   GPRG------IPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPGSPGLPGLQGPPG  133
            G RG      +PG  GEKG +GE        +G  G PG  G +G  G PG PG    PG
Sbjct  303  GQRGKRGKDGVPGNYGEKGSQGE--------QGLGGTPGYPGTKGGAGEPGYPGR---PG  351

Query  134  TKGDPGLSGPSGQ-HGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANETI  192
             +GD G  GP G+  G  G  G+ G  ++G +G KG  G  G PGP GP  P        
Sbjct  352  FEGDCGPEGPLGEGTGEAGPHGAQG--FDGVQGGKGLPGHDGLPGPVGPRGP--------  401

Query  193  IGPTGEPGQKG--------DRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPG-----  239
            +G  G PGQ G        ++G+RGE G  G  GE G PG  GD G  GE GLPG     
Sbjct  402  VGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQG  461

Query  240  ---IPGGRGRDGFAGPPGP---PGQKGDRGYDGLD-------GLGGRPGPKGEPGRDGSV  286
               + G  GRDGF G PG    PG  G++G+ G         G+ G PG  G PGR G  
Sbjct  462  PPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVD  521

Query  287  GLPGLPGPQGPPGDNLVY  304
            G PG PG  G  G++  Y
Sbjct  522  GYPGPPGNNGERGEDCGY  539


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 128/331 (39%), Positives = 160/331 (48%), Gaps = 61/331 (18%)

Query  2     GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMP------------GFPGIPGIPGTQ  49
             G PG +G PGP G   E G  G  G++G+ G  G+P            G  G+PG PG  
Sbjct  937   GSPGQDGYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEH  996

Query  50    GPTGPIGLPGLDGC------NGTDGVPGTHGFPGDPG-----------------------  80
             G  G  GLPG DG        G  G PG  G PG+PG                       
Sbjct  997   GTDGLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLP  1056

Query  81    -PRGIPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPGSPGLPGLQGPPGTKGDPG  139
                G+PG +GE+G  G+     P + GQ G+ G DG+ GVPG PG PG+ G PG KG+ G
Sbjct  1057  GQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESG  1116

Query  140   LSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEP  199
             L G  G+ G  G  G  GL     +G+ G+ GF G PG PG             G  G  
Sbjct  1117  LPGLPGRQGNDGIPGQPGL-----EGECGEDGFPGSPGQPG-----------YPGQQGRE  1160

Query  200   GQKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQK  259
             G+KG  G  GE G+ G  G+ G+PG +G+ G+ G+ G PG  G  G  G  G PG PG+ 
Sbjct  1161  GEKGYPGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGEN  1220

Query  260   GDRGYDGLDGLGGRPGPKGEPGRDGSVGLPG  290
             GD G  G D   G+PG +GE G+ G  GLPG
Sbjct  1221  GDNGNQGRD---GQPGLRGESGQPGQPGLPG  1248


 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 137/347 (39%), Positives = 154/347 (44%), Gaps = 75/347 (22%)

Query  5     GTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFP------GIPGIPGTQGPTGPIGLP  58
             G +G PG +G    PG  G  G  G   + GM G+P      G PG PG  G  GP G+P
Sbjct  895   GRDGTPGTRGQDGGPGYSGEAGAPG---QNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIP  951

Query  59    GLDGCNGTDGVPGTHGFPGDP------------GPRGIPGPSGEKGVKGEPAI----SRP  102
             G DG  G  G+ G HG  G P            G  G+PG  GE G  G P +     +P
Sbjct  952   GEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQP  1011

Query  103   NIRGQKGEPGLDGVRGVPGSP---------------------------GLPGLQGPPGTK  135
                G+ GEPG  G RG PG P                           GLPGL G  G  
Sbjct  1012  GFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDN  1071

Query  136   GD-----PGLSGPSGQHGRKG-DKGSMGLSYEGAKGDKGDKGFQGPPGPPGPDKPYFHAN  189
             GD     PGLSG  G  G  G D       Y G  G  G KG  G PG PG        N
Sbjct  1072  GDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPG-----RQGN  1126

Query  190   ETIIGPTGEPGQKGDRGERGERGMSGNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGF  249
             + I      PGQ G  GE GE G  G+P   G+PGY G  G +GEKG PGIPG  G  G 
Sbjct  1127  DGI------PGQPGLEGECGEDGFPGSP---GQPGYPGQQGREGEKGYPGIPGENGLPGL  1177

Query  250   AGPPGPPGQKGDRGYDGLDGLGGRPGPKGEPGRDGSVGLPGLPGPQG  296
              G  G PG KG+   +GLDG  G PG  G+ G  G VG PG PG  G
Sbjct  1178  RGQDGQPGLKGE---NGLDGQPGYPGSAGQLGTPGDVGYPGAPGENG  1221


 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 156/463 (34%), Positives = 183/463 (40%), Gaps = 127/463 (27%)

Query  1    MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGM------------------------  36
            +G PG  GL GP G     G +G  G  G RGK G                         
Sbjct  275  VGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGSQGEQGLGGTPGY  334

Query  37   ---------PGFPGIPGIPGTQGPTGPI----------GLPGLDGCNGTDGVPGTHGFPG  77
                     PG+PG PG  G  GP GP+          G  G DG  G  G+PG  G PG
Sbjct  335  PGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPG  394

Query  78   DPGPR---GIPGPSGEKGVKGEPAISRPNIRGQKGEPGLDGVRGVPGSP---------GL  125
              GPR   G PG  G+ G+ G P  +    RG+ G PG  G  G+PG P         GL
Sbjct  395  PVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGL  454

Query  126  PG--LQGPPGTKGD------PGLSGPSGQHGRKGDKGSMGLSYE-----------GAKGD  166
            PG  +QGPPG  G       PG+ G  G  G  G+KG  G               G  G 
Sbjct  455  PGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGM  514

Query  167  KGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKGDRG------------ERGERGMS  214
             G  G  G PGPPG +       +    P G PG  GD G              G+ G  
Sbjct  515  PGRIGVDGYPGPPGNNG--ERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDC  572

Query  215  GNPGERGEPGYEGDAGMKGEKGLPGIPGGRGRDGFAG--------PPGPPGQKGDRGYDG  266
            G PG  G+PG  G  G+ G  GLPGIPG  G  G AG        P G PG KGD G  G
Sbjct  573  GMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPG  632

Query  267  LDGLGGR---------------PGPKGEP---------GRDGSVGLPGLPGPQGPPGDNL  302
            L G  G                PG +GEP         GR GS+G+PGL   QGPPGD+ 
Sbjct  633  LPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGL---QGPPGDSF  689

Query  303  V----YPGLKDLEVTQDCMGLKVWMAFQEIQVREVLLDLLAGQ  341
                  PG K         GL      + I     +++ +AGQ
Sbjct  690  PGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAGQ  732


 Score = 88.6 bits (218),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 142/417 (34%), Positives = 176/417 (42%), Gaps = 130/417 (31%)

Query  1     MGFPGTEGLPGPKGNKAE------PGPQGPRG---VKGDRGKMGMPGFPGIPGIPGTQGP  51
              G PG +G+PG  G++        PGP GP G     G+RG  G+PGFPG+ G PG +G 
Sbjct  730   AGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQ  789

Query  52    TGPIGLPGLDGCNGTDGVPGTH------------GFPGDPGPRGIPGPSGEKGVKGEPAI  99
              G +G  G+DG  G  G+ G              GF G PG  G PGP+G+ G  G P  
Sbjct  790   QGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGF-GFPGQVGYPGPNGDAGAAGLP--  846

Query  100   SRPNIRGQKGEPGLDGVRGVPGSPGLPGLQGP------PGTKGDPGLSGPSGQHGRKGDK  153
                   G  G PG DG+ G PG PG  G+ G       PG++G+ GL G  G+ GR G  
Sbjct  847   ------GPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTP  900

Query  154   GSMGLS----YEGAKGDKGDKGFQGPPGPPGPD-KPYFHANETIIGPTGEPGQ-------  201
             G+ G      Y G  G  G  G  G PG PG    P     +   GP+G PG+       
Sbjct  901   GTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFP  960

Query  202   --KGDRGERG------------ERGMSGNPGERGE---------PGYEGDAGMKGEKGLP  238
               +G+ G+ G             RG+ G PG  GE         PG +G  G  GE G P
Sbjct  961   GLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGADGQPGFVGEAGEP  1020

Query  239   GIPGGRGR--------------------------------------------DGFAGPPG  254
             G PG RG+                                            D + G PG
Sbjct  1021  GTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYPGNPG  1080

Query  255   PPGQKGDRGYDGLD---------GLGGRPGPKGE------PGRDGSVGLPGLPGPQG  296
               GQ GD GYDGLD         G+ G PG KGE      PGR G+ G+PG PG +G
Sbjct  1081  LSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGNDGIPGQPGLEG  1137


 Score = 85.5 bits (210),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 140/401 (35%), Positives = 166/401 (41%), Gaps = 113/401 (28%)

Query  2    GFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPGTQGPTGPIGLPGLD  61
            G PG+ G PG +G    PG +G  G+ G  G  G PG PG+ G PG  G  G  G PGL 
Sbjct  97   GLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPGLS  156

Query  62   GC--------------------NGTDGVPGTHGFPG------DPGPRGIPGPSGEKGVKG  95
            G                     +G  G+PG  G+PG      DPGP G+PG  G  G+KG
Sbjct  157  GPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKG  216

Query  96   EPAISRPNIR-------------------------------------GQKGEPGLDGVRG  118
               +    ++                                     G KGE G DG  G
Sbjct  217  RMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVG  276

Query  119  VPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSMGLSYEGAKGDKGDKGFQGPPGP  178
             PG  GL G  G PG KG  G  G +GQ G++G  G  G +Y G KG +G++G  G PG 
Sbjct  277  PPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDGVPG-NY-GEKGSQGEQGLGGTPGY  334

Query  179  PG----------PDKPYFHANETIIGP----TGEPGQKGDRGERGERGMSGNPGERGEPG  224
            PG          P +P F  +    GP    TGE G  G +G  G +G  G PG  G PG
Sbjct  335  PGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPG  394

Query  225  YEGDAGMKGEKGLPGIPG-----------GRGRDG---FAGPPGPPGQKGDRGYDG----  266
              G  G  G  G PG PG            RG DG   FAG PG PG+ GD GY G    
Sbjct  395  PVGPRGPVGAPGAPGQPGIDGMPGYTEKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGL  454

Query  267  ----------LDGLGGR------PGPKGEPGRDGSVGLPGL  291
                      LDG  GR      PG  G+PG  G  G PG 
Sbjct  455  PGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGT  495


 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 127/330 (38%), Positives = 152/330 (46%), Gaps = 60/330 (18%)

Query  1    MGFPGTEGLPGPKGNKAEPGPQGPRGVKGDRGKMGMPGFPGIPGIPG-------------  47
             G PG  G+PG  G    PGP G  G +G+       G PG  G PG             
Sbjct  506  TGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGP  565

Query  48   --TQGPTGPIGLPGLDGCNGTDGVPGTHGFPGDPGPRGIPGPSGEKGVKGEPAISRPNIR  105
                G  G  G PG  G  G+DG+ G+ G PG PG    PG  GE G    P  +   I 
Sbjct  566  NGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPG---YPGMKGEAGEIVGPMENPAGIP  622

Query  106  GQKGEPGLDGVRGVPGSPGLPGLQGP------PGTKGDPGLSGPSGQHGRKGDKGSMGLS  159
            G KG+ GL G+ G PGS GLPG  G       PG +G+PGL+G  G+ GR   +GS+G+ 
Sbjct  623  GLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGR---QGSLGI-  678

Query  160  YEGAKGDKGDKGFQGPPGPPGPDKPYFHANETIIGPTGEPGQKGDRGERGERGMSGNPGE  219
                       G QGPPG            ++  G  G PG KG+RG  G  G+ G  G 
Sbjct  679  ----------PGLQGPPG------------DSFPGQPGTPGYKGERGADGLPGLPGAQGP  716

Query  220  RGEPG----YEGDAGMKGEKGLPGIPGGRGRDGFAGPPGP------PGQKGDRGYDGLDG  269
            RG P         AG  G  G+PG+PG RG DG  G PGP      PG  G+RG DGL G
Sbjct  717  RGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGLPG  776

Query  270  LGGRPGPKGEPGRDGSVGLPGLPGPQGPPG  299
              G  G  G  G+ G VG  G+ G  G PG
Sbjct  777  FPGLHGEPGMRGQQGEVGFNGIDGDCGEPG  806


 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 112/275 (41%), Gaps = 81/275 (29%)

Query  97   PAISRPNIRGQKGEPGLDGVRGVPGSPGLPGLQGPPGTKGDPGLSGPSGQHGRKGDKGSM  156
            P    P  +G++G PG     G PG PG PG  GP G  G PG+       G +GD G M
Sbjct  37   PPCVCPGTKGERGNPGFG---GEPGHPGAPGQDGPEGAPGAPGM------FGAEGDFGDM  87

Query  157  GLSYEGAKGDKGDKGFQGPPGPPGPDK----PYFHANETIIGPTGE------------PG  200
                 G+KG +GD+G  G PG PG       P     E I G  G             PG
Sbjct  88   -----GSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPG  142

Query  201  QKGDRGERGERGMSGNPGERG--EPGYEGDAGMKGEKGLPGIPGGRGRDGFAGPPGPPGQ  258
            Q G  G  G  G+SG PGE G    G +G  G  G  G+PG+PG  G  G  G  G PG 
Sbjct  143  QSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGP  202

Query  259  KGDRGYDGLDGLGGR---------------------------------------------  273
             G  G+ G+ GL GR                                             
Sbjct  203  YGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGP  262

Query  274  PGPKGEPGRDGSVGLPGLPGPQGPPGDNLVYPGLK  308
             G KGE GRDG VG PG+ G  GPPG    YPGLK
Sbjct  263  AGVKGEKGRDGPVGPPGMLGLDGPPG----YPGLK  293



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


Query= CAQU000034-PA

Length=1720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CO4A1_CAEEL  unnamed protein product                                  842     0.0  
Q9VMV5_DROME  unnamed protein product                                 812     0.0  
O18407_DROME  unnamed protein product                                 805     0.0  


>CO4A1_CAEEL unnamed protein product
Length=1759

 Score = 842 bits (2174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/1685 (45%), Positives = 907/1685 (54%), Gaps = 167/1685 (10%)

Query  131   GDRGNPGYPGSRGPPGGFGPVGPPGDPG------EGGINSVGVKGDRGDSGQPGGHGQDG  184
             G  G PG PG  GPPG  G  G PG PG      EGG+NS G KG +G+SG+    G  G
Sbjct  127   GTDGFPGMPGLAGPPGQSGQNGNPGRPGLSGPPGEGGVNSQGRKGVKGESGR---SGVPG  183

Query  185   IPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQGETGSPGPKGQQQV  244
             +PG +G PG +G  GDPG  G PG+PG  G  G       GVKGE+G  G PGP GQ   
Sbjct  184   LPGNSGYPGLKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGS  243

Query  245   F-----PLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKGMKGERGPDG  299
             +     P++    +GP G  G  G++G  G  G  G  GLDG PG+ G KG KG+ G  G
Sbjct  244   YPWASKPIEMEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAG  303

Query  300   PRGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEGGEDGQPGPPGVQGTLGAPGEFD  359
              RGK+G+DG  G  G KG++G  G  G+ G  G KG  GE G PG PG +G  G  G   
Sbjct  304   QRGKRGKDGVPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLG  363

Query  360   YNSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLS  419
               +   G  GA GF G  G  G  G  GLPG    +G RGP G PG  G PG  G  G +
Sbjct  364   EGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGP---VGPRGPVGAPGAPGQPGIDGMPGYT  420

Query  420   IKGDPGDDGVPGPPGRMGPPGGPGLPGSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGD  479
              KGD G+DG PG  G  G PG PG  G  G  GLPG  I GPPG+DG  GRDGFPG+ GD
Sbjct  421   EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGD  480

Query  480   RGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYC  539
              G+ G  G KG  G GV   GPPG  GLPG PG PG  G+ G  G  G  G +GEDCGYC
Sbjct  481   IGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYC  540

Query  540   PPGYPGAKGTDGDPGIPGASGLPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSAGLAG  599
             P G PG  G  G PG+ G  G PG +G  G+ G  G  GK G  G  GL+G PG  G+ G
Sbjct  541   PDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPG  600

Query  600   RQGPPGDPGQLVMPPDGVKGLRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGYKGDKGN  659
               G  G+ G++V P +   G+ G  GD G PGL G PG +G  G PG PG  G+ G +G 
Sbjct  601   YPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGE  660

Query  660   AGDVGLPGMDGRPGEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEGD  719
              G  G+ G  GR G  G+PGL GP    P     G+PG  G++G RG  G  G  G +G 
Sbjct  661   PGLAGIDGKRGRQGSLGIPGLQGP----PGDSFPGQPGTPGYKGERGADGLPGLPGAQGP  716

Query  720   AGSHI---IVIGEHGDPGPQGFRGWPGDKGHRGDP------GPGGFPGFPGRNGEPGLSQ  770
              G      IV    G PG  G  G PGD+G  G P      GP G+PG PG  G  GL  
Sbjct  717   RGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGMDGL--  774

Query  771   PGPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMGPPGF  830
                PG  G  G PG+ G +G  GF G DG  G  G+ G  G  G  G     G  G PG 
Sbjct  775   ---PGFPGLHGEPGMRGQQGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETG-FGFPGQ  830

Query  831   PGSKGDRGDEGPQGATGRDGFPGSPGYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPR  890
              G  G  GD G  G  G DG+PG  G  GT G PG AG++G  G PG         PG R
Sbjct  831   VGYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQ--------PGSR  882

Query  891   GAPGLA--LGRRGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGL----  944
             G  GL    G++G  G PG RG DGG G  G+ G  G+ G+ G  G  G+ G PG     
Sbjct  883   GESGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQD  942

Query  945   -----DGLPGRQGLPGLPGTEGDRGTMGIP---------GQKGPNGRPGLPGTFGIDGPK  990
                   G+PG  GL G PG  G+ G  G+P         G +G +G PG PG  G D   
Sbjct  943   GYPGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTD---  999

Query  991   GDPGAPGLDGLNGRDGDAGESGDPGIPGQKGIPGDGGFPAVPGD---------------R  1035
             G PG PG DG  G  G+AGE G PG  GQ G PG+  +P  PGD                
Sbjct  1000  GLPGLPGADGQPGFVGEAGEPGTPGYRGQPGEPGNLAYPGQPGDVGYPGPDGPPGLPGQD  1059

Query  1036  GEPGFPGEIGPRGN--PGFNGLKGQLGEPG----------EVIGGEPGIPGERGESGLPG  1083
             G PG  GE G  G+  PG  GL GQ G+ G              G  G+PG +GESGLPG
Sbjct  1060  GLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPG  1119

Query  1084  VSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGKPGGKGIRGSPGFPGAFGLKG  1143
             + GR G  GI G  G+ GE    G  GFPG  G+PG+ G+ G +G +G PG PG  GL G
Sbjct  1120  LPGRQGNDGIPGQPGLEGE---CGEDGFPGSPGQPGYPGQQGREGEKGYPGIPGENGLPG  1176

Query  1144  FSGEPGEPGFSGRPGPIGEPGFPGGPGFPGFPGVKGEPGETALLAFGSPGESGLPGEKGP  1203
               G+ G+PG  G  G  G+PG+PG  G                   G+PG+ G PG  G 
Sbjct  1177  LRGQDGQPGLKGENGLDGQPGYPGSAG-----------------QLGTPGDVGYPGAPGE  1219

Query  1204  VGDRGDAGFSGGPGLKGEPGDFGAAGKPGR---------------PGGPGQK--GAPGEY  1246
              GD G+ G  G PGL+GE G  G  G PGR               PG PGQ   G PG+ 
Sbjct  1220  NGDNGNQGRDGQPGLRGESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQA  1279

Query  1247  GRDGAPGRPGPPGFRRDGPKGQPGDPGPL------------------GPSGSPGLTGRRG  1288
             G+DG PG  G PG    G  G+PG PG                    G  G PGL G+RG
Sbjct  1280  GQDGYPGLDGLPG--APGLNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRG  1337

Query  1289  PPGRSGGPGLKGPRGDRGRP-SISFRGEPGEAGLDGYDGLPGERGIP------GESGRDG  1341
               G  G PG+ G  G  G        G PG  G  G +G PGERG+P      G SG +G
Sbjct  1338  HDGLPGAPGVPGVEGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNG  1397

Query  1342  FIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPGPLSTFFKGAQGDP---GLPGF  1398
             + G PG+PG +G  GDDG PG  G+DG  G  G  G PGP++   +   G P   G PG 
Sbjct  1398  YPGAPGQPGIKGPRGDDGFPGRDGLDGLPGRPGREGLPGPMAMAVRNPPGQPGENGYPGE  1457

Query  1399  SGQPGQPGRRGF---PGRAGQPGFQGEAGTPGPSGLPGLQGPKGMLGESGFPGIPGNRGL  1455
              G PG PG  G    PG+AG PG  G  G PGP   PGL G  G  G+ GF G  G  G 
Sbjct  1458  KGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGP---PGLSGMPGHGGDQGFQGAAGRTGN  1514

Query  1456  PGFPGSPGPDALPGPPPRSRGFFFTRHSQTVFQPPCPAGTTKLWDGYSLLHFTGDGKARG  1515
             PG PG+PG    PG    SRGF F +HSQT   P CP G ++LW+GYSLL+  G+G+A G
Sbjct  1515  PGLPGTPGYPGSPGGWAPSRGFTFAKHSQTTAVPQCPPGASQLWEGYSLLYVQGNGRASG  1574

Query  1516  QDLGAPGSCLSKFSTMPFLFCNLNNVCNYASRNDYSYWLSTPEPMPMSMTPITGREIRKF  1575
             QDLG PGSCLSKF+TMPF+FCN+N+VC+ +SRNDYS+WLST EPM   M P+TG  IR +
Sbjct  1575  QDLGQPGSCLSKFNTMPFMFCNMNSVCHVSSRNDYSFWLSTDEPMTPMMNPVTGTAIRPY  1634

Query  1576  VSKCSVCESTTHVIAVHSQTMDTPDCPSDWEQLWIGYSFLMHTDSGSEGAGQPLVSPGSC  1635
             +S+C+VCE  T +IAVHSQ    P CP  W  +W GYSF+MHT +G+EG GQ L SPGSC
Sbjct  1635  ISRCAVCEVPTQIIAVHSQDTSVPQCPQGWSGMWTGYSFVMHTAAGAEGTGQSLQSPGSC  1694

Query  1636  LEEFRAVPFIECHGQGRCNFYTTASSYWLATIEEYEQFRRPRSQTLKAGDLTTKVSRCAV  1695
             LEEFRAVPFIECHG+G CN+Y T   +WL+ +++ +QFR+P SQTLKAG L  +VSRC V
Sbjct  1695  LEEFRAVPFIECHGRGTCNYYATNHGFWLSIVDQDKQFRKPMSQTLKAGGLKDRVSRCQV  1754

Query  1696  CRRKH  1700
             C +  
Sbjct  1755  CLKNR  1759


 Score = 407 bits (1047),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 585/1417 (41%), Positives = 688/1417 (49%), Gaps = 242/1417 (17%)

Query  109   AKKAIEAMLVFRAFKVAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGVK  168
             A K IE M V +     PV P G +G  G  G  GPPG  G  GPPG PG       G K
Sbjct  247   ASKPIE-MEVLQG----PVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPG-----LKGQK  296

Query  169   GDRGDSGQPGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKG  228
             GD GD+GQ G  G+DG+PG  G  G Q   G+ G  G PGYPG KG  GE   GYPG  G
Sbjct  297   GDLGDAGQRGKRGKDGVPGNYGEKGSQ---GEQGLGGTPGYPGTKGGAGEP--GYPGRPG  351

Query  229   EQGETGSPGP--KGQQQVFPLDTIFWKGPR---------GLPGPPGDRGIPGEKGFEGSK  277
              +G+ G  GP  +G  +  P     + G +         GLPGP G RG  G  G  G  
Sbjct  352   FEGDCGPEGPLGEGTGEAGPHGAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQP  411

Query  278   GLDGVPGFVGSKGMKGERGPDGPRGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEG  337
             G+DG+PG+   KG +GE G  G  G+ G  G+ G  G  G  G PGY    G  G  G+ 
Sbjct  412   GIDGMPGYT-EKGDRGEDGYPGFAGEPGLPGEPGDCGYPGEDGLPGYD-IQGPPGLDGQS  469

Query  338   GEDGQPGPPGVQGTLGAPGEFDYNSDG---VGVPGAPGFQGPTGLPGEAGESGLPGQPGD  394
             G DG PG PG  G  G  GE  +   G   VG PG  G  G  G+PG  G  G PG PG+
Sbjct  470   GRDGFPGIPGDIGDPGYSGEKGFPGTGVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGN  529

Query  395   LGFRGPPGPPGPEGVPGNPGQRGL----------SIKGDPGDDGVPGPPGRMGPPGGPGL  444
              G RG      P+GVPGN G  G              GD GD G+PG PG+ G  G  GL
Sbjct  530   NGERGEDCGYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGL  589

Query  445   PGSAGNKGLPGL--------TIMGP-------------PGMDGLPGRDG-----------  472
              GS G  G+PG          I+GP              G+ GLPGR G           
Sbjct  590   SGSPGLPGIPGYPGMKGEAGEIVGPMENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGP  649

Query  473   ----FPGLRGDRGEAGVPGPKGPAG-FGVQ-IRGPPGEQGLPGLPGTPGFPGLPGLDGGS  526
                 FPGL+G+ G AG+ G +G  G  G+  ++GPPG+   PG PGTPG+ G  G DG  
Sbjct  650   GQNGFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDS-FPGQPGTPGYKGERGADGLP  708

Query  527   GLPGIKGEDCGYCPPGYP----------GAKGTDGDPGIPGASGLPGFHGLPGERGPKGL  576
             GLPG +G      P G P          G  G DG PG+PG  G  G  GLPG  GP G 
Sbjct  709   GLPGAQG------PRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGY  762

Query  577   GGKGGPRGYQGLTGRPGSAGLAGRQGPPGDPGQLVMPPDGVKGLRGPGGDPGFPGLMGLP  636
              G  G RG  GL G PG  G  G +G  G+            G  G  GD G PGL G P
Sbjct  763   PGTPGERGMDGLPGFPGLHGEPGMRGQQGE-----------VGFNGIDGDCGEPGLDGYP  811

Query  637   GRNGNKGLP-----GPPGAPGYKGDKGNAGDVGLPGMDGRPGEDGLPGLDGPNADIPKQF  691
             G  G  G P     G PG  GY G  G+AG  GLPG DG PG DGLPG            
Sbjct  812   GAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPDGYPGRDGLPGTP----------  861

Query  692   LRGEPGLNGFRGPRGPTGEKGHKGEEGDAGSHIIVIGEHGDPGPQGFRGWPGDKGHRGDP  751
               G PG  G  G  G  G+ G +GE G  G            G +G  G PG +G  G P
Sbjct  862   --GYPGEAGMNGQDGAPGQPGSRGESGLVGID----------GKKGRDGTPGTRGQDGGP  909

Query  752   GPGGFPGFPGRNGEPGLSQPGPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKG  811
             G  G  G PG+NG  G   PG PG +GYPG PG  G  GP G PG DG     G PG +G
Sbjct  910   GYSGEAGAPGQNGMDGY--PGAPGDQGYPGSPGQDGYPGPSGIPGEDGLV---GFPGLRG  964

Query  812   DRGDHGM------GILGGDMGPPGFPGSKGDRGDEGPQGATGRDGFPGSPGYKGTKGAPG  865
             + GD+G+          G  G  G PG  G+ G +G  G  G D   G PG+ G  G PG
Sbjct  965   EHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLPGAD---GQPGFVGEAGEPG  1021

Query  866   LAGLSGLRGLPGDVGDSYPGPPG-----PRGAPGLALGRRGLPGIPGIRGIDGGVGPLGD  920
               G  G  G PG++  +YPG PG         P    G+ GLPG+ G RG +G   P G+
Sbjct  1022  TPGYRGQPGEPGNL--AYPGQPGDVGYPGPDGPPGLPGQDGLPGLNGERGDNGDSYP-GN  1078

Query  921   KGMQGEPGLTGLRGMD------GNLGIPGLDGLPGRQGLPGLPGTEGDRGTMGIPGQKGP  974
              G+ G+PG  G  G+D      G  GI G+ GL G  GLPGLPG +G+    GIPGQ   
Sbjct  1079  PGLSGQPGDAGYDGLDGVPGPPGYPGITGMPGLKGESGLPGLPGRQGND---GIPGQ---  1132

Query  975   NGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAGESGDPGIPGQKGIPGDGGFPAVPGD  1034
                PGL G  G DG  G PG PG  G  GR+   GE G PGIPG+ G+PG      + G 
Sbjct  1133  ---PGLEGECGEDGFPGSPGQPGYPGQQGRE---GEKGYPGIPGENGLPG------LRGQ  1180

Query  1035  RGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGERGESGLPGVSGRGGQKGIM  1094
              G+PG  GE G  G PG+ G  GQLG PG+V  G PG PGE G++   G  GR GQ G+ 
Sbjct  1181  DGQPGLKGENGLDGQPGYPGSAGQLGTPGDV--GYPGAPGENGDN---GNQGRDGQPGLR  1235

Query  1095  GDMGIPGEKGMAGNRGFPGRQGRPGWSGKPG--GKGIRGSPGFPGAFGLKGFSGEPGEPG  1152
             G+ G PG+ G+ G  G PG  G PG  G PG  G+ I G PG  G  G  G  G PG PG
Sbjct  1236  GESGQPGQPGLPGRDGQPGPVGPPGDDGYPGAPGQDIYGPPGQAGQDGYPGLDGLPGAPG  1295

Query  1153  FSGRPGPIGE------------PGFPGGPGFPGFPGVKGEPGETALLAFGSPGESGLPGE  1200
              +G PG  G+             G PG PG  G PG+ G+ G   L     PG  G+PG 
Sbjct  1296  LNGEPGSPGQYGMPGLPGGPGESGLPGYPGERGLPGLDGKRGHDGL-----PGAPGVPGV  1350

Query  1201  KGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPGGPGQKGAPGEYGRDGAPGRPGPPGF  1260
             +G  G  GD G  G PG  G PG  G  G+ G PG PGQ+G  G+ G  GAPG+PG  G 
Sbjct  1351  EGVPGLEGDCGEDGYPGAPGAPGSNGYPGERGLPGVPGQQGRSGDNGYPGAPGQPGIKGP  1410

Query  1261  RRDGPKGQPGDPGPLGPSGSPGLTGRRGPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAG  1320
             R D               G PG  G  G PGR G  GL GP       +++ R  PG+ G
Sbjct  1411  RGD--------------DGFPGRDGLDGLPGRPGREGLPGPM------AMAVRNPPGQPG  1450

Query  1321  LDGYDGLPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPG  1380
              +GY   PGE+G PG  G +G  G PG+ G  G PG DG PG  G+ G  G  GD G   
Sbjct  1451  ENGY---PGEKGYPGLPGDNGLSGPPGKAGYPGAPGTDGYPGPPGLSGMPGHGGDQG---  1504

Query  1381  PLSTFFKGA---QGDPGLPGFSGQPGQPG----RRGF  1410
                  F+GA    G+PGLPG  G PG PG     RGF
Sbjct  1505  -----FQGAAGRTGNPGLPGTPGYPGSPGGWAPSRGF  1536


 Score = 357 bits (915),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 513/1280 (40%), Positives = 604/1280 (47%), Gaps = 227/1280 (18%)

Query  359   DYNSDGVGVPGAPGFQG---PTGLPGEAGESGLPGQPGDLGFRGPPGPPGPEGVPGNPGQ  415
              +  D + V  A   +G   P   PG  GE G PG  G+ G  G PG  GPEG PG PG 
Sbjct  18    SFCQDRIHVDAAAACKGCAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGM  77

Query  416   RG-------LSIKGDPGDDGVPGPPGRMGPPGGPGLPGSAGNKGLPGLT-IMGPPGMDGL  467
              G       +  KG  GD G+PG PG  G  G  GLPG  G +G+PG     G PGM GL
Sbjct  78    FGAEGDFGDMGSKGARGDRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGL  137

Query  468   PGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSG  527
              G  G  G  G+ G  G+ GP G  G   Q     G +G+ G  G  G PGLPG  G  G
Sbjct  138   AGPPGQSGQNGNPGRPGLSGPPGEGGVNSQ-----GRKGVKGESGRSGVPGLPGNSGYPG  192

Query  528   LPGIKGEDCGYCPPGYPGAKGTDGDPGI------------------------PGASG---  560
             L G KG+   Y  PG+PG  G  G  G+                        P AS    
Sbjct  193   LKGAKGDPGPYGLPGFPGVSGLKGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIE  252

Query  561   ---LPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSAGLAGRQGPPGDPGQL-VMPPDG  616
                L G  G  G +G KG  G  GP G  GL G PG  GL G++G  GD GQ      DG
Sbjct  253   MEVLQGPVGPAGVKGEKGRDGPVGPPGMLGLDGPPGYPGLKGQKGDLGDAGQRGKRGKDG  312

Query  617   V---KGLRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGYKGD----------KGNAGDV  663
             V    G +G  G+ G  G  G PG  G  G PG PG PG++GD           G AG  
Sbjct  313   VPGNYGEKGSQGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPH  372

Query  664   GLPGMD------GRPGEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEE  717
             G  G D      G PG DGLPG  GP   +      G+PG++G  G      EKG +GE+
Sbjct  373   GAQGFDGVQGGKGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPG----YTEKGDRGED  428

Query  718   GDAGSHIIVIGEHGDPGPQGFRGWPGDK-----------GHRGDPGPGGFPGFPGRNGEP  766
             G  G      GE G PG  G  G+PG+            G  G  G  GFPG PG  G+P
Sbjct  429   GYPG----FAGEPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDP  484

Query  767   GLSQPGPPGLKGYPGI-------PGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMG  819
             G S     G KG+PG        PG+ G  G  G PGR    G DG PGP G+ G+ G  
Sbjct  485   GYS-----GEKGFPGTGVNKVGPPGMTGLPGEPGMPGR---IGVDGYPGPPGNNGERGED  536

Query  820   ILGGDMGPPGFPGSKGDRG---------------DEGPQGATGRDGFPGSPGYKGTKGAP  864
                    P G PG+ GD G               D G  G  G  G PGS G  G  G+P
Sbjct  537   C---GYCPDGVPGNAGDPGFPGMNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSP  593

Query  865   GLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLPGIPGIRGIDGGVGPLGDK---  921
             GL G+ G  G+ G+ G+       P G PGL  G  GLPG+PG  G DG  G  G     
Sbjct  594   GLPGIPGYPGMKGEAGEIVGPMENPAGIPGLK-GDHGLPGLPGRPGSDGLPGYPGGPGQN  652

Query  922   ---GMQGEPGLTGL---RGMDGNLGIPGLDGLPGRQ--GLPGLPGTEGDRGTMGIPGQKG  973
                G+QGEPGL G+   RG  G+LGIPGL G PG    G PG PG +G+RG  G+PG  G
Sbjct  653   GFPGLQGEPGLAGIDGKRGRQGSLGIPGLQGPPGDSFPGQPGTPGYKGERGADGLPGLPG  712

Query  974   PNGRPGLPGTF----------GIDGPKGDPGAPGLDGLNGRDGDAGESGDPGIPGQKGIP  1023
               G  G+P             G+DG  G PG  G DGL G  G  G  G PG PG++G+ 
Sbjct  713   AQGPRGIPAPLRIVNQVAGQPGVDGMPGLPGDRGADGLPGLPGPVGPDGYPGTPGERGM-  771

Query  1024  GDGGFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGE----------------------  1061
                G P  PG  GEPG  G+   +G  GFNG+ G  GE                      
Sbjct  772   --DGLPGFPGLHGEPGMRGQ---QGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFG  826

Query  1062  -PGEVIGGEPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGR---QGR  1117
              PG+V  G PG  G+ G +GLPG  G  G+ G+ G  G PGE GM G  G PG+   +G 
Sbjct  827   FPGQV--GYPGPNGDAGAAGLPGPDGYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGE  884

Query  1118  PGWSGKPGGKGIRGSPGFPGAFGLKGFSGE---PGEPGFSGRPGPIGEPGFPGGPGFPGF  1174
              G  G  G KG  G+PG  G  G  G+SGE   PG+ G  G PG  G+ G+PG PG  G+
Sbjct  885   SGLVGIDGKKGRDGTPGTRGQDGGPGYSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGY  944

Query  1175  PGVKGEPGETALLAF----GSPGESGLPGEKGPVGDRGDAGFSGGPGLKGEPGDFGAAGK  1230
             PG  G PGE  L+ F    G  G++GLPG +G  G+ G  G  G PG    PG+ G  G 
Sbjct  945   PGPSGIPGEDGLVGFPGLRGEHGDNGLPGLEGECGEEGSRGLDGVPGY---PGEHGTDGL  1001

Query  1231  PGRPGGPGQKGAPGEYGRDGAPGRPGPPGFRRDGPKGQPGDPGPLGPSGSPGLT------  1284
             PG PG  GQ G  GE       G PG PG+R     GQPG+PG L   G PG        
Sbjct  1002  PGLPGADGQPGFVGEA------GEPGTPGYR-----GQPGEPGNLAYPGQPGDVGYPGPD  1050

Query  1285  GRRGPPGRSGGPGLKGPRGDRGRP---SISFRGEPGEAGLDGYD---------------G  1326
             G  G PG+ G PGL G RGD G     +    G+PG+AG DG D               G
Sbjct  1051  GPPGLPGQDGLPGLNGERGDNGDSYPGNPGLSGQPGDAGYDGLDGVPGPPGYPGITGMPG  1110

Query  1327  LPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPGPLSTFF  1386
             L GE G+PG  GR G  G+PG+PG  G  G+DG PG  G  G  G +G  G+ G     +
Sbjct  1111  LKGESGLPGLPGRQGNDGIPGQPGLEGECGEDGFPGSPGQPGYPGQQGREGEKG-----Y  1165

Query  1387  KGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEA---GTPGPSGLPGLQGPKGMLGE  1443
              G  G+ GLPG  GQ GQPG +G  G  GQPG+ G A   GTPG  G PG  G  G  G 
Sbjct  1166  PGIPGENGLPGLRGQDGQPGLKGENGLDGQPGYPGSAGQLGTPGDVGYPGAPGENGDNGN  1225

Query  1444  SGFPGIPGNRGLPGFPGSPG  1463
              G  G PG RG  G PG PG
Sbjct  1226  QGRDGQPGLRGESGQPGQPG  1245


 Score = 274 bits (701),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 403/1001 (40%), Positives = 471/1001 (47%), Gaps = 170/1001 (17%)

Query  611   VMPPDGVKGLRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGY---------KGDKGNAG  661
               PP    G +G  G+PGF G  G PG  G  G  G PGAPG           G KG  G
Sbjct  35    CAPPCVCPGTKGERGNPGFGGEPGHPGAPGQDGPEGAPGAPGMFGAEGDFGDMGSKGARG  94

Query  662   DVGLPGMDGRP---GEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEG  718
             D GLPG  G P   G DGLPGL G           G PG+ G  GP G +G+ G+ G  G
Sbjct  95    DRGLPGSPGHPGLQGLDGLPGLKGEEGIPGCNGTDGFPGMPGLAGPPGQSGQNGNPGRPG  154

Query  719   DAG----------SHIIVIGEHGD---PGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGE  765
              +G              V GE G    PG  G  G+PG KG +GDPGP G PGFPG +G 
Sbjct  155   LSGPPGEGGVNSQGRKGVKGESGRSGVPGLPGNSGYPGLKGAKGDPGPYGLPGFPGVSGL  214

Query  766   PGLSQPGPPGLK----------------GYPG------IPGLAGPRGPKGFPGRDGFSGA  803
              G       G+K                 YP       +  L GP GP G  G  G  G 
Sbjct  215   KGRMGVRTSGVKGEKGLPGPPGPPGQPGSYPWASKPIEMEVLQGPVGPAGVKGEKGRDGP  274

Query  804   DGIPGPKGDRGDHGMGILGGDMGPPGFP---GSKGDRGDEGPQGATGRDGFPGSPGYKGT  860
              G P           G+LG D GPPG+P   G KGD GD G +G  G+DG PG+ G KG+
Sbjct  275   VGPP-----------GMLGLD-GPPGYPGLKGQKGDLGDAGQRGKRGKDGVPGNYGEKGS  322

Query  861   KGAPGLAGLSGLRGLPGDVGD-SYPGPP------GPRGAPGLALGRRGLPGIPGIRGIDG  913
             +G  GL G  G  G  G  G+  YPG P      GP G  G   G  G  G  G  G+ G
Sbjct  323   QGEQGLGGTPGYPGTKGGAGEPGYPGRPGFEGDCGPEGPLGEGTGEAGPHGAQGFDGVQG  382

Query  914   GVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTEGDRGTMGIPGQKG  973
             G      KG+ G  GL G  G  G +G PG  G PG  G+PG    +GDRG  G PG  G
Sbjct  383   G------KGLPGHDGLPGPVGPRGPVGAPGAPGQPGIDGMPGYT-EKGDRGEDGYPGFAG  435

Query  974   PNGRPGLPGTFGIDGPKGDPGA-----PGLDGLNGRD---GDAGESGDPGIPGQKGIPGD  1025
               G PG PG  G  G  G PG      PGLDG +GRD   G  G+ GDPG  G+KG PG 
Sbjct  436   EPGLPGEPGDCGYPGEDGLPGYDIQGPPGLDGQSGRDGFPGIPGDIGDPGYSGEKGFPGT  495

Query  1026  G----GFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGEP-GEVIGGEPGIPGERGESG  1080
             G    G P + G  GEPG PG IG  G PG  G  G+ GE  G    G PG  G+ G  G
Sbjct  496   GVNKVGPPGMTGLPGEPGMPGRIGVDGYPGPPGNNGERGEDCGYCPDGVPGNAGDPGFPG  555

Query  1081  LPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGKPGGKGIRGSPG-----F  1135
             + G  G  G  G  GD G+PG  G  G+ G  G  G PG  G PG  G++G  G      
Sbjct  556   MNGYPGPPGPNGDHGDCGMPGAPGKPGSAGSDGLSGSPGLPGIPGYPGMKGEAGEIVGPM  615

Query  1136  PGAFGLKGFSGEPGEPGFSGRPGPIGEPGFPGGPGFPGFPGVKGEPGETALL-AFGSPGE  1194
                 G+ G  G+ G PG  GRPG  G PG+PGGPG  GFPG++GEPG   +    G  G 
Sbjct  616   ENPAGIPGLKGDHGLPGLPGRPGSDGLPGYPGGPGQNGFPGLQGEPGLAGIDGKRGRQGS  675

Query  1195  SGLPGEKGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPGGPGQKGAPGEY-------G  1247
              G+PG +GP GD     F G PG  G  G+ GA G PG PG  G +G P          G
Sbjct  676   LGIPGLQGPPGDS----FPGQPGTPGYKGERGADGLPGLPGAQGPRGIPAPLRIVNQVAG  731

Query  1248  RDGAPGRPGPPGFRRDGPKGQPGDPGPLGPSGSPGLTGRRGPPGRSGGPGLKGPRGDRGR  1307
             + G  G PG PG R  G  G PG PGP+GP G PG  G RG  G  G PGL G  G RG+
Sbjct  732   QPGVDGMPGLPGDR--GADGLPGLPGPVGPDGYPGTPGERGMDGLPGFPGLHGEPGMRGQ  789

Query  1308  P-SISFR---GEPGEAGLDGY---------------------------------------  1324
                + F    G+ GE GLDGY                                       
Sbjct  790   QGEVGFNGIDGDCGEPGLDGYPGAPGAPGAPGETGFGFPGQVGYPGPNGDAGAAGLPGPD  849

Query  1325  -----DGLPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDP  1379
                  DGLPG  G PGE+G +G  G PG+PG RG  G  G  G +G DG  G++G  G P
Sbjct  850   GYPGRDGLPGTPGYPGEAGMNGQDGAPGQPGSRGESGLVGIDGKKGRDGTPGTRGQDGGP  909

Query  1380  GPLSTFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKG  1439
             G     + G  G PG  G  G PG PG +G+PG  GQ G+ G +G PG  GL G  G +G
Sbjct  910   G-----YSGEAGAPGQNGMDGYPGAPGDQGYPGSPGQDGYPGPSGIPGEDGLVGFPGLRG  964

Query  1440  MLGESGFPGIP---------GNRGLPGFPGSPGPDALPGPP  1471
               G++G PG+          G  G+PG+PG  G D LPG P
Sbjct  965   EHGDNGLPGLEGECGEEGSRGLDGVPGYPGEHGTDGLPGLP  1005


>Q9VMV5_DROME unnamed protein product
Length=1940

 Score = 812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1651 (44%), Positives = 880/1651 (53%), Gaps = 118/1651 (7%)

Query  134   GNPGYPGSRGPPGGFGPVGPPGDPGE---------GGINSVGVKGDRGDSGQPGGHGQDG  184
             G PG  G  G PG  G  GPPG PG+         GGINS G KG+RG++GQPGG G  G
Sbjct  126   GRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPG  185

Query  185   IPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNS------GYPGVKGEQGETGSPGP  238
               G  G  G  G  G  G  G PG PG KGD G  +       G PG KGE G++ S   
Sbjct  186   FDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLS---  242

Query  239   KGQQQVFPLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKGMKGERGPD  298
                  + P DT+  KG +G  G  GD G  G  G +G+ G +G+P      G +GE G  
Sbjct  243   ---GVLKPDDTL--KGYKGYVGLQGDEGPQGPTGEQGAVGRNGLP------GARGEIGGP  291

Query  299   GPRGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEGGEDGQPGPPGVQGTLGAPGEF  358
             G RGK G+DG+ G  G KG KGAPG+ G++G DG  GE GEDG  G PGVQG  G PG +
Sbjct  292   GERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIY  351

Query  359   DYNSDGVGVPGAPGFQGPT------------GLPGEAGESGLPGQPGDLGFRGPPGPPGP  406
             D  S    +PG  G QG              G PG  G  GL GQ GD G  G  GPP  
Sbjct  352   D-PSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP--  408

Query  407   EGVPGNPGQRGLSIKGDPGDDGVPGPPGRMGPPGGPGLPGSAGNKGLPGLTIMGPPGMDG  466
                       G S +G+ GD G  GPPG  GPPG  GLPG  G  G PG  ++GP G  G
Sbjct  409   ----------GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPG  458

Query  467   LPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGS  526
             L G+ G  G RGDRGE G+PG KG  G G  I GPPG QG PG  G PG  G  GL G  
Sbjct  459   LNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLP  518

Query  527   GLPGIKGEDCGYCPPGYPGAKGTDGDPGIPGASGLPGFHGLPGERGPKGLGGKGGPRGYQ  586
             G  G++G+DC  C  G  G +G +GD G PG+ G  G  GL G RG +GL G  G  G++
Sbjct  519   GEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHK  578

Query  587   GLTGRPGSAGLAGRQGPPGDPGQLVMPPDGVKGLRGPGGDPGFPGLMGLPGRNGNKGLPG  646
             GL G  G  G  G+ G  G  G+ +      KG  G  GD G  G  G  G  G  G  G
Sbjct  579   GLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDG  638

Query  647   PPGAPGYKGDKGNAGDVGLPGMDGRPGEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRG  706
               G  G  G +G+ GD G  G DG PG DG  G  G NA  PK +L GEPG +G +G RG
Sbjct  639   SKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERG  698

Query  707   PTGEKGHKGEEGDAGSHIIVIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGEP  766
               G+ G KG +G+     I     G+PG  G+ G  G KG +G+ G  G  G  G  G  
Sbjct  699   DDGDTGFKGVKGEPNPGQIYD-NTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPA  757

Query  767   GLSQPGPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMG  826
             G   PGP G KGYPG  G  G +G  G PGRDG  G DG  G KG RG  G  ++ G++G
Sbjct  758   GEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIG  817

Query  827   PPGFPGSKGDRGDEGPQGATGRDGFPGSPGYKGTKGAPGLAGLSGLRGLPGDVGDSYPGP  886
             PPG  G KG  GD G  G  G  G PG  G KG +G  G  G +GL G  G  GD +   
Sbjct  818   PPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGD-FLVG  876

Query  887   PGPRGAPGLALGRRGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDG  946
             P          GR+   G  G +G  G +G  G  G +G  G +G RG+ GN G+ GL G
Sbjct  877   PPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPG  936

Query  947   LPGRQGLPGLPGTEGDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDG  1006
              PG  GLPG+ G  G+RG +G  G++G  G  G  G FG  G  GD G  G  G NG  G
Sbjct  937   SPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPG  996

Query  1007  DAGESGDPGIPGQKGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVI  1066
               GE+G+PG PG+ G  G   +  + GD GE G  G IG  G PG  G +G +G+    +
Sbjct  997   RKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGAKGQRGPVGDSQPAL  1056

Query  1067  GGEPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGKPGG  1126
              G  G  GE G  G  G+ GR G KG  GD G+PG++G  G    PG +G  G+ G+ G 
Sbjct  1057  DGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGE---PGAKGLGGYPGRNGI  1113

Query  1127  KGIRGSPGFPGAFGLKGFSGEPGEPGFSGRPGPIGEP---------------------GF  1165
              G++G+ GFPG  G KG  GE G  G  GR G IG+                      G 
Sbjct  1114  NGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGI  1173

Query  1166  PGG----------PGFPGFPGVKGEPGETALLA-FGSPGESGLPGEKGPVGDRGDAGFSG  1214
             PG            GF G  G++GE GE   +   G  G  G  GE+G +G  G  GF G
Sbjct  1174  PGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDG  1233

Query  1215  GPGLKG-----------------EPGDFGAA---GKPGRPGGPGQKGAPGEYGRDGAPGR  1254
               GLKG                 E GD G A   G+ GRPG  GQKGAPG  G +G  G 
Sbjct  1234  AEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGA  1293

Query  1255  PGPPGFRRDGPKGQPGDPGPLGPSGSPGLTGRRGPPGRSGGPGLKGPRGDRGRPSISFRG  1314
              G  G +  GP G  GD G  G  G  G  G  GP G  G  G +G RG+ G   +  +G
Sbjct  1294  IGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQG  1353

Query  1315  EPGEAGLD---GYDGLPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQG  1371
             + G+ G     G+DG  GE+G PG  G++G +G    PGPRG  GD G  G+ G+DG  G
Sbjct  1354  DIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGA---PGPRGPTGDAGWGGIDGMDGLVG  1410

Query  1372  SKGDIGDPGPLSTFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGL  1431
              KG  G     S    G +G+PGL GF G+ G  G  G  G  GQ G  G  G  G  G 
Sbjct  1411  PKGQPGVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGY  1470

Query  1432  PGLQGPKGMLGESGFPGIPGNRGLPGFPGSPGPDALPGPPPRSRGFFFTRHSQTVFQPPC  1491
              G  GP+G  G+ G+ G+ G  GL G PG  G  A   P P+SRGF F RHSQ+V  P C
Sbjct  1471  TGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQSVHVPQC  1530

Query  1492  PAGTTKLWDGYSLLHFTGDGKARGQDLGAPGSCLSKFSTMPFLFCNLNNVCNYASRNDYS  1551
             PA T  LW+GYSL       +A GQDLG  GSC+ +F+TMP++ C++ NVC++A  ND S
Sbjct  1531  PANTNLLWEGYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDS  1590

Query  1552  YWLSTPEPMPMSMTPITGREIRKFVSKCSVCESTTHVIAVHSQTMDTPDCPSDWEQLWIG  1611
              WLST EPMPM+MTPI GR++ K++S+C VCE+TT +IA+HSQ+M  PDCP  WE++W G
Sbjct  1591  LWLSTAEPMPMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTG  1650

Query  1612  YSFLMHTDSGSEGAGQPLVSPGSCLEEFRAVPFIECHGQGRCNFYTTASSYWLATIEEYE  1671
             YS+ M T     G GQ LVSPGSCLEEFRA P IECHG GRCN+Y   +S+WL  IEE +
Sbjct  1651  YSYFMSTLDNVGGVGQNLVSPGSCLEEFRAQPVIECHGHGRCNYYDALASFWLTVIEEQD  1710

Query  1672  QFRRPRSQTLKAGDLTTKVSRCAVCRRKHRS  1702
             QF +PR QTLKA D T+K+SRC VCRR+  S
Sbjct  1711  QFVQPRQQTLKA-DFTSKISRCTVCRRRGNS  1740


 Score = 291 bits (744),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 410/1060 (39%), Positives = 488/1060 (46%), Gaps = 196/1060 (18%)

Query  131   GDRGNPGYPGSRGPPGGFGPVGPPGDPGE---------------------GGINSVGVKG  169
             G +GNPG  G +G PG   P G PG+PG+                     G     G +G
Sbjct  567   GLQGNPGRAGHKGLPG---PAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRG  623

Query  170   DRGDSGQPGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGE--TNS------  221
             D GD G+ G  G DG  G  G  G +G  GD GY G  G PG  G DG    N+      
Sbjct  624   DTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVY  683

Query  222   -----GYPGVKGEQGETGSPGPKGQQQVFPLDTIFWKGPRGLPGP---PGDRGIPGEKGF  273
                  GY G+KGE+G+ G  G              +KG +G P P     + G PGE G+
Sbjct  684   LIGEPGYDGIKGERGDDGDTG--------------FKGVKGEPNPGQIYDNTGEPGEDGY  729

Query  274   EGSKGLDGVPGFVGSKGMKGERGPDGPRGK-----QGRDGQSGPSGLKGAKGAPGYAGSN  328
              G KG+ G  G  G+ G++GE G  GP G+      G  G  GP+G  G +GAPG  G +
Sbjct  730   TGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRD  789

Query  329   GA---DGGKGEGGEDGQPGPPGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGE  385
             G    DGG G  G+ G PG   +QG +G PG            G  GF G  G PG+ G 
Sbjct  790   GEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGR----------SGIKGFPGDVGAPGQYGL  839

Query  386   SGLPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSIKGDPGDDGVPGPPGRMGPPGGPGLP  445
             +G PG  G  G +GP G  G  G+PGN GQRG  + G PG  G PG  GR  P G  G  
Sbjct  840   AGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQK  899

Query  446   GSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQ  505
             G  G+        +G  G +G  G  GF G RG  G AG+                   Q
Sbjct  900   GEVGS--------LGQNGQNGAKGSIGFSGRRGLLGNAGL-------------------Q  932

Query  506   GLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCPP------GYPGAKGTDGDPGIPGAS  559
             GLPG PG PG PG+ G  G  G  G  G      P       G  G  G DG  G PGA+
Sbjct  933   GLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGAN  992

Query  560   GLPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSAGLAGRQGPPGDPGQLVMPPDGVKG  619
             GLPG  G  G  G  G  G  G   Y G+ G  G +GL G  G PG P        G KG
Sbjct  993   GLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAP--------GAKG  1044

Query  620   LRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGYKGDKGNAGDVGLPGMDGRPGEDGLPG  679
              RGP GD   P L G+ GR G  G PGP G PG  G KG  GD GLPG  GRPGE G  G
Sbjct  1045  QRGPVGDS-QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKG  1103

Query  680   LDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEGDAGSHIIVIGEHGDPGPQGFR  739
             L G         L+G  G  G +GP+GP GE G  G +G         G+ GD GP+G  
Sbjct  1104  LGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRN-------GQIGDQGPRGLI  1156

Query  740   GWPGDKGHRGDPGPGGFPG----------FPGRNGEPGLS----QPGPPGLKGYPGIPGL  785
             G  G++G +GD G  G PG          + G  G+ GL     + G  G  G+ G PG 
Sbjct  1157  GEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGA  1216

Query  786   AGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMGPPG--FPGSKGDRGDEGPQ  843
              G RG  G+ G+ GF GA+G+ G +GD+G           GPPG   P  KGD      +
Sbjct  1217  KGERGDIGYAGQLGFDGAEGLKGFQGDQGPR---------GPPGITLPAEKGD------E  1261

Query  844   GATGRDGFPGSPGYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLP  903
             G  G DG  G PG+ G KGAPG  G +G  G  G  G    GPPGP+G         G P
Sbjct  1262  GVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDV-------GFP  1314

Query  904   GIPGIRGIDGGVGP---LGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTE  960
             G PG  G  G +GP   LGD G QGE G +G         I G  G  G  G  G PG +
Sbjct  1315  GAPGHNGRHGLIGPKGELGDMGRQGERGESG-------YAIVGRQGDIGDIGFQGEPGWD  1367

Query  961   GDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAGESGDPGIPGQK  1020
             G +G  G PG  G NGR G P      GP+G  G  G  G++G DG  G  G PG+    
Sbjct  1368  GAKGEQGYPGLPGKNGRVGAP------GPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSY  1421

Query  1021  GIPGDGGFPAVPGDRGEP---GFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGERG  1077
              +       A PGDRGEP   GF GE G  G PG  G +GQ         G  G  G++G
Sbjct  1422  SM-------ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQR--------GAVGYRGDQG  1466

Query  1078  ESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGR  1117
             E G  G  G  GQ+G  G MG+ G  G+   RG PG QG 
Sbjct  1467  EVGYTGADGPQGQRGDKGYMGLTGAPGL---RGLPGPQGE  1503


 Score = 270 bits (691),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 436/1180 (37%), Positives = 516/1180 (44%), Gaps = 267/1180 (23%)

Query  472   GFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGI  531
             G  G  G  G  GVPG +GPAG      GPPG  G  G  G  G  G  G  G  G  G 
Sbjct  42    GIKGRMGAPGPIGVPGLEGPAG----DIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGP  97

Query  532   KGEDCGYCPPGYPGAKGTDGDPGIPGASGLPGFHGLPGERGPKGLGGKGGPRGYQGLTGR  591
             KGE       GYPG  G  G+PG PG  G+ G  G PG +GP G  G+ G RG       
Sbjct  98    KGE------MGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRG-------  144

Query  592   PGSAGLAGRQGPPGDPGQLV---------MPPDGVKGLRGPG---------------GDP  627
                        PPG PGQ           +   G KG RG                 G  
Sbjct  145   -----------PPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSK  193

Query  628   GFPGLMGLPGRNGNKGLPGPPGAPGYKGDKGNAGDV--------GLPGMDGRPGEDGLPG  679
             G  G  GL G  G+ GLPGP         KG+ G V        G PG  G PG D L G
Sbjct  194   GDTGYAGLTGEKGDPGLPGP---------KGDTGAVSELPYSLIGPPGAKGEPG-DSLSG  243

Query  680   LDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEGDAGS--HIIVIGEHGDPGPQG  737
             +  P+  +  +  +G  GL G  GP+GPTGE+G  G  G  G+   I   GE G PG  G
Sbjct  244   VLKPDDTL--KGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDG  301

Query  738   FRGWPGDKGHRGDP---GPGGFPGFPGRNGEPGLSQPGPPGLKGYPGIPGLAGP------  788
               G  GDKG +G P   G  G  G PG  GE G +  G PG++G  G PG+  P      
Sbjct  302   EPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFT--GMPGVQGGAGPPGIYDPSLTKSL  359

Query  789   ---------------------------RGPKGFPGRDGFSGADGIPGP-----KGDRGDH  816
                                        RGP G  G+ G  G +G  GP     +G+ GD+
Sbjct  360   PGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDY  419

Query  817   ---------------------------GMGILG--GDMGPPGFPGSKGDRGDEGPQGATG  847
                                        G  ++G  G+ G  G PG +G RGD G  G  G
Sbjct  420   GFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPG  479

Query  848   RDGFPGSPGYKGT-----------KGAPGLAGLSGLRGLPGDV---GDSYP----GPPGP  889
               G PG  GY              +G PG  G +GLRGLPG+    GD  P    GP GP
Sbjct  480   DKGLPGE-GYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGP  538

Query  890   RGAPGLALGRRGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPG  949
             RG  G      G PG  G RG  G  GP G +G+QG PG  G +G+ G  GIP   G PG
Sbjct  539   RGQEGDT----GYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIP---GEPG  591

Query  950   RQGLPGLPGTEGDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAG  1009
             + G  G  G   + G++   G+ G  G  G  G  G DG KG  G+ G  G  G  G  G
Sbjct  592   KVGAAGPDGKAIEVGSL-RKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRG  650

Query  1010  ESGDPGIPGQKGIPGDGGFPAVPGDR---------GEPGFPGEIGPRGNPGFNGLKGQLG  1060
             + GD G  G+ G PG  G    PG           GEPG+ G  G RG+ G  G KG  G
Sbjct  651   DYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGVKG  710

Query  1061  E--PGEVI--GGEPGIPGERGESGLPGVSGRGGQKGIMGDMG--------IP--------  1100
             E  PG++    GEPG  G  G  G+ G  G  G  G+ G++G        IP        
Sbjct  711   EPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGY  770

Query  1101  ----GEKGMAGNRGFPGRQGRPGWSGKPGGKGIRGSPGF---------PGAFGLKGFSGE  1147
                 G+ G  G  G PGR G PG  G  G KG RG PG          PG  G+KGF G+
Sbjct  771   PGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKGFPGD  830

Query  1148  ---PGEPGFSGRPGP---IGEPGFPGGPGFPGFPGVKGEPGETALL--------------  1187
                PG+ G +GRPGP    GE G  G  G  G PG KG+ G+  +               
Sbjct  831   VGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQ  890

Query  1188  ----AFGSPGESGLPGEKGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPGGPGQKGAP  1243
                 A G  GE G  G+ G  G +G  GFSG  GL G  G  G  G PG PG PG  G  
Sbjct  891   APHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGSPGIPGLPGMIGEI  950

Query  1244  GEYGRDGAPGRPGPPGFRRDGPKGQPGDPGPLGPSGSPGLTGRRGPPGRSGGPGLKGPRG  1303
             GE G  G  GR G  G R           GP G  G  GL+G  GP G  G  GL G +G
Sbjct  951   GERGEIGYNGRQGDIGPR-----------GPNGEFGPKGLSGDDGPDGYPGANGLPGRKG  999

Query  1304  DRGRPSISFRGEPGEAGLDGYDGLPGERGIPGESGRDGFIGLPGRPGPRG--GPGDDGRP  1361
             + G P   F G PG  G+  Y G+ G+    GESG  G IG PG PG +G  GP  D +P
Sbjct  1000  ETGNP--GFPGRPGAKGVAAYSGIKGD---DGESGLTGPIGYPGAPGAKGQRGPVGDSQP  1054

Query  1362  GLRGIDGRQGSKGDIGDPGPL----STFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQP  1417
              L G+ GR   KG++G PGP         KG +GD GLPG  G+PG+PG +G     G P
Sbjct  1055  ALDGVAGR---KGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGL---GGYP  1108

Query  1418  GFQGEAGTPGPSGLPGLQGPKGMLGESGFPGIPGNRGLPG  1457
             G  G  G  G +G PG QGPKG  GESG  G+ G  G  G
Sbjct  1109  GRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIG  1148


 Score = 224 bits (570),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 346/897 (39%), Positives = 421/897 (47%), Gaps = 136/897 (15%)

Query  632   LMGLPGRNGNKGLPGPPGAPGYKGDKGNAGDVGLPGMDGRPGEDGLPGLDGPNADIPKQF  691
             L    G  G  G PGP G PG +G    AGD+G PG  G  GE G         D+ +  
Sbjct  37    LCDCKGIKGRMGAPGPIGVPGLEGP---AGDIGPPGRAGPLGEKG---------DVGEYG  84

Query  692   LRGEPGLNGFRGPRGPTGEKGHKGEEGDAGS--HIIVIGEHGDPGPQGFRGWPGDKGHRG  749
              +GE G  G  GP+G  G  G  G+ G+ G+     + G  G PG QG  G PG  G RG
Sbjct  85    EQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRG  144

Query  750   DPGPGG--------------FPGFPGRNGEPGLSQPGPP-------GLKGYPGIPGLAGP  788
              PG  G                G  G  GE G      P       G KG  G  GL G 
Sbjct  145   PPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGE  204

Query  789   RGPKGFPGRDGFSGA--------DGIPGPKGDRGDHGMGILGGDMGPPGFPGSKGDRGDE  840
             +G  G PG  G +GA         G PG KG+ GD   G+L  D    G+ G  G +GDE
Sbjct  205   KGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDE  264

Query  841   GPQGATGRDGFPGS---PGYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLAL  897
             GPQG TG  G  G    PG +G  G PG  G  G  G PG  GD                
Sbjct  265   GPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDK---------------  309

Query  898   GRRGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLP  957
             G +G PG  G  G+D      G  G +GE G TG+ G+ G  G PG+      + LPG  
Sbjct  310   GMKGAPGWTGADGLD------GSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPI  363

Query  958   GTEGDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRD--GDAGESGDPG  1015
             G++GD G  G  G  G  G+PG  G  G+ G  GDPG  G  G  GR   G+AG+ G  G
Sbjct  364   GSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIG  423

Query  1016  IPGQKGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPGFN---GLKGQLGEPGEV-IGGEPG  1071
              PG +G PG+ G P   G  GEPG    +GP+G PG N   GL+G  G+ GEV + G+ G
Sbjct  424   PPGPQGPPGEAGLPGRYGLHGEPG-QNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKG  482

Query  1072  IPGE-------------RGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRP  1118
             +PGE              G  GLPG  G  G +G+ G+ G+ G+     N G  G +G+ 
Sbjct  483   LPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQE  542

Query  1119  GWSGKPGGKGIRGSPGFPGAFGLKGFSGEPGEPGFSGRPGPIGEPGFPGGPGFPGFPGVK  1178
             G +G PG  G RG+ G  G  G++G  G PG  G  G PGP    G PG PG  G  G  
Sbjct  543   GDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPA---GIPGEPGKVGAAGPD  599

Query  1179  GEPGETALLAFGSPGESGLPGEKGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPGGPG  1238
             G+  E   L  G  G++G  G +G  GD G+ G  G  G KGE G+ G  G  G  G  G
Sbjct  600   GKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQG  659

Query  1239  QKGAPGEYGRDGAPGRP---------GPPGFRRDGPKGQPGDPGPLGPSGSPGL------  1283
             + G PG  GRDGAPGR          G PG+  DG KG+ GD G  G  G  G       
Sbjct  660   RDGEPGRDGRDGAPGRNATTPKVYLIGEPGY--DGIKGERGDDGDTGFKGVKGEPNPGQI  717

Query  1284  ---TGRRGPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAGLDGYDGLPGERGIPGESGRD  1340
                TG  G  G +G  G+KG +G++G  +I  RGE G+ G       P    IPG  G  
Sbjct  718   YDNTGEPGEDGYTGPKGVKGAKGEQG--AIGLRGEIGDRG-------PAGEVIPGPVGAK  768

Query  1341  GFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPGPLSTFFKGAQGDPGLPGFSG  1400
             G+      PGP G  G  G PGL G DG  G  G IG        +KG +G PG     G
Sbjct  769   GY------PGPTGDYGQQGAPGLPGRDGEPGLDGGIG--------YKGQRGVPGQEVIQG  814

Query  1401  QPGQPGR---RGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKGMLGESGFPGIPGNRG  1454
             + G PGR   +GFPG  G PG  G AG PGP G+ G QGP G +G++G PG  G RG
Sbjct  815   EIGPPGRSGIKGFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRG  871


 Score = 217 bits (553),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 320/832 (38%), Positives = 384/832 (46%), Gaps = 139/832 (17%)

Query  129   PPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGV---KGDRGDSGQPGGHGQDGI  185
             P G +G  G  G+ G  G  G  GP G+   G + + G     GD G  G PG  G+DG 
Sbjct  732   PKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGE  791

Query  186   PGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQGETGSPGPKGQQQVF  245
             PG  G  GY+G                         G PG +  QGE G PG  G +  F
Sbjct  792   PGLDGGIGYKG-----------------------QRGVPGQEVIQGEIGPPGRSGIKG-F  827

Query  246   PLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKGMKGERG-----PDGP  300
             P D        G PG  G  G PG KG +G +G DG  G  G  G KG+RG     P GP
Sbjct  828   PGDV-------GAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGP  880

Query  301   RGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEGGEDGQPGPPGVQGTLGAPGEFDY  360
             +G+ GR+G+  P G KG KG  G  G NG +G KG  G  G+ G  G  G  G PG    
Sbjct  881   KGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNAGLQGLPGS---  937

Query  361   NSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSI  420
                    PG PG  G  G  GE GE G  G+ GD+G RGP G  GP+G+ G+ G  G   
Sbjct  938   -------PGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGY--  988

Query  421   KGDPGDDGVPGPPGRMGPPGGPGLPGSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGDR  480
                PG +G+PG  G  G PG PG PG+ G     G  I G  G  GL G  G+PG  G +
Sbjct  989   ---PGANGLPGRKGETGNPGFPGRPGAKGVAAYSG--IKGDDGESGLTGPIGYPGAPGAK  1043

Query  481   GEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCP  540
             G+ G  G   PA  GV  R   GE G PG  G PG  GL G  G  GLPG +G       
Sbjct  1044  GQRGPVGDSQPALDGVAGR--KGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGR------  1095

Query  541   PGYPGAKGTDGDPGIPGASGLPGFHGLPGERGPKGLGGKGGPRGYQGLTGR---------  591
             PG PGAKG  G PG  G +GL G  G PG +GPKG  G+ G  G  G  G+         
Sbjct  1096  PGEPGAKGLGGYPGRNGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGL  1155

Query  592   ----------------------------------PGSAGLAGRQGPPGDPGQL-VMPPDG  616
                                                G  GL G +G  GD G +  + P G
Sbjct  1156  IGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPG  1215

Query  617   VKGLRGP---GGDPGFPGLMGLPGRNGNKGLPGPPGA--PGYKGDKGNA---GDVGLPGM  668
              KG RG     G  GF G  GL G  G++G  GPPG   P  KGD+G A   G  G PG 
Sbjct  1216  AKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGH  1275

Query  669   DGRPGEDGLPGLDGPNADIPKQ--------------FLRGEPGLNGFRGPRGPTGEKGHK  714
              G+ G  G PG +GPN  I  +                 G PG NG  G  GP GE G  
Sbjct  1276  FGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDM  1335

Query  715   GEEGDAG-SHIIVIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGEPGLSQP-G  772
             G +G+ G S   ++G  GD G  GF+G PG  G +G+    G+PG PG+NG  G   P G
Sbjct  1336  GRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQ---GYPGLPGKNGRVGAPGPRG  1392

Query  773   PPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMGPPGFPG  832
             P G  G+ GI G+ G  GPKG PG   +S +   PG +G+ G  G     GD G PG  G
Sbjct  1393  PTGDAGWGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIG  1451

Query  833   SKGDRGDEGPQGATGRDGFPGS---PGYKGTKGAPGLAGLSGLRGLPGDVGD  881
              +G RG  G +G  G  G+ G+    G +G KG  GL G  GLRGLPG  G+
Sbjct  1452  FQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1503


 Score = 163 bits (412),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 260/706 (37%), Positives = 306/706 (43%), Gaps = 139/706 (20%)

Query  122   FKVAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGIN-SVGVKGDRGDSGQPGGH  180
             F V P  P G  G  G     G  G  G VG  G  G+ G   S+G  G R         
Sbjct  873   FLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRR---------  923

Query  181   GQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQGETGSPGPKG  240
                   G  G  G QG PG PG  G PG  GE G+ GE      G  G QG+ G  GP G
Sbjct  924   ------GLLGNAGLQGLPGSPGIPGLPGMIGEIGERGEI-----GYNGRQGDIGPRGPNG  972

Query  241   QQQVFPLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKGMKGERGPDGP  300
             +            GP+GL G  G  G PG  G  G KG  G PGF G  G KG     G 
Sbjct  973   E-----------FGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGI  1021

Query  301   RGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEGGEDGQPGPPGVQGTLGAPGEFDY  360
             +G  G  G +GP G  GA GA G  G  G          D QP   GV G  G       
Sbjct  1022  KGDDGESGLTGPIGYPGAPGAKGQRGPVG----------DSQPALDGVAGRKGE------  1065

Query  361   NSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSI  420
                 VG PG  G  G  GL G+ G+ GLPGQ      +G PG PG +G+ G PG+ G  I
Sbjct  1066  ----VGSPGPNGLPGRHGLKGQRGDRGLPGQ------QGRPGEPGAKGLGGYPGRNG--I  1113

Query  421   KGDPGDDGVPGPPGRMGPPGGPGLPGSAGNKGLPGLTIMGPPGMD---------------  465
              G  G  G PGP G  GP G  G+ G  G  G  G    GP G+                
Sbjct  1114  NGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIG--DQGPRGLIGEQGEQGEQGDEGEV  1171

Query  466   GLPGR----------DGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPG  515
             G+PGR           GF G +G +GE G  G  GP GF     GPPG +   G  G  G
Sbjct  1172  GIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGF----IGPPGAK---GERGDIG  1224

Query  516   FPGLPGLDGGSGLPGIKGEDCGYCPPGY--PGAKGTDGDPGIPGASGLPGFHGL------  567
             + G  G DG  GL G +G+     PPG   P  KG +G  G+ G +G PG  G       
Sbjct  1225  YAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGP  1284

Query  568   PGERGPKGLGGKGGPR--------------------GYQGLTGRPGSAGLAGRQGPPGDP  607
             PGE GP G  G  GP+                    G  GL G  G  G  GRQG  G+ 
Sbjct  1285  PGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGES  1344

Query  608   GQLVMPPDGVKGLRGPGGDPGFPGLMGLPGRNGNKGLPGPP------GAPGYKGDKGNAG  661
             G  ++      G +G  GD GF G  G  G  G +G PG P      GAPG +G  G+AG
Sbjct  1345  GYAIV------GRQGDIGDIGFQGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAG  1398

Query  662   DVGLPGMDGRPGEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEGDAG  721
               G+ GMDG  G  G PG+   +  + +   RGEPGL+GF+G  G  G  G  G +G  G
Sbjct  1399  WGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG  1457

Query  722   SHIIVIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGEPG  767
             +    +G  GD G  G+ G  G +G RGD G  G  G PG  G PG
Sbjct  1458  A----VGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG  1499


 Score = 150 bits (379),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 256/748 (34%), Positives = 312/748 (42%), Gaps = 190/748 (25%)

Query  856   GYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLPGIPGIRGIDGGV  915
             G KG  GAPG  G+ GL G  GD+G     PPG                           
Sbjct  42    GIKGRMGAPGPIGVPGLEGPAGDIG-----PPGR-------------------------A  71

Query  916   GPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTEGDRGTMGIPGQKGPN  975
             GPLG+KG  GE G  G +G  G++G  G  G PG  G  G PGT G RG  G       +
Sbjct  72    GPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGC------D  125

Query  976   GRPGL------PGTFGIDGPKGDPG--------------APGLDGLNGRDGDAGESGDPG  1015
             GRPG+      PG  G+ GP G PG              + G  G  G  G  G  G PG
Sbjct  126   GRPGMQGPSGAPGQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPG  185

Query  1016  IPGQKGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPG--------FNGLKGQLGEPGEVIG  1067
               G +G  GD G+  + G++G+PG P   GP+G+ G          G  G  GEPG+ + 
Sbjct  186   FDGDRGSKGDTGYAGLTGEKGDPGLP---GPKGDTGAVSELPYSLIGPPGAKGEPGDSLS  242

Query  1068  G----EPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGK  1123
             G    +  + G +G  GL G  G  G  G  G +G  G  G  G  G PG +G+PG  G+
Sbjct  243   GVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGE  302

Query  1124  P---GGKGIRGSPGFPGAFGLKGFSGEPGEPGFSGR---------------------PGP  1159
             P   G KG++G+PG+ GA GL G  GE GE GF+G                      PGP
Sbjct  303   PGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGP  362

Query  1160  IGEP------------------------GFPGGPGFPGFPGVKGEPGETAL---------  1186
             IG                          G  G  G PG  G +G PG +           
Sbjct  363   IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFI  422

Query  1187  ---------LAFGSPGESGLPGE--KGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPG  1235
                         G PG  GL GE  +  VG +G+ G +G PGL+G  GD G  G PG  G
Sbjct  423   GPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKG  482

Query  1236  GPGQ----------------KGAPGEYGRDGAPGRPGPPGFRRDGPKGQPGDPGPLGPSG  1279
              PG+                +G PG+ G +G  G PG  G R D       + GP GP G
Sbjct  483   LPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGD--DCPVCNAGPRGPRG  540

Query  1280  SPGLTGRRGPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAGLDGYDGLPGERGIPGESG-  1338
               G TG  G  G  G  GL GPRG +G      +G PG A   G+ GLPG  GIPGE G 
Sbjct  541   QEGDTGYPGSHGNRGAIGLTGPRGVQG-----LQGNPGRA---GHKGLPGPAGIPGEPGK  592

Query  1339  ----------------RDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPGPL  1382
                             R G IG  G  G RG  GDDG  G  G DG +G +G+ G     
Sbjct  593   VGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQ----  648

Query  1383  STFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKGMLG  1442
                 +G  GD G  G  G+PG+ GR G PGR          G PG  G+ G +G  G  G
Sbjct  649   ----RGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTG  704

Query  1443  ESGFPGIPGNRGLPGFPGSPGPDALPGP  1470
               G  G P    +    G PG D   GP
Sbjct  705   FKGVKGEPNPGQIYDNTGEPGEDGYTGP  732


 Score = 141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 237/616 (38%), Positives = 274/616 (44%), Gaps = 85/616 (14%)

Query  929   LTGLRGMDGNLGIPGLDGLPGRQGLPG---LPGTEGDRGTMGIPGQKGPNGRPGLPGTFG  985
             +T   G   N  +    G+ GR G PG   +PG EG  G +G PG+ GP G  G  G +G
Sbjct  25    VTLADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYG  84

Query  986   IDGPKGDPGAPGLDGLNGRDGDAGESGDPGIPGQKGIPGDGGFPAVPGDRGEPGFPGEIG  1045
               G KG  G  G  G  G  G  G+SG+PG PG +GI G  G P + G  G PG  G  G
Sbjct  85    EQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRG  144

Query  1046  PRGNPGFNGLKGQLGEPGEVIGGEPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGM  1105
             P G PG  G  G+ GE G    G  G  GE G+ G  G  G  G +G  GD G  G  G 
Sbjct  145   PPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGE  204

Query  1106  AGNRGFPGRQGRPG--------WSGKPGGKGIRGSPGFPGAF----GLKGFSGEPGEPGF  1153
              G+ G PG +G  G          G PG KG  G     G       LKG+ G  G  G 
Sbjct  205   KGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDS-LSGVLKPDDTLKGYKGYVGLQGD  263

Query  1154  SGRPGPIGEPGFPGGPGFPGFPGVKGEPGETALLAFGSPGESGLPGEKGPVGDRGDAGFS  1213
              G  GP GE G  G  G PG  G  G PGE      G PG+ G PG  G  G +G  G++
Sbjct  264   EGPQGPTGEQGAVGRNGLPGARGEIGGPGER-----GKPGKDGEPGRFGDKGMKGAPGWT  318

Query  1214  GGPGLKGEPGDFGAAGKPGRPGGPGQKGAPGEYGRDGAPGRPGPPGFRRD----------  1263
             G  GL G PG+ G  G  G PG  G  G PG Y        PGP G + D          
Sbjct  319   GADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPP  378

Query  1264  ---GPKGQPGDPGPLGPSGSPGLTGRRGPPGRS--------------------GGPGLKG  1300
                G  G+ G  G  G SG PGL G RGPPGRS                    G  GL G
Sbjct  379   GLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPG  438

Query  1301  PRGDRGRPSISFRGEPGEAGLDGYDGLPGERGIPGESGRDGFIGLPGR------------  1348
               G  G P  +  G  GE GL+G  GL G RG  GE G  G  GLPG             
Sbjct  439   RYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQG  498

Query  1349  -PGPRGGPGDDGRPGLRGIDGRQGSKGD---IGDPGPL-------STFFKGAQGDPGLPG  1397
              PG RG PGDDG  GLRG+ G +G +GD   + + GP         T + G+ G+ G  G
Sbjct  499   PPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIG  558

Query  1398  FSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKGML--------GESGFPGI  1449
              +G  G  G +G PGRAG  G  G AG PG  G  G  GP G          GE G  G 
Sbjct  559   LTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGD  618

Query  1450  PGNRGLPGFPGSPGPD  1465
              G+RG  G  G  G D
Sbjct  619   SGHRGDTGDDGEKGRD  634


 Score = 108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 175/491 (36%), Positives = 203/491 (41%), Gaps = 82/491 (17%)

Query  117   LVFRAFKVAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGVKGDRGDSGQ  176
             +  R  +V    P G  G  G  G RG  G  G  G PG+P        G KG  G  G+
Sbjct  1059  VAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEP--------GAKGLGGYPGR  1110

Query  177   PGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDG-------------------  217
              G +G  G  GF GP G +GP G+ G  G  G  G+ GD G                   
Sbjct  1111  NGINGLKGATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGE  1170

Query  218   ----------ETNSGYPGVKGEQGETGSPGPKGQQQVFPLDTIFWKGPRGLPGPPGDRGI  267
                          S Y G  G+QG  G  G +G             GP G  GPPG +G 
Sbjct  1171  VGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDM-----------GPIGFIGPPGAKGE  1219

Query  268   PGEKGFEGSKGLDGVPGFVGSKGMKGERGPDGPRGKQGRDGQSGPSGLKGAKGAPGYAGS  327
              G+ G+ G  G DG  G    KG +G++GP GP G            L   KG  G AG 
Sbjct  1220  RGDIGYAGQLGFDGAEGL---KGFQGDQGPRGPPGIT----------LPAEKGDEGVAGL  1266

Query  328   NGADGGKGEGGEDGQPGPPGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGESG  387
             +G  G  G  G+ G PGPPG  G  GA G              P  QGP G  G+ G  G
Sbjct  1267  DGRAGRPGHFGQKGAPGPPGENGPNGAIGHR-----------GPQIQGPPGPQGDVGFPG  1315

Query  388   LPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSIKGDPGD------DGVPGPPGRMGPPGG  441
              PG  G  G  GP G  G  G  G  G+ G +I G  GD       G PG  G  G  G 
Sbjct  1316  APGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGY  1375

Query  442   PGLPGSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGP  501
             PGLPG  G  G PG    GP G  G  G DG  GL G +G+ GV      A  G   RG 
Sbjct  1376  PGLPGKNGRVGAPG--PRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPG--DRGE  1431

Query  502   PGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCPPGYPGAKGTDGDPGIPGASGL  561
             PG  G  G  G  G PGL G  G  G  G +G+       G  G +G  GD G  G +G 
Sbjct  1432  PGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGA  1491

Query  562   PGFHGLPGERG  572
             PG  GLPG +G
Sbjct  1492  PGLRGLPGPQG  1502


 Score = 105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 184/480 (38%), Positives = 211/480 (44%), Gaps = 98/480 (20%)

Query  1053  NGLKGQLGEPGEVIGGEPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFP  1112
              G+KG++G PG +  G PG+ G  G+ G PG +G  G+KG +G+ G  GEKG  G+ G  
Sbjct  41    KGIKGRMGAPGPI--GVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPK  98

Query  1113  GRQGRPGWSGKPGGKGIRGSPGFPGAFGLKGFSGEPGEPGFSGRPGPIGEPGFPGGPGFP  1172
             G  G PG  GK                     SGEPG PG  G  G  G PG  G  G P
Sbjct  99    GEMGYPGIMGK---------------------SGEPGTPGPRGIDGCDGRPGMQGPSGAP  137

Query  1173  GFPGVKGEPGE---------TALLAFGSPGESGLPGEK---------GPVGDRGDAGFSG  1214
             G  GV+G PG+                S G  G  GE          G  GDRG  G +G
Sbjct  138   GQNGVRGPPGKPGQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTG  197

Query  1215  GPGLKGEPGDFGAAGKPGRPGGPGQKGAPGE--YGRDGAPGRPGPPGFRRDGP-------  1265
               GL GE GD      PG PG  G  GA  E  Y   G PG  G PG    G        
Sbjct  198   YAGLTGEKGD------PGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLSGVLKPDDTL  251

Query  1266  ------KGQPGDPGPLGPSGSPGLTGRRGPP---GRSGGPGLKGPRGDRGRP----SISF  1312
                    G  GD GP GP+G  G  GR G P   G  GGPG +G  G  G P        
Sbjct  252   KGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGEPGRFGDKGM  311

Query  1313  RGEPGEAGLDGYDGLPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGS  1372
             +G PG  G DG DG PGER      G DGF G+PG  G  G PG       + + G  GS
Sbjct  312   KGAPGWTGADGLDGSPGER------GEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGPIGS  365

Query  1373  KGDIGDPGPLSTFFKGA----QGDPGLPGFSGQPGQPGRRGFPGRA--GQPG--------  1418
             +GDIG PG             +G  GL G SG PG  G RG PGR+  G+ G        
Sbjct  366   QGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPP  425

Query  1419  ----FQGEAGTPGPSGLPG-----LQGPKGMLGESGFPGIPGNRGLPGFPGSPGPDALPG  1469
                   GEAG PG  GL G     + GPKG  G +G PG+ G RG  G  G PG   LPG
Sbjct  426   GPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKGLPG  485


 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 117/310 (38%), Positives = 144/310 (46%), Gaps = 35/310 (11%)

Query  124   VAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGVKGDRGDSGQPGGHGQD  183
             + P    G+RG+ GY G  G  G  G  G  GD G  G   + +  ++GD G  G  G+ 
Sbjct  1211  IGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRA  1270

Query  184   GIPGFTGPPGYQGPPGDPGYAGGPGY--------PGEKGDDGETNSGYPGVKGEQGETGS  235
             G PG  G  G  GPPG+ G  G  G+        PG +GD      G+PG  G  G  G 
Sbjct  1271  GRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGD-----VGFPGAPGHNGRHGL  1325

Query  236   PGPKGQQQVFPLDTIFWKGPRGLPGPP--------GDRGIPGEKGFEGSKGLDGVPGFVG  287
              GPKG+     L  +  +G RG  G          GD G  GE G++G+KG  G PG  G
Sbjct  1326  IGPKGE-----LGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPG  1380

Query  288   SKGMKGERGPDGPRGKQGRDGQSGPSGLKGAKGAPG--YAGSNGADGGKGEGGEDGQPGP  345
               G  G  GP GP G  G  G  G  GL G KG PG  Y+ S    G +GE G DG  G 
Sbjct  1381  KNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGE  1440

Query  346   PGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPG  405
                +G  GAPG   +     G  GA G++G  G  G  G  G  GQ GD G+ G  G PG
Sbjct  1441  ---EGDGGAPGLIGFQ----GQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG  1493

Query  406   PEGVPGNPGQ  415
               G+PG  G+
Sbjct  1494  LRGLPGPQGE  1503


 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 21/130 (16%)

Query  123   KVAPVSPPGDRGNPGYPGSRGPPGGFGPVGP-----------PGDPGEGGINSVGVKGDR  171
             +V    P G  G+ G+ G  G  G  GP G            PGD GE G++  G +G+ 
Sbjct  1384  RVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLD--GFQGEE  1441

Query  172   GDSGQPGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQG  231
             GD G P   G  G  G  G  GY+G  G+ GY G  G  G++GD      GY G+ G  G
Sbjct  1442  GDGGAP---GLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGD-----KGYMGLTGAPG  1493

Query  232   ETGSPGPKGQ  241
               G PGP+G+
Sbjct  1494  LRGLPGPQGE  1503


>O18407_DROME unnamed protein product
Length=1761

 Score = 805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 726/1642 (44%), Positives = 879/1642 (54%), Gaps = 111/1642 (7%)

Query  134   GNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGVKGDRGDSGQPGGHGQDGIPGFTGPPG  193
             G PG  G RGPPG     GPPG+ GEGGINS G KG+RG++GQPGG G  G  G  G  G
Sbjct  135   GRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPGFDGDRGSKG  194

Query  194   YQGPPGDPGYAGGPGYPGEKGDDGETNS------GYPGVKGEQGETGSPGPKGQQQVFPL  247
               G  G  G  G PG PG KGD G  +       G PG KGE G++ S        + P 
Sbjct  195   DTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKGEPGDSLS------GVLKPD  248

Query  248   DTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKGMKGERGPDGPRGKQGRD  307
             DT+  KG +G  G  GD G  G  G +G+ G +G+P      G +GE G  G RGK G+D
Sbjct  249   DTL--KGYKGYVGLQGDEGPQGPTGEQGAVGRNGLP------GARGEIGGPGERGKPGKD  300

Query  308   GQSGPSGLKGAKGAPGYAGSNGADGGKGEGGEDGQPGPPGVQGTLGAPGEFDYNSDGVGV  367
             G+ G  G KG KGAPG+ G++G DG  GE GEDG  G PGVQG  G PG +D  S    +
Sbjct  301   GEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYD-PSLTKSL  359

Query  368   PGAPGFQGPT------------GLPGEAGESGLPGQPGDLGFRGPPGPPGPEGVPGNPGQ  415
             PG  G QG              G PG  G  GL GQ GD G  G  GPP           
Sbjct  360   PGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPP-----------  408

Query  416   RGLSIKGDPGDDGVPGPPGRMGPPGGPGLPGSAGNKGLPGLTIMGPPGMDGLPGRDGFPG  475
              G S +G+ GD G  GPPG  GPPG  GLPG  G  G PG  ++GP G  GL G+ G  G
Sbjct  409   -GRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEG  467

Query  476   LRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGED  535
              RGDRGE G+PG KG  G G  I GPPG QG PG  G PG  G  GL G  G  G++G+D
Sbjct  468   YRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDD  527

Query  536   CGYCPPGYPGAKGTDGDPGIPGASGLPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSA  595
             C  C  G  G +G +GD G PG+ G  G  GL G RG +GL G  G  G++GL G  G  
Sbjct  528   CPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIP  587

Query  596   GLAGRQGPPGDPGQLVMPPDGVKGLRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGYKG  655
             G  G+ G  G  G+ +      KG  G  GD G  G  G  G  G  G  G  G  G  G
Sbjct  588   GEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETG  647

Query  656   DKGNAGDVGLPGMDGRPGEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKG  715
              +G+ GD G  G DG PG DG  G  G NA  PK +L GEPG +G +G RG  G+ G KG
Sbjct  648   QRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTGFKG  707

Query  716   EEGDAGSHIIVIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGEPGLSQPGPPG  775
              +G+     I     G+PG  G+ G  G KG +G+ G  G  G  G  G  G   PGP G
Sbjct  708   VKGEPNPGQIYD-NTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVG  766

Query  776   LKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMGPPGFPGSKG  835
              KGYPG  G  G +G  G PGRDG  G DG  G KG RG  G  ++ G++GPPG  G KG
Sbjct  767   AKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIKG  826

Query  836   DRGDEGPQGATGRDGFPGSPGYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGL  895
               GD G  G  G  G PG  G KG +G  G  G +GL G  G  GD +   P        
Sbjct  827   FPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGD-FLVGPPGPKGQPG  885

Query  896   ALGRRGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPG  955
               GR+   G  G +G  G +G  G  G +G  G +G RG+ GNL   GL G PG  GLPG
Sbjct  886   RNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNL--QGLPGSPGIPGLPG  943

Query  956   LPGTEGDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAGESGDPG  1015
             + G  G+RG +G  G++G  G  G  G FG  G  GD G  G  G NG  G  GE+G+PG
Sbjct  944   MIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPG  1003

Query  1016  IPGQKGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGE  1075
              PG+ G  G   +  + GD GE G  G IG  G PG  G +G +G+    + G  G  GE
Sbjct  1004  FPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGE  1063

Query  1076  RGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGKPGGKGIRGSPGF  1135
              G  G  G+ GR G KG  GD G+PG++G  G    PG +G  G+ G+ G  G++ + GF
Sbjct  1064  VGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGE---PGAKGLGGYPGRNGINGLKAATGF  1120

Query  1136  PGAFGLKGFSGEPGEPGFSGRPGPIGEP---------------------GFPGG------  1168
             PG  G KG  GE G  G  GR G IG+                      G PG       
Sbjct  1121  PGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRD  1180

Query  1169  ----PGFPGFPGVKGEPGETALLA-FGSPGESGLPGEKGPVGDRGDAGFSGGPGLKG---  1220
                  GF G  G++GE GE   +   G  G  G  GE+G +G  G  GF G  GLKG   
Sbjct  1181  RSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQG  1240

Query  1221  --------------EPGDFGAA---GKPGRPGGPGQKGAPGEYGRDGAPGRPGPPGFRRD  1263
                           E GD G A   G+ GRPG  GQKGAPG  G +G  G  G  G +  
Sbjct  1241  DQGPRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQ  1300

Query  1264  GPKGQPGDPGPLGPSGSPGLTGRRGPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAGLD-  1322
             GP G  GD G  G  G  G  G  GP G  G  G +G RG+ G   +  +G+ G+ G   
Sbjct  1301  GPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQG  1360

Query  1323  --GYDGLPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPG  1380
               G+DG  GE+G PG  G++G +G    PGPRG  GD G  G+ G+DG  G KG  G   
Sbjct  1361  EPGWDGAKGEQGYPGLPGKNGRVGA---PGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTY  1417

Query  1381  PLSTFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKGM  1440
               S    G +G+PGL GF G+ G  G  G  G  GQ G  G  G  G  G  G  GP+G 
Sbjct  1418  SYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQ  1477

Query  1441  LGESGFPGIPGNRGLPGFPGSPGPDALPGPPPRSRGFFFTRHSQTVFQPPCPAGTTKLWD  1500
              G+ G+ G+ G  GL G PG  G  A   P P+SRGF F RHSQ+V  P CPA T  LW+
Sbjct  1478  RGDKGYMGLTGAPGLRGLPGPQGEPAPAPPAPKSRGFIFARHSQSVHVPQCPANTNLLWE  1537

Query  1501  GYSLLHFTGDGKARGQDLGAPGSCLSKFSTMPFLFCNLNNVCNYASRNDYSYWLSTPEPM  1560
             GYSL       +A GQDLG  GSC+ +F+TMP++ C++ NVC++A  ND S WLST EPM
Sbjct  1538  GYSLSGNVAASRAVGQDLGQSGSCMMRFTTMPYMLCDITNVCHFAQNNDDSLWLSTAEPM  1597

Query  1561  PMSMTPITGREIRKFVSKCSVCESTTHVIAVHSQTMDTPDCPSDWEQLWIGYSFLMHTDS  1620
             PM+MTPI GR++ K++S+C VCE+TT +IA+HSQ+M  PDCP  WE++W GYS+ M T  
Sbjct  1598  PMTMTPIQGRDLMKYISRCVVCETTTRIIALHSQSMSIPDCPGGWEEMWTGYSYFMSTLD  1657

Query  1621  GSEGAGQPLVSPGSCLEEFRAVPFIECHGQGRCNFYTTASSYWLATIEEYEQFRRPRSQT  1680
                G GQ LVSPGSCLEEFRA P IECHG GRCN+Y   +S+WL  IEE +QF +PR QT
Sbjct  1658  NVGGVGQNLVSPGSCLEEFRAQPVIECHGHGRCNYYDALASFWLTVIEEQDQFVQPRQQT  1717

Query  1681  LKAGDLTTKVSRCAVCRRKHRS  1702
             LKA D T+K+SRC VCRR+  S
Sbjct  1718  LKA-DFTSKISRCTVCRRRGNS  1738


 Score = 328 bits (840),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 507/1349 (38%), Positives = 611/1349 (45%), Gaps = 198/1349 (15%)

Query  127   VSPPGDRGNP---------------GYPGSRGPPGGFGPVGPPGDPGEGGINSV-GVKGD  170
             + PPG +G P               GY G  G  G  GP GP G+ G  G N + G +G+
Sbjct  228   IGPPGAKGEPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGE  287

Query  171   RGDSGQPGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQ  230
              G  G+ G  G+DG PG  G  G +G PG  G  G  G PGE+G+DG T  G PGV+G  
Sbjct  288   IGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFT--GMPGVQGGA  345

Query  231   G---------ETGSPGPKGQQQVF----------PLDTIFWKGPRGLPGPPGDRGIPG--  269
             G             PGP G Q                    +GP GL G  GD G+ G  
Sbjct  346   GPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSR  405

Query  270   ---------------------------EKGFEGSKGLDGVPGFVGSKGMKGERGPDGPRG  302
                                        E G  G  GL G PG     G KGE G +G  G
Sbjct  406   GPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPG-QNVVGPKGEPGLNGQPG  464

Query  303   KQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEGGED--GQPGPPGVQGTLGAPGEFDY  360
              +G  G  G  GL G KG PG  G N       +G     G PG  G  G  G PGE   
Sbjct  465   LEGYRGDRGEVGLPGDKGLPG-EGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGL  523

Query  361   NSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSI  420
               D   V  A    GP G  G+ G++G PG  G+ G  G  GP G +G+ GNPG+ G   
Sbjct  524   RGDDCPVCNA----GPRGPRGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGH--  577

Query  421   KGDPGDDGVPGPPGRMGP--PGGPGLPGSAGNKGLPGLT----IMGPPGMDGLPGRDGFP  474
             KG PG  G+PG PG++G   P G  +   +  KG  G T      G  G DG  GRDG  
Sbjct  578   KGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSD  637

Query  475   GLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGE  534
             G +G+RGE G  G  G AG+          QG  G PG  G  G PG +  +    + GE
Sbjct  638   GSKGERGETGQRGDYGDAGY----------QGRDGEPGRDGRDGAPGRNATTPKVYLIGE  687

Query  535   DCGYCPPGYPGAKGT---DGDPGIPGASGLPGFHGLPGERGPKGLGGKGGPRGYQGLTGR  591
                   PGY G KG    DGD G  G  G P    +    G  G  G  GP+G +G  G 
Sbjct  688   ------PGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGE  741

Query  592   PGSAGLAGRQGPPGDPGQLVMPPDGVKGLRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAP  651
              G+ GL G  G  G  G+++  P G KG  GP GD G  G  GLPGR+G    PG  G  
Sbjct  742   QGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGE---PGLDGGI  798

Query  652   GYKGDKGNAGDVGLPGMDGRPGEDGLPGLDGPNADIPKQF-LRGEPGLNGFRGPRGPTGE  710
             GYKG +G  G   + G  G PG  G+ G  G +   P Q+ L G PG  G +G +GP G 
Sbjct  799   GYKGQRGVPGQEVIQGEIGPPGRSGIKGFPG-DVGAPGQYGLAGRPGPKGVKGEQGPDGA  857

Query  711   KGHKGEEGDAGSHIIVI-------------GEHGDPGPQGFRGWPGDKGHRGDPGPGGFP  757
              G  G  G+ G     +             G     G +G +G  G  G  G  G  G  
Sbjct  858   VGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSI  917

Query  758   GFPGRNGEPGLSQPGPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHG  817
             GF GR G  G  Q    GL G PGIPGL G  G  G  G  G++G  G  GP+G  G+ G
Sbjct  918   GFSGRRGLLGNLQ----GLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFG  973

Query  818   MGILGGDMGPPGFPGSKGDRGDEGPQGATGRDGFPGSPGYKGTKGAPGLAGLSGLRGLPG  877
                L GD GP G+PG+    G  G +G TG  GFPG PG KG     G+ G  G  GL G
Sbjct  974   PKGLSGDDGPDGYPGAN---GLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTG  1030

Query  878   DVGDSYPGPPGPRGAPGLALGRRGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDG  937
              +G  YPG PG +G  G     +     P + G+ G  G +G  G  G PG  GL+G  G
Sbjct  1031  PIG--YPGAPGVKGQRGPVGDSQ-----PALDGVAGRKGEVGSPGPNGLPGRHGLKGQRG  1083

Query  938   NLGIPGLDGLPGRQGLPGLPGTEGDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPG  997
             +       GLPG+QG PG PG +G  G  G  G  G     G PG  G  GP+G+ G  G
Sbjct  1084  DR------GLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVG  1137

Query  998   LDGLNGRDGDAGESG---------------DPGIPGQ----------KGIPGDGGFPAVP  1032
             LDG NG+ GD G  G               + GIPG+          +G  GD G   + 
Sbjct  1138  LDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQG---LQ  1194

Query  1033  GDRGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGERGESGLPGVSGRGGQKG  1092
             G+RGE G  G IG  G PG  G +G +G  G++     G  G  G  G  G  G  G  G
Sbjct  1195  GERGEQGDMGPIGFIGPPGAKGERGDIGYAGQL-----GFDGAEGLKGFQGDQGPRGPPG  1249

Query  1093  IMGDMGIPGEKGMAGNRGFPGRQGRPGWSGKPGGKGIRGSPGFPGAFGLKGFSGEPGEPG  1152
             I     +P EKG  G  G  GR GRPG  G+      +G+PG PG  G  G  G  G P 
Sbjct  1250  IT----LPAEKGDEGVAGLDGRAGRPGHFGQ------KGAPGPPGENGPNGAIGHRG-PQ  1298

Query  1153  FSGRPGPIGEPGFPGGPGFPGFPGVKGEPGETALLAF-GSPGESG--LPGEKGPVGDRGD  1209
               G PGP G+ GFPG PG  G  G+ G  GE   +   G  GESG  + G +G +GD G 
Sbjct  1299  IQGPPGPQGDVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGF  1358

Query  1210  AGFSGGPGLKGEPGDFGAAGKPGRPGGPGQKGAPGEYGRDGAPGRPGPPGFRRDGPKGQP  1269
              G  G  G KGE G  G  GK GR G PG +G  G+ G  G  G  G       GPKGQP
Sbjct  1359  QGEPGWDGAKGEQGYPGLPGKNGRVGAPGPRGPTGDAGWGGIDGMDG-----LVGPKGQP  1413

Query  1270  GDPGPL-----GPSGSPGLTGRRGPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAGLDGY  1324
             G          G  G PGL G +G  G  G PGL G +G RG  ++ +RG+ GE G  G 
Sbjct  1414  GVTYSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRG--AVGYRGDQGEVGYTGA  1471

Query  1325  DGLPGERGIPGESGRDGFIGLPGRPGPRG  1353
             DG  G+RG  G  G  G  GL G PGP+G
Sbjct  1472  DGPQGQRGDKGYMGLTGAPGLRGLPGPQG  1500


 Score = 301 bits (770),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 486/1343 (36%), Positives = 575/1343 (43%), Gaps = 247/1343 (18%)

Query  345   PPGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPP  404
             P  ++   G PG        V V  A G    T L    G  G  G PG +G  G  GP 
Sbjct  3     PRDLRHLSGLPGVVYLLGSLVSVTLADGKICNTTLCDCKGIKGRMGAPGPIGVPGLEGPA  62

Query  405   GPEGVPGNPGQRGLSIKGDPGDDGVPGPPGR---MGPPGGPGLPGSAGNKGLPGLTIMGP  461
             G  G PG  G   L  KGD G+ G  G  G    +GP G  G PG  G  G PG      
Sbjct  63    GDIGPPGRAGP--LGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGT-----  115

Query  462   PGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQI-----------------------  498
             PG  G+ G DG PG++G  G  G  G +GP G   Q                        
Sbjct  116   PGPRGIDGCDGRPGMQGPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGET  175

Query  499   --------------RGPPGEQGLPGLPGTPGFPGLPG-----------------------  521
                           RG  G+ G  GL G  G PGLPG                       
Sbjct  176   GQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPGAKG  235

Query  522   ---------------LDGGSGLPGIKGEDCGYCPPGYPGAKGTDGDPGI------PGASG  560
                            L G  G  G++G++    P G  GA G +G PG       PG  G
Sbjct  236   EPGDSLSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERG  295

Query  561   LPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSAGLAGRQGPPGDPGQL----VMPPDG  616
              PG  G PG  G KG+ G  G  G  GL G PG  G  G  G PG  G      +  P  
Sbjct  296   KPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSL  355

Query  617   VKGLRGPGGDPG------------------FPGLMGLPGRNGNKGLPGPPGAPGYKGDKG  658
              K L GP G  G                    G +GL G++G+ GL G  G PG + ++G
Sbjct  356   TKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPG-RSERG  414

Query  659   NAGDVGLPGMD---------GRPGEDGLPGLDGPNADIPKQF--LRGEPGLNGFRGPRGP  707
              AGD G  G           G PG  GL G  G N   PK    L G+PGL G+RG RG 
Sbjct  415   EAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGE  474

Query  708   TGEKGHKGEEGDAGSHII----------VIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFP  757
              G  G KG  G+ G +I+            G  GD G  G RG PG+KG RGD  P    
Sbjct  475   VGLPGDKGLPGE-GYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNA  533

Query  758   GFPGRNGEPGLSQPGPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHG  817
             G  G  G+ G +  G PG  G  G  GLAGPRG +G  G  G +G  G+PGP G  G+ G
Sbjct  534   GPRGPRGQEGDT--GYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPG  591

Query  818   M--------------GILGGDMGPPGFPGSKGDRGDEGPQGATGRDGFPGSPGYKGTKGA  863
                             +  G++G  G  G +GD GD+G +G  G DG  G  G  G +G 
Sbjct  592   KVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQRGD  651

Query  864   PGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLPGIPGIRGIDGGVGPLGDKGM  923
              G AG  G  G PG   D   G PG R A    +   G PG  GI+G  G  G  G KG+
Sbjct  652   YGDAGYQGRDGEPGR--DGRDGAPG-RNATTPKVYLIGEPGYDGIKGERGDDGDTGFKGV  708

Query  924   QGEPG------LTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTEGDRGTMG--IPGQKGPN  975
             +GEP        TG  G DG  G  G+ G  G QG  GL G  GDRG  G  IP   GP 
Sbjct  709   KGEPNPGQIYDNTGEPGEDGYTGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIP---GPV  765

Query  976   GRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAGESGDPGIPGQKGI------PGDGGFP  1029
             G  G PG  G  G +G PG PG DG  G DG  G  G  G+PGQ+ I      PG  G  
Sbjct  766   GAKGYPGPTGDYGQQGAPGLPGRDGEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGRSGIK  825

Query  1030  AVPGDRGEP------------GFPGEIGPRGNPGFNGLKGQLGEPGEVI-----------  1066
               PGD G P            G  GE GP G  G  GL G  G+ G+ +           
Sbjct  826   GFPGDVGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPG  885

Query  1067  -GGEPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGN-RGFPGRQGRPGWSGKP  1124
               G     G +G+ G  G  G+ GQ G  G +G  G +G+ GN +G PG  G PG  G  
Sbjct  886   RNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMI  945

Query  1125  GGKGIRGSPGF------------PGAFGLKGFSGE------PGEPGFSGRPGPIGEPGFP  1166
             G  G RG  G+             G FG KG SG+      PG  G  GR G  G PGFP
Sbjct  946   GEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFP  1005

Query  1167  GGPGFPG---FPGVKGEPGETALLA-FGSPGESGLPGEKGPVGDR--------GDAGFSG  1214
             G PG  G   + G+KG+ GE+ L    G PG  G+ G++GPVGD         G  G  G
Sbjct  1006  GRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGEVG  1065

Query  1215  GPGLKGEPGDFGAAGKPGRPGGPGQKGAPGEYGRDGAPGRPGPPGFRRDGPKGQPGDPGP  1274
              PG  G PG  G  G+ G  G PGQ+G PGE G  G  G PG  G   +G K   G PGP
Sbjct  1066  SPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKGLGGYPGRNGI--NGLKAATGFPGP  1123

Query  1275  LGPSGSPGLTGRRGPPGRSGGPGLKGPRGDRGRPSI-----------------SFRGEPG  1317
              GP G  G +G  G  GR+G  G +GPRG  G                     + R    
Sbjct  1124  QGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSF  1183

Query  1318  EAGLDGYDGLPGERGIPGESGRDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIG  1377
               G  G  GL GERG  G+ G  GFIG PG  G RG  G  G+ G  G +G +G +GD G
Sbjct  1184  YRGFTGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQG  1243

Query  1378  DPGPLSTFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGP  1437
               GP        +GD G+ G  G+ G+PG  G  G  G PG  G  G  G  G P +QGP
Sbjct  1244  PRGPPGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRG-PQIQGP  1302

Query  1438  KGMLGESGFPGIPGNRGLPGFPG  1460
              G  G+ GFPG PG+ G  G  G
Sbjct  1303  PGPQGDVGFPGAPGHNGRHGLIG  1325


 Score = 287 bits (735),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 407/1057 (39%), Positives = 485/1057 (46%), Gaps = 192/1057 (18%)

Query  131   GDRGNPGYPGSRGPPGGFGPVGPPGDPGE---------------------GGINSVGVKG  169
             G +GNPG  G +G PG   P G PG+PG+                     G     G +G
Sbjct  567   GLQGNPGRAGHKGLPG---PAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRG  623

Query  170   DRGDSGQPGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGE--TNS------  221
             D GD G+ G  G DG  G  G  G +G  GD GY G  G PG  G DG    N+      
Sbjct  624   DTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVY  683

Query  222   -----GYPGVKGEQGETGSPGPKGQQQVFPLDTIFWKGPRGLPGP---PGDRGIPGEKGF  273
                  GY G+KGE+G+ G  G              +KG +G P P     + G PGE G+
Sbjct  684   LIGEPGYDGIKGERGDDGDTG--------------FKGVKGEPNPGQIYDNTGEPGEDGY  729

Query  274   EGSKGLDGVPGFVGSKGMKGERGPDGPRGK-----QGRDGQSGPSGLKGAKGAPGYAGSN  328
              G KG+ G  G  G+ G++GE G  GP G+      G  G  GP+G  G +GAPG  G +
Sbjct  730   TGPKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRD  789

Query  329   GA---DGGKGEGGEDGQPGPPGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGE  385
             G    DGG G  G+ G PG   +QG +G PG            G  GF G  G PG+ G 
Sbjct  790   GEPGLDGGIGYKGQRGVPGQEVIQGEIGPPGR----------SGIKGFPGDVGAPGQYGL  839

Query  386   SGLPGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSIKGDPGDDGVPGPPGRMGPPGGPGLP  445
             +G PG  G  G +GP G  G  G+PGN GQRG  + G PG  G PG  GR  P G  G  
Sbjct  840   AGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQK  899

Query  446   GSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQ  505
             G  G+        +G  G +G  G  GF G RG  G                       Q
Sbjct  900   GEVGS--------LGQNGQNGAKGSIGFSGRRGLLGNL---------------------Q  930

Query  506   GLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCPP------GYPGAKGTDGDPGIPGAS  559
             GLPG PG PG PG+ G  G  G  G  G      P       G  G  G DG  G PGA+
Sbjct  931   GLPGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGAN  990

Query  560   GLPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSAGLAGRQGPPGDPGQLVMPPDGVKG  619
             GLPG  G  G  G  G  G  G   Y G+ G  G +GL G  G PG P        GVKG
Sbjct  991   GLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAP--------GVKG  1042

Query  620   LRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGYKGDKGNAGDVGLPGMDGRPGEDGLPG  679
              RGP GD   P L G+ GR G  G PGP G PG  G KG  GD GLPG  GRPGE G  G
Sbjct  1043  QRGPVGDS-QPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEPGAKG  1101

Query  680   LDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEGDAGSHIIVIGEHGDPGPQGFR  739
             L G         L+   G  G +GP+GP GE G  G +G         G+ GD GP+G  
Sbjct  1102  LGGYPGRNGINGLKAATGFPGPQGPKGPQGESGVVGLDGRN-------GQIGDQGPRGLI  1154

Query  740   GWPGDKGHRGDPGPGGFPG----------FPGRNGEPGLS----QPGPPGLKGYPGIPGL  785
             G  G++G +GD G  G PG          + G  G+ GL     + G  G  G+ G PG 
Sbjct  1155  GEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIGPPGA  1214

Query  786   AGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMGPPG--FPGSKGDRGDEGPQ  843
              G RG  G+ G+ GF GA+G+ G +GD+G           GPPG   P  KGD      +
Sbjct  1215  KGERGDIGYAGQLGFDGAEGLKGFQGDQGPR---------GPPGITLPAEKGD------E  1259

Query  844   GATGRDGFPGSPGYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLP  903
             G  G DG  G PG+ G KGAPG  G +G  G  G  G    GPPGP+G         G P
Sbjct  1260  GVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDV-------GFP  1312

Query  904   GIPGIRGIDGGVGP---LGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTE  960
             G PG  G  G +GP   LGD G QGE G +G         I G  G  G  G  G PG +
Sbjct  1313  GAPGHNGRHGLIGPKGELGDMGRQGERGESG-------YAIVGRQGDIGDIGFQGEPGWD  1365

Query  961   GDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAGESGDPGIPGQK  1020
             G +G  G PG  G NGR G P      GP+G  G  G  G++G DG  G  G PG+    
Sbjct  1366  GAKGEQGYPGLPGKNGRVGAP------GPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSY  1419

Query  1021  GIPGDGGFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGERGESG  1080
              +       A PGDRGEPG  G  G  G+ G  GL G  G+ G V     G  G++GE G
Sbjct  1420  SM-------ARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGAV-----GYRGDQGEVG  1467

Query  1081  LPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGR  1117
               G  G  GQ+G  G MG+ G  G+   RG PG QG 
Sbjct  1468  YTGADGPQGQRGDKGYMGLTGAPGL---RGLPGPQGE  1501


 Score = 268 bits (686),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 418/1108 (38%), Positives = 509/1108 (46%), Gaps = 181/1108 (16%)

Query  500   GPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCPPGYPGAKGTDGDPGIPGAS  559
             G PG  G+PGL G  G  G PG  G  G  G  GE   Y   G  G +G  G  G  G  
Sbjct  48    GAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGE---YGEQGEKGHRGDIGPKGEMGYP  104

Query  560   GLPGFHGLPGERGPKGLGGKGGPRGYQGLTGRPGSAGLAGRQGPPGDPGQL---------  610
             G+ G  G PG  GP+G+ G  G  G QG +GRPG  G+   +GPPG   Q          
Sbjct  105   GIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGRPGQNGV---RGPPGKSRQQGPPGEAGEG  161

Query  611   VMPPDGVKGLRGPG---------------GDPGFPGLMGLPGRNGNKGLPGPPGAPGYKG  655
              +   G KG RG                 G  G  G  GL G  G+ GLPGP      KG
Sbjct  162   GINSKGTKGNRGETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGP------KG  215

Query  656   DKGNAGD-----VGLPGMDGRPGEDGLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGE  710
             D G   +     +G PG  G PG D L G+  P+  +  +  +G  GL G  GP+GPTGE
Sbjct  216   DTGAVSELPYSLIGPPGAKGEPG-DSLSGVLKPDDTL--KGYKGYVGLQGDEGPQGPTGE  272

Query  711   KGHKGEEGDAGSHIIVIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGEPGLSQ  770
             +G  G  G  G+     GE G PG +G  G  G+ G  GD G  G PG+ G +G  G   
Sbjct  273   QGAVGRNGLPGAR----GEIGGPGERGKPGKDGEPGRFGDKGMKGAPGWTGADGLDG--S  326

Query  771   PGPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGI----------  820
             PG  G  G+ G+PG+ G  GP   PG    S    +PGP G +GD G             
Sbjct  327   PGERGEDGFTGMPGVQGGAGP---PGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGK  383

Query  821   --------LGGDMGPPGFPGSKG-----DRGDEG---------------PQGATGRDGFP  852
                     L G  G PG  GS+G     +RG+ G                 G  GR G  
Sbjct  384   PGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLH  443

Query  853   GSPGYK--GTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLPGIPGIRG  910
             G PG    G KG PGL G  GL G  GD G+   G PG +G PG      G PG  G  G
Sbjct  444   GEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEV--GLPGDKGLPGEGYNIVGPPGSQGPPG  501

Query  911   IDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTEGDRGTMGIP-  969
               G  G  G  G++G PG  GLRG D  +   G  G  G++G  G PG+ G+RG +G+  
Sbjct  502   FRGLPGDDGYYGLRGLPGEKGLRGDDCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAG  561

Query  970   --GQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDA--------GESGDPGIPGQ  1019
               G +G  G PG  G  G+ GP G PG PG  G  G DG A        GE GD G  G 
Sbjct  562   PRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGH  621

Query  1020  KGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGERGES  1079
             +G  GD G     G  G  G  GE G RG+ G  G +G+ GEPG    G  G PG    +
Sbjct  622   RGDTGDDGEKGRDGSDGSKGERGETGQRGDYGDAGYQGRDGEPGRD--GRDGAPGRNATT  679

Query  1080  ------GLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGKPGGKGIRGSP  1133
                   G PG  G  G++G  GD G  G KG           G PG  G  G KG++G+ 
Sbjct  680   PKVYLIGEPGYDGIKGERGDDGDTGFKGVKGEPNPGQIYDNTGEPGEDGYTGPKGVKGAK  739

Query  1134  GFPGAFGLKGFSGEPGEPGFSGRPGPIGEPGFP------GGPGFPGFPGVKGEPGETALL  1187
             G  GA GL+G  G+ G P     PGP+G  G+P      G  G PG PG  GEPG     
Sbjct  740   GEQGAIGLRGEIGDRG-PAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGEPGLDG--  796

Query  1188  AFGSPGESGLPGEKGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPGGPGQKGAPGEYG  1247
               G  G+ G+PG++   G+ G  G S   G+KG PGD GA G+ G  G PG KG  GE G
Sbjct  797   GIGYKGQRGVPGQEVIQGEIGPPGRS---GIKGFPGDVGAPGQYGLAGRPGPKGVKGEQG  853

Query  1248  RDGAPGRPGPPGFR---------------------RDGP---KGQPGDPGPLGPS-----  1278
              DGA G+ G PG +                     R  P   KGQ G+ G LG +     
Sbjct  854   PDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGA  913

Query  1279  -GSPGLTGRR----------GPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAGLDGYDGL  1327
              GS G +GRR          G PG  G PG+ G  G+RG   I + G  G+ G  G +G 
Sbjct  914   KGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMIGEIGERG--EIGYNGRQGDIGPRGPNGE  971

Query  1328  PGERGIPGESGRDGF---IGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPGPLST  1384
              G +G+ G+ G DG+    GLPGR G  G PG  GRPG +G+    G KGD G+ G    
Sbjct  972   FGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGESG----  1027

Query  1385  FFKGAQGDPGLPGFSGQPG-----QPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKG  1439
                G  G PG PG  GQ G     QP   G  GR G+ G  G  G PG  GL G +G +G
Sbjct  1028  -LTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGLPGRHGLKGQRGDRG  1086

Query  1440  MLGESGFPGIPGNRGLPGFPGSPGPDAL  1467
             + G+ G PG PG +GL G+PG  G + L
Sbjct  1087  LPGQQGRPGEPGAKGLGGYPGRNGINGL  1114


 Score = 213 bits (542),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 310/835 (37%), Positives = 388/835 (46%), Gaps = 147/835 (18%)

Query  129   PPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGV---KGDRGDSGQPGGHGQDGI  185
             P G +G  G  G+ G  G  G  GP G+   G + + G     GD G  G PG  G+DG 
Sbjct  732   PKGVKGAKGEQGAIGLRGEIGDRGPAGEVIPGPVGAKGYPGPTGDYGQQGAPGLPGRDGE  791

Query  186   PGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQGETGSPGPKGQQQVF  245
             PG  G  GY+G                         G PG +  QGE G PG  G +  F
Sbjct  792   PGLDGGIGYKG-----------------------QRGVPGQEVIQGEIGPPGRSGIKG-F  827

Query  246   PLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKG--------------M  291
             P D +   G  GL G PG +G+ GE+G +G+ G  G+PG  G +G               
Sbjct  828   PGD-VGAPGQYGLAGRPGPKGVKGEQGPDGAVGQTGLPGNKGQRGDFLVGPPGPKGQPGR  886

Query  292   KGERGPDGPRGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGG-KGEGGEDGQPGPPGVQG  350
              G + P G +G++G  G  G +G  GAKG+ G++G  G  G  +G  G  G PG PG+ G
Sbjct  887   NGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQGLPGSPGIPGLPGMIG  946

Query  351   TLGAPGEFDYN--SDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPGPEG  408
              +G  GE  YN     +G  G  G  GP GL G+ G  G PG  G  G +G  G P   G
Sbjct  947   EIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGLPGRKGETGNP---G  1003

Query  409   VPGNPGQRGLS----IKGDPGDDGVPGPPGRMGPPG-----------GPGLPGSAGNKGL  453
              PG PG +G++    IKGD G+ G+ GP G  G PG            P L G AG KG 
Sbjct  1004  FPGRPGAKGVAAYSGIKGDDGESGLTGPIGYPGAPGVKGQRGPVGDSQPALDGVAGRKGE  1063

Query  454   PGLTIMGPPGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGT  513
                  +G PG +GLPGR G  G RGDRG                    PG+QG PG PG 
Sbjct  1064  -----VGSPGPNGLPGRHGLKGQRGDRGL-------------------PGQQGRPGEPGA  1099

Query  514   PGFPGLPGLDGGSGLPGIKGEDCGYCPPGYPGAKGTDGDPGIPGASGLPGFHGLPGERGP  573
              G  G PG +G +GL             G+PG +G  G  G  G  GL G +G  G++GP
Sbjct  1100  KGLGGYPGRNGINGLK---------AATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGP  1150

Query  574   KGL-------------GGKGGPRGYQGLTGR------PGSAGLAGRQGPPGDPGQL-VMP  613
             +GL             G  G P   + L  R       G  GL G +G  GD G +  + 
Sbjct  1151  RGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGPIGFIG  1210

Query  614   PDGVKGLRGP---GGDPGFPGLMGLPGRNGNKGLPGPPGA--PGYKGDKGNA---GDVGL  665
             P G KG RG     G  GF G  GL G  G++G  GPPG   P  KGD+G A   G  G 
Sbjct  1211  PPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRAGR  1270

Query  666   PGMDGRPGEDGLPGLDGPNADIPKQ--------------FLRGEPGLNGFRGPRGPTGEK  711
             PG  G+ G  G PG +GPN  I  +                 G PG NG  G  GP GE 
Sbjct  1271  PGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGDVGFPGAPGHNGRHGLIGPKGEL  1330

Query  712   GHKGEEGDAG-SHIIVIGEHGDPGPQGFRGWPGDKGHRGDPGPGGFPGFPGRNGEPGLSQ  770
             G  G +G+ G S   ++G  GD G  GF+G PG  G +G+    G+PG PG+NG  G   
Sbjct  1331  GDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQ---GYPGLPGKNGRVGAPG  1387

Query  771   P-GPPGLKGYPGIPGLAGPRGPKGFPGRDGFSGADGIPGPKGDRGDHGMGILGGDMGPPG  829
             P GP G  G+ GI G+ G  GPKG PG   +S +   PG +G+ G  G     GD G PG
Sbjct  1388  PRGPTGDAGWGGIDGMDGLVGPKGQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPG  1446

Query  830   FPGSKGDRGDEGPQGATGRDGFPGS---PGYKGTKGAPGLAGLSGLRGLPGDVGD  881
               G +G RG  G +G  G  G+ G+    G +G KG  GL G  GLRGLPG  G+
Sbjct  1447  LIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGLRGLPGPQGE  1501


 Score = 157 bits (398),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 261/692 (38%), Positives = 317/692 (46%), Gaps = 113/692 (16%)

Query  122   FKVAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGIN-SVGVKGDRGDSGQPGGH  180
             F V P  P G  G  G     G  G  G VG  G  G+ G   S+G  G RG  G   G 
Sbjct  873   FLVGPPGPKGQPGRNGRQAPHGAKGQKGEVGSLGQNGQNGAKGSIGFSGRRGLLGNLQGL  932

Query  181   -GQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETN----------SGYPGVK--  227
              G  GIPG  G  G  G  G+ GY G  G  G +G +GE             GYPG    
Sbjct  933   PGSPGIPGLPGMIGEIGERGEIGYNGRQGDIGPRGPNGEFGPKGLSGDDGPDGYPGANGL  992

Query  228   -GEQGETGSPGPKGQQQVFPLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFV  286
              G +GETG+PG       FP          G PG  G     G KG +G  GL G  G+ 
Sbjct  993   PGRKGETGNPG-------FP----------GRPGAKGVAAYSGIKGDDGESGLTGPIGYP  1035

Query  287   GSKGMKGERGP--------DGPRGKQGRDGQSGPSGLKGAKGAPGYAGSNGADGGKGEGG  338
             G+ G+KG+RGP        DG  G++G  G  GP+GL      PG  G  G  G +G  G
Sbjct  1036  GAPGVKGQRGPVGDSQPALDGVAGRKGEVGSPGPNGL------PGRHGLKGQRGDRGLPG  1089

Query  339   EDGQPGPPGVQGTLGAPGEFDYNSDGVGVPGAPGF---QGPTGLPGEAGESGLPGQPGDL  395
             + G+PG PG +G  G PG    N    G+  A GF   QGP G  GE+G  GL G+ G +
Sbjct  1090  QQGRPGEPGAKGLGGYPGRNGIN----GLKAATGFPGPQGPKGPQGESGVVGLDGRNGQI  1145

Query  396   GFRGPPG------------PPGPEGVPG---NPGQRGLS--IKGDPGDDGVPGPPGRMGP  438
             G +GP G              G  G+PG   N   R       GD G  G  G  G MGP
Sbjct  1146  GDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGFTGDQGLQGERGEQGDMGP  1205

Query  439   PGGPGLPGSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQ-  497
              G  G PG+ G +G      +G  G  G  G +G  G +GD+G  G PG   PA  G + 
Sbjct  1206  IGFIGPPGAKGERG-----DIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEG  1260

Query  498   IRGPPGEQGLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCPPGYPGAKGTDGDPGIPG  557
             + G  G  G PG  G  G PG PG +G +G  G +G       P   G  G  GD G PG
Sbjct  1261  VAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRG-------PQIQGPPGPQGDVGFPG  1313

Query  558   ASGLPGFHGLPGERGPKGLGGKGGPRGYQG--LTGRPGSAGLAGRQGPPGDPGQLVMPPD  615
             A G  G HGL G +G  G  G+ G RG  G  + GR G  G  G QG PG         D
Sbjct  1314  APGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPG--------WD  1365

Query  616   GVKGLRGPGGDPGFPGLMGLPGRNGNKGLPGPPGAPGYKGDKGNAGDVGLPGMDGRPGED  675
             G K      G+ G+P   GLPG+NG  G PGP      +G  G+AG  G+ GMDG  G  
Sbjct  1366  GAK------GEQGYP---GLPGKNGRVGAPGP------RGPTGDAGWGGIDGMDGLVGPK  1410

Query  676   GLPGLDGPNADIPKQFLRGEPGLNGFRGPRGPTGEKGHKGEEGDAGSHIIVIGEHGDPGP  735
             G PG+   +  + +   RGEPGL+GF+G  G  G  G  G +G  G+    +G  GD G 
Sbjct  1411  GQPGVT-YSYSMARPGDRGEPGLDGFQGEEGDGGAPGLIGFQGQRGA----VGYRGDQGE  1465

Query  736   QGFRGWPGDKGHRGDPGPGGFPGFPGRNGEPG  767
              G+ G  G +G RGD G  G  G PG  G PG
Sbjct  1466  VGYTGADGPQGQRGDKGYMGLTGAPGLRGLPG  1497


 Score = 145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 254/748 (34%), Positives = 309/748 (41%), Gaps = 190/748 (25%)

Query  856   GYKGTKGAPGLAGLSGLRGLPGDVGDSYPGPPGPRGAPGLALGRRGLPGIPGIRGIDGGV  915
             G KG  GAPG  G+ GL G  GD+G     PPG                           
Sbjct  42    GIKGRMGAPGPIGVPGLEGPAGDIG-----PPGR-------------------------A  71

Query  916   GPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPGLPGTEGDRGTMGIPGQKGPN  975
             GPLG+KG  GE G  G +G  G++G  G  G PG  G  G PGT G RG  G       +
Sbjct  72    GPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGC------D  125

Query  976   GRPGL------PGTFGIDGPKGDP--------------GAPGLDGLNGRDGDAGESGDPG  1015
             GRPG+      PG  G+ GP G                 + G  G  G  G  G  G PG
Sbjct  126   GRPGMQGPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNRGETGQPGGVGPPG  185

Query  1016  IPGQKGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPG--------FNGLKGQLGEPGEVIG  1067
               G +G  GD G+  + G++G+PG P   GP+G+ G          G  G  GEPG+ + 
Sbjct  186   FDGDRGSKGDTGYAGLTGEKGDPGLP---GPKGDTGAVSELPYSLIGPPGAKGEPGDSLS  242

Query  1068  G----EPGIPGERGESGLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPGWSGK  1123
             G    +  + G +G  GL G  G  G  G  G +G  G  G  G  G PG +G+PG  G+
Sbjct  243   GVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGPGERGKPGKDGE  302

Query  1124  P---GGKGIRGSPGFPGAFGLKGFSGEPGEPGFSGR---------------------PGP  1159
             P   G KG++G+PG+ GA GL G  GE GE GF+G                      PGP
Sbjct  303   PGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAGPPGIYDPSLTKSLPGP  362

Query  1160  IGEP------------------------GFPGGPGFPGFPGVKGEPGETAL---------  1186
             IG                          G  G  G PG  G +G PG +           
Sbjct  363   IGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGRSERGEAGDYGFI  422

Query  1187  ---------LAFGSPGESGLPGE--KGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPG  1235
                         G PG  GL GE  +  VG +G+ G +G PGL+G  GD G  G PG  G
Sbjct  423   GPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEVGLPGDKG  482

Query  1236  GPGQ----------------KGAPGEYGRDGAPGRPGPPGFRRDGPKGQPGDPGPLGPSG  1279
              PG+                +G PG+ G  G  G PG  G R D       + GP GP G
Sbjct  483   LPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGD--DCPVCNAGPRGPRG  540

Query  1280  SPGLTGRRGPPGRSGGPGLKGPRGDRGRPSISFRGEPGEAGLDGYDGLPGERGIPGESG-  1338
               G TG  G  G  G  GL GPRG +G      +G PG A   G+ GLPG  GIPGE G 
Sbjct  541   QEGDTGYPGSHGNRGAIGLAGPRGVQG-----LQGNPGRA---GHKGLPGPAGIPGEPGK  592

Query  1339  ----------------RDGFIGLPGRPGPRGGPGDDGRPGLRGIDGRQGSKGDIGDPGPL  1382
                             R G IG  G  G RG  GDDG  G  G DG +G +G+ G     
Sbjct  593   VGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRDGSDGSKGERGETGQ----  648

Query  1383  STFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGTPGPSGLPGLQGPKGMLG  1442
                 +G  GD G  G  G+PG+ GR G PGR          G PG  G+ G +G  G  G
Sbjct  649   ----RGDYGDAGYQGRDGEPGRDGRDGAPGRNATTPKVYLIGEPGYDGIKGERGDDGDTG  704

Query  1443  ESGFPGIPGNRGLPGFPGSPGPDALPGP  1470
               G  G P    +    G PG D   GP
Sbjct  705   FKGVKGEPNPGQIYDNTGEPGEDGYTGP  732


 Score = 142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 210/564 (37%), Positives = 247/564 (44%), Gaps = 118/564 (21%)

Query  123   KVAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSV----GVKGDRGDSGQPG  178
             +  P    GD G  GYPG+ G PG  G  G PG PG  G   V    G+KGD G+S    
Sbjct  971   EFGPKGLSGDDGPDGYPGANGLPGRKGETGNPGFPGRPGAKGVAAYSGIKGDDGES----  1026

Query  179   GHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQGETGSPGP  238
                     G TGP          GY G PG  G++G  G++     GV G +GE GSPGP
Sbjct  1027  --------GLTGP---------IGYPGAPGVKGQRGPVGDSQPALDGVAGRKGEVGSPGP  1069

Query  239   KGQQQVFPLDTIFWKGPRGLPGPPGDRGIPGEKGFEGSKGLDGVPGFVGSKGMKGERGPD  298
              G      L     +G RGLPG  G  G PG KG  G  G +G+ G   + G  G +GP 
Sbjct  1070  NGLPGRHGLKG--QRGDRGLPGQQGRPGEPGAKGLGGYPGRNGINGLKAATGFPGPQGPK  1127

Query  299   GPRGKQ------GRDGQSGPSGLKG---------------AKGAPG----------YAGS  327
             GP+G+       GR+GQ G  G +G                 G PG          Y G 
Sbjct  1128  GPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGIPGRLENLRDRSFYRGF  1187

Query  328   NGADGGKGEGGEDGQPGPPGVQGTLGAPGEF-DYNSDGV----GVPGAPGFQGPTG----  378
              G  G +GE GE G  GP G  G  GA GE  D    G     G  G  GFQG  G    
Sbjct  1188  TGDQGLQGERGEQGDMGPIGFIGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGP  1247

Query  379   ----LPGEAGESGL------PGQPGDLGFRGPPGPPGPEGVPGNPGQRGLSIKGDP---G  425
                 LP E G+ G+       G+PG  G +G PGPPG  G  G  G RG  I+G P   G
Sbjct  1248  PGITLPAEKGDEGVAGLDGRAGRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQG  1307

Query  426   DDGVPGPPGR------MGPPGGPGLPGSAGNKGLPGLTIM------------GPPGMDGL  467
             D G PG PG       +GP G  G  G  G +G  G  I+            G PG DG 
Sbjct  1308  DVGFPGAPGHNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGA  1367

Query  468   PGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGEQGLPGLPGTPGFPGLPGLDGGSG  527
              G  G+PGL G  G  G PGP+GP G      G  G  G+ GL G  G PG+        
Sbjct  1368  KGEQGYPGLPGKNGRVGAPGPRGPTGDA----GWGGIDGMDGLVGPKGQPGVT-YSYSMA  1422

Query  528   LPGIKGEDCGYCPPGYPGAKGTDGDPGIPGASGLPGFHGLPGERGPKGL---------GG  578
              PG +GE      PG  G +G +GD G PG  G  G  G  G RG +G           G
Sbjct  1423  RPGDRGE------PGLDGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQG  1476

Query  579   KGGPRGYQGLTGRPGSAGLAGRQG  602
             + G +GY GLTG PG  GL G QG
Sbjct  1477  QRGDKGYMGLTGAPGLRGLPGPQG  1500


 Score = 138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 242/648 (37%), Positives = 286/648 (44%), Gaps = 102/648 (16%)

Query  900   RGLPGIPGIRGIDGGVGPLGDKGMQGEPGLTGLRGMDGNLGIPGLDGLPGRQGLPG---L  956
             R L G+PG+  + G +             +T   G   N  +    G+ GR G PG   +
Sbjct  7     RHLSGLPGVVYLLGSL-----------VSVTLADGKICNTTLCDCKGIKGRMGAPGPIGV  55

Query  957   PGTEGDRGTMGIPGQKGPNGRPGLPGTFGIDGPKGDPGAPGLDGLNGRDGDAGESGDPGI  1016
             PG EG  G +G PG+ GP G  G  G +G  G KG  G  G  G  G  G  G+SG+PG 
Sbjct  56    PGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGDIGPKGEMGYPGIMGKSGEPGT  115

Query  1017  PGQKGIPGDGGFPAVPGDRGEPGFPGEIGPRGNPGFNGLKGQLGEPGEVIGGEPGIPGER  1076
             PG +GI G  G P +   +G  G PG+ G RG PG +  +G  GE GE      G  G R
Sbjct  116   PGPRGIDGCDGRPGM---QGPSGRPGQNGVRGPPGKSRQQGPPGEAGEGGINSKGTKGNR  172

Query  1077  GES---GLPGVSGRGGQKGIMGDMGIPGEKGMAGNRGFPGRQGRPG--------WSGKPG  1125
             GE+   G  G  G  G +G  GD G  G  G  G+ G PG +G  G          G PG
Sbjct  173   GETGQPGGVGPPGFDGDRGSKGDTGYAGLTGEKGDPGLPGPKGDTGAVSELPYSLIGPPG  232

Query  1126  GKGIRGSPGFPGAF----GLKGFSGEPGEPGFSGRPGPIGEPGFPGGPGFPGFPGVKGEP  1181
              KG  G     G       LKG+ G  G  G  G  GP GE G  G  G PG  G  G P
Sbjct  233   AKGEPGDS-LSGVLKPDDTLKGYKGYVGLQGDEGPQGPTGEQGAVGRNGLPGARGEIGGP  291

Query  1182  GETALLAFGSPGESGLPGEKGPVGDRGDAGFSGGPGLKGEPGDFGAAGKPGRPGGPGQKG  1241
             GE      G PG+ G PG  G  G +G  G++G  GL G PG+ G  G  G PG  G  G
Sbjct  292   GER-----GKPGKDGEPGRFGDKGMKGAPGWTGADGLDGSPGERGEDGFTGMPGVQGGAG  346

Query  1242  APGEYGRDGAPGRPGPPGFRRD-------------GPKGQPGDPGPLGPSGSPGLTGRRG  1288
              PG Y        PGP G + D             G  G+ G  G  G SG PGL G RG
Sbjct  347   PPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRG  406

Query  1289  PPGRS--------------------GGPGLKGPRGDRGRPSISFRGEPGEAGLDGYDGLP  1328
             PPGRS                    G  GL G  G  G P  +  G  GE GL+G  GL 
Sbjct  407   PPGRSERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLE  466

Query  1329  GERGIPGESGRDGFIGLPGR-------------PGPRGGPGDDGRPGLRGIDGRQGSKGD  1375
             G RG  GE G  G  GLPG              PG RG PGDDG  GLRG+ G +G +GD
Sbjct  467   GYRGDRGEVGLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYYGLRGLPGEKGLRGD  526

Query  1376  ---IGDPGPL-------STFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGEAGT  1425
                + + GP         T + G+ G+ G  G +G  G  G +G PGRAG  G  G AG 
Sbjct  527   DCPVCNAGPRGPRGQEGDTGYPGSHGNRGAIGLAGPRGVQGLQGNPGRAGHKGLPGPAGI  586

Query  1426  PGPSGLPGLQGPKGML--------GESGFPGIPGNRGLPGFPGSPGPD  1465
             PG  G  G  GP G          GE G  G  G+RG  G  G  G D
Sbjct  587   PGEPGKVGAAGPDGKAIEVGSLRKGEIGDTGDSGHRGDTGDDGEKGRD  634


 Score = 108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 174/488 (36%), Positives = 201/488 (41%), Gaps = 82/488 (17%)

Query  120   RAFKVAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGVKGDRGDSGQPGG  179
             R  +V    P G  G  G  G RG  G  G  G PG+P        G KG  G  G+ G 
Sbjct  1060  RKGEVGSPGPNGLPGRHGLKGQRGDRGLPGQQGRPGEP--------GAKGLGGYPGRNGI  1111

Query  180   HGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDG----------------------  217
             +G     GF GP G +GP G+ G  G  G  G+ GD G                      
Sbjct  1112  NGLKAATGFPGPQGPKGPQGESGVVGLDGRNGQIGDQGPRGLIGEQGEQGEQGDEGEVGI  1171

Query  218   -------ETNSGYPGVKGEQGETGSPGPKGQQQVFPLDTIFWKGPRGLPGPPGDRGIPGE  270
                       S Y G  G+QG  G  G +G             GP G  GPPG +G  G+
Sbjct  1172  PGRLENLRDRSFYRGFTGDQGLQGERGEQGDM-----------GPIGFIGPPGAKGERGD  1220

Query  271   KGFEGSKGLDGVPGFVGSKGMKGERGPDGPRGKQGRDGQSGPSGLKGAKGAPGYAGSNGA  330
              G+ G  G DG  G    KG +G++GP GP G            L   KG  G AG +G 
Sbjct  1221  IGYAGQLGFDGAEGL---KGFQGDQGPRGPPGIT----------LPAEKGDEGVAGLDGR  1267

Query  331   DGGKGEGGEDGQPGPPGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGESGLPG  390
              G  G  G+ G PGPPG  G  GA G              P  QGP G  G+ G  G PG
Sbjct  1268  AGRPGHFGQKGAPGPPGENGPNGAIGHR-----------GPQIQGPPGPQGDVGFPGAPG  1316

Query  391   QPGDLGFRGPPGPPGPEGVPGNPGQRGLSIKGDPGD------DGVPGPPGRMGPPGGPGL  444
               G  G  GP G  G  G  G  G+ G +I G  GD       G PG  G  G  G PGL
Sbjct  1317  HNGRHGLIGPKGELGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGL  1376

Query  445   PGSAGNKGLPGLTIMGPPGMDGLPGRDGFPGLRGDRGEAGVPGPKGPAGFGVQIRGPPGE  504
             PG  G  G PG    GP G  G  G DG  GL G +G+ GV      A  G   RG PG 
Sbjct  1377  PGKNGRVGAPG--PRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPG--DRGEPGL  1432

Query  505   QGLPGLPGTPGFPGLPGLDGGSGLPGIKGEDCGYCPPGYPGAKGTDGDPGIPGASGLPGF  564
              G  G  G  G PGL G  G  G  G +G+       G  G +G  GD G  G +G PG 
Sbjct  1433  DGFQGEEGDGGAPGLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPGL  1492

Query  565   HGLPGERG  572
              GLPG +G
Sbjct  1493  RGLPGPQG  1500


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 117/310 (38%), Positives = 144/310 (46%), Gaps = 35/310 (11%)

Query  124   VAPVSPPGDRGNPGYPGSRGPPGGFGPVGPPGDPGEGGINSVGVKGDRGDSGQPGGHGQD  183
             + P    G+RG+ GY G  G  G  G  G  GD G  G   + +  ++GD G  G  G+ 
Sbjct  1209  IGPPGAKGERGDIGYAGQLGFDGAEGLKGFQGDQGPRGPPGITLPAEKGDEGVAGLDGRA  1268

Query  184   GIPGFTGPPGYQGPPGDPGYAGGPGY--------PGEKGDDGETNSGYPGVKGEQGETGS  235
             G PG  G  G  GPPG+ G  G  G+        PG +GD      G+PG  G  G  G 
Sbjct  1269  GRPGHFGQKGAPGPPGENGPNGAIGHRGPQIQGPPGPQGD-----VGFPGAPGHNGRHGL  1323

Query  236   PGPKGQQQVFPLDTIFWKGPRGLPGPP--------GDRGIPGEKGFEGSKGLDGVPGFVG  287
              GPKG+     L  +  +G RG  G          GD G  GE G++G+KG  G PG  G
Sbjct  1324  IGPKGE-----LGDMGRQGERGESGYAIVGRQGDIGDIGFQGEPGWDGAKGEQGYPGLPG  1378

Query  288   SKGMKGERGPDGPRGKQGRDGQSGPSGLKGAKGAPG--YAGSNGADGGKGEGGEDGQPGP  345
               G  G  GP GP G  G  G  G  GL G KG PG  Y+ S    G +GE G DG  G 
Sbjct  1379  KNGRVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLDGFQGE  1438

Query  346   PGVQGTLGAPGEFDYNSDGVGVPGAPGFQGPTGLPGEAGESGLPGQPGDLGFRGPPGPPG  405
                +G  GAPG   +     G  GA G++G  G  G  G  G  GQ GD G+ G  G PG
Sbjct  1439  ---EGDGGAPGLIGFQ----GQRGAVGYRGDQGEVGYTGADGPQGQRGDKGYMGLTGAPG  1491

Query  406   PEGVPGNPGQ  415
               G+PG  G+
Sbjct  1492  LRGLPGPQGE  1501


 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 59/116 (51%), Gaps = 8/116 (7%)

Query  1363  LRGIDGRQGSKGDIGDPGPLSTFFKGAQGDPGLPGFSGQPGQPGRRGFPGRAGQPGFQGE  1422
              +GI GR G+ G IG PG      +G  GD G PG +G  G+ G  G  G  G+ G +G+
Sbjct  40    CKGIKGRMGAPGPIGVPG-----LEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGHRGD  94

Query  1423  AGTPGPSGLPGLQGPKGMLGESGFPGIPGNRGLPGF---PGSPGPDALPGPPPRSR  1475
              G  G  G PG+ G  G  G  G  GI G  G PG     G PG + + GPP +SR
Sbjct  95    IGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGRPGQNGVRGPPGKSR  150


 Score = 37.0 bits (84),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 62/130 (48%), Gaps = 21/130 (16%)

Query  123   KVAPVSPPGDRGNPGYPGSRGPPGGFGPVGP-----------PGDPGEGGINSVGVKGDR  171
             +V    P G  G+ G+ G  G  G  GP G            PGD GE G++  G +G+ 
Sbjct  1382  RVGAPGPRGPTGDAGWGGIDGMDGLVGPKGQPGVTYSYSMARPGDRGEPGLD--GFQGEE  1439

Query  172   GDSGQPGGHGQDGIPGFTGPPGYQGPPGDPGYAGGPGYPGEKGDDGETNSGYPGVKGEQG  231
             GD G P   G  G  G  G  GY+G  G+ GY G  G  G++GD      GY G+ G  G
Sbjct  1440  GDGGAP---GLIGFQGQRGAVGYRGDQGEVGYTGADGPQGQRGD-----KGYMGLTGAPG  1491

Query  232   ETGSPGPKGQ  241
               G PGP+G+
Sbjct  1492  LRGLPGPQGE  1501



Lambda      K        H
   0.321    0.133    0.386 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 684922980


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  12:13 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000035-PA

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PDV9_DROME  unnamed protein product                                 601     0.0  
M9PDI9_DROME  unnamed protein product                                 593     0.0  
SKY_DROME  unnamed protein product                                    569     0.0  


>M9PDV9_DROME unnamed protein product
Length=597

 Score = 601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/532 (54%), Positives = 380/532 (71%), Gaps = 11/532 (2%)

Query  1    MVDAGKAKEVKLLLREASWMVDDPIRKELWVTLSGQHEASKTSLDGMYWETVKQIFGHTD  60
            ++  GK ++VK +LRE SW ++ PIR +LW  L GQH+  +  LDG YWE V Q+FG T+
Sbjct  65   LLQQGKKRDVKNILRENSWPINSPIRAQLWPMLCGQHQTKQQMLDGFYWEMVHQVFGTTE  124

Query  61   LPMQAIALPSFMDNQQPFTYYLTTEGRRKAERVVTVIGYAYPDITYCPLVFPLACLLLHY  120
            L  + I LP+F+D      Y+LT+ GR  A+R+V V+GY  PDITY P+++P+  +LLH+
Sbjct  125  LSEKPIMLPAFVDATHCLPYHLTSTGRAVADRIVNVLGYDCPDITYSPVLYPITSILLHF  184

Query  121  LPEEPCYEALLTLLSAKHKRFITQTKLLHEVTWRTAMQLTKKFAKNAFVHLSRPLGREAL  180
            + EE  Y  L  L+ +K K FI QTKL HEVTW+T MQ+ KK  K+A  +  R      L
Sbjct  185  MSEEEAYICLAGLVGSKEKVFINQTKLQHEVTWKTVMQIAKKHTKSATSYFQRICPGLKL  244

Query  181  EHMFQGWLGWIFRELPISHLLRVVDCYLHEGMKVLYRIAMAICILFWKHHTRVD------  234
            E +F  W  WI   LP  HL+R++DCY HEG+KVLYR+A+ I  LF K     +      
Sbjct  245  ERIFMDWCWWILAGLPFQHLVRIMDCYFHEGIKVLYRVALVILNLFHKECQSNNEWSPDN  304

Query  235  -AQEVEATFMRFCREMGNTVSPDKLLKTAFTIRHLRSKEISSIFLKTEMCLKSNSVI-CG  292
               ++    ++FC+++   VSP KLL  AF+IR L ++ IS IF+KTEM LKS SV+  G
Sbjct  305  IKNDIGNALIKFCKKI--PVSPAKLLHAAFSIRGLSTQYISRIFIKTEMLLKSRSVLTSG  362

Query  293  SSQVQRSKSSENMPTSQSQLDIHMMSHTLTIREGATSPGAKVKSMGDYPIQNLKSSAVEH  352
            S Q+ +S+SS+N+PTSQSQ++I MMSHTLTIREG  SPG +  +MG YPI NLKS A ++
Sbjct  363  SKQLIKSRSSDNLPTSQSQVNIQMMSHTLTIREGEKSPGHRAIAMGVYPIHNLKSQACKN  422

Query  353  DCLLTLWSWLPVRITMYTPSLLYTTEEHGCSLTTFFGKVDGYEPTIMIVKTLTNEVFGAY  412
            + L TLWSWLPVRITMY P LLYTTEEHGCSLTTF+ +V+ +EPT++++KT  NEVFGAY
Sbjct  423  EDLFTLWSWLPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHEPTLLMIKTCNNEVFGAY  482

Query  413  LSTSWRERNCRDEHGSRQAYFGTGESFLFTLSPERRKFPWVGINQTK-VDHGNELFMAAD  471
             S+ W ERN +D+ G RQAYFGTGE+FLF+L PER K+PWVGI   K + H +ELFMAAD
Sbjct  483  CSSRWFERNVKDDKGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAAD  542

Query  472  AHMLTIGGGGGQSIWLDENLRFGKTEPCTTFDNPPLCSRTDFEVKVVEVFGF  523
            + M+TIGGG GQ+IW+DEN+RFGKT+ C TF+NPPLC   DFE++V+EV+GF
Sbjct  543  SKMITIGGGEGQAIWMDENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVYGF  594


>M9PDI9_DROME unnamed protein product
Length=606

 Score = 593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 380/541 (70%), Gaps = 20/541 (4%)

Query  1    MVDAGKAKEVKLLLREASWMVDDPIRKELWVTLSGQHEASKTSLDGMYWETVKQIFGHTD  60
            ++  GK ++VK +LRE SW ++ PIR +LW  L GQH+  +  LDG YWE V Q+FG T+
Sbjct  65   LLQQGKKRDVKNILRENSWPINSPIRAQLWPMLCGQHQTKQQMLDGFYWEMVHQVFGTTE  124

Query  61   LPMQAIALPSFMDNQQPFTYYLTTEGRRKAERVVTVIGYAYPDITYCPLVFPLACLLLHY  120
            L  + I LP+F+D      Y+LT+ GR  A+R+V V+GY  PDITY P+++P+  +LLH+
Sbjct  125  LSEKPIMLPAFVDATHCLPYHLTSTGRAVADRIVNVLGYDCPDITYSPVLYPITSILLHF  184

Query  121  LPEEPCYEALLTLLSAKHKRFITQTKLLHEVTWRTAMQLTKKFAKNAFVHLSRPLGREAL  180
            + EE  Y  L  L+ +K K FI QTKL HEVTW+T MQ+ KK  K+A  +  R      L
Sbjct  185  MSEEEAYICLAGLVGSKEKVFINQTKLQHEVTWKTVMQIAKKHTKSATSYFQRICPGLKL  244

Query  181  EHMFQGWLGWIFRELPISHLLRVVDCYLHEGMKVLYRIAMAICILFWKHHTRVD------  234
            E +F  W  WI   LP  HL+R++DCY HEG+KVLYR+A+ I  LF K     +      
Sbjct  245  ERIFMDWCWWILAGLPFQHLVRIMDCYFHEGIKVLYRVALVILNLFHKECQSNNEWSPDN  304

Query  235  -AQEVEATFMRFCREMGNTVSPDKLLKTAFTIRHLRSKEISSIFLKTEMCLKSNSVI-CG  292
               ++    ++FC+++   VSP KLL  AF+IR L ++ IS IF+KTEM LKS SV+  G
Sbjct  305  IKNDIGNALIKFCKKI--PVSPAKLLHAAFSIRGLSTQYISRIFIKTEMLLKSRSVLTSG  362

Query  293  SSQVQRSKSSENMPTSQSQLDIHMMSHTLTIRE---------GATSPGAKVKSMGDYPIQ  343
            S Q+ +S+SS+N+PTSQSQ++I MMSHTLTIRE         G  SPG +  +MG YPI 
Sbjct  363  SKQLIKSRSSDNLPTSQSQVNIQMMSHTLTIRELHSESCRNLGEKSPGHRAIAMGVYPIH  422

Query  344  NLKSSAVEHDCLLTLWSWLPVRITMYTPSLLYTTEEHGCSLTTFFGKVDGYEPTIMIVKT  403
            NLKS A +++ L TLWSWLPVRITMY P LLYTTEEHGCSLTTF+ +V+ +EPT++++KT
Sbjct  423  NLKSQACKNEDLFTLWSWLPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHEPTLLMIKT  482

Query  404  LTNEVFGAYLSTSWRERNCRDEHGSRQAYFGTGESFLFTLSPERRKFPWVGINQTK-VDH  462
              NEVFGAY S+ W ERN +D+ G RQAYFGTGE+FLF+L PER K+PWVGI   K + H
Sbjct  483  CNNEVFGAYCSSRWFERNVKDDKGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGH  542

Query  463  GNELFMAADAHMLTIGGGGGQSIWLDENLRFGKTEPCTTFDNPPLCSRTDFEVKVVEVFG  522
             +ELFMAAD+ M+TIGGG GQ+IW+DEN+RFGKT+ C TF+NPPLC   DFE++V+EV+G
Sbjct  543  SSELFMAADSKMITIGGGEGQAIWMDENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVYG  602

Query  523  F  523
            F
Sbjct  603  F  603


>SKY_DROME unnamed protein product
Length=587

 Score = 569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/532 (52%), Positives = 367/532 (69%), Gaps = 21/532 (4%)

Query  1    MVDAGKAKEVKLLLREASWMVDDPIRKELWVTLSGQHEASKTSLDGMYWETVKQIFGHTD  60
            ++  GK ++VK +LRE SW ++ PIR +LW  L GQH+  +  LDG YWE V Q+FG T+
Sbjct  65   LLQQGKKRDVKNILRENSWPINSPIRAQLWPMLCGQHQTKQQMLDGFYWEMVHQVFGTTE  124

Query  61   LPMQAIALPSFMDNQQPFTYYLTTEGRRKAERVVTVIGYAYPDITYCPLVFPLACLLLHY  120
            L  + I LP+F+D      Y+LT+ GR  A+R+V V+GY  PDITY P+++P+  +LLH+
Sbjct  125  LSEKPIMLPAFVDATHCLPYHLTSTGRAVADRIVNVLGYDCPDITYSPVLYPITSILLHF  184

Query  121  LPEEPCYEALLTLLSAKHKRFITQTKLLHEVTWRTAMQLTKKFAKNAFVHLSRPLGREAL  180
            + EE  Y  L  L+ +K K FI QTKL HEVTW+T MQ+ KK  K+A  +  R      L
Sbjct  185  MSEEEAYICLAGLVGSKEKVFINQTKLQHEVTWKTVMQIAKKHTKSATSYFQRICPGLKL  244

Query  181  EHMFQGWLGWIFRELPISHLLRVVDCYLHEGMKVLYRIAMAICILFWKHHTRVD------  234
            E +F  W  WI   LP  HL+R++DCY HEG+KVLYR+A+ I  LF K     +      
Sbjct  245  ERIFMDWCWWILAGLPFQHLVRIMDCYFHEGIKVLYRVALVILNLFHKECQSNNEWSPDN  304

Query  235  -AQEVEATFMRFCREMGNTVSPDKLLKTAFTIRHLRSKEISSIFLKTEMCLKSNSVI-CG  292
               ++    ++FC+++   VSP KLL  AF+IR L ++ IS IF+KTEM LKS SV+  G
Sbjct  305  IKNDIGNALIKFCKKI--PVSPAKLLHAAFSIRGLSTQYISRIFIKTEMLLKSRSVLTSG  362

Query  293  SSQVQRSKSSENMPTSQSQLDIHMMSHTLTIREGATSPGAKVKSMGDYPIQNLKSSAVEH  352
            S Q+ +S+SS+N+PTSQSQ++I MMSHTLTIRE    PG K          N   +  + 
Sbjct  363  SKQLIKSRSSDNLPTSQSQVNIQMMSHTLTIREHFGLPGTK----------NFIKTWTDR  412

Query  353  DCLLTLWSWLPVRITMYTPSLLYTTEEHGCSLTTFFGKVDGYEPTIMIVKTLTNEVFGAY  412
              L TLWSWLPVRITMY P LLYTTEEHGCSLTTF+ +V+ +EPT++++KT  NEVFGAY
Sbjct  413  QFLFTLWSWLPVRITMYQPVLLYTTEEHGCSLTTFYVRVEQHEPTLLMIKTCNNEVFGAY  472

Query  413  LSTSWRERNCRDEHGSRQAYFGTGESFLFTLSPERRKFPWVGINQTK-VDHGNELFMAAD  471
             S+ W ERN +D+ G RQAYFGTGE+FLF+L PER K+PWVGI   K + H +ELFMAAD
Sbjct  473  CSSRWFERNVKDDKGQRQAYFGTGETFLFSLYPERAKYPWVGIEGDKDLGHSSELFMAAD  532

Query  472  AHMLTIGGGGGQSIWLDENLRFGKTEPCTTFDNPPLCSRTDFEVKVVEVFGF  523
            + M+TIGGG GQ+IW+DEN+RFGKT+ C TF+NPPLC   DFE++V+EV+GF
Sbjct  533  SKMITIGGGEGQAIWMDENIRFGKTDSCKTFNNPPLCPSGDFEIRVLEVYGF  584



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000036-PA

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A1X7RC97_CAEEL  unnamed protein product                             66.2    1e-11
E9AEX1_LEIMA  unnamed protein product                                 62.8    1e-10
Q380Z6_TRYB2  unnamed protein product                                 32.0    1.5  


>A0A1X7RC97_CAEEL unnamed protein product
Length=327

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/239 (27%), Positives = 105/239 (44%), Gaps = 26/239 (11%)

Query  91   MYNLTKAVEDIRTHFEQIVDSGCKPLAIGGDHTL---TYPVLQAIKKRWGPVGLIHVDAH  147
            M  +T+    +     Q++++  + L  GGDH+    T+  +    +  G +GLI VDAH
Sbjct  68   MSGVTQTCRQLAHETRQVIENKEELLVFGGDHSCAIGTWSGVATAMRPVGDIGLIWVDAH  127

Query  148  NDC-----SDT--MMGQKVAH------GTTFRRAQEDGLLLKNKVVQIGIRGSRYTLEDN  194
             D      SDT  + G  VAH       T  +       LL + +  +GIR   Y   + 
Sbjct  128  MDAHTPDTSDTGNIHGMPVAHLLGFGDKTLVKIGDRLPKLLPHNLCMVGIRD--YESAEQ  185

Query  195  DWGISQGFRVVLVEECWHKSLAPLMEEVRGMMGDAPV-Y-LSFDIDGIDPGFAPGTGTPE  252
            +     G R+    E   + +  +M+E + ++    + Y LS D+DG D  +AP  GTP 
Sbjct  186  ELLEKLGVRIFYAHEVEKRGIQDVMQEAQYLVTRNTIGYGLSIDLDGFDVSYAPAVGTPS  245

Query  253  IGGLTPIQALEIIRGSRGLN---LVGCDLVEVSPPYDQAGTTALLAANLLFEMLSALPQ  308
              G   I ALE I+    ++   L+  ++VE  P +D    T+    + L E +    Q
Sbjct  246  ADG---INALEFIKALLTIDLTKLIATEIVEFLPRFDDTQRTSEQLVSSLVEYIYKTKQ  301


 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (48%), Gaps = 8/113 (7%)

Query  397  GFRVVLAEACWHKSLIPLMEEVRGMMGNMPV-Y-LSFDIDGIDPGFAPGTGTPEIGGLTT  454
            G R+  A     + +  +M+E + ++    + Y LS D+DG D  +AP  GTP   G   
Sbjct  192  GVRIFYAHEVEKRGIQDVMQEAQYLVTRNTIGYGLSIDLDGFDVSYAPAVGTPSADG---  248

Query  455  IQALEIIRGCKGLN---LIGCDIVEVSPPYDQSGTTALLAANLLFEMLSALPQ  504
            I ALE I+    ++   LI  +IVE  P +D +  T+    + L E +    Q
Sbjct  249  INALEFIKALLTIDLTKLIATEIVEFLPRFDDTQRTSEQLVSSLVEYIYKTKQ  301


>E9AEX1_LEIMA unnamed protein product
Length=329

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 94/209 (45%), Gaps = 24/209 (11%)

Query  95   TKAVEDIRTHFEQIVDSGCKPLAIGGDHTLTYPVLQAIKKRWGPVGLIHVDAHNDCSDTM  154
             +  E I     ++ + G  PL IGGDH++    +  +   +   G+I VDAH D  +TM
Sbjct  87   AECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGTVAGVLSVYPDAGVIWVDAHADI-NTM  145

Query  155  MGQKVA--HGTTFR----RAQED---------GLLLKNKVVQIGIRGSRYTLED--NDWG  197
             G      HG          +E+          +L  NK+  IG+R      +   +D  
Sbjct  146  SGTVSGNLHGCPLSILLGLDRENIPECFSWVPQVLKPNKIAYIGLRAVDEEEKKILHDLN  205

Query  198  ISQGFRVVLVEECWHKSLAPLMEEVRGMMGDAPVYLSFDIDGIDPGFAPGTGTPEIGGLT  257
            I+  F +  V+      +  +  E     G  PV +S+D+D IDP + P TGTP  GGL+
Sbjct  206  IA-AFSMHHVDRYGINKVVSMAIEAISPKGTEPVMVSYDVDTIDPLYVPATGTPVRGGLS  264

Query  258  PIQAL---EIIRGSRGLNLVGCDLVEVSP  283
              +AL   E+I  +    LV  D+VE +P
Sbjct  265  FREALFLCELI--AECGRLVALDVVECNP  291


 Score = 49.7 bits (117),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (62%), Gaps = 5/60 (8%)

Query  423  GNMPVYLSFDIDGIDPGFAPGTGTPEIGGLTTIQAL---EIIRGCKGLNLIGCDIVEVSP  479
            G  PV +S+D+D IDP + P TGTP  GGL+  +AL   E+I  C    L+  D+VE +P
Sbjct  234  GTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCELIAECG--RLVALDVVECNP  291


>Q380Z6_TRYB2 unnamed protein product
Length=912

 Score = 32.0 bits (71),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (4%)

Query  356  SLTRAVEDIRSFFEQIMKSGCKPLAIGGDHTLTYPVLQAIKGFRVVLAEACWHK  409
            +L   V  ++SFFE+I +    P   GGD TLT    + ++    V  E C H+
Sbjct  226  TLQNIVMSLKSFFERIAQR--NPGNDGGDSTLTAACEEELEMISCVYGEECVHR  277



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000037-PA

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCGH_DICDI  unnamed protein product                                  31.6    0.91 
Q385I2_TRYB2  unnamed protein product                                 30.4    1.5  
Q586V2_TRYB2  unnamed protein product                                 29.6    2.8  


>ABCGH_DICDI unnamed protein product
Length=1476

 Score = 31.6 bits (70),  Expect = 0.91, Method: Composition-based stats.
 Identities = 15/51 (29%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  169  RQDVPDFPGQFKTARRRLKEKGIKGRVPAKKIVLTQAQKDARLEFAMDYLE  219
            R+  PDF       + R+ + G +GRVP   + L  A K ++L  +M + +
Sbjct  403  RKSTPDFLTGITNPQERIVKVGFEGRVPETSVDLEDAWKKSQLFQSMKHAQ  453


>Q385I2_TRYB2 unnamed protein product
Length=342

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 52/129 (40%), Gaps = 19/129 (15%)

Query  70   PATMRTAYKSMPHSSQEERGMIAAYHEKGMRPALIAQQPGISLSVRSIERWV---KRYSE  126
            P  ++ A KS      ++RGM  + HE G+   LI   P I   V  +E W    +  +E
Sbjct  34   PVALKVAAKS----GSDDRGMHPSLHEAGVY-KLICPHPSIPDYVDCVEDWFDTERFLAE  88

Query  127  EDMQGLKTRKIPGRPRVSTQEQDEALVEAARLRPFQPSTTTVRQDVP-DFPGQFKTARRR  185
            E+ +G +       P + TQ      ++A  L  F  S   +R  V      Q     + 
Sbjct  89   EERRGEQR-----LPVLVTQ-----FIKAVALDRFLCSVRVIRWSVVIHIANQLVEVLKH  138

Query  186  LKEKGIKGR  194
            +  KG+  R
Sbjct  139  INSKGVVYR  147


>Q586V2_TRYB2 unnamed protein product
Length=525

 Score = 29.6 bits (65),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 34/82 (41%), Gaps = 7/82 (9%)

Query  30   PRSGRPKSTTPDLDNLVLSSVKAQPERAASSVVKEVAPDYPATMRTAYKSMPHSSQEERG  89
            PR  R  +TT   DN+   SV  +    +   +K +A DY AT +  +     +  +ER 
Sbjct  45   PRDKRIVNTTDVTDNVDWGSVNMKLTEESFEKLKTIAKDYFATCKHLFVMDCFAGHDERY  104

Query  90   MIAA-------YHEKGMRPALI  104
             +         YH   MR  LI
Sbjct  105  RLKVRVYTTRPYHALFMRNMLI  126



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000038-PA

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BL83_CAEEL  unnamed protein product                                 52.0    2e-08
E9AEB2_LEIMA  unnamed protein product                                 40.4    2e-04
Q57V58_TRYB2  unnamed protein product                                 40.0    2e-04


>Q9BL83_CAEEL unnamed protein product
Length=430

 Score = 52.0 bits (123),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 44/70 (63%), Gaps = 1/70 (1%)

Query  19  AIAVLKRAVEMDTKKRFTESLVCYQEGLQLLMEAIKHVSD-EAKRAQFRKKAGEYMDRAE  77
           AI ++ +A E DT  R+ ++L  Y + ++  + AIK+ S  + +R   R K G+Y++RAE
Sbjct  9   AIELVTKATEEDTAGRYDQALRLYDQAIEYFLHAIKYESQGDKQRNAIRDKVGQYLNRAE  68

Query  78  KVKAHIEREK  87
           ++K H++  K
Sbjct  69  QIKTHLKDGK  78


>E9AEB2_LEIMA unnamed protein product
Length=445

 Score = 40.4 bits (93),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/71 (30%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query  19  AIAVLKRAVEMDTKKRFTESLVCYQEGLQLLMEAIKHVS-DEAKRAQFRKKAGEYMDRAE  77
           A+ + K+A  +D  K + ++   Y E + + + AIK+ + +  KR   R K  + + RAE
Sbjct  9   AVELFKKAATLDENKEYEQAYRWYMETIDVFLTAIKYENKNPTKREYMRSKVSDIIARAE  68

Query  78  KVKAHIEREKE  88
           K+K  ++R K+
Sbjct  69  KIKEFLDRSKD  79


>Q57V58_TRYB2 unnamed protein product
Length=444

 Score = 40.0 bits (92),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 49/98 (50%), Gaps = 13/98 (13%)

Query  17   SAAIAVLKRAVEMDTKKRFTESLVCYQEGLQLLMEAIKH-VSDEAKRAQFRKKAGEYMDR  75
            S A+ + K+A   D +  + E+   Y E +++ + AIK+   +  KR   RKK  E  +R
Sbjct  7    SKAVELFKKAARHDEQGEYREAYHWYMEAIEVFITAIKYETKNVTKRDLLRKKTMEITER  66

Query  76   AEKVKAHIEREKELGQYHEQIHIDNNSTGFSYASVMGR  113
            AEK+K ++E            + D N +G   +S +G+
Sbjct  67   AEKIKEYLE------------NCDANRSGGQASSAVGQ  92



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000039-PA

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q94543_DROME  unnamed protein product                                 84.0    1e-16
Q9W2R4_DROME  unnamed protein product                                 82.8    3e-16
Q24367_DROME  unnamed protein product                                 82.0    6e-16


>Q94543_DROME unnamed protein product
Length=767

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 134/255 (53%), Gaps = 12/255 (5%)

Query  249  HTFTALVDLMLSREVKVLLEAVEDASPMTLPDLRLALHSLAAL-GLDGDHLCRL---IAR  304
            HT   L  L+  R V+VL+ ++E +    L  LR  ++ +A L  +D D    L     +
Sbjct  460  HTLITL-RLIFERLVRVLVISIEQSQCDLL--LRANINMVATLMNIDYDGFASLSDAFVQ  516

Query  305  EGGIRSLLELCLELRLRATRPLALRALATVCCVSESIRQLEKAGGVEVLSDILCDPTS--  362
               +R+LL + L+ +  + R LALRALAT+CC  ++I QL   GG+E++ DIL   ++  
Sbjct  517  NEAVRTLLVVVLDHKQSSVRALALRALATLCCAPQAINQLGSCGGIEIVRDILQVESAGE  576

Query  363  -DAEELSEAAGVLAQITSPWIDNNHRIQDLDRHVVPLVRSLTSLAGSTSSTETFLLAAAA  421
              A E  EA  +LAQIT+ W  + HR+  L      LV  L +L      T+T LL AAA
Sbjct  577  RGAIERREAVSLLAQITAAWHGSEHRVPGLRDCAESLVAGLAALLQPECCTQTLLLCAAA  636

Query  422  LANLTFMEGAAALALSSTGAVRVLVQAVRASP-NSSVFLQDQVATVLANLSAVPECRHDV  480
            L NL+ ME  +  ++ S  A+  L+  +      +SVFL +Q+  +L N+S   +C H  
Sbjct  637  LNNLSRMEATSHYSIMSNEAIFRLIDTLEHQTCGTSVFLYEQIVGMLHNMSLNKKC-HSH  695

Query  481  VRNHGLVALLCFLQQ  495
            + N  ++  +  + Q
Sbjct  696  LANGVIINFITSVYQ  710


>Q9W2R4_DROME unnamed protein product
Length=859

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 134/255 (53%), Gaps = 12/255 (5%)

Query  249  HTFTALVDLMLSREVKVLLEAVEDASPMTLPDLRLALHSLAAL-GLDGDHLCRL---IAR  304
            HT   L  L+  R V+VL+ ++E +    L  LR  ++ +A L  +D D    L     +
Sbjct  459  HTLITL-RLIFERLVRVLVISIEQSQCDLL--LRANINMVATLMNIDYDGFASLSDAFVQ  515

Query  305  EGGIRSLLELCLELRLRATRPLALRALATVCCVSESIRQLEKAGGVEVLSDILCDPTS--  362
               +R+LL + L+ +  + R LALRALAT+CC  ++I QL   GG+E++ DIL   ++  
Sbjct  516  NEAVRTLLVVVLDHKQSSVRALALRALATLCCAPQAINQLGSCGGIEIVRDILQVESAGE  575

Query  363  -DAEELSEAAGVLAQITSPWIDNNHRIQDLDRHVVPLVRSLTSLAGSTSSTETFLLAAAA  421
              A E  EA  +LAQIT+ W  + HR+  L      LV  L +L      T+T LL AAA
Sbjct  576  RGAIERREAVSLLAQITAAWHGSEHRVPGLRDCAESLVAGLAALLQPECCTQTLLLCAAA  635

Query  422  LANLTFMEGAAALALSSTGAVRVLVQAVRASP-NSSVFLQDQVATVLANLSAVPECRHDV  480
            L NL+ ME  +  ++ S  A+  L+  +      +SVFL +Q+  +L N+S   +C H  
Sbjct  636  LNNLSRMEATSHYSIMSNEAIFRLIDTLEHQTCGTSVFLYEQIVGMLHNMSLNKKC-HSH  694

Query  481  VRNHGLVALLCFLQQ  495
            + N  ++  +  + Q
Sbjct  695  LANGVIINFITSVYQ  709


>Q24367_DROME unnamed protein product
Length=859

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 134/255 (53%), Gaps = 12/255 (5%)

Query  249  HTFTALVDLMLSREVKVLLEAVEDASPMTLPDLRLALHSLAAL-GLDGD---HLCRLIAR  304
            HT   L  L+  R V+VL+ ++E +    L  LR  ++ +A L  +D D    L     +
Sbjct  459  HTLITL-RLIFERLVRVLVISIEQSQCDLL--LRANINMVATLMNIDYDGFRSLSDAFVQ  515

Query  305  EGGIRSLLELCLELRLRATRPLALRALATVCCVSESIRQLEKAGGVEVLSDILCDPTS--  362
               +R+LL + L+ +  + R LALRALAT+CC  ++I QL   GG+E++ DIL   ++  
Sbjct  516  NEAVRTLLVVVLDHKQSSVRALALRALATLCCAPQAINQLGSCGGIEIVRDILQVESAGE  575

Query  363  -DAEELSEAAGVLAQITSPWIDNNHRIQDLDRHVVPLVRSLTSLAGSTSSTETFLLAAAA  421
              A E  EA  +LAQIT+ W  + HR+  L      LV  L +L      T+T LL AAA
Sbjct  576  RGAIERREAVSLLAQITAAWHGSEHRVPGLRDCAESLVAGLAALLQPECCTQTLLLCAAA  635

Query  422  LANLTFMEGAAALALSSTGAVRVLVQAVRASP-NSSVFLQDQVATVLANLSAVPECRHDV  480
            L NL+ ME  +  ++ S  A+  L+  +      +SVFL +Q+  +L N+S   +C H  
Sbjct  636  LNNLSRMEATSHYSIMSNEAIFRLIDTLEHQTCGTSVFLYEQIVGMLHNMSLNKKC-HSH  694

Query  481  VRNHGLVALLCFLQQ  495
            + N  ++  +  + Q
Sbjct  695  LANGVIINFITSVYQ  709



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000040-PA

Length=1248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDC6_DROME  unnamed protein product                                 195     7e-51
O76858_DROME  unnamed protein product                                 194     2e-50
Q8SXA1_DROME  unnamed protein product                                 163     2e-41


>Q9VDC6_DROME unnamed protein product
Length=879

 Score = 195 bits (495),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 204/723 (28%), Positives = 326/723 (45%), Gaps = 108/723 (15%)

Query  19   CLHEMFGRQAKESPDKVAVV--------GHQGQKVTFRQL-ERMTDA--LATALRH-RGV  66
             LH +F  Q     DKVA++        G    + ++RQ+ ER   A  L  A  H R +
Sbjct  21   ALHRIFEEQQLRHADKVALIYQPSTTGQGMAPSQSSYRQMNERANRAARLLVAETHGRFL  80

Query  67   RRNR----IVGIYMERCLEFVVSYIAILKAGGGYLPIEVSYPQPLLESVLEDAEPVVVCT  122
            + N     IV + M+     V + +AI KAGG YLPI+ S+P   +  +L +A+P +V  
Sbjct  81   QPNSDGDFIVAVCMQPSEGLVTTLLAIWKAGGAYLPIDPSFPANRIHHILLEAKPTLVIR  140

Query  123  KKHL-SERLKGQKEVLILDDDWLSSLEEDNGKLPPFTGPPLV-------GLDDLAYTVYS  174
               + + R +G   +         S  E   K     G  L+       G D +A  +Y+
Sbjct  141  DDDIDAGRFQGTPTL---------STTELYAKSLQLAGSNLLSEEMLRGGNDHIAIVLYT  191

Query  175  SGTTGKPKGIRCPHRGAVFSYHWRHLAFPYEEDDREACNVF--------FVWEMLRPILK  226
            SG+TG PKG+R PH   +    W+   FPY  +  EA +VF         + E+  P++ 
Sbjct  192  SGSTGVPKGVRLPHESILNRLQWQWATFPYTAN--EAVSVFKTALTFVDSIAELWGPLMC  249

Query  227  GVPMYIIPDDVIYDPPRLCEFLMQNRITRMLFTPSLLEAV---LDTRGSIDMQTSFRSMR  283
            G+ + ++P  V  DP RL   L + +I R++  P+LL ++   L   G    Q    ++ 
Sbjct  250  GLAILVVPKAVTKDPQRLVALLERYKIRRLVLVPTLLRSLLMYLKMEGGGAAQKLLYNL-  308

Query  284  QIWFC-GEVVTVGLRNRV---MREIPHIRLLNLYSISECHDIACSDLTHLEVDQSQKF--  337
            QIW C GE ++V L +       E  H RL N Y  +E       D+T+   +  ++   
Sbjct  309  QIWVCSGEPLSVSLASSFFDYFDEGVH-RLYNFYGSTEV----LGDVTYFACESKKQLSL  363

Query  338  ---CPVGRLFPKVHVVIMDSDLNIQPIGLPGEIYVGGPTLALGYLN--RPE--LNAQRFV  390
                P+G       V ++D+D      G  GEI+  G  LA GY+N   PE  L     V
Sbjct  364  YDNVPIGIPLSNTVVYLLDADYRPVKNGEIGEIFASGLNLAAGYVNGRDPERFLENPLAV  423

Query  391  DAGDCRVYRTGDWGYLRSDGGLEICGRCDSMVKIRGYSIEVQAVEAALLDLPMVNSGCVL  450
            +    R+YRTGD+G L+ +G +   GR DS VKIRG+ +++  VE  + +LP+V+   VL
Sbjct  424  EKKYARLYRTGDYGSLK-NGSIMYEGRTDSQVKIRGHRVDLSEVEKNVAELPLVDKAIVL  482

Query  451  ALGEEGSDKTLVAYILPEGK---TNRREVRAALKRRLPFYMIPAKFIFLDSLPILEASGK  507
                   D+ ++A++            ++ A LK +L  YM P + + L+ +P+L  +GK
Sbjct  483  CYHAGQVDQAILAFVKLRDDAPMVTEMQMEARLKDKLADYMTP-QVVILEHVPLL-VNGK  540

Query  508  LDRKALPKV---------DLDNMDDID----PEDLPSTPMEKRLAKSWCEVL---QLKAV  551
            +DR+AL K          D   + D D    PEDL  T   + L ++   V+       +
Sbjct  541  VDRQALLKTYETANNNEGDSSIVLDFDYSQVPEDLKLTA--RDLFETVGGVIGRSTRATL  598

Query  552  DVQESFFDLGGHSLQAARLLNSINEDTGRGISMGDLFAHPTVSSMASFLEEAGNGGDSDA  611
                +F++LGG+SL +   +  + E  G  I + +  A     ++   +E+     D+  
Sbjct  599  APHSNFYELGGNSLNSIFTVTLLRE-KGYNIGISEFIA---AKNLGEIIEKMAANHDAVQ  654

Query  612  LH-------PDLLAEVD----RHDQGVVKIDMRLRAFWRSVQLASNKWSHGKVLLTGATG  660
            L        P L  E       H Q V  ID+ + +F+    L   +W    VL T  + 
Sbjct  655  LEEESLNACPHLKMEAVPLRLEHRQEV--IDIIVASFYNKADL--EQWLKPGVLRTDYSD  710

Query  661  FLG  663
             L 
Sbjct  711  ILN  713


>O76858_DROME unnamed protein product
Length=879

 Score = 194 bits (492),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 204/723 (28%), Positives = 325/723 (45%), Gaps = 108/723 (15%)

Query  19   CLHEMFGRQAKESPDKVAVV--------GHQGQKVTFRQL-ERMTDA--LATALRH-RGV  66
             LH +F  Q     DKVA++        G    + ++RQ+ ER   A  L  A  H R +
Sbjct  21   ALHRIFEEQQLRHADKVALIYQPSTTGQGMAPSQSSYRQMNERANRAARLLVAETHGRFL  80

Query  67   RRNR----IVGIYMERCLEFVVSYIAILKAGGGYLPIEVSYPQPLLESVLEDAEPVVVCT  122
            + N     IV + M+     V + +AI KAGG YLPI+ S+P   +  +L +A+P +V  
Sbjct  81   QPNSDGDFIVAVCMQPSEGLVTTLLAIWKAGGAYLPIDPSFPANRIHHILLEAKPTLVIR  140

Query  123  KKHL-SERLKGQKEVLILDDDWLSSLEEDNGKLPPFTGPPLV-------GLDDLAYTVYS  174
               + + R +G   +         S  E   K     G  L+       G D  A  +Y+
Sbjct  141  DDDIDAGRFQGTPTL---------STTELYAKSLQLAGSNLLSEEMLRGGNDHTAIVLYT  191

Query  175  SGTTGKPKGIRCPHRGAVFSYHWRHLAFPYEEDDREACNVF--------FVWEMLRPILK  226
            SG+TG PKG+R PH   +    W+   FPY  +  EA +VF         + E+  P++ 
Sbjct  192  SGSTGVPKGVRLPHESILNRLQWQWATFPYTAN--EAVSVFKTALTFVDSIAELWGPLMC  249

Query  227  GVPMYIIPDDVIYDPPRLCEFLMQNRITRMLFTPSLLEAV---LDTRGSIDMQTSFRSMR  283
            G+ + ++P  V  DP RL   L + +I R++  P+LL ++   L   G    Q    ++ 
Sbjct  250  GLAILVVPKAVTKDPQRLVALLERYKIRRLVLVPTLLRSLLMYLKMEGGGAAQKLLYNL-  308

Query  284  QIWFC-GEVVTVGLRNRV---MREIPHIRLLNLYSISECHDIACSDLTHLEVDQSQKF--  337
            QIW C GE ++V L +       E  H RL N Y  +E       D+T+   +  ++   
Sbjct  309  QIWVCSGEPLSVSLASSFFDYFDEGVH-RLYNFYGSTEV----LGDVTYFACESKKQLSL  363

Query  338  ---CPVGRLFPKVHVVIMDSDLNIQPIGLPGEIYVGGPTLALGYLN--RPE--LNAQRFV  390
                P+G       V ++D+D      G  GEI+  G  LA GY+N   PE  L     V
Sbjct  364  YDNVPIGIPLSNTVVYLLDADYRPVKNGEIGEIFASGLNLAAGYVNGRDPERFLENPLAV  423

Query  391  DAGDCRVYRTGDWGYLRSDGGLEICGRCDSMVKIRGYSIEVQAVEAALLDLPMVNSGCVL  450
            +    R+YRTGD+G L+ +G +   GR DS VKIRG+ +++  VE  + +LP+V+   VL
Sbjct  424  EKKYARLYRTGDYGSLK-NGSIMYEGRTDSQVKIRGHRVDLSEVEKNVAELPLVDKAIVL  482

Query  451  ALGEEGSDKTLVAYILPEGK---TNRREVRAALKRRLPFYMIPAKFIFLDSLPILEASGK  507
                   D+ ++A++            ++ A LK +L  YM P + + L+ +P+L  +GK
Sbjct  483  CYHAGQVDQAILAFVKLRDDAPMVTETQMEARLKDKLADYMTP-QVVILEHVPLL-VNGK  540

Query  508  LDRKALPKV---------DLDNMDDID----PEDLPSTPMEKRLAKSWCEVL---QLKAV  551
            +DR+AL K          D   + D D    PEDL  T   + L ++   V+       +
Sbjct  541  VDRQALLKTYETANNNEGDSSIVLDFDYSQVPEDLKLTA--RDLFETVGGVIGRSTETTL  598

Query  552  DVQESFFDLGGHSLQAARLLNSINEDTGRGISMGDLFAHPTVSSMASFLEEAGNGGDSDA  611
                +F++LGG+SL +   +  + E  G  I + +  A     ++   +E+     D+  
Sbjct  599  PPHSNFYELGGNSLNSIFTVTLLRE-KGYNIGISEFIA---AKNLGEIIEKMAANHDAVQ  654

Query  612  LH-------PDLLAEVD----RHDQGVVKIDMRLRAFWRSVQLASNKWSHGKVLLTGATG  660
            L        P L  E       H Q V  ID+ + +F+    L   +W    VL T  + 
Sbjct  655  LEEESLNACPHLKMEAVPLRLEHRQEV--IDIIVASFYNKADL--EQWLKPGVLRTDYSD  710

Query  661  FLG  663
             L 
Sbjct  711  ILN  713


>Q8SXA1_DROME unnamed protein product
Length=703

 Score = 163 bits (413),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 158/554 (29%), Positives = 255/554 (46%), Gaps = 75/554 (14%)

Query  164  GLDDLAYTVYSSGTTGKPKGIRCPHRGAVFSYHWRHLAFPYEEDDREACNVF--------  215
            G D +A  +Y+SG+TG PKG+R PH   +    W+   FPY  +  EA +VF        
Sbjct  5    GNDHIAIVLYTSGSTGVPKGVRLPHESILNRLQWQWATFPYTAN--EAVSVFKTALTFVD  62

Query  216  FVWEMLRPILKGVPMYIIPDDVIYDPPRLCEFLMQNRITRMLFTPSLLEAV---LDTRGS  272
             + E+  P++ G+ + ++P  V  DP RL   L + +I R++  P+LL ++   L   G 
Sbjct  63   SIAELWGPLMCGLAILVVPKAVTKDPQRLVALLERYKIRRLVLVPTLLRSLLMYLKMEGG  122

Query  273  IDMQTSFRSMRQIWFC-GEVVTVGLRNRV---MREIPHIRLLNLYSISECHDIACSDLTH  328
               Q    ++ QIW C GE ++V L +       E  H RL N Y  +E       D+T+
Sbjct  123  GAAQKLLYNL-QIWVCSGEPLSVSLASSFFDYFDEGVH-RLYNFYGSTEV----LGDVTY  176

Query  329  LEVDQSQKF-----CPVGRLFPKVHVVIMDSDLNIQPIGLPGEIYVGGPTLALGYLN--R  381
               +  ++       P+G       V ++D+D      G  GEI+  G  LA GY+N   
Sbjct  177  FACESKKQLSLYDNVPIGIPLSNTVVYLLDADYRPVKNGEIGEIFASGLNLAAGYVNGRD  236

Query  382  PE--LNAQRFVDAGDCRVYRTGDWGYLRSDGGLEICGRCDSMVKIRGYSIEVQAVEAALL  439
            PE  L     V+    R+YRTGD+G L+ +G +   GR DS VKIRG+ +++  VE  + 
Sbjct  237  PERFLENPLAVEKKYARLYRTGDYGSLK-NGSIMYEGRTDSQVKIRGHRVDLSEVEKNVA  295

Query  440  DLPMVNSGCVLALGEEGSDKTLVAYILPEGK---TNRREVRAALKRRLPFYMIPAKFIFL  496
            +LP+V+   VL       D+ ++A++            ++ A LK +L  YM P + + L
Sbjct  296  ELPLVDKAIVLCYHAGQVDQAILAFVKLRDDAPMVTEMQMEARLKDKLADYMTP-QVVIL  354

Query  497  DSLPILEASGKLDRKALPKV---------DLDNMDDID----PEDLPSTPMEKRLAKSWC  543
            + +P+L  +GK+DR+AL K          D   + D D    PEDL  T   + L ++  
Sbjct  355  EHVPLL-VNGKVDRQALLKTYETANNNEGDSSIVLDFDYSQVPEDLKLTA--RDLFETVG  411

Query  544  EVL---QLKAVDVQESFFDLGGHSLQAARLLNSINEDTGRGISMGDLFAHPTVSSMASFL  600
             V+       +    +F++LGG+SL +   +  + E  G  I + +  A     ++   +
Sbjct  412  GVIGRSTRATLAPHSNFYELGGNSLNSIFTVTLLRE-KGYNIGISEFIA---AKNLGEII  467

Query  601  EEAGNGGDSDALH-------PDLLAEVD----RHDQGVVKIDMRLRAFWRSVQLASNKWS  649
            E+     D+  L        P L  E       H Q V  ID+ + +F+    L   +W 
Sbjct  468  EKMAANHDAVQLEEESLNACPHLKMEAVPLRLEHRQEV--IDIIVASFYNKADL--EQWL  523

Query  650  HGKVLLTGATGFLG  663
               VL T  +  L 
Sbjct  524  KPGVLRTDYSDILN  537



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000041-PA

Length=315
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEF5_DROME  unnamed protein product                                 176     1e-51
Q9VJY8_DROME  unnamed protein product                                 164     2e-48
Q8IP71_DROME  unnamed protein product                                 163     2e-48


>Q9VEF5_DROME unnamed protein product
Length=433

 Score = 176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 81/90 (90%), Gaps = 0/90 (0%)

Query  226  REDSPPDIPIDPDEPTYCLCDQVSYGEMIGCDNDLCPIEWFHFSCVGLATKPKGKWYCPK  285
            RE++PP   IDPDEPTYC+C+Q+S+GEMI CDNDLCPIEWFHFSCV L  KPKGKW+CP 
Sbjct  344  REETPPPETIDPDEPTYCVCNQISFGEMILCDNDLCPIEWFHFSCVSLVLKPKGKWFCPN  403

Query  286  CRGDRPNIMKPKAQFLKELEKFNREKEEKA  315
            CRG+RPN+MKPKAQFLKELE++N+EKEEK 
Sbjct  404  CRGERPNVMKPKAQFLKELERYNKEKEEKT  433


 Score = 117 bits (292),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 5/120 (4%)

Query  11   AAALEALYSATYLEDYLDCVENLPDDVQRQLSRMRELDVSYQGYLRDLDQLQD---SLRQ  67
            A+  EA+ SATY+++Y+D VENLPDDVQRQLSR+R++DV Y+G +RD+D   D   SL+ 
Sbjct  6    ASESEAINSATYVDNYIDSVENLPDDVQRQLSRIRDIDVQYRGLIRDVDHYYDLYLSLQN  65

Query  68   --DPTSRKRHMQRIKGILIAAQEIGDEKLQLMQQIQDLVDNKARQLEIDYKNLGRKRGRD  125
              D   R R + R+   LI AQE+GDEK+Q++  +Q+++D K RQL+ D +NL  K  RD
Sbjct  66   SADAGRRSRSISRMHQSLIQAQELGDEKMQIVNHMQEIIDGKLRQLDTDQQNLDLKEDRD  125


>Q9VJY8_DROME unnamed protein product
Length=285

 Score = 164 bits (414),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 152/300 (51%), Gaps = 44/300 (15%)

Query  17   LYSATYLEDYLDCVENLPDDVQRQLSRMRELDVSYQGYLRDLD-QLQDSLRQ-------D  68
            + SA YLE+YLD +E+LP +++R    MR+LD   Q  ++ +D   +D +R+        
Sbjct  1    MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMS  60

Query  69   PTSRKRHMQRIKGILIAAQEIGDEKLQLMQQIQDLVDNKARQLEIDYKNLGRKRGRDHDN  128
               R+   + IK +   A+E  D+K+QL  Q  +LVD + R+L+ D   L R  G   + 
Sbjct  61   EDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDND---LARFEGEIQEK  117

Query  129  GDSSRDLHSGERQSKRARRTRGEATHCNDSAMDLLLDKPLLALCSASAASAKKGGGGGGG  188
              S+R   S E  +K+ R+   ++                      SA+S ++ G G   
Sbjct  118  ASSTR-AKSEEVVAKKGRKKTKDSKTTGKK--------------KKSASSDEETGRGNNQ  162

Query  189  GGGGGAGGG---GGMGGGVGGGVGGNRKKKRKS-KQEKEKEREDS-----------PPDI  233
                 +       G G           K+ RK   Q+K  E +DS           P D+
Sbjct  163  SNANSSVNSSSNAGQGSKKKKSKVNQEKETRKGGAQKKTVEVDDSEKESCHTAATHPSDV  222

Query  234  ---PIDPDEPTYCLCDQVSYGEMIGCDNDLCPIEWFHFSCVGLATKPKGKWYCPKCRGDR  290
               P+DP+EPTYCLC QVSYGEMIGCDN  CPIEWFHF+CVGL TKPKGKW+CPKC  DR
Sbjct  223  MDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKCTQDR  282


>Q8IP71_DROME unnamed protein product
Length=271

 Score = 163 bits (412),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/287 (36%), Positives = 146/287 (51%), Gaps = 32/287 (11%)

Query  17   LYSATYLEDYLDCVENLPDDVQRQLSRMRELDVSYQGYLRDLD-QLQDSLRQ-------D  68
            + SA YLE+YLD +E+LP +++R    MR+LD   Q  ++ +D   +D +R+        
Sbjct  1    MSSAIYLENYLDGLESLPTELERNFKLMRKLDDRAQTAMKSIDSHAKDFMRKLGENGAMS  60

Query  69   PTSRKRHMQRIKGILIAAQEIGDEKLQLMQQIQDLVDNKARQLEIDYKNLGRKRGRDHDN  128
               R+   + IK +   A+E  D+K+QL  Q  +LVD + R+L+ D   L R  G   + 
Sbjct  61   EDERRERQEDIKALFGKAKEYSDDKVQLAIQTYELVDKQIRRLDND---LARFEGEIQEK  117

Query  129  GDSSRDLHSGERQSKRARRTRGEATHCNDSAMDLLLDKPLLALCSASAASAKKGGGGGGG  188
              S+R   S E  +K+ R+   ++                       +AS+ +  G G  
Sbjct  118  ASSTR-AKSEEVVAKKGRKKTKDSKT---------------TGKKKKSASSDEETGRGNN  161

Query  189  GGGGGAGGGGGMGGGVGGGVGGNRKKKRKSKQEKEK--EREDSPPDI---PIDPDEPTYC  243
                 +        G G     ++K       EKE        P D+   P+DP+EPTYC
Sbjct  162  QSNANSSVNSSSNAGQGSKKKKSKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYC  221

Query  244  LCDQVSYGEMIGCDNDLCPIEWFHFSCVGLATKPKGKWYCPKCRGDR  290
            LC QVSYGEMIGCDN  CPIEWFHF+CVGL TKPKGKW+CPKC  DR
Sbjct  222  LCHQVSYGEMIGCDNPDCPIEWFHFACVGLTTKPKGKWFCPKCTQDR  268



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000042-PA

Length=1855
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JNM1_DROME  unnamed protein product                                 701     0.0   
Q86C16_DROME  unnamed protein product                                 701     0.0   
Q86NV5_DROME  unnamed protein product                                 519     7e-159


>A8JNM1_DROME unnamed protein product
Length=1717

 Score = 701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/914 (48%), Positives = 554/914 (61%), Gaps = 179/914 (20%)

Query  288   PMAPVPPKPEPEVEHVRLPQQETPTPKAKMKTINWNKIPNNK----NNIWSLVAQQHSTS  343
             P  P P   E     + LPQQ+TP PKAKMKTINW KIP+NK     NIWS+VA  H  S
Sbjct  396   PRTPDPLAAEAVATAILLPQQDTPAPKAKMKTINWGKIPHNKVLGKQNIWSIVASNHQDS  455

Query  344   PMADLDWKEMEGLFCQQPAAHGSGASGASSLQGSPKLGREAS-----TSGASDVDRR-RR  397
             PM D+DW EMEGLFC Q A          S QGSPKLGR+ S     ++G   +DR+ ++
Sbjct  456   PMQDIDWNEMEGLFCLQTA----------SAQGSPKLGRDGSQAAAGSNGCDTLDRKSKK  505

Query  398   EPTEIALLDGKRSLNVNIFLKQFRSSHHDIVQLIREGAHDDIGSERLRGLLKLLPENDEL  457
             E TEI LLDGKRSLNVNIFLKQFR+S+ DI+QLIR+GAH++IG+ERLRGLLK++PE DEL
Sbjct  506   ESTEITLLDGKRSLNVNIFLKQFRTSNDDIIQLIRQGAHEEIGAERLRGLLKIMPEVDEL  565

Query  458   EVLKSFDGDKHRLGNAEKFLLLLIHVPNYRLRIEAMLLKEEFASNMGYLEPSISAMIMAA  517
             ++LK F+GDK RLGNAEKFLL L+ VPNY+LRIE+MLLKEEFA+N+ YLEP I++M+ A 
Sbjct  566   DMLKGFNGDKARLGNAEKFLLQLLEVPNYKLRIESMLLKEEFAANVAYLEPCINSMLYAG  625

Query  518   EDLKNNKDLHEVLYMVLVAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNLLHYVA  577
             +DL NNK L EVLYMV+VAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNL+H+VA
Sbjct  626   DDLLNNKTLQEVLYMVVVAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNLIHFVA  685

Query  578   LQAEKKNRVLLKFTEDMSALEEATKTTTEQIRNEIAALDVRTTKIGQQIELQSTQADIRE  637
             LQAEK+N  LL+FT  +S LE A+KTT+EQI NEI  LD R  +I +QIE  +T  DI+E
Sbjct  686   LQAEKRNPELLQFTGQLSNLESASKTTSEQINNEINTLDGRIRRIARQIEQPATDVDIKE  745

Query  638   QMSGFLQMSMQEMKALRTDLEELELVRVELSNFFCEDPTSFKLEECFKVFHTFCVRFKQA  697
             QM+ FLQ +  E+  L+  ++++E +R+++S FFC+D  +F+LEECFK+FH FC +FKQA
Sbjct  746   QMADFLQAAESELSVLQAGMKQVESMRLKMSEFFCDDAATFRLEECFKIFHNFCDKFKQA  805

Query  698   VTENQRRKLQEEQAEQRRRQREEQLAARRRQ-SQANSSQGPSGSESDCNLVDSLLGDIRA  756
             V EN+RR+ QE+QA  RR+QREEQLA R RQ  QA    G   S+S+ + +   + D RA
Sbjct  806   VKENERRQQQEQQATLRRKQREEQLARRARQIGQA----GTPVSDSEHSFLGDAIFDPRA  861

Query  757   GLLQRKNSDKDKNRKIKRDLGVANGIPTSEEELGSLTNSPRIVRRRLGSFSGPPGEPNRE  816
                                                   SP + RR LGS     G    E
Sbjct  862   --------------------------------------SPALSRRHLGSGEISNGFIRLE  883

Query  817   -DTNSPDVTPNGSLRRRRSRVPSEEDDSNLMDFLRAS---GHDG--SRERKSWGGLGGCA  870
              D  SPD+TPNGSLRRRRSRV +EEDD  LM+FLR+S    HDG  SRERK+        
Sbjct  884   QDGASPDITPNGSLRRRRSRVLAEEDD--LMEFLRSSTGPHHDGHNSRERKA--------  933

Query  871   GVSATAADVPRPASAAYSYGSLDRSW-ARRARGSGGRRRPDLLSADFGVERERPSSPG--  927
                              +YGSLDRSW  R   GS  R+RPDLL+ DFG++RER SSP   
Sbjct  934   -----------------AYGSLDRSWARRARSGSSSRKRPDLLNIDFGMDRERASSPAPL  976

Query  928   ----------------LGGAPSVPSAASTPTQEGAPAVPVPSEVPDSKSKPS-PWRQKIE  970
                                A +  +AA+TPT  G+     PS   D+K + S  WRQKIE
Sbjct  977   LQQQQQNVQERLQSPLASTAGTPTTAANTPTGSGSAIAQTPSNNEDAKPRISREWRQKIE  1036

Query  971   AWLAATEQEEQRAEDLSNRRRRLQPQRRVAEAEPETDNRGTVGSPLDTLPEGKA------  1024
              WL + E +E++ E+   +RR +   RR  E E E + +      LD LPE K       
Sbjct  1037  TWLQSNESDEKQNEEYRRKRRLVNANRRSLENETENERK------LDPLPEEKILPSTTT  1090

Query  1025  ----------------------ASEYQRVYPDWKP--TIDKTDVVGAMEAIEGAQSPVKD  1060
                                   + +YQRVY DWKP  T+++TDVV  ++AI  AQ     
Sbjct  1091  ATPTNTPTTTNPTNSTNRMDQESGKYQRVYADWKPSRTLEQTDVVANLQAIADAQ-----  1145

Query  1061  KSIWRKSTLNVPNSSEETEIEARRLRRMRSRGNLDPVAASSGLQVIKEEDKRKEMIGSLG  1120
                        P+ +       R+ RR RS+    P+A    LQ I EED+RK +I   G
Sbjct  1146  -----------PHDA------LRQHRRQRSQEQPSPIA----LQSIAEEDRRKSLIQKQG  1184

Query  1121  -KQRMKESLTLYIR  1133
              + +  E L +YIR
Sbjct  1185  ERDKSNERLQIYIR  1198


 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 51/62 (82%), Gaps = 5/62 (8%)

Query  11   NLRGERYRFKVVVDELKSASA-----LDYQTALVAFVNCLIISTPQLKDRIRLRNEFLGL  65
            NL+ +RYRFK+V++EL+ +SA     LDYQ AL+AF+NC+IIS   L++RIR+RNEF+GL
Sbjct  62   NLKKQRYRFKIVINELELSSAAAHPPLDYQAALLAFINCVIISAATLQERIRIRNEFIGL  121

Query  66   RL  67
            ++
Sbjct  122  KV  123


>Q86C16_DROME unnamed protein product
Length=1644

 Score = 701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/914 (48%), Positives = 554/914 (61%), Gaps = 179/914 (20%)

Query  288   PMAPVPPKPEPEVEHVRLPQQETPTPKAKMKTINWNKIPNNK----NNIWSLVAQQHSTS  343
             P  P P   E     + LPQQ+TP PKAKMKTINW KIP+NK     NIWS+VA  H  S
Sbjct  323   PRTPDPLAAEAVATAILLPQQDTPAPKAKMKTINWGKIPHNKVLGKQNIWSIVASNHQDS  382

Query  344   PMADLDWKEMEGLFCQQPAAHGSGASGASSLQGSPKLGREAS-----TSGASDVDRR-RR  397
             PM D+DW EMEGLFC Q A          S QGSPKLGR+ S     ++G   +DR+ ++
Sbjct  383   PMQDIDWNEMEGLFCLQTA----------SAQGSPKLGRDGSQAAAGSNGCDTLDRKSKK  432

Query  398   EPTEIALLDGKRSLNVNIFLKQFRSSHHDIVQLIREGAHDDIGSERLRGLLKLLPENDEL  457
             E TEI LLDGKRSLNVNIFLKQFR+S+ DI+QLIR+GAH++IG+ERLRGLLK++PE DEL
Sbjct  433   ESTEITLLDGKRSLNVNIFLKQFRTSNDDIIQLIRQGAHEEIGAERLRGLLKIMPEVDEL  492

Query  458   EVLKSFDGDKHRLGNAEKFLLLLIHVPNYRLRIEAMLLKEEFASNMGYLEPSISAMIMAA  517
             ++LK F+GDK RLGNAEKFLL L+ VPNY+LRIE+MLLKEEFA+N+ YLEP I++M+ A 
Sbjct  493   DMLKGFNGDKARLGNAEKFLLQLLEVPNYKLRIESMLLKEEFAANVAYLEPCINSMLYAG  552

Query  518   EDLKNNKDLHEVLYMVLVAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNLLHYVA  577
             +DL NNK L EVLYMV+VAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNL+H+VA
Sbjct  553   DDLLNNKTLQEVLYMVVVAGNFLNSGGYAGNAAGVKLSSLQKLTDIRANKPGMNLIHFVA  612

Query  578   LQAEKKNRVLLKFTEDMSALEEATKTTTEQIRNEIAALDVRTTKIGQQIELQSTQADIRE  637
             LQAEK+N  LL+FT  +S LE A+KTT+EQI NEI  LD R  +I +QIE  +T  DI+E
Sbjct  613   LQAEKRNPELLQFTGQLSNLESASKTTSEQINNEINTLDGRIRRIARQIEQPATDVDIKE  672

Query  638   QMSGFLQMSMQEMKALRTDLEELELVRVELSNFFCEDPTSFKLEECFKVFHTFCVRFKQA  697
             QM+ FLQ +  E+  L+  ++++E +R+++S FFC+D  +F+LEECFK+FH FC +FKQA
Sbjct  673   QMADFLQAAESELSVLQAGMKQVESMRLKMSEFFCDDAATFRLEECFKIFHNFCDKFKQA  732

Query  698   VTENQRRKLQEEQAEQRRRQREEQLAARRRQ-SQANSSQGPSGSESDCNLVDSLLGDIRA  756
             V EN+RR+ QE+QA  RR+QREEQLA R RQ  QA    G   S+S+ + +   + D RA
Sbjct  733   VKENERRQQQEQQATLRRKQREEQLARRARQIGQA----GTPVSDSEHSFLGDAIFDPRA  788

Query  757   GLLQRKNSDKDKNRKIKRDLGVANGIPTSEEELGSLTNSPRIVRRRLGSFSGPPGEPNRE  816
                                                   SP + RR LGS     G    E
Sbjct  789   --------------------------------------SPALSRRHLGSGEISNGFIRLE  810

Query  817   -DTNSPDVTPNGSLRRRRSRVPSEEDDSNLMDFLRAS---GHDG--SRERKSWGGLGGCA  870
              D  SPD+TPNGSLRRRRSRV +EEDD  LM+FLR+S    HDG  SRERK+        
Sbjct  811   QDGASPDITPNGSLRRRRSRVLAEEDD--LMEFLRSSTGPHHDGHNSRERKA--------  860

Query  871   GVSATAADVPRPASAAYSYGSLDRSW-ARRARGSGGRRRPDLLSADFGVERERPSSPG--  927
                              +YGSLDRSW  R   GS  R+RPDLL+ DFG++RER SSP   
Sbjct  861   -----------------AYGSLDRSWARRARSGSSSRKRPDLLNIDFGMDRERASSPAPL  903

Query  928   ----------------LGGAPSVPSAASTPTQEGAPAVPVPSEVPDSKSKPS-PWRQKIE  970
                                A +  +AA+TPT  G+     PS   D+K + S  WRQKIE
Sbjct  904   LQQQQQNVQERLQSPLASTAGTPTTAANTPTGSGSAIAQTPSNNEDAKPRISREWRQKIE  963

Query  971   AWLAATEQEEQRAEDLSNRRRRLQPQRRVAEAEPETDNRGTVGSPLDTLPEGKA------  1024
              WL + E +E++ E+   +RR +   RR  E E E + +      LD LPE K       
Sbjct  964   TWLQSNESDEKQNEEYRRKRRLVNANRRSLENETENERK------LDPLPEEKILPSTTT  1017

Query  1025  ----------------------ASEYQRVYPDWKP--TIDKTDVVGAMEAIEGAQSPVKD  1060
                                   + +YQRVY DWKP  T+++TDVV  ++AI  AQ     
Sbjct  1018  ATPTNTPTTTNPTNSTNRMDQESGKYQRVYADWKPSRTLEQTDVVANLQAIADAQ-----  1072

Query  1061  KSIWRKSTLNVPNSSEETEIEARRLRRMRSRGNLDPVAASSGLQVIKEEDKRKEMIGSLG  1120
                        P+ +       R+ RR RS+    P+A    LQ I EED+RK +I   G
Sbjct  1073  -----------PHDA------LRQHRRQRSQEQPSPIA----LQSIAEEDRRKSLIQKQG  1111

Query  1121  -KQRMKESLTLYIR  1133
              + +  E L +YIR
Sbjct  1112  ERDKSNERLQIYIR  1125


>Q86NV5_DROME unnamed protein product
Length=1167

 Score = 519 bits (1336),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 345/749 (46%), Positives = 440/749 (59%), Gaps = 159/749 (21%)

Query  443   RLRGLLKLLPENDELEVLKSFDGDKHRLGNAEKFLLLLIHVPNYRLRIEAMLLKEEFASN  502
             RLRGLLK++PE DEL++LK F+GDK RLGNAEKFLL L+ VPNY+LRIE+MLLKEEFA+N
Sbjct  1     RLRGLLKIMPEVDELDMLKGFNGDKARLGNAEKFLLQLLEVPNYKLRIESMLLKEEFAAN  60

Query  503   MGYLEPSISAMIMAAEDLKNNKDLHEVLYMVLVAGNFLNSGGYAGNAAGVKLSSLQKLTD  562
             + YLEP I++M+ A +DL NNK L EVLYMV+VAGNFLNSGGYAGNAAGVKLSSLQKLTD
Sbjct  61    VAYLEPCINSMLYAGDDLLNNKTLQEVLYMVVVAGNFLNSGGYAGNAAGVKLSSLQKLTD  120

Query  563   IRANKPGMNLLHYVALQAEKKNRVLLKFTEDMSALEEATKTTTEQIRNEIAALDVRTTKI  622
             IRANKPGMNL+H+VALQAEK+N  LL+FT  +S LE A+KTT+EQI NEI  LD R  +I
Sbjct  121   IRANKPGMNLIHFVALQAEKRNPELLQFTGQLSNLESASKTTSEQINNEINTLDGRIRRI  180

Query  623   GQQIELQSTQADIREQMSGFLQMSMQEMKALRTDLEELELVRVELSNFFCEDPTSFKLEE  682
              +QIE  +T  DI+EQM+ FLQ +  E+  L+  ++++E +R+++S FFC+D  +F+LEE
Sbjct  181   ARQIEQPATDVDIKEQMADFLQAAESELSVLQAGMKQVESMRLKMSEFFCDDAATFRLEE  240

Query  683   CFKVFHTFCVRFKQAVTENQRRKLQEEQAEQRRRQREEQLAARRRQ-SQANSSQGPSGSE  741
             CFK+FH FC +FKQAV EN+RR+ QE+QA  RR+QREEQLA R RQ  QA    G   S+
Sbjct  241   CFKIFHNFCDKFKQAVKENERRQQQEQQATLRRKQREEQLARRARQIGQA----GTPVSD  296

Query  742   SDCNLVDSLLGDIRAGLLQRKNSDKDKNRKIKRDLGVANGIPTSEEELGSLTNSPRIVRR  801
             S+ + +   + D RA                                      SP + RR
Sbjct  297   SEHSFLGDAIFDPRA--------------------------------------SPALSRR  318

Query  802   RLGSFSGPPGEPNRE-DTNSPDVTPNGSLRRRRSRVPSEEDDSNLMDFLRAS---GHDG-  856
              LGS     G    E D  SPD+TPNGSLRRRRSRV +EEDD  LM+FLR+S    HDG 
Sbjct  319   HLGSGEISNGFIRLEQDGASPDITPNGSLRRRRSRVLAEEDD--LMEFLRSSTGPHHDGH  376

Query  857   -SRERKSWGGLGGCAGVSATAADVPRPASAAYSYGSLDRSW-ARRARGSGGRRRPDLLSA  914
              SRERK+                         +YGSLDRSW  R   GS  R+RPDLL+ 
Sbjct  377   NSRERKA-------------------------AYGSLDRSWARRARSGSSSRKRPDLLNI  411

Query  915   DFGVERERPSSPG------------------LGGAPSVPSAASTPTQEGAPAVPVPSEVP  956
             DFG++RER SSP                      A +  +AA+TPT  G+     PS   
Sbjct  412   DFGMDRERASSPAPLLQQQQQNVQERLQSPLASTAGTPTTAANTPTGSGSAIAQTPSNNE  471

Query  957   DSKSKPS-PWRQKIEAWLAATEQEEQRAEDLSNRRRRLQPQRRVAEAEPETDNRGTVGSP  1015
             D+K + S  WRQKIE WL + E +E++ E+   +RR +   RR  E E E + +      
Sbjct  472   DAKPRISREWRQKIETWLQSNESDEKQNEEYRRKRRLVNANRRSLENETENERK------  525

Query  1016  LDTLPEGKA----------------------------ASEYQRVYPDWKP--TIDKTDVV  1045
             LD LPE K                             + +YQRVY DWKP  T+++TDVV
Sbjct  526   LDPLPEEKILPSTTTATPTNTPTTTNPTNSTNRMDQESGKYQRVYADWKPSRTLEQTDVV  585

Query  1046  GAMEAIEGAQSPVKDKSIWRKSTLNVPNSSEETEIEARRLRRMRSRGNLDPVAASSGLQV  1105
               ++AI  AQ                P+ +       R+ RR RS+    P+A    LQ 
Sbjct  586   ANLQAIADAQ----------------PHDA------LRQHRRQRSQEQPSPIA----LQS  619

Query  1106  IKEEDKRKEMIGSLG-KQRMKESLTLYIR  1133
             I EED+RK +I   G + +  E L +YIR
Sbjct  620   IAEEDRRKSLIQKQGERDKSNERLQIYIR  648



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000043-PA

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DPH3_CAEEL  unnamed protein product                                   76.3    1e-17
D3YT20_CAEEL  unnamed protein product                                 42.7    6e-06


>DPH3_CAEEL unnamed protein product
Length=80

 Score = 76.3 bits (186),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 53/61 (87%), Gaps = 0/61 (0%)

Query  1   MTSYYDEVEIEDFEYDEEESTYYYPCPCGDRFQITKAELESGEEVAACPSCSLIIKVIYD  60
           M+ ++DEVEIEDFE+DEE+  Y+YPCPCGDRF+I +  LE GE+VA CPSCSL+I+VIYD
Sbjct  1   MSVFHDEVEIEDFEFDEEKDVYHYPCPCGDRFEIPREMLEMGEDVAQCPSCSLLIRVIYD  60

Query  61  P  61
           P
Sbjct  61  P  61


>D3YT20_CAEEL unnamed protein product
Length=43

 Score = 42.7 bits (99),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 21/23 (91%), Gaps = 0/23 (0%)

Query  39  LESGEEVAACPSCSLIIKVIYDP  61
           LE GE+VA CPSCSL+I+VIYDP
Sbjct  2   LEMGEDVAQCPSCSLLIRVIYDP  24



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000044-PA

Length=343
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U9Q1_DROME  unnamed protein product                                 458     1e-162
Q7KLW6_DROME  unnamed protein product                                 459     2e-162
Q18547_CAEEL  unnamed protein product                                 358     3e-123


>Q9U9Q1_DROME unnamed protein product
Length=356

 Score = 458 bits (1179),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 275/356 (77%), Gaps = 13/356 (4%)

Query  1    MSLWVDKHRPTSLAKLDYHKTQAAYLKQLVQQGDFPHLMVYGPSGAGKKTRVMCLLRELY  60
            M+LWVDK+RP  L+KLD+HK QA  L+ L +Q DFPHLM YGPSGAGKKTR+MCLLRE+Y
Sbjct  1    MALWVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY  60

Query  61   GPG------------TPSKKKLEVVTVASNYHIEVNPSDVGIYDRVVVQELIKMVAQTQQ  108
            G G            TPS +K+EV+TV+SNYH+EVNPSD G+YDR VV +LIK VAQT Q
Sbjct  61   GSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ  120

Query  109  LDVGGQRDFKVIVLTEVDKLTKEAQHALRRTMEKYMRTCRIVLVTTSTSKVIPAIRSRCL  168
            +++ GQR+FKVIV++E D+LTK+AQHALRRTMEKY+ TCRI++   STS++IPAIRSRCL
Sbjct  121  IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL  180

Query  169  GVRVSAPTQETIIQVLTQVCKKEGLTLPNQLASRIAEKSGRNLRRALLMCEACKVEQSPF  228
            G+RV+AP +  I+ +L   CK+EGL LP +LA R+ +KS RNLRRALLM EA KV ++PF
Sbjct  181  GIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF  240

Query  229  QEDQKIHEPDWETYLSQTAAKIVEDQSPPNLLEIRGRLYELLTHCIPPNVIFKGLLKELV  288
              +Q+I + DW+ +L +TA++I+ +Q+P  L +IR RLYELLT  +PPN+IF+GL+++LV
Sbjct  241  TANQEIPDLDWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLV  300

Query  289  KNCDGQVKTDVTQMAAMYEHRLNLGNKAIFHLEAFVAKFMSIYKRFMDDA-MDVDF  343
             NCD  +K    + A  YEHR+  G K IFHLEAFVA+FM+IYK+F+ +  M  DF
Sbjct  301  NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELDMTDDF  356


>Q7KLW6_DROME unnamed protein product
Length=395

 Score = 459 bits (1181),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 210/356 (59%), Positives = 275/356 (77%), Gaps = 13/356 (4%)

Query  1    MSLWVDKHRPTSLAKLDYHKTQAAYLKQLVQQGDFPHLMVYGPSGAGKKTRVMCLLRELY  60
            M+LWVDK+RP  L+KLD+HK QA  L+ L +Q DFPHLM YGPSGAGKKTR+MCLLRE+Y
Sbjct  40   MALWVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY  99

Query  61   GPG------------TPSKKKLEVVTVASNYHIEVNPSDVGIYDRVVVQELIKMVAQTQQ  108
            G G            TPS +K+EV+TV+SNYH+EVNPSD G+YDR VV +LIK VAQT Q
Sbjct  100  GSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ  159

Query  109  LDVGGQRDFKVIVLTEVDKLTKEAQHALRRTMEKYMRTCRIVLVTTSTSKVIPAIRSRCL  168
            +++ GQR+FKVIV++E D+LTK+AQHALRRTMEKY+ TCRI++   STS++IPAIRSRCL
Sbjct  160  IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL  219

Query  169  GVRVSAPTQETIIQVLTQVCKKEGLTLPNQLASRIAEKSGRNLRRALLMCEACKVEQSPF  228
            G+RV+AP +  I+ +L   CK+EGL LP +LA R+ +KS RNLRRALLM EA KV ++PF
Sbjct  220  GIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF  279

Query  229  QEDQKIHEPDWETYLSQTAAKIVEDQSPPNLLEIRGRLYELLTHCIPPNVIFKGLLKELV  288
              +Q+I + DW+ +L +TA++I+ +Q+P  L +IR RLYELLT  +PPN+IF+GL+++LV
Sbjct  280  TANQEIPDLDWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLV  339

Query  289  KNCDGQVKTDVTQMAAMYEHRLNLGNKAIFHLEAFVAKFMSIYKRFMDDA-MDVDF  343
             NCD  +K    + A  YEHR+  G K IFHLEAFVA+FM+IYK+F+ +  M  DF
Sbjct  340  NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELDMTDDF  395


>Q18547_CAEEL unnamed protein product
Length=354

 Score = 358 bits (919),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 185/347 (53%), Positives = 235/347 (68%), Gaps = 17/347 (5%)

Query  1    MSLWVDKHRPTSLAK---LDYHKTQAAYLKQLVQQGDFPHLMVYGPSGAGKKTRVMCLLR  57
            M+LWVDK+RP  L     +DYH  QA +LK  +     PHL+  GPSGAGKKTR+ CLLR
Sbjct  1    MALWVDKYRPKDLLGKDGVDYHIEQANHLK-FLSADCMPHLLFCGPSGAGKKTRIKCLLR  59

Query  58   ELYGPG------------TPSKKKLEVVTVASNYHIEVNPSDVGIYDRVVVQELIKMVAQ  105
            ELYG G            +PS KKLE+ TV+SNYHIE+ PSDVGIYDRVVVQ+L+K +AQ
Sbjct  60   ELYGVGVEKTQLIMKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQ  119

Query  106  TQQLDVGGQRDFKVIVLTEVDKLTKEAQHALRRTMEKYMRTCRIVLVTTSTSKVIPAIRS  165
            T Q++   QR FKV+VL E D LT++AQH LRRTMEKY   C+IVL   S S++I  ++S
Sbjct  120  TSQIESTSQRSFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQS  179

Query  166  RCLGVRVSAPTQETIIQVLTQVCKKEGLTLPNQLASRIAEKSGRNLRRALLMCEACKVE-  224
            RC+ + V APT E + +VL +V ++E   LP  +  +I EKS  NLRRA+LM EA ++E 
Sbjct  180  RCIIINVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMTEALRMEN  239

Query  225  QSPFQEDQKIHEPDWETYLSQTAAKIVEDQSPPNLLEIRGRLYELLTHCIPPNVIFKGLL  284
            +S   E   I  P+WE Y+ +TA  I++ QS   LL++R RLYELL+ CIPP VIFK LL
Sbjct  240  ESGVAESVVIPVPEWEIYIQETARLILQKQSSDMLLKVRERLYELLSRCIPPTVIFKKLL  299

Query  285  KELVKNCDGQVKTDVTQMAAMYEHRLNLGNKAIFHLEAFVAKFMSIY  331
            + L+  C  Q+  +V   AA +EHRL LG KAIFHLE FVA FM IY
Sbjct  300  EHLLPKCPPQIAREVVSEAAKFEHRLVLGQKAIFHLEGFVAAFMDIY  346



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000045-PA

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FEH1_CAEEL  unnamed protein product                                   357     5e-113
NUMB_DROME  unnamed protein product                                   44.3    3e-04 


>FEH1_CAEEL unnamed protein product
Length=665

 Score = 357 bits (916),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 197/497 (40%), Positives = 277/497 (56%), Gaps = 92/497 (19%)

Query  269  LPSGWERHEDQDG-AYYWHIKSGTIQRELP----KDGQVQLPVRALSCEETPPAV-----  318
            LP GWE+HED  G +YYWH+ SGTIQR+ P    ++ Q   P   +        V     
Sbjct  235  LPPGWEKHEDPQGYSYYWHVDSGTIQRQPPPPVNRETQADAPPPQIIQLPPQQPVIEEHA  294

Query  319  ------PRSTSTTALSEMDVEKADTALKRRSYPTRSSDKAIRFAVRSLGWVEIAEDDLTP  372
                   R      +SE ++E         +Y      K +RFAVRSLGW +I+ED+LT 
Sbjct  295  FKQTTTKRRIEQDEMSEREIEDVAMIENGDTY-----HKPVRFAVRSLGWTDISEDELTA  349

Query  373  ERSSKAVNKCIIDLSLGKNDLLDVVGRWGDGKDLYMDLDEGSLKLVDPETMSPLNAQPIH  432
            E+SS+AVN+ I+DL+   +  +D + +WGDG++L M+LD+  L L+DP++M+ ++++ I 
Sbjct  350  EKSSRAVNRAIVDLTTRSD--IDSIPKWGDGRELIMELDDNELALLDPDSMNVIHSERIQ  407

Query  433  TIRVWGVGRDNGKDFAYVARDRSTRKYMCHVFRCDIPARTIANTLRDICKRIMIERSLQQ  492
             IRVWGVGRDNG+DFAYV+RDR TR++MCHVFRCD  A+TIANTLRDICKR+M+ R    
Sbjct  408  AIRVWGVGRDNGRDFAYVSRDRGTRRFMCHVFRCDTSAKTIANTLRDICKRLMLHR----  463

Query  493  GGVAGAVGTAAFPPGLLLSTSDAGSGSGNKSRQVARPTNLPTERRRFRLCGATGQPIVAP  552
                                               RP++L           +  + IV  
Sbjct  464  -----------------------------------RPSSLHA-------IESGEKRIVRS  481

Query  553  ETFPTPMEEPKKVLRVRYLGSVQVTRATGMDVLNDAIDRLSCSGPPESFPQVDVAVAPSM  612
            E    P++EP+KV+R  +LG  QV +ATG+++LN+A+DRL      E +   DV++APS 
Sbjct  482  EGLTAPIDEPRKVIRCHFLGVTQVPKATGIEILNEAVDRLVSQVRSERWILADVSIAPST  541

Query  613  ITVSTHPEAPPTLPLASQQVPPPPATQPDKPKILAECRVRYLSFLGIGKNVKQCAFIMHT  672
            I +         + +  QQ+              AECRVRYLSFLGIG++VK CAFIM T
Sbjct  542  IAI---------VEVNGQQI--------------AECRVRYLSFLGIGRDVKHCAFIMQT  578

Query  673  AQDMFVAHVFNCEPSSGALCKTIEAACKLRYQKCLDAYPQRIGGGGAGGCGQGAEHTPSS  732
            + + F+ +VF+ EP++ A+ K +EAACKLRYQK LDA+       G    GQ    T   
Sbjct  579  SSESFMCYVFHVEPNAAAMAKMVEAACKLRYQKVLDAHSSSRHHSGMSIHGQHPPSTYHG  638

Query  733  RGLGEKLKSVIGSLTGR  749
            +G  E  +   GS+T R
Sbjct  639  KGWTETFRDAFGSVTSR  655


>NUMB_DROME unnamed protein product
Length=556

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 29/117 (25%)

Query  355  FAVRSLGWVEIAEDDLTPERSSKAVNKCIIDLSLGKND-------LLDVVGRWGDGKDLY  407
            F+V+ LG VE+ E        S+ +  C   L + +         LL V G   DG    
Sbjct  83   FSVKYLGCVEVFE--------SRGMQVCEEALKVLRQSRRRPVRGLLHVSG---DG----  127

Query  408  MDLDEGSLKLVDPETMSPLNAQPIHTIRVWGVGRDNGKDFAYVARDRSTRKYMCHVF  464
                   L++VD ET   +  Q I  +      R++ + F+Y+ RD +TR++MCH F
Sbjct  128  -------LRVVDDETKGLIVDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGF  177



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000046-PA

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VC93_DROME  unnamed protein product                                 556     0.0  
Q960A7_DROME  unnamed protein product                                 556     0.0  
Q9BI20_DROME  unnamed protein product                                 555     0.0  


>Q9VC93_DROME unnamed protein product
Length=982

 Score = 556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 340/471 (72%), Gaps = 13/471 (3%)

Query  1    MLTHKTFVRKTKRGKILKVVREHYLRDDLWCGSESCQACESEPEERTLEKFPASDSQLCN  60
            M T + F RKTKRG ILK+VREHYLRDD+ CGSE C+ C  + E   L    A+ S L  
Sbjct  1    MQTLREFTRKTKRGNILKIVREHYLRDDIGCGSELCREC-FQNEVYQLTSQHANKSTLFK  59

Query  61   FPHYLLLDTNVVLDQIDVLESDAFRNVVVLQTVLDEVRHKSSPVYKRLRDIISNPSRKFF  120
            FPHYL+LDTNVVLDQIDVLE D  RNVVVL TVL+EV+H+SS +YKR  +I+ + +R F+
Sbjct  60   FPHYLVLDTNVVLDQIDVLEEDVLRNVVVLTTVLNEVKHRSSAIYKRFNEIVHDRTRNFY  119

Query  121  TFINEHHKDTYVEREPGESVNDRNDRAIRKACRWYQDHLAGIGKKKQ-------PIRMVL  173
             F+NEHHK+TY +REP E+ NDRNDRAIR A +WY DHL      K+         R+VL
Sbjct  120  VFVNEHHKETYADREPDETANDRNDRAIRLATKWYDDHLQASQSSKEFERSGKAATRVVL  179

Query  174  LTDDLGNRQKAEGEGLVTFAVADYVKSLKSQPLLADKLSKRSFESEGVGKTALYPEHLSP  233
            LTDD  NR KAE EG++    A+YVKSL+  PLL DKLS ++F+SE  G    YP HLS 
Sbjct  180  LTDDAANRAKAEAEGILVTTAAEYVKSLEDFPLLMDKLSHKTFDSEKNG-LPQYPPHLSM  238

Query  234  VEVHHGIKSGKLHQGTFYASRYNYLEGEVSVEGIEKRVLLQGRENLNRAVDGDTIAIELL  293
             E+  G++  KL QGTF ASR NYLEG V+VE  EK +L+QGRE+LNRAVDGD +A+ELL
Sbjct  239  KELLEGLRQNKLLQGTFQASRENYLEGTVNVEKFEKGILIQGRESLNRAVDGDLVAVELL  298

Query  294  PEKEWTSPSEVVLEDNEFD----PGDTVTKDEDMLKQSSRSKKAKSDVQPTGKVAGIIRR  349
            PE EW++PSE+VLE+        P +   KDE+ +    R+    ++  PTG++ GI+RR
Sbjct  299  PEAEWSAPSEIVLEEKNVYADEVPSEERAKDENEMLNQVRAAALSAERTPTGRIVGIVRR  358

Query  350  KWRQYCGIIQENPVAGAFRHLFVPAERKIPKIRIETRQAPVLANQRIIVAIDSWPRNSRY  409
            KWRQYCGI+Q + +    RH+FVPA+RKIP+IRIETRQA +L NQRIIV ID+WPRNSRY
Sbjct  359  KWRQYCGILQPSLIEDTNRHIFVPADRKIPRIRIETRQAAMLQNQRIIVTIDTWPRNSRY  418

Query  410  PMGHFVRALGKIGDKDTENEVLLLEHDVPHSQFSEAVLACLPTMPWGITVE  460
            P GHFVR+LG +GD  TENEV+LLEHDVPH +FS+ VL+ LP MPW IT E
Sbjct  419  PHGHFVRSLGPLGDMATENEVILLEHDVPHCKFSDEVLSFLPKMPWTITDE  469


>Q960A7_DROME unnamed protein product
Length=982

 Score = 556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 340/471 (72%), Gaps = 13/471 (3%)

Query  1    MLTHKTFVRKTKRGKILKVVREHYLRDDLWCGSESCQACESEPEERTLEKFPASDSQLCN  60
            M T + F RKTKRG ILK+VREHYLRDD+ CGSE C+ C  + E   L    A+ S L  
Sbjct  1    MQTLREFTRKTKRGNILKIVREHYLRDDIGCGSELCREC-FQNEVYQLTSQHANKSTLFK  59

Query  61   FPHYLLLDTNVVLDQIDVLESDAFRNVVVLQTVLDEVRHKSSPVYKRLRDIISNPSRKFF  120
            FPHYL+LDTNVVLDQIDVLE D  RNVVVL TVL+EV+H+SS +YKR  +I+ + +R F+
Sbjct  60   FPHYLVLDTNVVLDQIDVLEEDVLRNVVVLTTVLNEVKHRSSAIYKRFNEIVHDRTRNFY  119

Query  121  TFINEHHKDTYVEREPGESVNDRNDRAIRKACRWYQDHLAGIGKKKQ-------PIRMVL  173
             F+NEHHK+TY +REP E+ NDRNDRAIR A +WY DHL      K+         R+VL
Sbjct  120  VFVNEHHKETYADREPDETANDRNDRAIRLATKWYDDHLQASQSSKEFERSGKAATRVVL  179

Query  174  LTDDLGNRQKAEGEGLVTFAVADYVKSLKSQPLLADKLSKRSFESEGVGKTALYPEHLSP  233
            LTDD  NR KAE EG++    A+YVKSL+  PLL DKLS ++F+SE  G    YP HLS 
Sbjct  180  LTDDAANRAKAEAEGILVTTAAEYVKSLEDFPLLMDKLSHKTFDSEKNG-LPQYPPHLSM  238

Query  234  VEVHHGIKSGKLHQGTFYASRYNYLEGEVSVEGIEKRVLLQGRENLNRAVDGDTIAIELL  293
             E+  G++  KL QGTF ASR NYLEG V+VE  EK +L+QGRE+LNRAVDGD +A+ELL
Sbjct  239  KELLEGLRQNKLLQGTFQASRENYLEGTVNVEKFEKGILIQGRESLNRAVDGDLVAVELL  298

Query  294  PEKEWTSPSEVVLEDNEFD----PGDTVTKDEDMLKQSSRSKKAKSDVQPTGKVAGIIRR  349
            PE EW++PSE+VLE+        P +   KDE+ +    R+    ++  PTG++ GI+RR
Sbjct  299  PEAEWSAPSEIVLEEKNVYADEVPSEERAKDENEMLNQVRAAALSAERTPTGRIVGIVRR  358

Query  350  KWRQYCGIIQENPVAGAFRHLFVPAERKIPKIRIETRQAPVLANQRIIVAIDSWPRNSRY  409
            KWRQYCGI+Q + +    RH+FVPA+RKIP+IRIETRQA +L NQRIIV ID+WPRNSRY
Sbjct  359  KWRQYCGILQPSLIEDTNRHIFVPADRKIPRIRIETRQAAMLQNQRIIVTIDTWPRNSRY  418

Query  410  PMGHFVRALGKIGDKDTENEVLLLEHDVPHSQFSEAVLACLPTMPWGITVE  460
            P GHFVR+LG +GD  TENEV+LLEHDVPH +FS+ VL+ LP MPW IT E
Sbjct  419  PHGHFVRSLGPLGDMATENEVILLEHDVPHCKFSDEVLSFLPKMPWTITDE  469


>Q9BI20_DROME unnamed protein product
Length=983

 Score = 555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/471 (58%), Positives = 340/471 (72%), Gaps = 13/471 (3%)

Query  1    MLTHKTFVRKTKRGKILKVVREHYLRDDLWCGSESCQACESEPEERTLEKFPASDSQLCN  60
            M T + F RKTKRG ILK+VREHYLRDD+ CGSE C+ C  + E   L    A+ S L  
Sbjct  1    MQTLREFTRKTKRGNILKIVREHYLRDDIGCGSELCREC-FQNEVYQLTSQHANKSTLFK  59

Query  61   FPHYLLLDTNVVLDQIDVLESDAFRNVVVLQTVLDEVRHKSSPVYKRLRDIISNPSRKFF  120
            FPHYL+LDTNVVLDQIDVLE D  RNVVVL TVL+EV+H+SS +YKR  +I+ + +R F+
Sbjct  60   FPHYLVLDTNVVLDQIDVLEEDVLRNVVVLTTVLNEVKHRSSAIYKRFNEIVHDRTRNFY  119

Query  121  TFINEHHKDTYVEREPGESVNDRNDRAIRKACRWYQDHLAGIGKKKQ-------PIRMVL  173
             F+NEHHK+TY +REP E+ NDRNDRAIR A +WY DHL      K+         R+VL
Sbjct  120  VFVNEHHKETYADREPDETANDRNDRAIRLATKWYDDHLQASQSSKEFERSGKAATRVVL  179

Query  174  LTDDLGNRQKAEGEGLVTFAVADYVKSLKSQPLLADKLSKRSFESEGVGKTALYPEHLSP  233
            LTDD  NR KAE EG++    A+YVKSL+  PLL DKLS ++F+SE  G    YP HLS 
Sbjct  180  LTDDAANRAKAEAEGILVTTAAEYVKSLEDFPLLMDKLSHKTFDSEKNG-LPQYPPHLSM  238

Query  234  VEVHHGIKSGKLHQGTFYASRYNYLEGEVSVEGIEKRVLLQGRENLNRAVDGDTIAIELL  293
             E+  G++  KL QGTF ASR NYLEG V+VE  EK +L+QGRE+LNRAVDGD +A+ELL
Sbjct  239  KELLEGLRQNKLLQGTFQASRENYLEGTVNVEKFEKGILIQGRESLNRAVDGDLVAVELL  298

Query  294  PEKEWTSPSEVVLEDNEFD----PGDTVTKDEDMLKQSSRSKKAKSDVQPTGKVAGIIRR  349
            PE EW++PSE+VLE+        P +   KDE+ +    R+    ++  PTG++ GI+RR
Sbjct  299  PEAEWSAPSEIVLEEKNVYADEVPSEERAKDENEMLNQVRAAALSAERTPTGRIVGIVRR  358

Query  350  KWRQYCGIIQENPVAGAFRHLFVPAERKIPKIRIETRQAPVLANQRIIVAIDSWPRNSRY  409
            KWRQYCGI+Q + +    RH+FVPA+RKIP+IRIETRQA +L NQRIIV ID+WPRNSRY
Sbjct  359  KWRQYCGILQPSLIEDTNRHIFVPADRKIPRIRIETRQAAMLQNQRIIVTIDTWPRNSRY  418

Query  410  PMGHFVRALGKIGDKDTENEVLLLEHDVPHSQFSEAVLACLPTMPWGITVE  460
            P GHFVR+LG +GD  TENEV+LLEHDVPH +FS+ VL+ LP MPW IT E
Sbjct  419  PHGHFVRSLGPLGDMATENEVILLEHDVPHCKFSDEVLSFLPKMPWTITDE  469



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000047-PA

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PKN_DROME  unnamed protein product                                    31.6    1.4  
E1JJ71_DROME  unnamed protein product                                 31.2    1.6  
Q9VI21_DROME  unnamed protein product                                 31.2    1.9  


>PKN_DROME unnamed protein product
Length=1190

 Score = 31.6 bits (70),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 27/61 (44%), Gaps = 10/61 (16%)

Query  7    NSNKTSRAKQIEVTLEERLEKLRKREAELDSEIAALESEGYTVEDKKAYIEALHEYNEMK  66
              N +S+ + +E TLEER+E+LR R          L  E   V+  K  I  L   N   
Sbjct  238  GGNNSSQPQSLETTLEERIEELRHR----------LRIEAAVVDGAKNVIRTLQTANRAP  287

Query  67   D  67
            D
Sbjct  288  D  288


>E1JJ71_DROME unnamed protein product
Length=679

 Score = 31.2 bits (69),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  21   LEERLEKLRKREAELDSEIAALESEGYTVEDKKAYIEALHE--YNEMKDVTQVV  72
            L+ER+E+L   + E ++  A LESE Y  E  +  I  L E   NE++++ Q +
Sbjct  498  LKERIERLETGQKEFNNLTATLESERYRAEGLEEQINDLTELHQNEIENLKQTI  551


>Q9VI21_DROME unnamed protein product
Length=638

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  21   LEERLEKLRKREAELDSEIAALESEGYTVEDKKAYIEALHE--YNEMKDVTQVV  72
            L+ER+E+L   + E ++  A LESE Y  E  +  I  L E   NE++++ Q +
Sbjct  457  LKERIERLETGQKEFNNLTATLESERYRAEGLEEQINDLTELHQNEIENLKQTI  510



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000048-PA

Length=388
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NCC3_DROME  unnamed protein product                                 34.7    0.14 
Q20456_CAEEL  unnamed protein product                                 30.8    2.8  


>Q9NCC3_DROME unnamed protein product
Length=565

 Score = 34.7 bits (78),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 13/69 (19%), Positives = 35/69 (51%), Gaps = 2/69 (3%)

Query  108  DKLPSCDFNELMSSNETLLKWLENLEKYGFTLITSAPQKEGQVKRLSQRVGFMRQTHYNL  167
            +K+P C+   +    +++ +W +N   Y  +++ ++P+KE + K +   + +     +N 
Sbjct  192  EKIPECEMAYITQVEDSIYQWTQNHSPY--SVVVASPKKESKFKGMKTFIAYQLTPSFNN  249

Query  168  VEFTVHSKH  176
            +  +   KH
Sbjct  250  ISVSRRYKH  258


>Q20456_CAEEL unnamed protein product
Length=2581

 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 38/85 (45%), Gaps = 13/85 (15%)

Query  267  LIELNRDGKTQRVNMSAAQRDSFLDLEPEKVEAFYAAMKLFDSILHRDNNMISLKLREGD  326
            L+  + DG T  +N +   RDSF         A     +LF  +L+R    +   L  G 
Sbjct  302  LLPTSEDGSTIELNAALDNRDSF---------AMMIYEELFKWVLNRIGLQLKCSLHTGV  352

Query  327  MAAFDNRRVLHGREAFEDDGSERFL  351
            ++  D+    +G E + ++G E FL
Sbjct  353  ISILDH----YGFEKYNNNGVEEFL  373



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000049-PA

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C9QPE7_DROME  unnamed protein product                                 32.7    0.47 
Q9VM19_DROME  unnamed protein product                                 32.3    0.55 
Q9W542_DROME  unnamed protein product                                 32.3    0.95 


>C9QPE7_DROME unnamed protein product
Length=296

 Score = 32.7 bits (73),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (51%), Gaps = 5/75 (7%)

Query  48   CQCPKCFLQTSQSRQHLMKDLDPKVHPEAVEILNAGSF-LEVTWPDGHRSTYESQWLVQR  106
             + PK FL     R   +KD+  +V+ +   I  AG+  LE+ +PDG R  YE    +Q+
Sbjct  87   AKHPKVFLAVISGRG--LKDVQKQVNIDG--ITYAGNHGLEIEYPDGSRHDYELPTEIQK  142

Query  107  AFNPAAQEKRRRTQR  121
             +    +E + + ++
Sbjct  143  NYTQMVRELKEKVEK  157


>Q9VM19_DROME unnamed protein product
Length=273

 Score = 32.3 bits (72),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (51%), Gaps = 5/75 (7%)

Query  48   CQCPKCFLQTSQSRQHLMKDLDPKVHPEAVEILNAGSF-LEVTWPDGHRSTYESQWLVQR  106
             + PK FL     R   +KD+  +V+ +   I  AG+  LE+ +PDG R  YE    +Q+
Sbjct  64   AKHPKVFLAVISGRG--LKDVQKQVNIDG--ITYAGNHGLEIEYPDGSRHDYELPTEIQK  119

Query  107  AFNPAAQEKRRRTQR  121
             +    +E + + ++
Sbjct  120  NYTQMVRELKEKVEK  134


>Q9W542_DROME unnamed protein product
Length=986

 Score = 32.3 bits (72),  Expect = 0.95, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 26/53 (49%), Gaps = 3/53 (6%)

Query  260  RLHPRAFHLLTTVPVDFHDVGVDIIPYYKIHRAPIIQLNREGAPERINFNNQV  312
            ++ P AF L T   +    VG    P  K+ +API  LN  G P RI   N++
Sbjct  97   QVEPPAFSLAT---LGLQRVGSAPPPKPKVQKAPIPTLNARGMPARIRKRNRL  146



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000050-PA

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PF60_DROME  unnamed protein product                                 154     2e-40
O96395_DROME  unnamed protein product                                 154     2e-40
M9PCY3_DROME  unnamed protein product                                 149     6e-38


>M9PF60_DROME unnamed protein product
Length=571

 Score = 154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 147/291 (51%), Gaps = 14/291 (5%)

Query  74   CEVCGLRLSSRVSRKHHIITKHIQ---EKNFKCEECGKCFYIPKSLKNHQLVHKAVKDHH  130
            C  CG+  S++ +   H+     Q   +K   C+ CG+ F     L  H+  H   +   
Sbjct  230  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  289

Query  131  CPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDKTVKC  190
            CP+C K   H  +L+ H+   H    EK   CP CDK    + +L+ H+     ++  KC
Sbjct  290  CPLCPKAYTHGPTLKSHM---HTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKC  346

Query  191  LEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPHQCLD  250
              P CP+ F   S ++ H R H +E+P +C +CG+ F    ++  H R H+G R  +C D
Sbjct  347  --PDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPD  404

Query  251  CGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGNKPFECTICGYR  310
            C +S+   S++  H + H+G +P++C ECG+ F    HL  H  +H+G KP++C  CG  
Sbjct  405  CDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG--  462

Query  311  TGFKSN--WYAHRKRHVGSKN--FECYICQKPFFDRQSLLKHLESHQRRSE  357
             GF +N     H   HV + +  F+C  C K +  +QSL  H ++H+   E
Sbjct  463  KGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDE  513


 Score = 146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 143/295 (48%), Gaps = 12/295 (4%)

Query  67   DESKKYQCEVCGLRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAV  126
            D  K + C+ CG    +      H   +H  E+ FKC  C K +    +LK+H   H   
Sbjct  255  DTQKPHLCDFCGRGFRTNAQLTTHR-RRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEE  313

Query  127  KDHHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDK  186
            K H CP C K    + +L  HI+R    + E+   CP C +       LK H      ++
Sbjct  314  KGHKCPQCDKTFYTRGNLRAHIQR---HTGERPYKCPDCPQTFAKNSGLKLHSRLHKEER  370

Query  187  TVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPH  246
              KC    C K F    ++ +H R H  ++  +C  C + F  KS M KHQR+HSG++P 
Sbjct  371  PFKC--ELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPF  428

Query  247  QCLDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGN--KPFEC  304
            +C +CG+++    HL +H ++HTGE+PY+C +CGK F   + L+ H   H  N  +PF+C
Sbjct  429  KCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKC  488

Query  305  TICGYRTGFKSNWYAHRKRHVGSKN----FECYICQKPFFDRQSLLKHLESHQRR  355
            + C      + +   H K H          +C  C   F  +++L KH+ SH+ R
Sbjct  489  SQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIR  543


 Score = 143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 105/360 (29%), Positives = 165/360 (46%), Gaps = 23/360 (6%)

Query  8    ADEPDEMSDYSDCDSTTDMKS-----NDKECDNSVSGILKASKDSVASRTANDVISCKST  62
            A+ PD  +D    D  TD K+     ND + ++ VS I +  +D+      N+     +T
Sbjct  139  ANRPDVKTDI---DEPTDGKATNVTMNDIKTEDEVS-IQETFEDAFDEENDNN-----NT  189

Query  63   DDGQDESKKYQCEVCGLRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLV  122
            D  +++S ++       +    +       T     ++  C ECG  +   K+L  H   
Sbjct  190  DSEREDSDQWTVGSTEDQDEPWIPGGGGRQTVGGNNQSLLCTECGVSYSTQKALARHVAK  249

Query  123  HKAVKD----HHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCH  178
            HK   D    H C  C +     + L  H +R    + E+   CP+C K      +LK H
Sbjct  250  HKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRR---HTGERPFKCPLCPKAYTHGPTLKSH  306

Query  179  LSAVHTDKTVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQR  238
            +     +K  KC  P C K F     +R+H + H  E+P++C  C Q F   S ++ H R
Sbjct  307  MHTHDEEKGHKC--PQCDKTFYTRGNLRAHIQRHTGERPYKCPDCPQTFAKNSGLKLHSR  364

Query  239  SHSGLRPHQCLDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSG  298
             H   RP +C  CG+ ++   HL  H +VH G+R ++C +C K F  K +++ H   HSG
Sbjct  365  LHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSG  424

Query  299  NKPFECTICGYRTGFKSNWYAHRKRHVGSKNFECYICQKPFFDRQSLLKHLESHQRRSER  358
             KPF+C  CG       +  +H + H G K ++C  C K F   QSL+KH   H   ++R
Sbjct  425  IKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDR  484


 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 112/267 (42%), Gaps = 39/267 (15%)

Query  67   DESKKYQCEVCGLRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAV  126
            DE K ++C  C     +R + + HI  +H  E+ +KC +C + F     LK H  +HK  
Sbjct  311  DEEKGHKCPQCDKTFYTRGNLRAHI-QRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEE  369

Query  127  KDHHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDK  186
            +   C +C K       L  H+ RVH   R+    CP CDK   +K ++  H       K
Sbjct  370  RPFKCELCGKGFVQNQHLITHL-RVHNGDRQ--FKCPDCDKSFFEKSNMMKHQRTHSGIK  426

Query  187  TVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSH--SGLR  244
              KC E  C + F +  +++SH R H  EKP++C  CG+ F     + KH   H  +  R
Sbjct  427  PFKCEE--CGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDR  484

Query  245  PHQCLDCGRSYLTVSHLNAHAKVHTGE-------------------------------RP  273
            P +C  C ++Y T   L  H K H                                  RP
Sbjct  485  PFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRP  544

Query  274  YQCTECGKCFRLKRHLVYHANLHSGNK  300
            + C +C + F  ++ L  H  LH+  K
Sbjct  545  HPCPQCPEGFFSQKSLKKHLRLHNLKK  571


 Score = 30.4 bits (67),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query  41   LKASKDSVASRTANDVISCKSTDDGQDESKK-YQCEVCGLRLSSRVSRKHHIITKHIQEK  99
             K S+   A  T   +   + T    DE K  +QC  C +R + + +   HI +  I  +
Sbjct  486  FKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI--R  543

Query  100  NFKCEECGKCFYIPKSLKNHQLVHKAVK  127
               C +C + F+  KSLK H  +H   K
Sbjct  544  PHPCPQCPEGFFSQKSLKKHLRLHNLKK  571


>O96395_DROME unnamed protein product
Length=583

 Score = 154 bits (390),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 147/291 (51%), Gaps = 14/291 (5%)

Query  74   CEVCGLRLSSRVSRKHHIITKHIQ---EKNFKCEECGKCFYIPKSLKNHQLVHKAVKDHH  130
            C  CG+  S++ +   H+     Q   +K   C+ CG+ F     L  H+  H   +   
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRRHTGERPFK  301

Query  131  CPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDKTVKC  190
            CP+C K   H  +L+ H+   H    EK   CP CDK    + +L+ H+     ++  KC
Sbjct  302  CPLCPKAYTHGPTLKSHM---HTHDEEKGHKCPQCDKTFYTRGNLRAHIQRHTGERPYKC  358

Query  191  LEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPHQCLD  250
              P CP+ F   S ++ H R H +E+P +C +CG+ F    ++  H R H+G R  +C D
Sbjct  359  --PDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPD  416

Query  251  CGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGNKPFECTICGYR  310
            C +S+   S++  H + H+G +P++C ECG+ F    HL  H  +H+G KP++C  CG  
Sbjct  417  CDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCG--  474

Query  311  TGFKSN--WYAHRKRHVGSKN--FECYICQKPFFDRQSLLKHLESHQRRSE  357
             GF +N     H   HV + +  F+C  C K +  +QSL  H ++H+   E
Sbjct  475  KGFSANQSLMKHTLWHVDNNDRPFKCSQCPKAYDTQQSLRGHEKTHKNPDE  525


 Score = 146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 143/295 (48%), Gaps = 12/295 (4%)

Query  67   DESKKYQCEVCGLRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAV  126
            D  K + C+ CG    +      H   +H  E+ FKC  C K +    +LK+H   H   
Sbjct  267  DTQKPHLCDFCGRGFRTNAQLTTHR-RRHTGERPFKCPLCPKAYTHGPTLKSHMHTHDEE  325

Query  127  KDHHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDK  186
            K H CP C K    + +L  HI+R    + E+   CP C +       LK H      ++
Sbjct  326  KGHKCPQCDKTFYTRGNLRAHIQR---HTGERPYKCPDCPQTFAKNSGLKLHSRLHKEER  382

Query  187  TVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPH  246
              KC    C K F    ++ +H R H  ++  +C  C + F  KS M KHQR+HSG++P 
Sbjct  383  PFKC--ELCGKGFVQNQHLITHLRVHNGDRQFKCPDCDKSFFEKSNMMKHQRTHSGIKPF  440

Query  247  QCLDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGN--KPFEC  304
            +C +CG+++    HL +H ++HTGE+PY+C +CGK F   + L+ H   H  N  +PF+C
Sbjct  441  KCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDRPFKC  500

Query  305  TICGYRTGFKSNWYAHRKRHVGSKN----FECYICQKPFFDRQSLLKHLESHQRR  355
            + C      + +   H K H          +C  C   F  +++L KH+ SH+ R
Sbjct  501  SQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIR  555


 Score = 142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 126/260 (48%), Gaps = 9/260 (3%)

Query  103  CEECGKCFYIPKSLKNHQLVHKAVKD----HHCPICQKQIAHKSSLEVHIKRVHKMSREK  158
            C ECG  +   K+L  H   HK   D    H C  C +     + L  H +R    + E+
Sbjct  242  CTECGVSYSTQKALARHVAKHKEQGDTQKPHLCDFCGRGFRTNAQLTTHRRR---HTGER  298

Query  159  LLPCPICDKKMRDKHSLKCHLSAVHTDKTVKCLEPGCPKMFPNESYMRSHYRSHLDEKPH  218
               CP+C K      +LK H+     +K  KC  P C K F     +R+H + H  E+P+
Sbjct  299  PFKCPLCPKAYTHGPTLKSHMHTHDEEKGHKC--PQCDKTFYTRGNLRAHIQRHTGERPY  356

Query  219  ECGVCGQRFKTKSYMEKHQRSHSGLRPHQCLDCGRSYLTVSHLNAHAKVHTGERPYQCTE  278
            +C  C Q F   S ++ H R H   RP +C  CG+ ++   HL  H +VH G+R ++C +
Sbjct  357  KCPDCPQTFAKNSGLKLHSRLHKEERPFKCELCGKGFVQNQHLITHLRVHNGDRQFKCPD  416

Query  279  CGKCFRLKRHLVYHANLHSGNKPFECTICGYRTGFKSNWYAHRKRHVGSKNFECYICQKP  338
            C K F  K +++ H   HSG KPF+C  CG       +  +H + H G K ++C  C K 
Sbjct  417  CDKSFFEKSNMMKHQRTHSGIKPFKCEECGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKG  476

Query  339  FFDRQSLLKHLESHQRRSER  358
            F   QSL+KH   H   ++R
Sbjct  477  FSANQSLMKHTLWHVDNNDR  496


 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 112/267 (42%), Gaps = 39/267 (15%)

Query  67   DESKKYQCEVCGLRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAV  126
            DE K ++C  C     +R + + HI  +H  E+ +KC +C + F     LK H  +HK  
Sbjct  323  DEEKGHKCPQCDKTFYTRGNLRAHI-QRHTGERPYKCPDCPQTFAKNSGLKLHSRLHKEE  381

Query  127  KDHHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDK  186
            +   C +C K       L  H+ RVH   R+    CP CDK   +K ++  H       K
Sbjct  382  RPFKCELCGKGFVQNQHLITHL-RVHNGDRQ--FKCPDCDKSFFEKSNMMKHQRTHSGIK  438

Query  187  TVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSH--SGLR  244
              KC E  C + F +  +++SH R H  EKP++C  CG+ F     + KH   H  +  R
Sbjct  439  PFKCEE--CGQAFSHNHHLKSHLRIHTGEKPYKCDQCGKGFSANQSLMKHTLWHVDNNDR  496

Query  245  PHQCLDCGRSYLTVSHLNAHAKVHTGE-------------------------------RP  273
            P +C  C ++Y T   L  H K H                                  RP
Sbjct  497  PFKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKIRP  556

Query  274  YQCTECGKCFRLKRHLVYHANLHSGNK  300
            + C +C + F  ++ L  H  LH+  K
Sbjct  557  HPCPQCPEGFFSQKSLKKHLRLHNLKK  583


 Score = 30.4 bits (67),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 3/88 (3%)

Query  41   LKASKDSVASRTANDVISCKSTDDGQDESKK-YQCEVCGLRLSSRVSRKHHIITKHIQEK  99
             K S+   A  T   +   + T    DE K  +QC  C +R + + +   HI +  I  +
Sbjct  498  FKCSQCPKAYDTQQSLRGHEKTHKNPDEPKTLHQCPHCDVRFALKKTLDKHITSHKI--R  555

Query  100  NFKCEECGKCFYIPKSLKNHQLVHKAVK  127
               C +C + F+  KSLK H  +H   K
Sbjct  556  PHPCPQCPEGFFSQKSLKKHLRLHNLKK  583


>M9PCY3_DROME unnamed protein product
Length=878

 Score = 149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/283 (32%), Positives = 132/283 (47%), Gaps = 14/283 (5%)

Query  74   CEVCG----LRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAVKDH  129
            C++CG     R    V R++H      + K F C+ CG+ F   + L  H  +H      
Sbjct  223  CDICGKMFQFRYQLIVHRRYHS-----ERKPFMCQVCGQGFTTSQDLTRHGKIHIGGPMF  277

Query  130  HCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDKTVK  189
             C +C    A+ +SLE H+KR    S +K   C IC K    K  L  H  +   +   +
Sbjct  278  TCIVCFNVFANNTSLERHMKR---HSTDKPFACTICQKTFARKEHLDNHFRSHTGETPFR  334

Query  190  CLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPHQCL  249
            C    C K F  + +M +H R H  E PH C  C + F  K ++  H R H+G  PH+C 
Sbjct  335  CQY--CAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCS  392

Query  250  DCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGNKPFECTICGY  309
             C +++    HL  H + HTGE P++CT C K F  K H+V H   H+G  P +CT C  
Sbjct  393  YCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTK  452

Query  310  RTGFKSNWYAHRKRHVGSKNFECYICQKPFFDRQSLLKHLESH  352
                K +   H ++H G     C  C+K F  ++ L  H+  H
Sbjct  453  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH  495


 Score = 137 bits (345),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 91/294 (31%), Positives = 129/294 (44%), Gaps = 13/294 (4%)

Query  70   KKYQCEVCGLRLSSRVSRKHHI---ITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAV  126
            K + C +C        +RK H+      H  E  F+C+ C K F   + + NH   H   
Sbjct  303  KPFACTIC----QKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGE  358

Query  127  KDHHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDK  186
              H C  C K    K  L  H++   + + E    C  C K    K  L  H+     + 
Sbjct  359  TPHRCDFCSKTFTRKEHLLNHVR---QHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGET  415

Query  187  TVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPH  246
              KC    C K F  + +M +H R H  E PH+C  C + F  K ++  H R H+G  PH
Sbjct  416  PFKCTY--CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPH  473

Query  247  QCLDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGNKPFECTI  306
            +C  C +++    HL  H ++HTG+ P++C  C K F  K HL  H   HS + P  C +
Sbjct  474  RCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNV  533

Query  307  CGYRTGFKSNWYAHRKR-HVGSKNFECYICQKPFFDRQSLLKHLESHQRRSERE  359
            C      K +   H  R H G + F C  C K F  + +LL H  SH +  E E
Sbjct  534  CNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEME  587


 Score = 134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 128/289 (44%), Gaps = 10/289 (3%)

Query  66   QDESKKYQCEVCG--LRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVH  123
              E K + C+VCG     S  ++R   I   HI    F C  C   F    SL+ H   H
Sbjct  243  HSERKPFMCQVCGQGFTTSQDLTRHGKI---HIGGPMFTCIVCFNVFANNTSLERHMKRH  299

Query  124  KAVKDHHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVH  183
               K   C ICQK  A K  L+ H +     + E    C  C K    K  +  H+   H
Sbjct  300  STDKPFACTICQKTFARKEHLDNHFR---SHTGETPFRCQYCAKTFTRKEHMVNHVRK-H  355

Query  184  TDKTVKCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGL  243
            T +T    +  C K F  + ++ +H R H  E PH C  C + F  K ++  H R H+G 
Sbjct  356  TGETPHRCD-FCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGE  414

Query  244  RPHQCLDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYHANLHSGNKPFE  303
             P +C  C +++    H+  H + HTGE P++CT C K F  K HL  H   H+G+ P  
Sbjct  415  TPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHR  474

Query  304  CTICGYRTGFKSNWYAHRKRHVGSKNFECYICQKPFFDRQSLLKHLESH  352
            C+ C      K +   H + H G    +C  CQK F  ++ L  H+  H
Sbjct  475  CSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH  523


 Score = 132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/289 (30%), Positives = 130/289 (45%), Gaps = 17/289 (6%)

Query  72   YQCEVCGLRLSSRVSRKHHIIT---KHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAVKD  128
            ++C+ C    +   +RK H++    KH  E   +C+ C K F   + L NH   H     
Sbjct  333  FRCQYC----AKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESP  388

Query  129  HHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDKTV  188
            H C  C K    K  L  HI+   + + E    C  C K    K  +  H+     +   
Sbjct  389  HRCSYCMKTFTRKEHLVNHIR---QHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPH  445

Query  189  KCLEPGCPKMFPNESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSGLRPHQC  248
            KC    C K F  + ++ +H R H  + PH C  C + F  K ++  H R H+G  PH+C
Sbjct  446  KCTY--CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKC  503

Query  249  LDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCFRLKRHLVYH-ANLHSGNKPFECTIC  307
              C +++    HLN H + H+ + P+ C  C K F  K HL+ H +  H+G++PF C  C
Sbjct  504  EYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETC  563

Query  308  GYRTGFKSNWYAHRKRHVGSKN----FECYICQKPFFDRQSLLKHLESH  352
            G     K N   H++ H   +     F C  C K F  +  L+ H+ SH
Sbjct  564  GKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSH  612


 Score = 122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/254 (31%), Positives = 112/254 (44%), Gaps = 29/254 (11%)

Query  125  AVKDHHCPICQKQIAHKSSLEVHIKRVHK-------------------MSRE-------K  158
            A   H C IC K    +  L VH +R H                    ++R         
Sbjct  217  ATGTHVCDICGKMFQFRYQLIVH-RRYHSERKPFMCQVCGQGFTTSQDLTRHGKIHIGGP  275

Query  159  LLPCPICDKKMRDKHSLKCHLSAVHTDKTVKCLEPGCPKMFPNESYMRSHYRSHLDEKPH  218
            +  C +C     +  SL+ H+    TDK   C    C K F  + ++ +H+RSH  E P 
Sbjct  276  MFTCIVCFNVFANNTSLERHMKRHSTDKPFACTI--CQKTFARKEHLDNHFRSHTGETPF  333

Query  219  ECGVCGQRFKTKSYMEKHQRSHSGLRPHQCLDCGRSYLTVSHLNAHAKVHTGERPYQCTE  278
             C  C + F  K +M  H R H+G  PH+C  C +++    HL  H + HTGE P++C+ 
Sbjct  334  RCQYCAKTFTRKEHMVNHVRKHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSY  393

Query  279  CGKCFRLKRHLVYHANLHSGNKPFECTICGYRTGFKSNWYAHRKRHVGSKNFECYICQKP  338
            C K F  K HLV H   H+G  PF+CT C      K +   H ++H G    +C  C K 
Sbjct  394  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKT  453

Query  339  FFDRQSLLKHLESH  352
            F  ++ L  H+  H
Sbjct  454  FTRKEHLTNHVRQH  467


 Score = 110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/246 (33%), Positives = 108/246 (44%), Gaps = 13/246 (5%)

Query  85   VSRKHHI---ITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAVKDHHCPICQKQIAHK  141
             +RK H+   I +H  E  FKC  C K F     + NH   H     H C  C K    K
Sbjct  398  FTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRK  457

Query  142  SSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDKTVKCLEPGCPKMFPN  201
              L  H+++    S  +   C  C K    K  L  H+     D   KC    C K F  
Sbjct  458  EHLTNHVRQHTGDSPHR---CSYCKKTFTRKEHLTNHVRLHTGDSPHKCEY--CQKTFTR  512

Query  202  ESYMRSHYRSHLDEKPHECGVCGQRFKTKSYMEKHQ-RSHSGLRPHQCLDCGRSYLTVSH  260
            + ++ +H R H  + PH C VC + F  K ++  H  R H+G RP  C  CG+S+    +
Sbjct  513  KEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  261  LNAHAKVHTG----ERPYQCTECGKCFRLKRHLVYHANLHSGNKPFECTICGYRTGFKSN  316
            L  H + HT     ERP+ C +C K F  K HLV H   HSG KP  CT+C      + N
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGN  632

Query  317  WYAHRK  322
               H K
Sbjct  633  LKRHMK  638


 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 104/230 (45%), Gaps = 21/230 (9%)

Query  72   YQCEVCGLRLSSRVSRKHHIIT---KHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAVKD  128
            ++C  C    +   +RK H++    +H  E   KC  C K F   + L NH   H     
Sbjct  417  FKCTYC----TKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSP  472

Query  129  HHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTDKTV  188
            H C  C+K    K  L  H+ R+H  + +    C  C K    K  L  H+    +D   
Sbjct  473  HRCSYCKKTFTRKEHLTNHV-RLH--TGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPH  529

Query  189  KCLEPGCPKMFPNESYMRSHY-RSHLDEKPHECGVCGQRFKTKSYMEKHQRSHSG----L  243
             C    C K F  + ++ +H  R H  ++P  C  CG+ F  K  +  HQRSH+      
Sbjct  530  CCNV--CNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEME  587

Query  244  RPHQCLDCGRSYLTVSHLNAHAKVHTGERPYQCTECGKCF----RLKRHL  289
            RP  C  C ++++   HL +H + H+GE+P+ CT C K F     LKRH+
Sbjct  588  RPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHM  637


 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/204 (30%), Positives = 93/204 (46%), Gaps = 17/204 (8%)

Query  72   YQCEVCGLRLSSRVSRKHHI---ITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAVKD  128
            ++C  C    +   +RK H+   + +H  +   +C  C K F   + L NH  +H     
Sbjct  445  HKCTYC----TKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSP  500

Query  129  HHCPICQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHT-DKT  187
            H C  CQK    K  L  H++   + S +    C +C+K    K  L  H+S  HT D+ 
Sbjct  501  HKCEYCQKTFTRKEHLNNHMR---QHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRP  557

Query  188  VKCLEPGCPKMFPNESYMRSHYRSHLD----EKPHECGVCGQRFKTKSYMEKHQRSHSGL  243
              C    C K FP +  +  H RSH      E+P  C  C + F  K ++  H RSHSG 
Sbjct  558  FTC--ETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGE  615

Query  244  RPHQCLDCGRSYLTVSHLNAHAKV  267
            +PH C  C ++++   +L  H K+
Sbjct  616  KPHACTLCSKAFVERGNLKRHMKM  639


 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 50/116 (43%), Gaps = 7/116 (6%)

Query  74   CEVCGLRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKAVKDHHCPI  133
            C VC    + +    +H+   H  ++ F CE CGK F +  +L  HQ  H   ++   P 
Sbjct  531  CNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPF  590

Query  134  ----CQKQIAHKSSLEVHIKRVHKMSREKLLPCPICDKKMRDKHSLKCHLSAVHTD  185
                C K    K  L  H++     S EK   C +C K   ++ +LK H+   H D
Sbjct  591  ACEKCPKNFICKGHLVSHMR---SHSGEKPHACTLCSKAFVERGNLKRHMKMNHPD  643


 Score = 38.1 bits (87),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 25/87 (29%), Positives = 41/87 (47%), Gaps = 5/87 (6%)

Query  70   KKYQCEVCG----LRLSSRVSRKHHIITKHIQEKNFKCEECGKCFYIPKSLKNHQLVHKA  125
            + + CE CG    L+ +    ++ H   + + E+ F CE+C K F     L +H   H  
Sbjct  556  RPFTCETCGKSFPLKGNLLFHQRSHTKGQEM-ERPFACEKCPKNFICKGHLVSHMRSHSG  614

Query  126  VKDHHCPICQKQIAHKSSLEVHIKRVH  152
             K H C +C K    + +L+ H+K  H
Sbjct  615  EKPHACTLCSKAFVERGNLKRHMKMNH  641



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000051-PA

Length=332
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SUV39_DROME  unnamed protein product                                  115     2e-28
SETB1_DROME  unnamed protein product                                  74.3    3e-14
O17186_CAEEL  unnamed protein product                                 69.7    4e-13


>SUV39_DROME unnamed protein product
Length=635

 Score = 115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 109/181 (60%), Gaps = 9/181 (5%)

Query  161  RKQQLEKLRKWQTEINILSEESAEITVENFYDLEGPPQNFVYVNSNVPGSGIVIPNDPVV  220
            R++QL  L  ++  +N + + S  I VEN  DL+    NF+Y++ N+ G  +  P   +V
Sbjct  351  RRKQLADLALFEKRMNHVEKPSPPIRVENNIDLDTIDSNFMYIHDNIIGKDVPKPEAGIV  410

Query  221  GCNC--DT---CGEDDCCPAAAGYARPYTKAGY-LQLPQGEPIYECNSRCSCEPDCSNRV  274
            GC C  DT        CC   AG    Y ++   L+L  G  IYECNSRCSC+  CSNR+
Sbjct  411  GCKCTEDTEECTASTKCCARFAGELFAYERSTRRLRLRPGSAIYECNSRCSCDSSCSNRL  470

Query  275  VQKGRKVKLCIFRTPNGCGWGVKAKEPIKKNTFVAEYVGELITTEEAERRGESY---GKK  331
            VQ GR+V L +F+T NG GWGV+A   ++K  FV EY+GE+IT++EA  RG++Y   G+ 
Sbjct  471  VQHGRQVPLVLFKTANGSGWGVRAATALRKGEFVCEYIGEIITSDEANERGKAYDDNGRT  530

Query  332  Y  332
            Y
Sbjct  531  Y  531


>SETB1_DROME unnamed protein product
Length=1262

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 76/176 (43%), Gaps = 32/176 (18%)

Query  180   EESAEITVENFYDLEGPPQNFVYVNSNVPGSGIVIPNDPVV--------------GCNC-  224
             +E   I + N+YD   PP    Y    +P  G+ +  D                  C C 
Sbjct  905   QEKMAIPLVNYYDNTLPPP-CTYAKQRIPTEGVHLNLDEEFLLCCDCEDDCSDKSKCACW  963

Query  225   --DTCGEDDCCPAAAGYARPYTKAGYL------QLPQGEPIYECNSRCSCEPDCSNRVVQ  276
                  G   C P      +P  + GY        +P G  IYECNSRC C+ +C NRVVQ
Sbjct  964   QLTVAGVRYCNPK-----KPIEEIGYQYKRLHEHVPTG--IYECNSRCKCKKNCLNRVVQ  1016

Query  277   KGRKVKLCIFRTPNGCGWGVKAKEPIKKNTFVAEYVGELITTEEAERRGESYGKKY  332
                ++KL +F+T N  GWG++    I K  F+  Y G L+T   A   G+  G +Y
Sbjct  1017  FSLEMKLQVFKTSNR-GWGLRCVNDIPKGAFICIYAGHLLTETMANEGGQDAGDEY  1071


>O17186_CAEEL unnamed protein product
Length=367

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 0/79 (0%)

Query  249  LQLPQGEPIYECNSRCSCEPDCSNRVVQKGRKVKLCIFRTPNGCGWGVKAKEPIKKNTFV  308
            ++L   + + ECN  C+C   C NRV QKG    + IF     CGWGV+A   I   TF+
Sbjct  190  MELLMWDTVRECNEYCNCALWCGNRVAQKGAMYPVEIFARDPWCGWGVRASVDIAFGTFI  249

Query  309  AEYVGELITTEEAERRGES  327
             EY GELI  EEA  R +S
Sbjct  250  GEYAGELIDDEEAMDRHDS  268



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000052-PA

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARI1_DROME  unnamed protein product                                   273     6e-86
O01965_CAEEL  unnamed protein product                                 268     4e-84
RBRA_DICDI  unnamed protein product                                   189     6e-54


>ARI1_DROME unnamed protein product
Length=503

 Score = 273 bits (699),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 151/466 (32%), Positives = 251/466 (54%), Gaps = 28/466 (6%)

Query  30   LGEDTDVDTSDICRIDPESFQSQCLTMEEVEKMLNLSVETLSDACQITPSLAKLLLHAHH  89
             G + D+ +S   ++D + +Q + LT +E+ +     ++  +   ++     ++LL+   
Sbjct  28   FGMEVDLPSSADRQMDQDDYQYKVLTTDEIVQHQREIIDEANLLLKLPTPTTRILLNHFK  87

Query  90   WATQDIIQWYRQDCAKLLV--TSRIKPQKAPPP-QQASPQTQWGQGGDPGKVTCPVCVAV  146
            W  + +++ Y  D           I P  A    +Q + ++Q  +        C +C + 
Sbjct  88   WDKEKLLEKYFDDNTDEFFKCAHVINPFNATEAIKQKTSRSQCEE--------CEICFSQ  139

Query  147  SSRERFSGLSCGHLFCVDCWGMHFEVQLM-QGISTGIGCMAQQCQVLAPEDFVLSILSKV  205
               +  +GL CGH FC+ CW  +   +++ +G+   I C A  C +L  +  V ++++  
Sbjct  140  LPPDSMAGLECGHRFCMPCWHEYLSTKIVAEGLGQTISCAAHGCDILVDDVTVANLVTDA  199

Query  206  NLREKYQQFTFRDYVKSHPELRFCPGANCQVIVRAKEVRAKRCICEVCKTCFCFSCGMEY  265
             +R KYQQ     +V+ +  LR+CP  +C   V+      +R  C+ C   FCF+CG  +
Sbjct  200  RVRVKYQQLITNSFVECNQLLRWCPSVDCTYAVKVPYAEPRRVHCK-CGHVFCFACGENW  258

Query  266  HAPTDCETIKKWLTKCADDSETANYISAHTKDCPKCHICIEKNGGCNHMQC--YNCKHDF  323
            H P  C  +KKW+ KC DDSET+N+I+A+TK+CP+C + IEK+GGCNHM C   NCK++F
Sbjct  259  HDPVKCRWLKKWIKKCDDDSETSNWIAANTKECPRCSVTIEKDGGCNHMVCKNQNCKNEF  318

Query  324  CWMCLGDWKTHGSEYYECSRYKENPNIAHESVHAQAREALKKYLHYYERWENHSKSLKLE  383
            CW+CLG W+ HGS +Y C+RY E+          + R +L +YLHYY R+ NH +S+K E
Sbjct  319  CWVCLGSWEPHGSSWYNCNRYDEDEAKTARDAQEKLRSSLARYLHYYNRYMNHMQSMKFE  378

Query  384  EQTLQLSKDRINEKVMNGSGTWIDWQYLLQAAALLAKCRYTLQYTYPYAYYMEVGPRKEL  443
             +     K ++ E++   + +WI+ Q+L +A  +L +CR TL YTY +AYY++   +   
Sbjct  379  NKLYASVKQKM-EEMQQHNMSWIEVQFLKKAVDILCQCRQTLMYTYVFAYYLKKNNQS--  435

Query  444  VRFSRCLFEYQQAQLEAEIENLSWKIEHAETTDRGDLENQMDISEK  489
                  +FE  Q  LE+  E LS  +E   T+     EN  DI +K
Sbjct  436  -----MIFEDNQKDLESATEMLSEYLERDITS-----ENLADIKQK  471


>O01965_CAEEL unnamed protein product
Length=494

 Score = 268 bits (686),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/446 (32%), Positives = 243/446 (54%), Gaps = 36/446 (8%)

Query  51   SQCLTMEEVEKMLNLSVETLSDACQITPSLAKLLLHAHHWATQDIIQWYRQ--DCAKLLV  108
            ++ L  + +E  +  ++  +    Q+   + ++LLH + W  + +++ + +  D    L+
Sbjct  50   NEVLNHDSLEAEMKKTITDVQAVLQVKTGVCRILLHKYKWNKESLLERFYEHPDTTTFLI  109

Query  109  TSRIKPQKAPPPQQASPQTQWGQGGDPGKVTCPVCVAVSSRERFSGLSCGHLFCVDCWGM  168
             + + P++    Q+  P          G   C +C ++      SGLSC H  C  CW  
Sbjct  110  DAHVIPRR----QERLP---------AGDAECDICCSLGE---LSGLSCNHRACTQCWKA  153

Query  169  HFEVQLMQGISTGIGCMAQQCQVLAPEDFVLSILSKVNLREKYQQFTFRDYVKSHPELRF  228
            +   ++     + I CMA  C++L  ++ V+  ++   +   Y++     YV+++  L++
Sbjct  154  YLTNKIANNAQSEIECMAPNCKLLIEDEKVMFYITDPTVIATYRKLIVASYVETNRLLKW  213

Query  229  CPGANCQVIVRAKEVRAKRCICEVCKTCFCFSCGMEYHAPTDCETIKKWLTKCADDSETA  288
            CPG +C   VR      +  +C  C + FCFSCG ++H P +C  +K WL KC DDSET+
Sbjct  214  CPGIDCGKAVRVSHWEPRLVVCS-CGSRFCFSCGHDWHEPVNCRLLKLWLKKCNDDSETS  272

Query  289  NYISAHTKDCPKCHICIEKNGGCNHMQCYN--CKHDFCWMCLGDWKTHGSEYYECSRYKE  346
            N+I+A+TK+CPKC I IEK+GGCNHM C N  C+ +FCWMCLG W+ HGS +Y C+R+ +
Sbjct  273  NWINANTKECPKCMITIEKDGGCNHMTCKNTACRFEFCWMCLGPWEPHGSSWYSCNRFDD  332

Query  347  NPNIAHESVHAQAREALKKYLHYYERWENHSKSLKLEEQTLQLSKDRINEKVMNGSGTWI  406
            +           +R  L++YL YY R+  H +SL+LE +     K ++ E++   S +WI
Sbjct  333  SAAKNARDAQEVSRANLQRYLFYYNRYMGHQQSLRLEGKLYATVKSKM-EQMQTLSMSWI  391

Query  407  DWQYLLQAAALLAKCRYTLQYTYPYAYYMEVGPRKELVRFSRCLFEYQQAQLEAEIENLS  466
            + Q+L +A  +L++CR TL +TY +A+Y++          +  +FE  Q  LE E E LS
Sbjct  392  EVQFLRKAVDVLSECRRTLMFTYAFAFYLKRDN-------NAIIFESNQKDLEMETEQLS  444

Query  467  WKIEHAETTDRGDLENQMDISEKRRM  492
              +E        DL+N+  ++ K+++
Sbjct  445  GFLER-------DLDNENLVTLKQKV  463


>RBRA_DICDI unnamed protein product
Length=520

 Score = 189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 140/496 (28%), Positives = 237/496 (48%), Gaps = 59/496 (12%)

Query  8    EEYDSDMECSEEEEVGYDDYYRLGEDTDVDTSDICRIDPESFQSQ----CLTMEEVEKML  63
            E+YD D + +EE   G +      +DT+ D +     D +  Q Q     LT ++  ++L
Sbjct  8    EDYDVDDDSAEES--GNESL----DDTEYDDAATQEFDFDENQPQRSLGKLTRQKSFEVL  61

Query  64   NLS---------VETLSDACQITPSLAKL--LLHAHHWATQDIIQWYRQDCAKLLVTSRI  112
            N           ++ + D   I PS A +  LL    W  + +I+ Y ++  KL + + +
Sbjct  62   NKDDLFSESHKIIKEVKDVLSI-PSEAAVSTLLRHMKWNKEKLIERYMENPEKLCIDAGV  120

Query  113  KPQKAPPPQQASPQTQWGQGGDPGKVTCPVCVAVSSRERFSGLSCGHLFCVDCWGMHFEV  172
                  P       T   + G+   V+C +C+      +   L C H +C+ C+  + E+
Sbjct  121  ------PNVMKLNATIVEKSGN---VSCLICLEDYPPTQTFALICNHRYCLPCYKNYLEI  171

Query  173  QLMQGIS-TGIGCMAQQCQVLAPEDFVLSILSKVNLREKYQQFTFRDYVKSHPELRFCPG  231
            ++ +G       C A +C+V+  +D    I+S   + E++  F  + YV  +P++++CP 
Sbjct  172  KVSEGPECIYTPCPAPKCKVIVHQDAFKQIVSP-EVFERFNNFILKSYVDDNPQVKWCPA  230

Query  232  ANCQVIVRAKEVRAKRCICEVCKTCFCFSCG---MEYHAPTDCETIKKWLTKCADDSETA  288
              C   +R      K  +   C   +CF+C    +  H P  C  + KWL K +D+SE  
Sbjct  231  PGCIYSIRCDRKERKEAVNCKCGFQYCFNCNDYEIGDHMPCPCSQVDKWLQKASDESENV  290

Query  289  NYISAHTKDCPKCHICIEKNGGCNHMQCY----NCKHDFCWMCLGDWKTHGSE---YYEC  341
             ++ A+TK CP+C   IEKNGGC HM C      C  +FCW+C G W  HGS    YY C
Sbjct  291  TWMLANTKKCPECRSPIEKNGGCMHMTCRKNAGGCGFEFCWLCRGPWTEHGSTTGGYYNC  350

Query  342  SRY-----KENPNIAHESVHAQAREALKKYLHYYERWENHSKSLKLEEQTLQLSKDRINE  396
            ++Y     KE+ + AH+     A+  L+ Y+ YY R+E+H  ++K+ ++  + +  +  +
Sbjct  351  NKYDKSKAKEDDDKAHD-----AKTELEAYMFYYHRYESHRNAMKIADEQRRNAHLKEQQ  405

Query  397  KVMNGSGTWIDWQYLLQAAALLAKCRYTLQYTYPYAYYMEVGPRKELVRFSRCLFEYQQA  456
             +        D ++L++A   L K R  LQY+Y Y YY++   ++      R LFEY Q 
Sbjct  406  ILSKFDVRSADTKFLMEATEQLLKNRRVLQYSYVYGYYLDKKSQE------RNLFEYLQE  459

Query  457  QLEAEIENLSWKIEHA  472
             LE     LS + E +
Sbjct  460  DLEKHTNLLSTQYEQS  475



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


Query= CAQU000053-PA

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VBI0_DROME  unnamed protein product                                 45.4    3e-06
E1JIU2_DROME  unnamed protein product                                 27.3    6.7  
Q9VCQ0_DROME  unnamed protein product                                 27.3    6.7  


>Q9VBI0_DROME unnamed protein product
Length=195

 Score = 45.4 bits (106),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 40/69 (58%), Gaps = 0/69 (0%)

Query  7    MIDEMENYFYLNDDLEAYEVADCLTAIMDTEFNTRCEDGSLEEVSGQLCRYFSLCKAKKD  66
            ++D    Y   N+++   E+ + L  +MD EFNT C+D S+ E+   L RY  + +  + 
Sbjct  47   IMDYTYQYCVSNENITQGELVEVLEELMDQEFNTLCDDDSIPEICRNLLRYKLMAQQNQF  106

Query  67   EEVKAELAK  75
             +++AEL+K
Sbjct  107  PQIEAELSK  115


>E1JIU2_DROME unnamed protein product
Length=526

 Score = 27.3 bits (59),  Expect = 6.7, Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  60   LCKAKKDEEVKAELAKQGKC  79
            LC AK+ +E+K+E +K  KC
Sbjct  339  LCSAKQLDELKSEYSKSAKC  358


>Q9VCQ0_DROME unnamed protein product
Length=532

 Score = 27.3 bits (59),  Expect = 6.7, Method: Composition-based stats.
 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 0/20 (0%)

Query  60   LCKAKKDEEVKAELAKQGKC  79
            LC AK+ +E+K+E +K  KC
Sbjct  345  LCSAKQLDELKSEYSKSAKC  364



Lambda      K        H
   0.322    0.135    0.424 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6098800502


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  12:13 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000054-PA

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389Z4_TRYB2  unnamed protein product                                 117     6e-27
Q9W037_DROME  unnamed protein product                                 34.3    0.44 
E1JIB3_DROME  unnamed protein product                                 34.3    0.44 


>Q389Z4_TRYB2 unnamed protein product
Length=675

 Score = 117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 206/469 (44%), Gaps = 79/469 (17%)

Query  261  AILEELIQLRQKQADLLGYPNHAAYIQEMR--MAKNPATVDKFLQELATKLKPLWEKERK  318
            A L  L+Q R + + LLG+ + A   Q++R  M +N   V  FL  +A K +   EKE  
Sbjct  217  ATLRYLLQCRYELSQLLGFESFAE--QQLRGTMLENQQRVWHFLCGIAHKYRREAEKEMD  274

Query  319  VMMAFKKEEALESSEDLGDDLCFWDLRYYMCMVEEKLYA-VDKNKMREYFPLETVTKGLL  377
            ++ +   E  + + +++ DD+           V   L    +     EYF +    +G+ 
Sbjct  275  IIRSNVGE--VRNRQNITDDV--------RARVAHSLRRDAEPETAAEYFSVANCIRGIQ  324

Query  378  EIYQELLGLKFTEQKEGDK---WHEDVRIFKVEDASSGAFLGYFFLDLHPRDGKYGHACV  434
             +  E+ G++  E+ + DK   ++ D + + V D +  AFLG   LDL+  + KY  A  
Sbjct  325  CLCLEVFGVRL-EEVQFDKDEIFNNDAKKYHVYDENK-AFLGVIVLDLYASEMKYCQAGH  382

Query  435  FKLQPGCLSPDGKG----------KQVPVAGMVTNF--TRPTASRP--------ALLDHD  474
              LQ GC+ P  +           +Q PV  +  N     P    P         L+  +
Sbjct  383  LTLQLGCI-PHQEALAKVGLKLPKRQYPVVVLTCNVGACSPVQRLPNGRFDDESTLMHPN  441

Query  475  EVETYFHEFGHVMHNMCSEADYAMFSGTRVERDFVEAPSQMLENWVWEEEPLRRMSGHFK  534
            EV T FHEFGH MH +  +      +GTR   DFVE  SQ+ E ++   E L+  +    
Sbjct  442  EVTTVFHEFGHAMHTIFGQTKVQNLAGTRASIDFVETFSQLFEQFLTSHEFLQLWAHRIS  501

Query  535  DGSPIPAETLQKLIQSKKANAGAFN----LRQVLLATFDQMIH-----------------  573
               PI  + + K    + A A  F     + QV+L+  DQ +H                 
Sbjct  502  TREPISFDMVMK----RNAAADMFKHLDMMDQVVLSAVDQTLHGPQPYTVYFPRGDQGNL  557

Query  574  --RSGGPI-DTQKAFSDLYRDLVGVETIPDTNMPA--------NFGHLAGGYDAQYYGYL  622
              R+ G I D  +   +L + L+ + T      P         +F HL+ GY A YYGYL
Sbjct  558  GKRTLGDIGDYGRGTYNLAKVLIDICTPLSIVTPTETGVLGTLSFEHLS-GYPAGYYGYL  616

Query  623  WSEVFSMDMFAARFKSEGIMNPKVGMDYRKCILAPGGSVDAVDMLKSFL  671
            +S   +  ++A +F  +  +N   G +  + ++  G + + VD+++++L
Sbjct  617  YSLSIARRIWAKKFMKDP-LNRDAGRELVQKVMRHGAACNPVDVIENYL  664


 Score = 34.7 bits (78),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 26/115 (23%), Positives = 55/115 (48%), Gaps = 3/115 (3%)

Query  71   LLQALQDIHCEMYTLGSPLNIPQHVSTDKAVRDASSEAERKMEDFEVEMSMRVDIFKKVV  130
            L+ +  ++ C    L  P    + V  D   +  +S A +K  ++  +++ R D++  V+
Sbjct  95   LIDSTSNVLC---LLLDPCEFVRQVHPDAEYKQHASYAFQKGYEYMSKVNSRRDLYDVVL  151

Query  131  AFQEKCGTDGLKPEAKRVVERLVKLGMRNGLHLAEETRQKVKDIKKKLSDLSITF  185
                  G   L  E  + V +L +    NG+HL ++ R+KV ++  +  +L++ F
Sbjct  152  QLDSTEGHKELSSEEIKNVAQLRRDMESNGIHLPDKLREKVTEMNIEKEELAMRF  206


>Q9W037_DROME unnamed protein product
Length=1111

 Score = 34.3 bits (77),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  150   ERLVKLGMRNGLHLAEETRQKVKDIKKKLSDLSITFQRNLNEVDTELLFSDDQL  203
              R+   G+R+G+H+ E T   ++D   + +   +TF + + +V T L+  D+ L
Sbjct  1029  SRMTSTGVRDGIHVTESTANVLRDFNIRCTYRGMTFVKGVGQVPTYLVDLDENL  1082


>E1JIB3_DROME unnamed protein product
Length=1050

 Score = 34.3 bits (77),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 15/54 (28%), Positives = 30/54 (56%), Gaps = 0/54 (0%)

Query  150   ERLVKLGMRNGLHLAEETRQKVKDIKKKLSDLSITFQRNLNEVDTELLFSDDQL  203
              R+   G+R+G+H+ E T   ++D   + +   +TF + + +V T L+  D+ L
Sbjct  968   SRMTSTGVRDGIHVTESTANVLRDFNIRCTYRGMTFVKGVGQVPTYLVDLDENL  1021



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000055-PA

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W215_DROME  unnamed protein product                                 145     7e-45
NU153_DROME  unnamed protein product                                  35.0    0.026
Q383R0_TRYB2  unnamed protein product                                 33.5    0.077


>Q9W215_DROME unnamed protein product
Length=150

 Score = 145 bits (365),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 94/136 (69%), Gaps = 8/136 (6%)

Query  1    MDHKKNAANRRNKRQAKVLED-YWDCSVCTYRNTAEAFKCLMCDVRKGTSTRKPRINPQL  59
            MD KK++  RR KRQAKV+E+ +WDCSVCTYRN+AEAFKC MCDVRKGTSTRKPR+N  L
Sbjct  1    MD-KKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTSTRKPRLNSAL  59

Query  60   VAQQVAQQFNSTPPKVKKETTKEGKEKTEKKSMPTDKVAKKSKHPPRLKNVDRSTAQHRE  119
            VAQQ A     T P         GK  +  +        +  ++P RLKNVDRSTAQ RE
Sbjct  60   VAQQAA-----TLPGA-SVNMPNGKSASGSRHGSGHDRQRHKRYPARLKNVDRSTAQTRE  113

Query  120  VTVNNVTVIITEYKPK  135
            VTVN+VTV ITEYK K
Sbjct  114  VTVNSVTVFITEYKAK  129


>NU153_DROME unnamed protein product
Length=1883

 Score = 35.0 bits (79),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  23    WDCSVCTYRNTAEAFKCLMCDVRKGTST  50
             W+CSVC  RN  E  KC+ C+  K  +T
Sbjct  1013  WECSVCLVRNKVEVSKCVACESAKPGAT  1040


 Score = 34.7 bits (78),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 22/44 (50%), Gaps = 5/44 (11%)

Query  23    WDCSVCTYRNTAEAFKCLMCDVRKGTST-----RKPRINPQLVA  61
             W+C  C   N AEA KC+ C+  + +ST       P IN  L A
Sbjct  1072  WECDACMLSNKAEASKCIACETPRKSSTPIANSSYPSINNNLPA  1115


 Score = 33.9 bits (76),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (56%), Gaps = 2/34 (6%)

Query  23   WDCSVCTYRNTAEAFKCLMCDVRKGTSTRKPRIN  56
            W+C  C   N AEA KC+ C+  +   T  P++N
Sbjct  968  WECDACMLSNKAEASKCIACETPR--KTVAPKVN  999


 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 16/31 (52%), Gaps = 0/31 (0%)

Query  23   WDCSVCTYRNTAEAFKCLMCDVRKGTSTRKP  53
            W+C  C  RN  E  KC+ C+  K  ++  P
Sbjct  907  WECDTCMVRNKPEINKCVACETAKPVASAAP  937


>Q383R0_TRYB2 unnamed protein product
Length=1192

 Score = 33.5 bits (75),  Expect = 0.077, Method: Composition-based stats.
 Identities = 28/98 (29%), Positives = 42/98 (43%), Gaps = 3/98 (3%)

Query  63   QVAQQFNSTPPKVKKETTKEGKEKTEKKSMPTDKVAKKSKHPPR--LKNVDRSTAQHREV  120
            Q A+QF + P  V+ ET+          +M     A+   H P+  + N+ R    H   
Sbjct  695  QCARQFCTIPTLVQGETSAALLADATAVTMVRGDAARCYDHLPQEAVVNIMRGLVTHETY  754

Query  121  TVNNVTVI-ITEYKPKVKKTSSDSQSGQASSVSSENGN  157
                +TV+ +T  K   KKT S     Q SS+   NG+
Sbjct  755  YSLKLTVVTLTTVKNVSKKTRSSHAESQLSSMKETNGS  792



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000056-PA

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SYQ_DROME  unnamed protein product                                    998     0.0  
Q587C5_TRYB2  unnamed protein product                                 246     5e-72
SYEP_DROME  unnamed protein product                                   221     6e-60


>SYQ_DROME unnamed protein product
Length=778

 Score = 998 bits (2579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/777 (62%), Positives = 594/777 (76%), Gaps = 29/777 (4%)

Query  3    EEAIRLFQSVGLSEQKAKETAVNTNLSKNLTQAIVQSQEYGLKLDPKQGVLLYQIASKIR  62
            ++ I  FQ++G+SEQKAKET  N N++KNL  ++  +      L    G+L+Y +A+K++
Sbjct  4    DDLIAKFQALGMSEQKAKETLKNANVTKNLQLSLAAAG--SATLSDGTGMLIYHMATKLK  61

Query  63   PQIQNRLPTLVQYVCTGKIDGEIRMQAALDYFI---SHINQDLNIKEFEDACGVGVIVTP  119
            PQ  + LP LV+Y+   K+D   R+ AAL+Y +     +N +++++  E  CGVGV+VTP
Sbjct  62   PQTADHLPLLVRYIVEHKLDNTQRVDAALEYLLKCGQSLNANIDLQALEKECGVGVVVTP  121

Query  120  EDVEQAVE-KVIAKHKAQLVEERYAFNVGLLMQEARMALKWADGKAVKNEVDVQVLDLLG  178
            E +E+ V+ K+ A +K  L+E+RY FN   ++Q+ R  LKWAD K+VK  +DV++ DLLG
Sbjct  122  EQIERTVQAKIKASYKEALLEQRYHFNSFKILQDVRGELKWADAKSVKAAIDVEIFDLLG  181

Query  179  PKTLQDLSGKDK---KAKKAKPEKKTVPEQKADE--SDGAATIGELMK-KLNFHRPGENH  232
            PKT  DL  + K   K K AKP+ +  P  +  E  SDGA TI ELMK K++FH PGEN 
Sbjct  182  PKTEADLKPQTKANDKPKAAKPKAEVTPAAQTAEAASDGATTISELMKTKVHFHAPGENF  241

Query  233  KSDGYVITPNTPDLLKAHVKLTGGQVRTRFPPEPNGILHIGHAKAININFGYAAANNGVC  292
            K+DGYV+T +T  LLK H+  TGG+V TRFPPEPNGILHIGHAKAININFGYAAA++GVC
Sbjct  242  KADGYVVTEHTERLLKEHLARTGGKVHTRFPPEPNGILHIGHAKAININFGYAAAHDGVC  301

Query  293  FLRYDDTNPEKEEEKYFTAIREMVEWLGYKPYKVTHSSDNFDQLYLWAVELIRKGMAYVC  352
            +LRYDDTNPEKEEEK+F AI+EMVEWLGYKP+K+T+SSDNF QLY WAV LI KG+AYVC
Sbjct  302  YLRYDDTNPEKEEEKFFLAIKEMVEWLGYKPFKITYSSDNFQQLYEWAVVLINKGLAYVC  361

Query  353  HQKSEEIKGFNPPPSPWRDRPIEESLTLFRDMKHGRIWEGEATLRMKVTLEEGKQDPVAY  412
            HQK+EE+KGFNP PSPWR+RPIEESL LF DMK G+I EG ATLRMKVTLEEGK DPVAY
Sbjct  362  HQKAEELKGFNPKPSPWRERPIEESLRLFEDMKRGKIDEGAATLRMKVTLEEGKMDPVAY  421

Query  413  RIKFTPHHRSGGKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQSRRSSYYWLCNALDIYC  472
            RIKF  HHR+G  WCIYPTYDYTHCLCDS+E ITHSLCTKEFQSRRSSYYWLCNAL IYC
Sbjct  422  RIKFISHHRTGSDWCIYPTYDYTHCLCDSLEDITHSLCTKEFQSRRSSYYWLCNALGIYC  481

Query  473  PVQWEYGRLNVNYTVVSKRKIANLITSKVVNDWDDPRLFTLTALRRRGFPAEAINNFCAL  532
            PVQWEYGRLN+NY +VSKRKIA LIT ++V+DWDDPRLFTLTALRRRGFPAEAINNFCA 
Sbjct  482  PVQWEYGRLNMNYALVSKRKIAKLITEQIVHDWDDPRLFTLTALRRRGFPAEAINNFCAQ  541

Query  533  VGVTGAQATVDPQIA---------------MVVLEPLKVVITANFQSEGDVILNVPNFPS  577
            +GVTGAQ  VDP +                +VVLEPLKV I  NF     V L VP+FP 
Sbjct  542  MGVTGAQIAVDPAMLEAAVRDVLNVTAPRRLVVLEPLKVTIK-NFPHAAPVQLEVPDFPQ  600

Query  578  DPEKGSHTVPLSRVLYIEDSDFRETGDKGYRRLTLTQPVGLKHASLLLSVTKVVKD-ASG  636
            +P++G+H + L +V+YIE  DF+   +KGYRRL   Q VGL+HA L++SV ++VKD A+G
Sbjct  601  NPQQGTHKITLDKVIYIEQGDFKLEPEKGYRRLAPKQSVGLRHAGLVISVDEIVKDPATG  660

Query  637  KVDHLEATCHPMNEGQKPKAFIHWVSHPTEVEVRMYDRLFNHKNPEDPNEVPGGYLTDCN  696
            +V  L  T  P  + +KPKAF+ WVS P ++EVR+Y++LF HKNPEDPNEVPGG+L+D +
Sbjct  661  QVVELICTSQPAEQAEKPKAFVQWVSQPIQLEVRLYEQLFKHKNPEDPNEVPGGFLSDIS  720

Query  697  PNSLTVCTAYADQSVKGTKVYDKFQFERQGFFSVDPDSSSEKLVFNRTVGLKEDAGK  753
              S++V  A+AD+++   KVYDKFQFER GFFSVDPD+S+  LVFNRTVGLKEDAGK
Sbjct  721  EQSMSVVVAFADRALNQAKVYDKFQFERIGFFSVDPDTSANHLVFNRTVGLKEDAGK  777


>Q587C5_TRYB2 unnamed protein product
Length=607

 Score = 246 bits (629),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 182/531 (34%), Positives = 266/531 (50%), Gaps = 56/531 (11%)

Query  238  VITPNTPDLLKA--HVKLT-----GGQVRTRFPPEPNGILHIGHAKAININFGYAAANNG  290
            V++ +  D  KA  H KLT      G+V TRFPPE +G LHIGHAKA  IN   A    G
Sbjct  26   VMSKHEEDCQKAPEHDKLTLTNAEEGKVVTRFPPEASGFLHIGHAKAALINSMLALKYKG  85

Query  291  VCFLRYDDTNPEKEEEKYFTAIREMVEWLGYKPYKV--THSSDNFDQLYLWAVELIRKGM  348
               +R+DDTNP KE++ +  AI + +  LG   + V  T+SSD  + LY  A ELI KG+
Sbjct  86   KLVMRFDDTNPSKEKDHFEQAILDDLATLGV-TWDVGPTYSSDYMELLYEKADELIEKGL  144

Query  349  AYVCHQKSEEIKG--FNPPPSPWRDRPIEESLTLFRDMKHGRIWEGEATLRMKVTLE---  403
            AY      EE++   FN  P+ +RD  IEE+  ++ +MK G     E  LR K++++   
Sbjct  145  AYCDKTTREEMQKCRFNGVPTSYRDISIEETKRMWSEMKEGSAEGQETCLRAKISVDNEN  204

Query  404  EGKQDPVAYRIKFTPHHRSGGKWCIYPTYDYTHCLCDSIEHITHSLCTKEFQSRRSSYYW  463
            +  +DPV YR+  TPH R G K+  YPTYD+   + DS+E ITH+L T E+  R   YYW
Sbjct  205  KAMRDPVIYRVNLTPHARQGTKYKAYPTYDFCCPIIDSVEGITHALRTNEYHDRNDQYYW  264

Query  464  LCNALDIYCPVQWEYGRLNVNYTVVSKRKIANLITSKVVNDWDDPRLFTLTALRRRGFPA  523
             C+AL +  P+  ++ RLN+ Y V+SKRK+  LI SKVV+ WDDPR  T+ AL RRG   
Sbjct  265  FCDALGLRKPIVEDFSRLNMEYAVMSKRKLTQLIDSKVVDGWDDPRFPTVRALVRRGLKM  324

Query  524  EAINNFCALVGVTGA-------------QATVDPQIA--MVVLEPLK---VVITANFQSE  565
             A+  F    G++                  +DP +    VV   LK   VV       +
Sbjct  325  SALRQFVQEQGMSKTVNFMEWSKLWYFNTQILDPSVPRYTVVSNTLKVRCVVEGIGGLEK  384

Query  566  GDVILNVPNFPSDPEKGSHTVPLSRVLYI--EDSDFRETGDKGYRRLTLTQPVGLKHASL  623
             + +L+       P+ GS     S V+++  ED    + GD+    +TL     +   + 
Sbjct  385  CEKLLH----KKAPDMGSKVFYKSGVIFLDAEDVALLKEGDE----VTL-----MDWGNA  431

Query  624  LLSVTKVVKDASGKVDHLEATCHPMNEGQKPKAFIHWVSHPTE---VEVRMYDRLFNHKN  680
             +   +   + SG +   +   +   + +K K  + WV+   E   +E+  YD L   K 
Sbjct  432  FIRNIRTSGE-SGTITDADIVLNLEGDVKKTKHKLTWVAENPEAEVMEINEYDHLLTKKK  490

Query  681  PEDPNEVPGGYLTDCNPNSLTVCTAYADQSVKGTKVYDKFQFERQGFFSVD  731
            P DP E     L      +  V   Y++ +    K  D  Q ER+G++ VD
Sbjct  491  P-DPEESLDSILAAVTKYTQEV---YSEAATSALKKGDIIQLERRGYYIVD  537


>SYEP_DROME unnamed protein product
Length=1714

 Score = 221 bits (562),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 160/507 (32%), Positives = 244/507 (48%), Gaps = 51/507 (10%)

Query  256  GQVRTRFPPEPNGILHIGHAKAININFGYAAANNGVCFLRYDDTNPEKEEEKYFTAIREM  315
            G+V  RFPPE +G LHIGHAKA  +N  YA A  G   +R+DDTNP KE  ++   I   
Sbjct  202  GKVVVRFPPEASGYLHIGHAKAALLNQYYALAFQGTLIMRFDDTNPAKETVEFENVILGD  261

Query  316  VEWLGYKPYKVTHSSDNFDQLYLWAVELIRKGMAYVCHQKSEEIKGFNPP--PSPWRDRP  373
            +E L  KP   TH+S+ FD +  + V LI++  AYV     E++K        S  R   
Sbjct  262  LEQLQIKPDVFTHTSNYFDLMLDYCVRLIKESKAYVDDTPPEQMKLEREQRVESANRSNS  321

Query  374  IEESLTLFRDMKHGRIWEGEATLRMKVTLEEGK---QDPVAYRIKFTPHHRSGGKWCIYP  430
            +E++L+L+ +M  G     +  +R K+ +       +DP  YR K  PH R+G K+ +YP
Sbjct  322  VEKNLSLWEEMVKGSEKGQKYCVRAKIDMSSPNGCMRDPTIYRCKNEPHPRTGTKYKVYP  381

Query  431  TYDYTHCLCDSIEHITHSLCTKEFQSRRSSYYWLCNALDIYCPVQWEYGRLNVNYTVVSK  490
            TYD+   + D+IE++TH+L T E+  R   +YW  +AL +  P  W Y RLN+  TV+SK
Sbjct  382  TYDFACPIVDAIENVTHTLRTTEYHDRDDQFYWFIDALKLRKPYIWSYSRLNMTNTVLSK  441

Query  491  RKIANLITSKVVNDWDDPRLFTLTALRRRGFPAEAINNFCALVGVTGAQATVDPQIAMV-  549
            RK+   + S +V+ WDDPR  T+  + RRG   E +  F    G + +   ++       
Sbjct  442  RKLTWFVDSGLVDGWDDPRFPTVRGIIRRGMTVEGLKEFIIAQGSSKSVVFMNWDKIWAF  501

Query  550  ---VLEPLKVVITANFQSEGDVILNVPN----------FPSDPEKGSHTVPLSRVLYIE-  595
               V++P+    TA  + E  VI+NV             P D   G  TV L   +YI+ 
Sbjct  502  NKKVIDPIAPRYTA-LEKEKRVIVNVAGAKVERIQVSVHPKDESLGKKTVLLGPRIYIDY  560

Query  596  -DSDFRETGDKGYRRLTLTQPVGLKHASLLLSVTKVVKDASGKVDHLEATCHPMNEGQKP  654
             D++  + G+             +   ++L  + KV KDASG +  ++A  +  N+  K 
Sbjct  561  VDAEALKEGENA---------TFINWGNIL--IRKVNKDASGNITSVDAALNLENKDFKK  609

Query  655  KAFIHWVS-------HPTEVEVRMYDRLFNHK---NPEDPNEVPGGYLTDCNPNSLTVCT  704
               + W++       +P    V  +D + +       ED  +  G    D  P       
Sbjct  610  TLKLTWLAVEDDPSAYPPTFCV-YFDNIISKAVLGKDEDFKQFIGHKTRDEVP-------  661

Query  705  AYADQSVKGTKVYDKFQFERQGFFSVD  731
               D  +K  K  D  Q +R+GFF VD
Sbjct  662  MLGDPELKKCKKGDIIQLQRRGFFKVD  688



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000057-PA

Length=339
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YKK7_CAEEL  unnamed protein product                                   35.8    0.048
Q382S6_TRYB2  unnamed protein product                                 33.5    0.27 
O77291_DROME  unnamed protein product                                 31.2    1.6  


>YKK7_CAEEL unnamed protein product
Length=466

 Score = 35.8 bits (81),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 35/131 (27%), Positives = 52/131 (40%), Gaps = 36/131 (27%)

Query  195  LPSEVTCKIFSYLTPPDRGRCARIWSFEPYDTLPLIEEESSLHCGSCSVLDDDGDVDESE  254
            LP EV  K+FS+L      R A++                   C S S+L  DG      
Sbjct  60   LPKEVLLKVFSFLDTKALCRSAQV-------------------CRSWSILALDG------  94

Query  255  EACDDCDGTNDIRRIMLREMH--IFNYFIEFLLPKVGLAVKKLVLTGSKGLKDHHLRSML  312
                     ++ +R+ L      +    +E L  + G  +K+L L G + + D  LR+  
Sbjct  95   ---------SNWQRVDLFTFQRDVKTAVVENLARRCGGFLKELSLKGCENVHDSALRTFT  145

Query  313  EMCPNLEQLDL  323
              CPNLE L L
Sbjct  146  SRCPNLEHLSL  156


>Q382S6_TRYB2 unnamed protein product
Length=644

 Score = 33.5 bits (75),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 28/61 (46%), Gaps = 4/61 (7%)

Query  278  NYFIEFLLPKVGLAVKKLVLTGSKGLKDHHLRSMLEMCPNLEQLDLCYTMVTDGAFKGYV  337
            N F  F  P     ++ LVL  S  L D HLR +LE CP+L  +D+        A   Y+
Sbjct  122  NVFSLFRCP----VLEVLVLPPSNQLGDVHLRGILEGCPHLHTIDISGNTALTTACVKYI  177

Query  338  A  338
             
Sbjct  178  G  178


>O77291_DROME unnamed protein product
Length=2396

 Score = 31.2 bits (69),  Expect = 1.6, Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 54/124 (44%), Gaps = 34/124 (27%)

Query  80    DECISYGRKLQEVLQEFTRTFLPHMQEEEDIFQPLLMQYFEYE--------ELKHLKEI-  130
             +EC+S   KL+++ +E  +  L  +  + D  + +L  + +YE        ELKHL+E  
Sbjct  1090  EECLSIKSKLEDMARELDQIILAPLPRDLDSLEHVLEIHSDYERRLHLLEPELKHLQETF  1149

Query  131   --------VIKEH-----EVWKE------------KLLDGKEKSLIEEENQTAEKDNACR  165
                     V+K+      E+WKE            KLL+     L + E+  +E +N   
Sbjct  1150  RTIALKTPVLKKSLDNLMELWKELNTQSGLHKDRLKLLEASLAGLEDNEHVISELENELA  1209

Query  166   SEQN  169
               Q+
Sbjct  1210  RHQD  1213



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000058-PA

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

P4HA2_CAEEL  unnamed protein product                                  219     5e-65
Q9VA52_DROME  unnamed protein product                                 189     9e-54
Q9VA69_DROME  unnamed protein product                                 162     7e-44


>P4HA2_CAEEL unnamed protein product
Length=539

 Score = 219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 158/536 (29%), Positives = 237/536 (44%), Gaps = 114/536 (21%)

Query  6    LLGTLLLPACTGGDLFLTSADLGSFFALEKKILDILRDYVGNVDSSISKLQRYLEEYELI  65
            +L   LL      DLF   ADL      EK +  I+  Y+    + +  L+RY  EY   
Sbjct  4    VLLVCLLAGLAHADLFTAIADLQHMLGAEKDVTTIIDQYIEAERARLDDLRRYAHEYVHR  63

Query  66   EEEVFKSEEQYLEKVRDNPLHAYHLVKRLTVYWNDIQ-AFVRQKCHKRLHDRLDH-LRHS  123
                     +++     NP++AY L+KRLT  W  ++   +  K    L +  D+ +R  
Sbjct  64   NAHAESVGPEFV----TNPINAYLLIKRLTTEWKKVENIMLNNKASTFLKNITDNRVRSE  119

Query  124  FTFPKEKDLHGAANAIIRLQDVYNLNVSDLSRGSIWDVQTNTELKAQDCTFMGK------  177
              FP E+DL GAA A++RLQD Y+L+  DLS G I   + + +L   D   +G+      
Sbjct  120  VKFPGEEDLSGAATALLRLQDTYSLDTLDLSNGIIGGEKVSNKLSGHDTFEVGRSAYNQK  179

Query  178  ---HC--------------------------------YNAGIYTRA--------------  188
               HC                                Y  G   RA              
Sbjct  180  DYYHCLMWMQVALVKIENENPPTIEEWEILEYLAYSLYQQGNVRRALSLTKRLAKIAPNH  239

Query  189  ------IEWFE---QAYDLAGH---------EVNGSVSQDQVAHFLDSAIRR-DDRYTAK  229
                  ++W+E   Q  D+ G          E +G V +D         I   + ++  K
Sbjct  240  PRAKGNVKWYEDMLQGKDMVGDLPPIVNKRVEYDGIVERDAYEALCRGEIPPVEPKWKNK  299

Query  230  LRCWVDSRGNPFYLLHPVKVEQHQLTPSIYSFHDVVSSAEIERLISLARPLLSRSLVQGQ  289
            LRC++  R  PF  L P+KVE  +  P    F +V+  +EIE +  LA P L R+ VQ  
Sbjct  300  LRCYL-KRDKPFLKLAPIKVEILRFDPLAVLFKNVIHDSEIEVIKELASPKLKRATVQNS  358

Query  290  RGSESQLSNLRVSKTSWLPDQMDPLVRKISNRVSRLTGLKADTDQNEAEHLQIVNYASGE  349
            +  E + +  R+SK++WL   +DP++ +++ R+   T L    +Q  +E LQ        
Sbjct  359  KTGELEHATYRISKSAWLKGDLDPVIDRVNRRIEDFTNL----NQATSEELQ--------  406

Query  350  YYNLHYDFTLKYMKKVVNYGLGGHFSPHHDYLFRDKTASQMKGISQQDLFIGDRIATFMI  409
                           V NYGLGGH+ PH D+      A + +  + + L  G+RIAT + 
Sbjct  407  ---------------VANYGLGGHYDPHFDF------ARKEEKNAFKTLNTGNRIATVLF  445

Query  410  YLSDVSKGGATAFPRIGLSVWPRKGSALFWHNLKESGQPDVLTLHGACPVLYGHKW  465
            Y+S   +GGAT F  +G +V+P K  ALFW+NL+  G+ D+ T H ACPVL G KW
Sbjct  446  YMSQPERGGATVFNHLGTAVFPSKNDALFWYNLRRDGEGDLRTRHAACPVLLGVKW  501


>Q9VA52_DROME unnamed protein product
Length=536

 Score = 189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 144/499 (29%), Positives = 234/499 (47%), Gaps = 107/499 (21%)

Query  34   EKKILDILRDYVGNVDSSISKLQRYLEEYELIEEEVFKSEEQYLEKVRDNPLHAYHLVKR  93
            +++++ +L  Y   ++  I  L+R ++E++   E+    EE+YL     NP+ +  L+++
Sbjct  42   DRELIIVLDSYATELNEKIIMLKRIVKEFKQPLEKAKNREEEYLS----NPIDSLSLMRQ  97

Query  94   LTVYWNDIQAFVRQKCHKRLHDRLDHLRHSFTFPKEKDLHGAANAIIRLQDVYNLNVSDL  153
            +   W  ++  +++   +     ++ +R     P E DL  A  A+ R+   Y+L   D+
Sbjct  98   MHEDWEKVEKLLKKPVGQEKIALVEKMREDL--PVENDLMEANQAMFRILHTYDLEPKDV  155

Query  154  SRGSIWDVQTNTELKAQDCTFMGKHCYNAGIYTRAIEWFEQAYDL------AGHEVNG--  205
            S G I  VQ   ++ A DC  MG   + AG Y  A +W   A DL        HEV G  
Sbjct  156  SAGWIDGVQYGGKMSASDCFTMGTFSFMAGSYQIASKWLSAAKDLLVDQPRKYHEVMGIT  215

Query  206  ------------------SVSQDQV--------------AHFLD----------------  217
                              S++ D +               HFL                 
Sbjct  216  KADVTLLLARSLIASGNVSIATDMLMRDFMFGEAGSALTVHFLRNKPKPSINLESWESDE  275

Query  218  -------SAIRRD--DRYTAKLRCWVDSRGNPFYLLHPVKVEQHQLTPSIYSFHDVVSSA  268
                   S+ RR   +   ++L C  ++   PF  L P ++E+  L P +  +H+V+S A
Sbjct  276  SFNQLCRSSSRRQMGESKPSRLHCRYNTITTPFLKLAPFRMEELSLDPYVIFYHNVLSDA  335

Query  269  EIERLISLARPLLSRSLV-QGQRGSESQLSNLRVSKTSWLPDQ-MDPLVRKISNRVSRLT  326
            EIE+L  + +P L R+ V + ++GS+ ++   R +  +WLP Q +DP   ++ NR+ R  
Sbjct  336  EIEKLKPMGKPFLERAKVFRVEKGSD-EIDPSRSADGAWLPHQNIDPDDLEVLNRIGR--  392

Query  327  GLKADTDQNEAEHLQIVNYASGEYYNLHYDFTLKYMKKVVNYGLGGHFSPHHDYLFRDKT  386
                       E +  +N  SG          ++++K    YG GGHF PH+DY F  KT
Sbjct  393  ---------RIEDMTGLNTRSGS--------KMQFLK----YGFGGHFVPHYDY-FNSKT  430

Query  387  ASQMKGISQQDLFIGDRIATFMIYLSDVSKGGATAFPRIGLSVWPRKGSALFWHNL-KES  445
             S           +GDRIAT + YL++V  GGAT FP++ L+V  +KGSALFWHN+ ++S
Sbjct  431  FSLET--------VGDRIATVLFYLNNVDHGGATVFPKLNLAVPTQKGSALFWHNIDRKS  482

Query  446  GQPDVLTLHGACPVLYGHK  464
               D  T HGACP++ G K
Sbjct  483  YDYDTRTFHGACPLISGTK  501


>Q9VA69_DROME unnamed protein product
Length=550

 Score = 162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 87/236 (37%), Positives = 127/236 (54%), Gaps = 33/236 (14%)

Query  230  LRCWVDSRGNPFYLLHPVKVEQHQLTPSIYSFHDVVSSAEIERLISLARPLLSRSLVQGQ  289
            LRC   +   PF  L P+K+E+    P I  +HD +  +EI+ +  +ARP   R+ VQ  
Sbjct  320  LRCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARPRFRRATVQNS  379

Query  290  RGSESQLSNLRVSKTSWLPDQMDPLVRKISNRVSRLTGLKADTDQNEAEHLQIVNYASGE  349
                 + +N R+SK++WL  Q D ++  +  R + +TGL    D + AE LQ        
Sbjct  380  VTGALETANYRISKSAWLKTQEDRVIETVVQRTADMTGL----DMDSAEELQ--------  427

Query  350  YYNLHYDFTLKYMKKVVNYGLGGHFSPHHDYLFRDKTASQMKGISQQDLFIGDRIATFMI  409
                           VVNYG+GGH+ PH D+  R +     +G++     +G+RIAT + 
Sbjct  428  ---------------VVNYGIGGHYEPHFDFA-RKEEQRAFEGLN-----LGNRIATVLF  466

Query  410  YLSDVSKGGATAFPRIGLSVWPRKGSALFWHNLKESGQPDVLTLHGACPVLYGHKW  465
            Y+SDV +GGAT F  +  +++P+KG+A FW NL   GQ DV T H ACPVL G KW
Sbjct  467  YMSDVEQGGATVFTSLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKW  522


 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 87/179 (49%), Gaps = 4/179 (2%)

Query  17   GGDLFLTSADLGSFFALEKKILDILRDYVGNVDSSISKLQRYLEEYELIEEEVFKSEEQY  76
             G+++   A++      E  ++  L  Y+   +  ++ L+  ++EY+    +       Y
Sbjct  22   NGEVYTALAEMEELLETESVLITNLEGYIRVQEDKLNFLKNKMDEYQREHSDASHDITAY  81

Query  77   LEKVRDNPLHAYHLVKRLTVYWNDIQAFVRQKCHKRLHDRLDHLRHSFTFPKEKDLHGAA  136
            +     NP++AY L KRLT  W  ++  +           +   R    FP ++DL+GAA
Sbjct  82   V----SNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQYRSLLKFPSDEDLNGAA  137

Query  137  NAIIRLQDVYNLNVSDLSRGSIWDVQTNTELKAQDCTFMGKHCYNAGIYTRAIEWFEQA  195
             A++RLQD Y L+ S ++RG +  +Q +TE+ + DC  +G+  Y    Y   + W  +A
Sbjct  138  VALLRLQDTYQLDTSSVARGKLNGIQYSTEMSSDDCFELGRQSYVNHDYYHTVLWMNEA  196



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000059-PA

Length=439
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IBR8_PLAF7  unnamed protein product                                 34.7    0.18 
FAT_DROME  unnamed protein product                                    34.3    0.29 
O97302_PLAF7  unnamed protein product                                 33.1    0.56 


>Q8IBR8_PLAF7 unnamed protein product
Length=2543

 Score = 34.7 bits (78),  Expect = 0.18, Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 33/74 (45%), Gaps = 6/74 (8%)

Query  32    CPEGYELSVDEVTGKYDCVCLPYHLYWSGDGLCYREFSQGPCPPGHRLVYNDATEKADCQ  91
             C +G+E  +     ++DC+ +P + Y S  G   +E    PCP     +Y     K  C 
Sbjct  1317  CKKGFEF-IKTDDNEFDCLEVPKNYYKSHLGNKEKE----PCPENSVTLYTQTKSKVKCL  1371

Query  92    C-PSYWAKWKDGAC  104
             C P Y+   K+  C
Sbjct  1372  CMPGYYWDLKEFKC  1385


>FAT_DROME unnamed protein product
Length=5147

 Score = 34.3 bits (77),  Expect = 0.29, Method: Composition-based stats.
 Identities = 49/205 (24%), Positives = 70/205 (34%), Gaps = 63/205 (31%)

Query  195   PCQEAEHCQDGTMC-----------FVRS------LESLRI----GCQCLYGAADDQCHQ  233
             PC E + C++G +C           FV        L   R+     CQC  G + +QC +
Sbjct  3953  PCSEPDVCENGGVCSATMRLLDAHSFVIQDSPALVLSGPRVVHDYSCQCTSGFSGEQCSR  4012

Query  234   MYSRGNCQYGEWLTPGENGTAPLCQPKPQCQRFDNWFYW-------GPH---ER---CYR  280
                +  C       P        C  + QC+R  + F         G H   ER   CY 
Sbjct  4013  --RQDPC------LPNP------CHSQVQCRRLGSDFQCMCPANRDGKHCEKERSDVCYS  4058

Query  281   QFSRGPCEKGRLFYMDPSTGEAGCHCRPAWKAYYWSRTQQCFEQDSRGPCSSGQY-----  335
             +    PC  G      P      C CRP ++    ++ +   +     PC  G       
Sbjct  4059  K----PCRNGGSCQRSPDGSSYFCLCRPGFRG---NQCESVSDSCRPNPCLHGGLCVSLK  4111

Query  336   --FSFNYTSGETECNCFR-SYVFNP  357
               +  N T G    +C R SY F P
Sbjct  4112  PGYKCNCTPGRYGRHCERFSYGFQP  4136


>O97302_PLAF7 unnamed protein product
Length=1086

 Score = 33.1 bits (74),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 73/183 (40%), Gaps = 43/183 (23%)

Query  50   VCLPYHLYWSGDGL-------CYREFSQGPCP-PGHRLVYNDATEKADCQCPSYWAKWKD  101
            VC+  + Y   DG+       C R+  +  C  P     YN+ T+   C+C  ++ +   
Sbjct  751  VCICANDYKMEDGINCIAKNKCKRKEYENICTNPNEMCAYNEETDIVKCECKEHYYRS--  808

Query  102  GACYQEYSRGPCSEGDLFIADLNTGEA----------QCVCNRSMVMHYHAPTDKCYE--  149
                   SRG C   D +  D+N  E           +CVC  ++  +        YE  
Sbjct  809  -------SRGECILND-YCKDINCKENEECSIVNFKPECVCKENLKKNNKGEC--IYENS  858

Query  150  -LYSQGPCP-DGHIIRFDYRSLSP-ECTC-RDGHVKWSDGKCHQLNTRGPCQEAEHCQDG  205
             L ++G CP D   I   YR   P EC C + GHV   +GKC        C   + C + 
Sbjct  859  CLINEGNCPKDSKCI---YREYKPHECVCNKQGHVAV-NGKCV---LEDKCVHNKKCSEN  911

Query  206  TMC  208
            ++C
Sbjct  912  SIC  914



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000060-PA

Length=810
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VA69_DROME  unnamed protein product                                 202     3e-56
A0A1P6BZ71_BRUMA  unnamed protein product                             184     5e-50
P4HA2_CAEEL  unnamed protein product                                  177     3e-47


>Q9VA69_DROME unnamed protein product
Length=550

 Score = 202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 142/242 (59%), Gaps = 10/242 (4%)

Query  562  IRVSARDDAVLKCRLLHHSNPFLKLGPFKLEEVSLLPSISIFHEFLSHEEADTLKRMARP  621
            ++ S  D   L+CR + +  PFL+LGP KLEEV   P I I+H+ +   E D +KRMARP
Sbjct  310  LKPSPSDLRSLRCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSEIDLIKRMARP  369

Query  622  HLHR-SLHRGKKGTFVATDTRTSKQAWLSEEDDPIVQKLNDRVSAATNMLVYPEYIASEF  680
               R ++     G     + R SK AWL  ++D +++ +  R +  T +    +  ++E 
Sbjct  370  RFRRATVQNSVTGALETANYRISKSAWLKTQEDRVIETVVQRTADMTGL----DMDSAEE  425

Query  681  FQVANYGIGGRYTPHADFLHQTDDGVVPEEGGMDTGRGNRMATFMTYLEDVESGGATVFP  740
             QV NYGIGG Y PH DF  + +        G++ G  NR+AT + Y+ DVE GGATVF 
Sbjct  426  LQVVNYGIGGHYEPHFDFARKEEQRAFE---GLNLG--NRIATVLFYMSDVEQGGATVFT  480

Query  741  IIGRAVWPRKGMAVFWYNLMSNGAGDPLTRHGSCPVLHGTKWICNKWIRSHEQMFRLPCD  800
             +  A++P+KG A FW NL  +G GD  TRH +CPVL GTKW+ NKWI    Q FR PCD
Sbjct  481  SLHTALFPKKGTAAFWMNLHRDGQGDVRTRHAACPVLTGTKWVSNKWIHERGQEFRRPCD  540

Query  801  VK  802
            ++
Sbjct  541  LE  542


 Score = 180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 141/444 (32%), Positives = 215/444 (48%), Gaps = 42/444 (9%)

Query  11   VANPVDAYALLRRLTIDWSEVESALAVSANYTQGAEGEDILNWLVNFREKAHFPMLDDLH  70
            V+NP++AY L +RLT DW +VE       N  +   G D L  +  +R    FP  +DL+
Sbjct  82   VSNPINAYLLTKRLTTDWRQVE-------NLMEHDVGTDFLQNITQYRSLLKFPSDEDLN  134

Query  71   GAAQALVRLQHAYDLEVYALADGALQGTSSHSVFRSLHELSARDLLFLGKHAFSYGFYDK  130
            GAA AL+RLQ  Y L+  ++A G L G    +      E+S+ D   LG+ ++    Y  
Sbjct  135  GAAVALLRLQDTYQLDTSSVARGKLNGIQYST------EMSSDDCFELGRQSYVNHDYYH  188

Query  131  TLEWLGVALTKA-EEERNATTSPEEIRPILHTAMEMGNFSNFWNILYIIILFIQQHDDIL  189
            T+ W+  A+ +  EE  N T S  +   + + A       N  + L +    +Q    +L
Sbjct  189  TVLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKEGNIESALTMTNELLQ----LL  244

Query  190  DKHGPRGVNWQTNSVPVDPSLA-HKAKYSFHLDSPP--------FQPKLFQQQTEAEEVE  240
              H     N +     +   L   K K     D  P          P +F    +  E  
Sbjct  245  PHHERANGNKRFYEKEIAQQLQLRKMKGDDGTDEMPKSDLPVAKSDPAIF----DMTERR  300

Query  241  HYFRLCRGE-KLRPAKLEALLRCRYATNGAN--KLERIKIEEHSHDPFIVMVHDLVTPRQ  297
             Y  LCRGE K  P+ L +L RCRY TN     +L  +K+EE   DP+IV+ HD +   +
Sbjct  301  AYEMLCRGELKPSPSDLRSL-RCRYVTNRVPFLRLGPLKLEEVHADPYIVIYHDAMYDSE  359

Query  298  AEAVIETAQPRLYRSRHRHELENNKDVVSSKRVSQNAWLTEEDTPALSIVTRNIEKVTGL  357
             + +   A+PR  R+  ++ +    +  ++ R+S++AWL  ++   +  V +    +TGL
Sbjct  360  IDLIKRMARPRFRRATVQNSVTGALET-ANYRISKSAWLKTQEDRVIETVVQRTADMTGL  418

Query  358  RASYPQEAEDYQVTNYGIGGLYVTHTDHLMSNPDPDAYSEWEHYVGDRLATVMVYLSDVD  417
                   AE+ QV NYGIGG Y  H D      +  A+      +G+R+ATV+ Y+SDV+
Sbjct  419  DMD---SAEELQVVNYGIGGHYEPHFD-FARKEEQRAFEGLN--LGNRIATVLFYMSDVE  472

Query  418  AGGATVFPRAGVTLWPRKGSAAFW  441
             GGATVF      L+P+KG+AAFW
Sbjct  473  QGGATVFTSLHTALFPKKGTAAFW  496


 Score = 30.0 bits (66),  Expect = 8.7, Method: Compositional matrix adjust.
 Identities = 14/38 (37%), Positives = 25/38 (66%), Gaps = 0/38 (0%)

Query  469  DVFSSTVELEELYRKDKVIITLLQKYIDNVEEKLTAVR  506
            +V+++  E+EEL   + V+IT L+ YI   E+KL  ++
Sbjct  24   EVYTALAEMEELLETESVLITNLEGYIRVQEDKLNFLK  61


>A0A1P6BZ71_BRUMA unnamed protein product
Length=541

 Score = 184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/242 (41%), Positives = 134/242 (55%), Gaps = 11/242 (5%)

Query  559  KTTIRVSARDDAVLKCRLLHHSNPFLKLGPFKLEEVSLLPSISIFHEFLSHEEADTLKRM  618
            +  I VS +  + L C       PFL+L PFK+E +   P   +F + ++ EE   ++ +
Sbjct  294  RNEIPVSIKVTSKLYC-YYKMDRPFLRLAPFKVEILRFNPLAVLFRDVITDEEVTMIQML  352

Query  619  ARPHLHR-SLHRGKKGTFVATDTRTSKQAWLSEEDDPIVQKLNDRVSAATNMLVYPEYIA  677
            A P L R ++     G       RTSK AWL +E+  +V ++N R+   TN+    E   
Sbjct  353  ATPRLRRATVQNSITGELETASYRTSKSAWLKDEEHEVVHRINKRIDLMTNL----EQET  408

Query  678  SEFFQVANYGIGGRYTPHADFLHQTDDGVVPEEGGMDTGRGNRMATFMTYLEDVESGGAT  737
            SE  QV NYGIGG Y PH DF  + +   V     ++TG  NR+AT + Y+   ESGGAT
Sbjct  409  SEELQVGNYGIGGHYDPHFDFARREE---VNAFQSLNTG--NRLATLLFYMTQPESGGAT  463

Query  738  VFPIIGRAVWPRKGMAVFWYNLMSNGAGDPLTRHGSCPVLHGTKWICNKWIRSHEQMFRL  797
            VF  +   V P K  A+FWYNL+ +G GD  TRH +CPVL GTKW+ NKWI    Q FR 
Sbjct  464  VFTEVKTTVMPSKNDALFWYNLLRSGEGDLRTRHAACPVLTGTKWVSNKWIHERGQEFRR  523

Query  798  PC  799
            PC
Sbjct  524  PC  525


 Score = 148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 128/439 (29%), Positives = 204/439 (46%), Gaps = 38/439 (9%)

Query  10   LVANPVDAYALLRRLTIDWSEVESALAVSANYTQGAEGEDILNWLVNFREKAHF--PMLD  67
            L++NPV AY L++RL  +W +++              GE++L  +   R   +   P  +
Sbjct  75   LLSNPVSAYLLIKRLIEEWDDIKRLAGSDI-------GEELLKEISELRAMNYVKNPTTE  127

Query  68   DLHGAAQALVRLQHAYDLEVYALADGALQGTSSHSVFRSLHELSARDLLFLGKHAFSYGF  127
            DL GAA AL+RLQ  Y L V  +ADG +   S    F      +ARD   +G+ A++   
Sbjct  128  DLVGAAIALLRLQDTYRLNVKEIADGKILNASGVQPF------TARDCFDIGRAAYNVND  181

Query  128  YDKTLEWLGVALTKAEEERNATTSPEEIRPILHTAMEMGNFSNF--WNILYIIILFIQQH  185
            Y  TL W+  A     +ER    +P E    L   +E   F+ F   N+   ++L  Q H
Sbjct  182  YYHTLIWMEEA-----QERLRDEAPHETVQ-LKEILEYLAFALFKQGNLKRALLLTEQLH  235

Query  186  DDILDKHGPRGVNWQTNSVPVDPSLAHKA--KYSFHLDSPPFQPKLFQQQTEAEEVEHYF  243
               +D + PR  N   N    +  LA +      +  + PP          E  E + Y 
Sbjct  236  --TIDPNHPRAKN---NIKWYEDLLAEEGLKPIDYRRNIPPVTNPRPTTGLETAEHDIYE  290

Query  244  RLCRGEKLRPAKLEALLRCRYATNGAN-KLERIKIEEHSHDPFIVMVHDLVTPRQAEAVI  302
             LCR E     K+ + L C Y  +    +L   K+E    +P  V+  D++T  +   + 
Sbjct  291  ALCRNEIPVSIKVTSKLYCYYKMDRPFLRLAPFKVEILRFNPLAVLFRDVITDEEVTMIQ  350

Query  303  ETAQPRLYRSRHRHELENNKDVVSSKRVSQNAWLTEEDTPALSIVTRNIEKVTGLRASYP  362
              A PRL R+  ++ +    +  +S R S++AWL +E+   +  + + I+ +T L     
Sbjct  351  MLATPRLRRATVQNSITGELET-ASYRTSKSAWLKDEEHEVVHRINKRIDLMTNLEQ---  406

Query  363  QEAEDYQVTNYGIGGLYVTHTDHLMSNPDPDAYSEWEHYVGDRLATVMVYLSDVDAGGAT  422
            + +E+ QV NYGIGG Y  H D      + +A+       G+RLAT++ Y++  ++GGAT
Sbjct  407  ETSEELQVGNYGIGGHYDPHFD-FARREEVNAFQSLN--TGNRLATLLFYMTQPESGGAT  463

Query  423  VFPRAGVTLWPRKGSAAFW  441
            VF     T+ P K  A FW
Sbjct  464  VFTEVKTTVMPSKNDALFW  482


 Score = 35.8 bits (81),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  456  ICALMSLSLTVGTDVFSSTVELEELYRKDKVIITLLQKYIDNVEEKLTAVRRF  508
            +  +++L  T   D+F+S  E+E L   DK I  LL  YI+  +++L  +R+ 
Sbjct  5    VVFILALRSTTHADLFTSIAEMELLLEADKRIPDLLDMYIERFQQRLDQIRQL  57


 Score = 34.3 bits (77),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (49%), Gaps = 3/74 (4%)

Query  512  SRDCLFIGKAAFNKGLYDKAIQWLEAAMAKVADN--DKTTTEKEIRPFLKTTI-RVSARD  568
            +RDC  IG+AA+N   Y   + W+E A  ++ D    +T   KEI  +L   + +     
Sbjct  166  ARDCFDIGRAAYNVNDYYHTLIWMEEAQERLRDEAPHETVQLKEILEYLAFALFKQGNLK  225

Query  569  DAVLKCRLLHHSNP  582
             A+L    LH  +P
Sbjct  226  RALLLTEQLHTIDP  239


>P4HA2_CAEEL unnamed protein product
Length=539

 Score = 177 bits (448),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/233 (41%), Positives = 126/233 (54%), Gaps = 13/233 (6%)

Query  572  LKCRLLHHSNPFLKLGPFKLEEVSLLPSISIFHEFLSHEEADTLKRMARPHLHR-SLHRG  630
            L+C  L    PFLKL P K+E +   P   +F   +   E + +K +A P L R ++   
Sbjct  300  LRC-YLKRDKPFLKLAPIKVEILRFDPLAVLFKNVIHDSEIEVIKELASPKLKRATVQNS  358

Query  631  KKGTFVATDTRTSKQAWLSEEDDPIVQKLNDRVSAATNMLVYPEYIASEFFQVANYGIGG  690
            K G       R SK AWL  + DP++ ++N R+   TN+        SE  QVANYG+GG
Sbjct  359  KTGELEHATYRISKSAWLKGDLDPVIDRVNRRIEDFTNL----NQATSEELQVANYGLGG  414

Query  691  RYTPHADFLHQTDDGVVPEEGGMDT-GRGNRMATFMTYLEDVESGGATVFPIIGRAVWPR  749
             Y PH DF  +       E+    T   GNR+AT + Y+   E GGATVF  +G AV+P 
Sbjct  415  HYDPHFDFARKE------EKNAFKTLNTGNRIATVLFYMSQPERGGATVFNHLGTAVFPS  468

Query  750  KGMAVFWYNLMSNGAGDPLTRHGSCPVLHGTKWICNKWIRSHEQMFRLPCDVK  802
            K  A+FWYNL  +G GD  TRH +CPVL G KW+ NKWI    Q F  PC ++
Sbjct  469  KNDALFWYNLRRDGEGDLRTRHAACPVLLGVKWVSNKWIHEKGQEFTRPCGLE  521


 Score = 157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 134/444 (30%), Positives = 208/444 (47%), Gaps = 52/444 (12%)

Query  9    DLVANPVDAYALLRRLTIDWSEVESALAVSANYTQGAEGEDILNWLVNFREKAHFPMLDD  68
            + V NP++AY L++RLT +W +VE+   +  N       ++I +  V  R +  FP  +D
Sbjct  73   EFVTNPINAYLLIKRLTTEWKKVEN---IMLNNKASTFLKNITDNRV--RSEVKFPGEED  127

Query  69   LHGAAQALVRLQHAYDLEVYALADGALQGTSSHSVFRSLHELSARDLLFLGKHAFSYGFY  128
            L GAA AL+RLQ  Y L+   L++G + G       +  ++LS  D   +G+ A++   Y
Sbjct  128  LSGAATALLRLQDTYSLDTLDLSNGIIGGE------KVSNKLSGHDTFEVGRSAYNQKDY  181

Query  129  DKTLEWLGVALTKAEEERNATTSPEEIRPIL-HTAMEMGNFSNFWNILYIIILFIQQHDD  187
               L W+ VAL K E E   T    EI   L ++  + GN     ++   +      H  
Sbjct  182  YHCLMWMQVALVKIENENPPTIEEWEILEYLAYSLYQQGNVRRALSLTKRLAKIAPNH--  239

Query  188  ILDKHGPRG---VNWQTNSVPVDPSLAHKAKYSFHLDSPPFQPKLFQQQTEAEEVEHYFR  244
                  PR    V W  + +     +          D PP   K  +     E  + Y  
Sbjct  240  ------PRAKGNVKWYEDMLQGKDMVG---------DLPPIVNKRVEYDGIVER-DAYEA  283

Query  245  LCRGEKLRPA--KLEALLRCRYATNGAN-KLERIKIEEHSHDPFIVMVHDLVTPRQAEAV  301
            LCRGE + P   K +  LRC    +    KL  IK+E    DP  V+  +++   + E +
Sbjct  284  LCRGE-IPPVEPKWKNKLRCYLKRDKPFLKLAPIKVEILRFDPLAVLFKNVIHDSEIEVI  342

Query  302  IETAQPRLYRSRHRH----ELENNKDVVSSKRVSQNAWLTEEDTPALSIVTRNIEKVTGL  357
             E A P+L R+  ++    ELE+     ++ R+S++AWL  +  P +  V R IE  T L
Sbjct  343  KELASPKLKRATVQNSKTGELEH-----ATYRISKSAWLKGDLDPVIDRVNRRIEDFTNL  397

Query  358  RASYPQEAEDYQVTNYGIGGLYVTHTDHLMSNPDPDAYSEWEHYVGDRLATVMVYLSDVD  417
              +    +E+ QV NYG+GG Y  H D      + +A+       G+R+ATV+ Y+S  +
Sbjct  398  NQA---TSEELQVANYGLGGHYDPHFD-FARKEEKNAFKTLN--TGNRIATVLFYMSQPE  451

Query  418  AGGATVFPRAGVTLWPRKGSAAFW  441
             GGATVF   G  ++P K  A FW
Sbjct  452  RGGATVFNHLGTAVFPSKNDALFW  475


 Score = 34.3 bits (77),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 15/61 (25%), Positives = 35/61 (57%), Gaps = 3/61 (5%)

Query  451  RCLILICALMSLSLTVGTDVFSSTVELEELYRKDKVIITLLQKYIDNVEEKLTAVRRFVS  510
            R ++L+C L  L+     D+F++  +L+ +   +K + T++ +YI+    +L  +RR+  
Sbjct  2    RAVLLVCLLAGLA---HADLFTAIADLQHMLGAEKDVTTIIDQYIEAERARLDDLRRYAH  58

Query  511  Q  511
            +
Sbjct  59   E  59


 Score = 30.4 bits (67),  Expect = 7.2, Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query  514  DCLFIGKAAFNKGLYDKAIQWLEAAMAKVADNDKTTTEK-EIRPFLKTTI  562
            D   +G++A+N+  Y   + W++ A+ K+ + +  T E+ EI  +L  ++
Sbjct  167  DTFEVGRSAYNQKDYYHCLMWMQVALVKIENENPPTIEEWEILEYLAYSL  216



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000061-PA

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DAF31_CAEEL  unnamed protein product                                  279     3e-97
Q9VT75_DROME  unnamed protein product                                 279     6e-97
Q385W4_TRYB2  unnamed protein product                                 182     2e-58


>DAF31_CAEEL unnamed protein product
Length=182

 Score = 279 bits (714),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 152/179 (85%), Gaps = 0/179 (0%)

Query  1    MNIRCARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYVAEDEKGKIVGYVLAKM  60
            MNIRCAR +DLM+MQ+ NL+CLPENYQMKYYFYH LSWPQLSY+AED KG +VGYVLAKM
Sbjct  1    MNIRCARVDDLMSMQNANLMCLPENYQMKYYFYHALSWPQLSYIAEDHKGNVVGYVLAKM  60

Query  61   EEDSEDDPHGHITSLAVKRSHRRLGLAQKLMDQASRSMVECFNAKYVSLHVRKSNRAALN  120
            EED  ++PHGHITSLAVKRS+RRLGLA K+MDQ +R+MVE +NAKYVSLHVR SNRAALN
Sbjct  61   EEDPGEEPHGHITSLAVKRSYRRLGLANKMMDQTARAMVETYNAKYVSLHVRVSNRAALN  120

Query  121  LYTNTLKFMISEVEPKYYADGEDAYAMKRDLVTFAMQYSILPSDPSSFFGNRGHDDKRK  179
            LY NTLKF I + EPKYYADGEDAYAM+RDL  +A + +I P+D  ++   +  DDK+K
Sbjct  121  LYKNTLKFEIVDTEPKYYADGEDAYAMRRDLAKWAEERNIEPADREAYTTAKTTDDKKK  179


>Q9VT75_DROME unnamed protein product
Length=196

 Score = 279 bits (713),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 144/157 (92%), Gaps = 2/157 (1%)

Query  1    MNIRCARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYVAEDEKGKIVGYVLAKM  60
            MNIRCA+PEDLM MQHCNLLCLPENYQMKYYFYHGL+WPQLSYVA D+KG IVGYVLAKM
Sbjct  1    MNIRCAKPEDLMTMQHCNLLCLPENYQMKYYFYHGLTWPQLSYVAVDDKGAIVGYVLAKM  60

Query  61   EED--SEDDPHGHITSLAVKRSHRRLGLAQKLMDQASRSMVECFNAKYVSLHVRKSNRAA  118
            EE   +E+  HGHITSLAVKRS+RRLGLAQKLM+QAS++MVECFNA+YVSLHVRKSNRAA
Sbjct  61   EEPEPNEESRHGHITSLAVKRSYRRLGLAQKLMNQASQAMVECFNAQYVSLHVRKSNRAA  120

Query  119  LNLYTNTLKFMISEVEPKYYADGEDAYAMKRDLVTFA  155
            LNLYTN LKF I EVEPKYYADGEDAYAM+RDL  FA
Sbjct  121  LNLYTNALKFKIIEVEPKYYADGEDAYAMRRDLSEFA  157


>Q385W4_TRYB2 unnamed protein product
Length=239

 Score = 182 bits (463),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 108/150 (72%), Gaps = 1/150 (1%)

Query  1    MNIRCARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYVAEDEKGKIVGYVLAKM  60
            M +R A  ED+  MQHCNL CLPENY ++YY YH LSWPQL YV ED  G +VGYVLAKM
Sbjct  1    MQVRRATMEDMYQMQHCNLRCLPENYNLRYYLYHILSWPQLLYVQEDNNGNVVGYVLAKM  60

Query  61   EEDSE-DDPHGHITSLAVKRSHRRLGLAQKLMDQASRSMVECFNAKYVSLHVRKSNRAAL  119
            EE+   +   GHITS+AV R+HRRLG+A ++M+ A   M   ++A + SLHVRK+N AAL
Sbjct  61   EEEEHAEKVFGHITSIAVLRTHRRLGIASRVMNAALHEMEHEYDANFCSLHVRKTNDAAL  120

Query  120  NLYTNTLKFMISEVEPKYYADGEDAYAMKR  149
            +LY NTL F  + VE KYY D EDAY MKR
Sbjct  121  HLYQNTLNFRCANVESKYYVDEEDAYHMKR  150



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000062-PA

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NOC_DROME  unnamed protein product                                    163     1e-44
ELBOW_DROME  unnamed protein product                                  155     5e-42
A8JUN6_DROME  unnamed protein product                                 50.1    3e-06


>NOC_DROME unnamed protein product
Length=537

 Score = 163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 136/232 (59%), Gaps = 31/232 (13%)

Query  213  YLSYARLKTPSGGEALVPVCRDPYCTGCQLNVPGAVAAHMLKPGGCPSGCVQCDHQKNGF  272
            Y+SY R+KTP+GGEA+VPVC+DPYC GC  +   A    ML    CP+GC QC+HQK G 
Sbjct  313  YISYQRIKTPAGGEAIVPVCKDPYCQGCPYS---AHTQQMLMGAPCPAGCTQCEHQKYGL  369

Query  273  LASLMPGMPPGA-AAAALAYAPQHSFLGGSLPFVCNWIQGDAYCGKRFGSSEELLQHLRS  331
              +   G+PP    + A A A  ++    S P+VC+W+ GDAYCGKRF +S+EL  HLR+
Sbjct  370  AMASAAGLPPAHPYSQAAAAAAANAAAARSAPYVCSWVVGDAYCGKRFQTSDELFSHLRT  429

Query  332  HT-NLA-----AASDSTPLALLNPGGLPPHPLLHRTYPTPPLSPLS---AAARYHPYGKP  382
            HT NL+     AA+ +   A    G L P   L   YPTPPLSP+S   AAARYHPY KP
Sbjct  430  HTGNLSDPAAAAAALAQSQAQSLLGTLFPPSALRAGYPTPPLSPMSAAAAAARYHPYAKP  489

Query  383  AGIPGLPPTSLAG------------SMGLTPHPAMAPYYSPYSLYGQRLGGS  422
                  PP +LAG                    A+ PYYSPY++YGQR+G +
Sbjct  490  ------PPGALAGGPSPFGAAGAFNPAAAAAAAALGPYYSPYAMYGQRMGAA  535


 Score = 55.8 bits (133),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 1/39 (3%)

Query  10  LDAKKSPLALLAQTCSQIGADTSSSKPIIPPLEKKKTEP  48
           +DAKKSPLALLAQTCSQIGAD+S+ KP++  ++K KT+P
Sbjct  31  MDAKKSPLALLAQTCSQIGADSSAVKPLL-AMDKNKTKP  68


>ELBOW_DROME unnamed protein product
Length=553

 Score = 155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 138/236 (58%), Gaps = 32/236 (14%)

Query  208  AGLNPYLSYARLK--TPSGGEALVP-VCRDPYCTGCQLNVPGAVAAHMLKPGG--CPSGC  262
            + +NPYL+YAR+K  T     A  P VCRDPYCTGC      A   ++ K  G  CP+GC
Sbjct  327  SAMNPYLNYARMKGLTEQSMMAATPNVCRDPYCTGCP-----ASPHYINKAAGQPCPAGC  381

Query  263  VQCDHQKNGFLASLMPGMPPGAAAAALAYAPQHSFLG--------------GSLPFVCNW  308
             QC+    G   S       G +  + + A   +                   +P+VC+W
Sbjct  382  PQCEGGGGGGGGSSKSSGSQGGSGGSSSAAAAAAAAAASSYHAQLAALAAASQMPYVCSW  441

Query  309  IQGDA-YCGKRFGSSEELLQHLRSHTNLAAASDSTPLALLNPGGLPP-HPLLHRTYPTPP  366
            I  DA YCGKRFG+S++L QHLR+HT  A+  D+  L+    GG+PP HPL  RTYPTPP
Sbjct  442  IGSDAAYCGKRFGTSDDLFQHLRTHT--ASVPDAV-LSAAAAGGIPPNHPLFQRTYPTPP  498

Query  367  LSPLSAAARYHPYGKPAGIPGLPPTSLAGSMGLTPHPAMAPYYSPYSLYGQRLGGS  422
            LSPLSAA RYHPYGKP+ +P  P  +  G  GL PHPA+A Y++PYSLYG R+G S
Sbjct  499  LSPLSAA-RYHPYGKPSMLP--PSLAPPGMPGLPPHPALAQYFAPYSLYGPRMGSS  551


 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)

Query  9   QLDAKKSPLALLAQTCSQIGADTSSSKPIIPPLEKKKTE  47
           QLD K SPLALLAQTCS IGADT++ K +   +EK   +
Sbjct  24  QLDNKSSPLALLAQTCSAIGADTTNPKLLAANIEKSTKQ  62


>A8JUN6_DROME unnamed protein product
Length=715

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 4/34 (12%)

Query  300  GSLPFVCNWIQGDAYCGKRFGSSEELLQHLRSHT  333
            G  PFVCNW+    +CGKRF  S+EL +HLR+HT
Sbjct  411  GERPFVCNWL----FCGKRFTRSDELQRHLRTHT  440



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000063-PA

Length=363


***** No hits found *****



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000064-PA

Length=397
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCQ7_DROME  unnamed protein product                                 267     4e-82
Q17522_CAEEL  unnamed protein product                                 99.0    2e-25
Q19641_CAEEL  unnamed protein product                                 86.3    9e-21


>Q9VCQ7_DROME unnamed protein product
Length=806

 Score = 267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 145/187 (78%), Gaps = 10/187 (5%)

Query  1    MWTCHKCGKPVYFAERKQSLGFDWHPNCLRCEECGKRLNPGQHAEHKGVPYCHIPCYGAL  60
            MW CHKCGKPVYFAERKQS+G+DWHP CLRCEECGKRLNPGQHAEHK VPYCH+PCYGAL
Sbjct  1    MWKCHKCGKPVYFAERKQSIGYDWHPECLRCEECGKRLNPGQHAEHKSVPYCHVPCYGAL  60

Query  61   FGPQLFGHGTRVESHTSFG-KVENKPPSVNR----VPRTHLESKLKAYNQYYDGRSGELK  115
            FGPQLFGHGTRVESH S+G K   KP         +PR HLESKLK YNQ+YD +S E++
Sbjct  61   FGPQLFGHGTRVESHKSYGVKGAQKPTGAQANGPPLPRDHLESKLKVYNQFYDNKSLEIR  120

Query  116  CREVNKRLVLEGVLHIYWGVNNLIQLKEEDDQRMVVVIRKRNSYRRAISNGLEDDSDSDA  175
             REVN RLVLEG L +YWGV  +I LKE+DDQR  +++RKRNS R + +    ++S SD 
Sbjct  121  SREVNNRLVLEGALRVYWGVQGVIHLKEDDDQR--ILVRKRNSCRVSKA---ANESSSDK  175

Query  176  EGGGTDA  182
            E   +++
Sbjct  176  ENEASES  182


 Score = 195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 121/146 (83%), Gaps = 0/146 (0%)

Query  252  RETSVFTPPYGSHMSVWVTSLVGASDVISLLLDKYKVESKASDFALFVVRENGERRRLRD  311
            RETS FTPPYGS MSVWV+S+V  ++VI+L+L+KYKV+S   +F+LF+VR+NGE++RL+D
Sbjct  661  RETSFFTPPYGSQMSVWVSSMVTTTEVINLVLEKYKVDSSPGNFSLFIVRDNGEQKRLKD  720

Query  312  DEYPLVVRVMLGPHEDIARIFLMDSTSTREISSQVAQYINLSETECRSILGKFQEEEERE  371
            DEYPL+ RV LGPHED+ARIFL+DS  T EIS++VAQ++NLS  ECR+IL ++ +E  RE
Sbjct  721  DEYPLITRVTLGPHEDVARIFLVDSRKTDEISNEVAQFLNLSLPECRAILERYDQELARE  780

Query  372  VQRVRLRFREMKKRIKQRMDELKVRL  397
            V +++ R+ E+++RI  RM+ LKV L
Sbjct  781  VAKIKERYAELRRRIVSRMESLKVHL  806


>Q17522_CAEEL unnamed protein product
Length=84

 Score = 99.0 bits (245),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 47/78 (60%), Positives = 55/78 (71%), Gaps = 4/78 (5%)

Query  1   MWTCHKCGKPVYFAERKQSLGFDWHPNCLRC--EECGKRLNPGQHAEHKGVPYCHIPCYG  58
           M  C  C KPVYFAER  SLG DWH  CL+C  + CGK L+ G H+EH+G PYC+  CYG
Sbjct  1   MPNCPNCQKPVYFAERVSSLGKDWHRPCLKCANKACGKTLSAGSHSEHEGKPYCN-RCYG  59

Query  59  ALFGPQLFGHGTRVESHT  76
           ALFGP+ +GHG   ESHT
Sbjct  60  ALFGPKGYGHGG-TESHT  76


>Q19641_CAEEL unnamed protein product
Length=85

 Score = 86.3 bits (212),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 53/78 (68%), Gaps = 4/78 (5%)

Query  1   MWTCHKCGKPVYFAERKQSLGFDWHPNCLRCEE--CGKRLNPGQHAEHKGVPYCHIPCYG  58
           M  C +C K VYFAER  S+GFDWH  CLRCE   C K L  G H+E +G PYC+  CYG
Sbjct  1   MPNCPRCQKAVYFAERVTSIGFDWHRPCLRCENEACKKTLAAGSHSEREGKPYCNR-CYG  59

Query  59  ALFGPQLFGHGTRVESHT  76
           ALFGP+ +GHG   ESHT
Sbjct  60  ALFGPRGYGHGG-TESHT  76



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000065-PA

Length=370
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFP0_DROME  unnamed protein product                                 296     4e-98
DNJ1_CAEEL  unnamed protein product                                   236     2e-74
DNJC7_DICDI  unnamed protein product                                  84.3    2e-17


>Q9VFP0_DROME unnamed protein product
Length=370

 Score = 296 bits (757),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 146/297 (49%), Positives = 200/297 (67%), Gaps = 30/297 (10%)

Query  75   QIKLCKDYYEVLGVTKEATEADIKKSYRRLALQFHPDKCKAPGAEEVFKGSLQHVRAIGN  134
            ++K CKDYYEVLGV+K AT+++IKK+Y++LALQ HPDK KAPGA E FK       A+GN
Sbjct  100  KVKTCKDYYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEAFK-------ALGN  152

Query  135  AFAVLSDTEKRKQYDLYGSDEERMQRMHRSQHS----HHHDSEYDYTRGFEADMTAEELF  190
            A  VL+D EKRK YDLYG +E      +          ++++EY Y+RGF+AD++AEELF
Sbjct  153  AAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEELF  212

Query  191  NMFFGGGFPSSNVYVRRGGGMSGQGRWHRAGGAGAGGEYRHNTREAREPNGYSIVLQMLP  250
            NMFF GGFP  NV++R+                          RE RE N  S ++ +LP
Sbjct  213  NMFFNGGFPQQNVHMRQQRRRQQ-------------------AREDREGNNSSALVNLLP  253

Query  251  ILVLIFLSMMGSFFVSDPVYSLQQTSKYPILRKTSKLNVPYFVRDTFHRDYQGNIHRLEA  310
            I++LI LSMM SFF+SDP+YSL  + KY + R+T+ L VPY+V+D F+ +YQG++ RLE 
Sbjct  254  IVLLIGLSMMSSFFISDPMYSLTPSHKYSVKRETNSLKVPYYVKDNFYSEYQGSVARLEE  313

Query  311  NVEEEYVTNLQHSCYRERSYKETMLWRAQNFGDRSSVARAQKIATPSCETLQQLFST  367
            +VEE++V +L+HSC RER+Y+++ML +A+ FGDR    +AQ I TPSCE LQ+   T
Sbjct  314  SVEEDFVNHLKHSCSRERNYRDSMLAKARTFGDRDLYRKAQNINTPSCENLQKYLIT  370


>DNJ1_CAEEL unnamed protein product
Length=401

 Score = 236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/294 (42%), Positives = 182/294 (62%), Gaps = 26/294 (9%)

Query  75   QIKLCKDYYEVLGVTKEATEADIKKSYRRLALQFHPDKCKAPGAEEVFKGSLQHVRAIGN  134
            +I+ CKDYYE+L + K+A++ DI+K YR+LAL+ HPDKC+AP A E FK       A+GN
Sbjct  131  RIRHCKDYYEILKIDKKASDDDIRKEYRKLALKLHPDKCRAPHATEAFK-------ALGN  183

Query  135  AFAVLSDTEKRKQYDLYGSD--EERMQRMHRSQHSHHHDSEYDYTRGFEADMTAEELFNM  192
            A+AVLSDT+KR+QYD YG++          R    H    E+DY  GFEA+ T EE+FNM
Sbjct  184  AYAVLSDTDKRRQYDQYGAEAANSHTPTTRRRGGGHGAFFEHDYAHGFEAEFTPEEIFNM  243

Query  193  FFGGGFPSSNVYVRRGGGMSGQGRWHRAGGAGAGGEYRHNTREAREPNGYSIVLQMLPIL  252
            FFGGGFP+  V  R         R+       A  +  H+  + + P  Y  +LQ+LP++
Sbjct  244  FFGGGFPTEQVRRR--------ARY-------AQQQQYHHYEQQQSP--YGPLLQLLPLI  286

Query  253  VLIFLSMMGSFFVSDPVYSLQQTSKYPILRKTSKLNVPYFVRDTFHRDYQGNIHRLEANV  312
             ++ + ++    V +P YSL QTSK+ I R T+ L VPYFVR  F   Y+G I ++E  V
Sbjct  287  AIMVIGLLAQLMVGEPAYSLHQTSKFTIKRLTADLRVPYFVRTDFETSYRGRIRQVEQQV  346

Query  313  EEEYVTNLQHSCYRERSYKETMLWRAQNFGDRSSVARAQKIATPSCETLQQLFS  366
            E++Y+ NL+ +CY+E++ KET L+RA+   D + +  A++   PSC  L +++S
Sbjct  347  EDDYIQNLRMNCYKEQNLKETKLYRARWMRDEAMMRDAERTPLPSCIRLNEIYS  400


>DNJC7_DICDI unnamed protein product
Length=539

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 70/108 (65%), Gaps = 4/108 (4%)

Query  52   QGQPMDRASGMAWRRNTPKNKWTQIK-LCKDYYEVLGVTKEATEADIKKSYRRLALQFHP  110
            + Q +D  +G   +RN  + K    K L KDYY++LGV+KEA E +IKK+YR+LALQ+HP
Sbjct  332  KAQSLDPENG-ELQRNIKEAKIAHKKSLRKDYYKILGVSKEAGETEIKKAYRKLALQYHP  390

Query  111  DKCKAPGAEEVFKGSLQHVRAIGNAFAVLSDTEKRKQYDLYGSDEERM  158
            DK      EE  +   +  + IG A++VLSD +K++QYD+ G DE  M
Sbjct  391  DKNNQLPEEEKAQAE-KMFKDIGEAYSVLSDEKKKRQYDM-GQDENGM  436



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000066-PA

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VH64_DROME  unnamed protein product                                 275     3e-90
X2JAC7_DROME  unnamed protein product                                 37.0    0.024
M9NFR6_DROME  unnamed protein product                                 37.0    0.024


>Q9VH64_DROME unnamed protein product
Length=379

 Score = 275 bits (703),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 221/343 (64%), Gaps = 34/343 (10%)

Query  26   KTEKELKQLKEPFRMAKLNVLWSKATKRLSEAKLRSLLSDLKLQDKEEILWKKLRGEGKD  85
            K + + K ++ PFRMAKLN++W+KA  RL+E KL+SL  +LK+ DKEEI WK+L  + KD
Sbjct  48   KYDPDFKSIQRPFRMAKLNLVWAKAQNRLTEPKLKSLYMELKIHDKEEIAWKQLNSQHKD  107

Query  86   KEGLKEAELRKKLRGIINTYGLSEHFEDTAEEDQGK-------ADKAHLNKSLFKDKKLN  138
            K+GLK  ELR+KL GI+++Y L EHF+DT + ++ K       A++ H NKSLFKDKKLN
Sbjct  108  KDGLKADELRRKLIGIMSSYDLLEHFDDTQDTEKLKPYKKFHDAEERHRNKSLFKDKKLN  167

Query  139  KLWEKAEAAGFNEVELKTLREEFLHHQDKVDQYYDLLAKEEATDDD--ENHINRFD----  192
            +LWEKAE +GF   ELK+L++EF HHQDKVD YY LL      D D  EN IN  D    
Sbjct  168  RLWEKAEISGFTAEELKSLKQEFDHHQDKVDVYYSLLENIGTVDTDKHENAINTEDLDTY  227

Query  193  -----DFEESEAPS-----KTVQTRANMIKEKHQELKNGYNRLHRLAASGPEAKEFIEPK  242
                 D  E++  +     K+ +   N ++  H  +K+ Y+RL RL +SGP +++FIEPK
Sbjct  228  NLISNDVNENDIKTHAQNVKSFENDLNTLRGHHTGIKDHYDRLERLVSSGPHSQDFIEPK  287

Query  243  VQQLWSMALGSDFTPDELESLKTELKHYEQRLMKLSHLQAELVLVDERHKGKLDMDGEWD  302
            VQ LW +A  S+FT  ELES+KTEL H+E RL+KL HL AE  L  E++KG+   D    
Sbjct  288  VQGLWRVAQASNFTVKELESIKTELHHFESRLLKLRHLHAEHALQKEKYKGEKVKD----  343

Query  303  GSEDGEKTEGRRIMDDKVKKHARKVEKLHEHLEMRILQRHIEL  345
                  K+     M+D++KK  RKVEKL E++E  I  +H EL
Sbjct  344  ------KSSRFEEMEDQLKKQTRKVEKLQENIEKTIF-KHTEL  379


>X2JAC7_DROME unnamed protein product
Length=2853

 Score = 37.0 bits (84),  Expect = 0.024, Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 58/139 (42%), Gaps = 25/139 (18%)

Query  127  LNKSLFKDKKLNKLWEKAEAAGFNEVELKTLREEFLHHQDKVDQYYD-----------LL  175
             N++    K+ + L+++ EA+G++E +    R  F+ ++   ++Y D           LL
Sbjct  196  FNRATDPRKRASDLYDENEASGYHEEDTTLYRTYFVVNEPYDNEYRDRESVQFQNLQKLL  255

Query  176  AKE---------EATDDDENHINRFDDFEESEAPSKTVQTRANMIKEKHQELKNGYNRLH  226
              +         E  DD+E  I    +  E E P     T  N    K Q+  N YNR+ 
Sbjct  256  DDDLRNFFHSNYEGNDDEEQEIRSTLERVEIELP-----TSVNDFGSKLQQQLNVYNRIE  310

Query  227  RLAASGPEAKEFIEPKVQQ  245
             L+A+      F E  V +
Sbjct  311  NLSAATDGVFSFTESSVTE  329


>M9NFR6_DROME unnamed protein product
Length=3833

 Score = 37.0 bits (84),  Expect = 0.024, Method: Composition-based stats.
 Identities = 34/139 (24%), Positives = 58/139 (42%), Gaps = 25/139 (18%)

Query  127  LNKSLFKDKKLNKLWEKAEAAGFNEVELKTLREEFLHHQDKVDQYYD-----------LL  175
             N++    K+ + L+++ EA+G++E +    R  F+ ++   ++Y D           LL
Sbjct  196  FNRATDPRKRASDLYDENEASGYHEEDTTLYRTYFVVNEPYDNEYRDRESVQFQNLQKLL  255

Query  176  AKE---------EATDDDENHINRFDDFEESEAPSKTVQTRANMIKEKHQELKNGYNRLH  226
              +         E  DD+E  I    +  E E P     T  N    K Q+  N YNR+ 
Sbjct  256  DDDLRNFFHSNYEGNDDEEQEIRSTLERVEIELP-----TSVNDFGSKLQQQLNVYNRIE  310

Query  227  RLAASGPEAKEFIEPKVQQ  245
             L+A+      F E  V +
Sbjct  311  NLSAATDGVFSFTESSVTE  329



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000067-PA

Length=2741
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ANKHM_DROME  unnamed protein product                                  811     0.0  
G5ECZ1_CAEEL  unnamed protein product                                 209     1e-53
Q8MQG0_CAEEL  unnamed protein product                                 209     1e-53


>ANKHM_DROME unnamed protein product
Length=4001

 Score = 811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/550 (73%), Positives = 466/550 (85%), Gaps = 16/550 (3%)

Query  60    VLRRLTSSVSCALDEAAAALTRMRSDSSRQQVDA---RSLAEACSDGDVGAVQKLLDEGG  116
             VLR  T     A+DE   ALT+MR  SS +  ++   RSL  AC+D DV  V++LL +G 
Sbjct  517   VLRHATH----AIDETKQALTKMRCASSPRDKNSGFSRSLVAACTDNDVNTVKRLLCKGN  572

Query  117   -NVQE---TTEEGESLLSLACSAGYYELAQVLLAMRA-NVEDRGVKGDCTPLMEAASAGH  171
              N+ +   +T++GESLLS+ACSAGYYELAQVLLAM A  VED+G K D TPLMEAASAGH
Sbjct  573   VNLNDAAASTDDGESLLSMACSAGYYELAQVLLAMSAAQVEDKGQK-DSTPLMEAASAGH  631

Query  172   ADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLESGAHVEDHNENGHTPLME  231
              DIV+LL+ H ADVN+  ++GNTPLM+ACAGG  DVV+VLL+ GA+VE+ NENGHTPLME
Sbjct  632   LDIVKLLLNHNADVNAHCATGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLME  691

Query  232   AASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDE  291
             AASAGHV VA+ LLE GAGINTHSNEFKESALTLACYKGHL+MVRFLL+AGADQEHKTDE
Sbjct  692   AASAGHVEVAKVLLEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDE  751

Query  292   MHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAACGGHVELAMLLIERGANI  351
             MHTALMEASMDGHV+VARLLL+SGAQVNMP DSFESPLTLAACGGHVELA LLIERGANI
Sbjct  752   MHTALMEASMDGHVEVARLLLDSGAQVNMPTDSFESPLTLAACGGHVELATLLIERGANI  811

Query  352   EEVNDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQETALTLACCGGFPEVAEFL  411
             EEVNDEGYTPLMEAAREGHEEMVALLLS+GA INA T+ETQETALTLACCGGF EVA FL
Sbjct  812   EEVNDEGYTPLMEAAREGHEEMVALLLSKGANINATTEETQETALTLACCGGFMEVAAFL  871

Query  412   VKAGADIELGASTPLMESAQEGHLELVRFLLESEASVEAQTQTGDTALTYACENGHTDVA  471
             +K GA++ELGASTPLME++QEGH +LV FLL+ +A+V A+TQTGDTALT+ACENGHTD A
Sbjct  872   IKEGANLELGASTPLMEASQEGHTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAA  931

Query  472   ALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKGASVNRSTTNNDHTPLSLACA  531
              +LL YGAELEHESEGGRTPLMKACRAGH CTV+FL+ KGA+VN+ TT+NDHT LSLACA
Sbjct  932   GVLLSYGAELEHESEGGRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACA  991

Query  532   GGHLAVVEMLLASAADPYHKLKDNSTMVIESAKGGHTAVVQMLLDYPHSIVMSAHGAAAA  591
             GGH +VVE+LL + ADP+HKLKDNSTM+IE++KGGHT VV++L  YP+   +S    AA+
Sbjct  992   GGHQSVVELLLKNNADPFHKLKDNSTMLIEASKGGHTRVVELLFRYPN---ISPTENAAS  1048

Query  592   AALNQLGPQS  601
             A + Q  P S
Sbjct  1049  ANVTQAAPTS  1058


 Score = 534 bits (1376),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 261/414 (63%), Positives = 314/414 (76%), Gaps = 69/414 (17%)

Query  1339  LDVDCETESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVV  1398
             +++D ETESNHDTALTLACAGGH+ELVELLI+RG++IEHRDKKGFTPLIL ATAGH+KVV
Sbjct  2303  IEIDSETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVV  2362

Query  1399  EILLNHGSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAAS  1458
             +ILL H +E+EAQSERTKDTPLSLACSGGRYEVVELLL+ G+NKEHRNVSDYTPLSLAAS
Sbjct  2363  DILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAAS  2422

Query  1459  GGYVNIIKLLLSHGAEINSRTAGR------------------ELIM--------------  1486
             GGYVNIIKLLLSHGAEINSRT  +                  +L++              
Sbjct  2423  GGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNR  2482

Query  1487  -----LIC----HFIL--------------KTGLTPLMEAASGGYVDVGKVLLDKNADVN  1523
                  L C    H ++              KTGLTPLMEAASGGY++VG+VLLDK ADVN
Sbjct  2483  NTALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEVGRVLLDKGADVN  2542

Query  1524  AAPVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLL  1583
             AAPVP+SRDTALTIAADKGH +FVELL+SRNA +EV+NKKGN+PLWLA +GGHL V +LL
Sbjct  2543  AAPVPTSRDTALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLAAHGGHLSVVELL  2602

Query  1584  FSQGANIDSQDNRKVANTLYIIQCISSQTSCLMAAFRKGHVRVVKWMVKHVTQFPNDYEM  1643
             +   A+IDSQDNR+V              SCLMAAFRKGH ++VKWMV++V+QFP+D EM
Sbjct  2603  YDHNADIDSQDNRRV--------------SCLMAAFRKGHTKIVKWMVQYVSQFPSDQEM  2648

Query  1644  KRYMSTVSDKELLKKCEQCFEVIAAAKAKQAAEANKIATILLEEIDMEKSREES  1697
              R++ T+SDKEL+ KC  C +++ +AK  QA +ANK A+ILLEE+D+E++REES
Sbjct  2649  IRFIGTISDKELIDKCFDCMKILRSAKEAQAVKANKNASILLEELDLERTREES  2702


 Score = 194 bits (492),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 118/334 (35%), Positives = 187/334 (56%), Gaps = 10/334 (3%)

Query  184   DVNSQSSSG-NTPLMYACAGGHEDVVRVLLESGAHVEDHNENGHTPLMEAASAGHVGVAR  242
             +++S++ S  +T L  ACAGGHE++V +L+  GA++E  ++ G TPL+ AA+AGH  V  
Sbjct  2304  EIDSETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVD  2363

Query  243   TLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEASMD  302
              LL+  A +   S   K++ L+LAC  G  E+V  LL  GA++EH+    +T L  A+  
Sbjct  2364  ILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASG  2423

Query  303   GHVDVARLLLNSGAQVNMPADSFE--SPLTLAACGGHVELAMLLIERGANIE-EVNDEGY  359
             G+V++ +LLL+ GA++N    S    SPL LAA  GH     LL+++G++I  ++     
Sbjct  2424  GYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRN  2483

Query  360   TPLMEAAREGHEEMVALLLSQGALINAQTDETQETALTLACCGGFPEVAEFLVKAGADIE  419
             T L  A  +G  E+V+LLL + A +  +  +T  T L  A  GG+ EV   L+  GAD+ 
Sbjct  2484  TALTLACFQGRHEVVSLLLDRRANVEHRA-KTGLTPLMEAASGGYIEVGRVLLDKGADVN  2542

Query  420   -----LGASTPLMESAQEGHLELVRFLLESEASVEAQTQTGDTALTYACENGHTDVAALL  474
                      T L  +A +GH + V  LL   ASVE + + G++ L  A   GH  V  LL
Sbjct  2543  AAPVPTSRDTALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLAAHGGHLSVVELL  2602

Query  475   LEYGAELEHESEGGRTPLMKACRAGHACTVQFLL  508
              ++ A+++ +     + LM A R GH   V++++
Sbjct  2603  YDHNADIDSQDNRRVSCLMAAFRKGHTKIVKWMV  2636


 Score = 187 bits (476),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 194/332 (58%), Gaps = 10/332 (3%)

Query  120   ETTEEGESLLSLACSAGYYELAQVLLAMRANVEDRGVKGDCTPLMEAASAGHADIVRLLI  179
             ET    ++ L+LAC+ G+ EL ++L+   AN+E R  KG  TPL+ AA+AGH  +V +L+
Sbjct  2308  ETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKG-FTPLILAATAGHDKVVDILL  2366

Query  180   AHGADVNSQSS-SGNTPLMYACAGGHEDVVRVLLESGAHVEDHNENGHTPLMEAASAGHV  238
              H A++ +QS  + +TPL  AC+GG  +VV +LL  GA+ E  N + +TPL  AAS G+V
Sbjct  2367  KHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYV  2426

Query  239   GVARTLLERGAGINTHS-NEFKESALTLACYKGHLEMVRFLLEAGADQEHKTD-EMHTAL  296
              + + LL  GA IN+ + ++   S L LA   GH   V+ LL+ G+D   + +   +TAL
Sbjct  2427  NIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTAL  2486

Query  297   MEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAACGGHVELAMLLIERGANIEE--V  354
               A   G  +V  LLL+  A V   A +  +PL  AA GG++E+  +L+++GA++    V
Sbjct  2487  TLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEVGRVLLDKGADVNAAPV  2546

Query  355   NDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQETALTLACCGGFPEVAEFLVKA  414
                  T L  AA +GH++ V LLLS+ A +  + ++   + L LA  GG   V E L   
Sbjct  2547  PTSRDTALTIAADKGHQKFVELLLSRNASVEVK-NKKGNSPLWLAAHGGHLSVVELLYDH  2605

Query  415   GADIELGAS---TPLMESAQEGHLELVRFLLE  443
              ADI+   +   + LM + ++GH ++V+++++
Sbjct  2606  NADIDSQDNRRVSCLMAAFRKGHTKIVKWMVQ  2637


 Score = 187 bits (475),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 201/359 (56%), Gaps = 13/359 (4%)

Query  60    VLRRLTSSVSCALDEAAAALTRMRSDSSRQQVDARSLAEACSDGDVGAVQKLLDEGGNVQ  119
             V  +L  + + +LD+       +  DS  +     +L  AC+ G    V+ L++ G N++
Sbjct  2287  VQNQLAVATTVSLDKT------IEIDSETESNHDTALTLACAGGHEELVELLINRGANIE  2340

Query  120   ETTEEGESLLSLACSAGYYELAQVLLAMRANVEDRGVKGDCTPLMEAASAGHADIVRLLI  179
                ++G + L LA +AG+ ++  +LL   A +E +  +   TPL  A S G  ++V LL+
Sbjct  2341  HRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLL  2400

Query  180   AHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLESGAHVEDH--NENGHTPLMEAASAGH  237
             + GA+   ++ S  TPL  A +GG+ +++++LL  GA +     ++ G +PLM AA  GH
Sbjct  2401  SVGANKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGH  2460

Query  238   VGVARTLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALM  297
                 + LL++G+ IN      + +ALTLAC++G  E+V  LL+  A+ EH+     T LM
Sbjct  2461  TPAVKLLLDQGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLM  2520

Query  298   EASMDGHVDVARLLLNSGAQVN---MPADSFESPLTLAACGGHVELAMLLIERGANIEEV  354
             EA+  G+++V R+LL+ GA VN   +P  S ++ LT+AA  GH +   LL+ R A++E  
Sbjct  2521  EAASGGYIEVGRVLLDKGADVNAAPVPT-SRDTALTIAADKGHQKFVELLLSRNASVEVK  2579

Query  355   NDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQETALTLACCGGFPEVAEFLVK  413
             N +G +PL  AA  GH  +V LL    A I++Q D  + + L  A   G  ++ +++V+
Sbjct  2580  NKKGNSPLWLAAHGGHLSVVELLYDHNADIDSQ-DNRRVSCLMAAFRKGHTKIVKWMVQ  2637


 Score = 177 bits (449),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 115/322 (36%), Positives = 188/322 (58%), Gaps = 43/322 (13%)

Query  1350  DTALTLACAGGHDELVELLIS-RGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEI  1408
             ++ L++AC+ G+ EL ++L++   + +E + +K  TPL+  A+AGH  +V++LLNH +++
Sbjct  586   ESLLSMACSAGYYELAQVLLAMSAAQVEDKGQKDSTPLMEAASAGHLDIVKLLLNHNADV  645

Query  1409  EAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLL  1468
              A    T +TPL  AC+GG+ +VV++LL  G+N E +N + +TPL  AAS G+V + K+L
Sbjct  646   NAHCA-TGNTPLMFACAGGQVDVVKVLLKHGANVEEQNENGHTPLMEAASAGHVEVAKVL  704

Query  1469  LSHGAEIN--SRTAGRELIMLICH--------FILKTGL----------TPLMEAASGGY  1508
             L HGA IN  S       + L C+        F+L+ G           T LMEA+  G+
Sbjct  705   LEHGAGINTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGH  764

Query  1509  VDVGKVLLDKNADVNAAPVPS-SRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTP  1567
             V+V ++LLD  A VN   +P+ S ++ LT+AA  GH     LL+ R A+IE  N +G TP
Sbjct  765   VEVARLLLDSGAQVN---MPTDSFESPLTLAACGGHVELATLLIERGANIEEVNDEGYTP  821

Query  1568  LWLACNGGHLEVAQLLFSQGANID--SQDNRKVANTL-----------YIIQCISS----  1610
             L  A   GH E+  LL S+GANI+  +++ ++ A TL           ++I+  ++    
Sbjct  822   LMEAAREGHEEMVALLLSKGANINATTEETQETALTLACCGGFMEVAAFLIKEGANLELG  881

Query  1611  QTSCLMAAFRKGHVRVVKWMVK  1632
              ++ LM A ++GH  +V +++K
Sbjct  882   ASTPLMEASQEGHTDLVSFLLK  903


 Score = 174 bits (441),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 112/295 (38%), Positives = 162/295 (55%), Gaps = 42/295 (14%)

Query  324   SFESPLTLAACGGHVELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVALLLSQGAL  383
             + ++ LTLA  GGH EL  LLI RGANIE  + +G+TPL+ AA  GH+++V +LL   A 
Sbjct  2312  NHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAE  2371

Query  384   INAQTDETQETALTLACCGGFPEVAEFLVKAGADIE-----------LGAS---------  423
             + AQ++ T++T L+LAC GG  EV E L+  GA+ E           L AS         
Sbjct  2372  LEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAASGGYVNIIKL  2431

Query  424   ------------------TPLMESAQEGHLELVRFLLESEASVEAQTQTG-DTALTYACE  464
                               +PLM +A  GH   V+ LL+  + + AQ +T  +TALT AC 
Sbjct  2432  LLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNRNTALTLACF  2491

Query  465   NGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKGASVNRS--TTNND  522
              G  +V +LLL+  A +EH ++ G TPLM+A   G+    + LL KGA VN +   T+ D
Sbjct  2492  QGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEVGRVLLDKGADVNAAPVPTSRD  2551

Query  523   HTPLSLACAGGHLAVVEMLLASAADPYHKLKDNSTMVIESAKGGHTAVVQMLLDY  577
              T L++A   GH   VE+LL+  A    K K  ++ +  +A GGH +VV++L D+
Sbjct  2552  -TALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLAAHGGHLSVVELLYDH  2605


 Score = 167 bits (424),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 172/347 (50%), Gaps = 43/347 (12%)

Query  238   VGVARTL-LERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTAL  296
             + VA T+ L++   I++ +    ++ALTLAC  GH E+V  L+  GA+ EH+  +  T L
Sbjct  2291  LAVATTVSLDKTIEIDSETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPL  2350

Query  297   MEASMDGHVDVARLLLNSGAQVNMPAD-SFESPLTLAACGGHVELAMLLIERGANIEEVN  355
             + A+  GH  V  +LL   A++   ++ + ++PL+LA  GG  E+  LL+  GAN E  N
Sbjct  2351  ILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRN  2410

Query  356   DEGYT-----------------------------------PLMEAAREGHEEMVALLLSQ  380
                YT                                   PLM AA  GH   V LLL Q
Sbjct  2411  VSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQ  2470

Query  381   GALINAQTDETQETALTLACCGGFPEVAEFLVKAGADIELGAS---TPLMESAQEGHLEL  437
             G+ INAQ +  + TALTLAC  G  EV   L+   A++E  A    TPLME+A  G++E+
Sbjct  2471  GSDINAQIETNRNTALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEV  2530

Query  438   VRFLLESEASVEAQ--TQTGDTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKA  495
              R LL+  A V A     + DTALT A + GH     LLL   A +E +++ G +PL  A
Sbjct  2531  GRVLLDKGADVNAAPVPTSRDTALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLA  2590

Query  496   CRAGHACTVQFLLSKGASVNRSTTNNDHTPLSLACAGGHLAVVEMLL  542
                GH   V+ L    A ++ S  N   + L  A   GH  +V+ ++
Sbjct  2591  AHGGHLSVVELLYDHNADID-SQDNRRVSCLMAAFRKGHTKIVKWMV  2636


 Score = 163 bits (412),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 107/336 (32%), Positives = 169/336 (50%), Gaps = 44/336 (13%)

Query  1341  VDCETESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEI  1400
             ++  +    ++ALTLAC  GH ++V  L+  G+D EH+  +  T L+  +  GH +V  +
Sbjct  711   INTHSNEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVEVARL  770

Query  1401  LLNHGSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGG  1460
             LL+ G+++   ++ + ++PL+LA  GG  E+  LL+ RG+N E  N   YTPL  AA  G
Sbjct  771   LLDSGAQVNMPTD-SFESPLTLAACGGHVELATLLIERGANIEEVNDEGYTPLMEAAREG  829

Query  1461  YVNIIKLLLSHGAEINSRTAGRE---LIMLIC-------HFILKTGL-------TPLMEA  1503
             +  ++ LLLS GA IN+ T   +   L +  C        F++K G        TPLMEA
Sbjct  830   HEEMVALLLSKGANINATTEETQETALTLACCGGFMEVAAFLIKEGANLELGASTPLMEA  889

Query  1504  ASGGYVDVGKVLLDKNADVNAAPVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKK  1563
             +  G+ D+   LL K A+V+A     + DTALT A + GH     +L+S  A +E  ++ 
Sbjct  890   SQEGHTDLVSFLLKKKANVHAET--QTGDTALTHACENGHTDAAGVLLSYGAELEHESEG  947

Query  1564  GNTPLWLACNGGHLEVAQLLFSQGANIDSQDNRKVANTLYI-------------------  1604
             G TPL  AC  GHL   + L  +GAN++ Q        L +                   
Sbjct  948   GRTPLMKACRAGHLCTVKFLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNNAD  1007

Query  1605  -IQCISSQTSCLMAAFRKGHVRVVKWMVKHVTQFPN  1639
                 +   ++ L+ A + GH RVV+ + +    +PN
Sbjct  1008  PFHKLKDNSTMLIEASKGGHTRVVELLFR----YPN  1039


 Score = 148 bits (373),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 102/279 (37%), Positives = 148/279 (53%), Gaps = 25/279 (9%)

Query  1341  VDCETESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEI  1400
             V+  T+S  ++ LTLA  GGH EL  LLI RG++IE  + +G+TPL+  A  GHE++V +
Sbjct  778   VNMPTDS-FESPLTLAACGGHVELATLLIERGANIEEVNDEGYTPLMEAAREGHEEMVAL  836

Query  1401  LLNHGSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGG  1460
             LL+ G+ I A +E T++T L+LAC GG  EV   L+  G+N E   +   TPL  A+  G
Sbjct  837   LLSKGANINATTEETQETALTLACCGGFMEVAAFLIKEGANLE---LGASTPLMEASQEG  893

Query  1461  YVNIIKLLLSHGAEINSRT-AGRELIMLICH--------FILKTGL----------TPLM  1501
             + +++  LL   A +++ T  G   +   C          +L  G           TPLM
Sbjct  894   HTDLVSFLLKKKANVHAETQTGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLM  953

Query  1502  EAASGGYVDVGKVLLDKNADVNAAPVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRN  1561
             +A   G++   K L+ K A+VN     S+  TAL++A   GH   VELL+  NA    + 
Sbjct  954   KACRAGHLCTVKFLIQKGANVNKQTT-SNDHTALSLACAGGHQSVVELLLKNNADPFHKL  1012

Query  1562  KKGNTPLWLACNGGHLEVAQLLFSQGANIDSQDNRKVAN  1600
             K  +T L  A  GGH  V +LLF +  NI   +N   AN
Sbjct  1013  KDNSTMLIEASKGGHTRVVELLF-RYPNISPTENAASAN  1050


 Score = 118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 130/253 (51%), Gaps = 21/253 (8%)

Query  1344  ETESNHDTALTLACAGGHDELVELLISRGS----DIEHRDKKGFTPLILGATAGHEKVVE  1399
             +  S    +L  AC       V+ L+ +G+    D       G + L +  +AG+ ++ +
Sbjct  543   DKNSGFSRSLVAACTDNDVNTVKRLLCKGNVNLNDAAASTDDGESLLSMACSAGYYELAQ  602

Query  1400  ILL-NHGSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAAS  1458
             +LL    +++E + ++   TPL  A S G  ++V+LLLN  ++      +  TPL  A +
Sbjct  603   VLLAMSAAQVEDKGQK-DSTPLMEAASAGHLDIVKLLLNHNADVNAHCATGNTPLMFACA  661

Query  1459  GGYVNIIKLLLSHGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDK  1518
             GG V+++K+LL HGA +  +               + G TPLMEAAS G+V+V KVLL+ 
Sbjct  662   GGQVDVVKVLLKHGANVEEQN--------------ENGHTPLMEAASAGHVEVAKVLLEH  707

Query  1519  NADVNAAPVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLE  1578
              A +N       +++ALT+A  KGH   V  L+   A  E +  + +T L  A   GH+E
Sbjct  708   GAGINTHS-NEFKESALTLACYKGHLDMVRFLLQAGADQEHKTDEMHTALMEASMDGHVE  766

Query  1579  VAQLLFSQGANID  1591
             VA+LL   GA ++
Sbjct  767   VARLLLDSGAQVN  779


 Score = 117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 74/95 (78%), Gaps = 1/95 (1%)

Query  1995  KKVVVASNVVSRVIGRGGSNINAIREATGAHIEVEKQTKGQGERSIQIKGSAEATRQAHQ  2054
             KKV V  N +SRVIGRGGSNINAIR  TGAHIEVEKQ K Q ER I IKG  +AT+QAH 
Sbjct  3039  KKVQVPVNAISRVIGRGGSNINAIRATTGAHIEVEKQGKNQSERCITIKGLTDATKQAHM  3098

Query  2055  LIMALVKDPELDLQKMLPKSLKLAAAVAATGGSSS  2089
             LI+AL+KDP++D+ +MLP+ +  +   A++GG+S+
Sbjct  3099  LILALIKDPDVDILQMLPR-INSSIKQASSGGAST  3132


 Score = 104 bits (260),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 106/214 (50%), Gaps = 23/214 (11%)

Query  1340  DVDCETESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVE  1399
             +++  TE   +TALTLAC GG  E+   LI  G+++E       TPL+  +  GH  +V 
Sbjct  843   NINATTEETQETALTLACCGGFMEVAAFLIKEGANLE---LGASTPLMEASQEGHTDLVS  899

Query  1400  ILLNHGSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASG  1459
              LL   + + A+++ T DT L+ AC  G  +   +LL+ G+  EH +    TPL  A   
Sbjct  900   FLLKKKANVHAETQ-TGDTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRA  958

Query  1460  GYVNIIKLLLSHGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKN  1519
             G++  +K L+  GA +N +T   +              T L  A +GG+  V ++LL  N
Sbjct  959   GHLCTVKFLIQKGANVNKQTTSND-------------HTALSLACAGGHQSVVELLLKNN  1005

Query  1520  ADVNAAPVPSSRD--TALTIAADKGHYRFVELLV  1551
             AD    P    +D  T L  A+  GH R VELL 
Sbjct  1006  AD----PFHKLKDNSTMLIEASKGGHTRVVELLF  1035


 Score = 100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 1/137 (1%)

Query  442   LESEASVEAQTQTG-DTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGH  500
             L+    ++++T++  DTALT AC  GH ++  LL+  GA +EH  + G TPL+ A  AGH
Sbjct  2299  LDKTIEIDSETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGH  2358

Query  501   ACTVQFLLSKGASVNRSTTNNDHTPLSLACAGGHLAVVEMLLASAADPYHKLKDNSTMVI  560
                V  LL   A +   +     TPLSLAC+GG   VVE+LL+  A+  H+   + T + 
Sbjct  2359  DKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLS  2418

Query  561   ESAKGGHTAVVQMLLDY  577
              +A GG+  ++++LL +
Sbjct  2419  LAASGGYVNIIKLLLSH  2435


 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 68/197 (35%), Positives = 103/197 (52%), Gaps = 36/197 (18%)

Query  384   INAQTDETQETALTLACCGGFPEVAEFLVKAGADIELGASTPLMESAQEGHLELVRFLLE  443
             I+++T+   +TALTLAC GG                              H ELV  L+ 
Sbjct  2305  IDSETESNHDTALTLACAGG------------------------------HEELVELLIN  2334

Query  444   SEASVEAQTQTGDTALTYACENGHTDVAALLLEYGAELEHESEGGR-TPLMKACRAGHAC  502
               A++E + + G T L  A   GH  V  +LL++ AELE +SE  + TPL  AC  G   
Sbjct  2335  RGANIEHRDKKGFTPLILAATAGHDKVVDILLKHSAELEAQSERTKDTPLSLACSGGRYE  2394

Query  503   TVQFLLSKGASVNRSTTN-NDHTPLSLACAGGHLAVVEMLLASAADPYHKL--KDNSTMV  559
              V+ LLS GA  N+   N +D+TPLSLA +GG++ ++++LL+  A+   +   K   + +
Sbjct  2395  VVELLLSVGA--NKEHRNVSDYTPLSLAASGGYVNIIKLLLSHGAEINSRTGSKLGISPL  2452

Query  560   IESAKGGHTAVVQMLLD  576
             + +A  GHT  V++LLD
Sbjct  2453  MLAAMNGHTPAVKLLLD  2469


 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 50/132 (38%), Positives = 77/132 (58%), Gaps = 1/132 (1%)

Query  1340  DVDCETESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVE  1399
             +V  ET++  DTALT AC  GH +   +L+S G+++EH  + G TPL+    AGH   V+
Sbjct  907   NVHAETQTG-DTALTHACENGHTDAAGVLLSYGAELEHESEGGRTPLMKACRAGHLCTVK  965

Query  1400  ILLNHGSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASG  1459
              L+  G+ +  Q+     T LSLAC+GG   VVELLL   ++  H+   + T L  A+ G
Sbjct  966   FLIQKGANVNKQTTSNDHTALSLACAGGHQSVVELLLKNNADPFHKLKDNSTMLIEASKG  1025

Query  1460  GYVNIIKLLLSH  1471
             G+  +++LL  +
Sbjct  1026  GHTRVVELLFRY  1037


>G5ECZ1_CAEEL unnamed protein product
Length=1867

 Score = 209 bits (532),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 163/536 (30%), Positives = 260/536 (49%), Gaps = 71/536 (13%)

Query  109  QKLLDEGGNVQETTEEGESLLSLACSAGYYELAQVLLAMRANVEDRGVKGDCTPLMEAAS  168
            Q LL++G NV        S L +A   G   +A +LL+ R  + D   K   TPL  AA 
Sbjct  244  QLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS-RGAIIDSRTKDLLTPLHCAAR  302

Query  169  AGHADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLESGAHVEDHNENGHTP  228
            +GH  +V LL+  GA +++++ +G  PL  A  G H D  R LL   A V+D   +  TP
Sbjct  303  SGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP  362

Query  229  LMEAASAGHVGVARTLLERGAGINTHS-------------NEFK----------------  259
            L  AA  GHV VA+ LL+R A  N+ +             N  K                
Sbjct  363  LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT  422

Query  260  ESALT---LACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEASMDGHVDVARLLLNSGA  316
            ES LT   +A + G + +V +LL+ GA+ + +T    T L  A+     DV R+L+ +GA
Sbjct  423  ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGA  482

Query  317  QVNMPADSFESPLTLAACGGHVELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVAL  376
            +V+  A   ++PL +A+  G+ ++ +LL++ GAN      + Y+PL  AA+EG EE+  +
Sbjct  483  KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGI  542

Query  377  LLSQGALINAQTDETQETALTLACCGGFPEVAEFLVKAGADIEL----------------  420
            LL   A     T +   T L LA   G  EV   L++ G  +++                
Sbjct  543  LLDHNADKTLLTKKGF-TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYN  601

Query  421  -----------GAS---------TPLMESAQEGHLELVRFLLESEASVEAQTQTGDTALT  460
                       GAS         TPL  +A++  +E+   LL+ +A   A+++ G T L 
Sbjct  602  NDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLH  661

Query  461  YACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKGASVNRSTTN  520
             + + GH +++ LL+E G+++  ++  G T +    +  H    Q L + GA +N S TN
Sbjct  662  LSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN-SKTN  720

Query  521  NDHTPLSLACAGGHLAVVEMLLASAADPYHKLKDNSTMVIESAKGGHTAVVQMLLD  576
              +TPL +AC  G L +V+ L+ + AD   K + + T + ++A+ GH   V+ LL+
Sbjct  721  AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 209 bits (531),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 164/484 (34%), Positives = 245/484 (51%), Gaps = 11/484 (2%)

Query  95   SLAEACSDGDVGAVQKLLDEGGNVQETTEEGESLLSLACSAGYYELAQVLLAMRANVEDR  154
            S   A   GD+  V +LL  G ++  +   G + L LA   G+ E+ + L+  +A V+  
Sbjct  36   SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAA  95

Query  155  GVKGDCTPLMEAASAGHADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLES  214
              KG+ T L  A+ AG + IV +L+ +GA+VN QS +G TPL  A    HE+VV+ LL+ 
Sbjct  96   TRKGN-TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH  154

Query  215  GAHVEDHNENGHTPLMEAASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEM  274
            GA+     E+G TPL  A   GH  V   LLE     N    + +  AL +A  K     
Sbjct  155  GANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTA  209

Query  275  VRFLLEAGADQEHKTDEMHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAAC  334
               LL+   + +  +    T L  A+  GH +V +LLL  GA VN  A    SPL +A  
Sbjct  210  ATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATK  269

Query  335  GGHVELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQET  394
             G   +A LL+ RGA I+    +  TPL  AAR GH+++V LL+ QGA I+A+T +    
Sbjct  270  WGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLA  328

Query  395  ALTLACCGGFPEVAEFLVKAGA---DIELGASTPLMESAQEGHLELVRFLLESEASVEAQ  451
             L +A  G   + A  L+   A   D+ +   TPL  +A  GH+ + + LL+  A   ++
Sbjct  329  PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR  388

Query  452  TQTGDTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKG  511
               G T L  AC+     V  LLL+Y A +E  +E G TPL  A   G    V +LL +G
Sbjct  389  ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQG  448

Query  512  ASVNRSTTNNDHTPLSLACAGGHLAVVEMLLASAADPYHKLKDNSTMVIESAKGGHTAVV  571
            A+ +  T   + TPL LA       VV +L+ + A    + ++  T +  +++ G+T +V
Sbjct  449  ANPDVETVRGE-TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV  507

Query  572  QMLL  575
             +LL
Sbjct  508  ILLL  511


 Score = 179 bits (455),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 139/412 (34%), Positives = 211/412 (51%), Gaps = 6/412 (1%)

Query  99   ACSDGDVGAVQKLLDEGGNVQETTEEGESLLSLACSAGYYELAQVLLAMRANVEDRGVKG  158
            AC    +  V+ LL     ++ TTE G + L +A   G   +   LL   AN +   V+G
Sbjct  399  ACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG  458

Query  159  DCTPLMEAASAGHADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLESGAHV  218
            + TPL  AA A   D+VR+LI +GA V++Q+    TPL  A   G+ D+V +LL++GA+ 
Sbjct  459  E-TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS  517

Query  219  EDHNENGHTPLMEAASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEMVRFL  278
                 + ++PL  AA  G   VA  LL+  A   T   +   + L LA   G+LE+VR L
Sbjct  518  NATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLL  576

Query  279  LEAGADQEHKTDEMHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAACGGHV  338
            LE G   + +     T L  A+   +  VA LLL +GA     A +  +PL +AA    +
Sbjct  577  LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQM  636

Query  339  ELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQETALTL  398
            E+A  L++  A+    +  G+TPL  +A+EGH+E+  LL+  G+ + A+ +    TA+ L
Sbjct  637  EIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGL-TAMHL  695

Query  399  ACCGGFPEVAEFLVKAGADIELGAS---TPLMESAQEGHLELVRFLLESEASVEAQTQTG  455
                    VA+ L   GA+I    +   TPL  +   G L +V+FL+E+ A V  +T+  
Sbjct  696  CAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS  755

Query  456  DTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFL  507
             T L  A + GH +    LLE GA    ++  G+TPL  A R G+   V+ L
Sbjct  756  YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL  807


 Score = 142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 200/419 (48%), Gaps = 60/419 (14%)

Query  225  GHTPLMEAASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGAD  284
            G    + AA AG +     LL  G  INT SN    ++L LA  +GH E+VR L++  A 
Sbjct  33   GSASFLRAARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQ  91

Query  285  QEHKTDEMHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAACGGHVELAMLL  344
             +  T + +TAL  AS+ G   +  +L+ +GA VN+ + +  +PL +AA   H E+   L
Sbjct  92   VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL  151

Query  345  IERGANIEEVNDEGYTPLMEAAREGHEEMVALLL---SQGAL------INAQTDETQETA  395
            ++ GAN     ++G+TPL  A ++GH+ +VA+LL   S+G +      I A+ D+T    
Sbjct  152  LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAAT  211

Query  396  LTLACCGGFPEVAEFLVKAGADIELGASTPLMESAQEGHLELVRFLLESEASVEAQTQTG  455
            L L      P+V     K+G        TPL  +A  GH  + + LLE  A+V  Q +  
Sbjct  212  LLLQNEHN-PDVTS---KSGF-------TPLHIAAHYGHENVGQLLLEKGANVNYQARHN  260

Query  456  DTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKGASVN  515
             + L  A + G T++A LLL  GA ++  ++   TPL  A R+GH   V  L+ +GA ++
Sbjct  261  ISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPIS  320

Query  516  RSTTN----------NDH----------------------TPLSLACAGGHLAVVEMLLA  543
              T N           DH                      TPL +A   GH+ V ++LL 
Sbjct  321  AKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD  380

Query  544  SAADPYHKLKDNSTMVIESAKGGHTAVVQMLLDYPHSI-------VMSAHGAAAAAALN  595
             +ADP  +  +  T +  + K     VV++LL Y  +I       +   H AA   A+N
Sbjct  381  RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAIN  439


 Score = 119 bits (297),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 131/250 (52%), Gaps = 21/250 (8%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L +A   GH  + +LL+ R +D   R   GFTPL +       KVVE+LL + + IEA
Sbjct  361   TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEA  420

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
              +E +  TPL +A   G   +V  LL +G+N +   V   TPL LAA     +++++L+ 
Sbjct  421   TTE-SGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIR  479

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSS  1530
             +GA+++++   REL             TPL  A+  G  D+  +LL   A+ NA    ++
Sbjct  480   NGAKVDAQ--AREL------------QTPLHIASRLGNTDIVILLLQAGANSNA----TT  521

Query  1531  RD--TALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGA  1588
             RD  + L IAA +G      +L+  NA   +  KKG TPL LA   G+LEV +LL  +G 
Sbjct  522   RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT  581

Query  1589  NIDSQDNRKV  1598
              +D +   +V
Sbjct  582   PVDIEGKNQV  591


 Score = 101 bits (252),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 91/298 (31%), Positives = 140/298 (47%), Gaps = 41/298 (14%)

Query  1353  LTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEAQS  1412
             L  A AG  ++++ELL + G+DI   +  G   L L +  GH +VV  L+   ++++A +
Sbjct  38    LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAAT  96

Query  1413  ERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLSHG  1472
              R  +T L +A   G+  +V +L+  G+N   ++V+ +TPL +AA   +  ++K LL HG
Sbjct  97    -RKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHG  155

Query  1473  AEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSSRD  1532
             A     T              + G TPL  A   G+  V  VLL+ ++          R 
Sbjct  156   ANQALST--------------EDGFTPLAVALQQGHDRVVAVLLENDSKGKV------RL  195

Query  1533  TALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGANIDS  1592
              AL IAA K       LL+    + +V +K G TPL +A + GH  V QLL  +GAN++ 
Sbjct  196   PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  1593  QDNRKV--------------ANTLYII-QCISSQTSCLM----AAFRKGHVRVVKWMV  1631
             Q    +              AN L      I S+T  L+     A R GH +VV  +V
Sbjct  256   QARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV  313


 Score = 101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 173/412 (42%), Gaps = 65/412 (16%)

Query  1320  QQQQQQQQQ-QQPQPA-------------------AVPML----DVDCETESNHDTALTL  1355
             Q + Q+ Q    P+P                     + +L    D++  + +N   +L L
Sbjct  14    QPESQEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINT-SNANGLNSLHL  72

Query  1356  ACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEAQSERT  1415
             A   GH E+V  LI R + ++   +KG T L + + AG   +V IL+ +G+ +  QS   
Sbjct  73    ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQS-VN  131

Query  1416  KDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS-----  1470
               TPL +A      EVV+ LL  G+N+       +TPL++A   G+  ++ +LL      
Sbjct  132   GFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKG  191

Query  1471  -------HGAEINSRTAGRELIMLICH---FILKTGLTPLMEAASGGYVDVGKVLLDKNA  1520
                    H A     T    L++   H      K+G TPL  AA  G+ +VG++LL+K A
Sbjct  192   KVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGA  251

Query  1521  DVNAAPVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVA  1580
             +VN         + L +A   G      LL+SR A I+ R K   TPL  A   GH +V 
Sbjct  252   NVNYQ--ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVV  309

Query  1581  QLLFSQGANIDSQ--------------DNRKVANTLY-----IIQCISSQTSCLMAAFRK  1621
              LL  QGA I ++              D+   A TL      +        + L  A   
Sbjct  310   DLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC  369

Query  1622  GHVRVVKWMVKHVTQFPNDYEMKRY--MSTVSDKELLKKCEQCFEVIAAAKA  1671
             GHVRV K ++      PN   +  +  +     K  +K  E   +  AA +A
Sbjct  370   GHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEA  420


 Score = 101 bits (251),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 124/246 (50%), Gaps = 17/246 (7%)

Query  1345  TESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNH  1404
             T  ++ + L +A   G +E+  +L+   +D     KKGFTPL L +  G+ +VV +LL  
Sbjct  520   TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579

Query  1405  GSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNI  1464
             G+ ++ +  + + TPL +A      +V  LLL  G++ +    + YTPL +AA    + I
Sbjct  580   GTPVDIEG-KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEI  638

Query  1465  IKLLLSHGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNA  1524
                LL   A+ N+++              + G TPL  +A  G+ ++  +L++  +DV A
Sbjct  639   ASTLLQFKADPNAKS--------------RAGFTPLHLSAQEGHKEISGLLIENGSDVGA  684

Query  1525  APVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLF  1584
                 ++  TA+ + A + H    ++L +  A I  +   G TPL +AC+ G L + + L 
Sbjct  685   K--ANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV  742

Query  1585  SQGANI  1590
               GA++
Sbjct  743   ENGADV  748


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 136/285 (48%), Gaps = 35/285 (12%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L +A   G+ ++V LL+  G++     +  ++PL + A  G E+V  ILL+H ++   
Sbjct  493   TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL  552

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
              +++   TPL LA   G  EVV LLL RG+  +    +  TPL +AA      +  LLL 
Sbjct  553   LTKKGF-TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE  611

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSS  1530
             +GA  +++ A             K G TPL  AA    +++   LL   AD NA     S
Sbjct  612   NGA--SAKAAA------------KNGYTPLHIAAKKNQMEIASTLLQFKADPNA----KS  653

Query  1531  RD--TALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGA  1588
             R   T L ++A +GH     LL+   + +  +   G T + L     H+ VAQ+L++ GA
Sbjct  654   RAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA  713

Query  1589  NIDSQDNRKVANTLYIIQCISSQTSCLMAAFRKGHVRVVKWMVKH  1633
              I+S+ N              +  + L  A   G + +VK++V++
Sbjct  714   EINSKTN--------------AGYTPLHVACHFGQLNMVKFLVEN  744


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 85/165 (52%), Gaps = 15/165 (9%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L L+   GH E+  LLI  GSD+  +   G T + L A   H  V +IL N+G+EI +
Sbjct  658   TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINS  717

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
             ++     TPL +AC  G+  +V+ L+  G++   +  + YTPL  AA  G+ N ++ LL 
Sbjct  718   KTN-AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVL  1515
             +GA  N +TA              TG TPL  A   GYV V + L
Sbjct  777   NGASPNEQTA--------------TGQTPLSIAQRLGYVSVVETL  807


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 117/243 (48%), Gaps = 17/243 (7%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L LA   G+ E+V LL+ RG+ ++   K   TPL + A   ++KV  +LL +G+  +A
Sbjct  559   TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA  618

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
              + +   TPL +A    + E+   LL   ++   ++ + +TPL L+A  G+  I  LL+ 
Sbjct  619   AA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE  677

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSS  1530
             +G+++ ++                 GLT +   A   +V V ++L +  A++N+    ++
Sbjct  678   NGSDVGAKA--------------NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKT--NA  721

Query  1531  RDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGANI  1590
               T L +A   G    V+ LV   A +  + +   TPL  A   GH    + L   GA+ 
Sbjct  722   GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASP  781

Query  1591  DSQ  1593
             + Q
Sbjct  782   NEQ  784


>Q8MQG0_CAEEL unnamed protein product
Length=1841

 Score = 209 bits (531),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 263/538 (49%), Gaps = 75/538 (14%)

Query  109  QKLLDEGGNVQETTEEGESLLSLACSAGYYELAQVLLAMRANVEDRGVKGDCTPLMEAAS  168
            Q LL++G NV        S L +A   G   +A +LL+ R  + D   K   TPL  AA 
Sbjct  244  QLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLS-RGAIIDSRTKDLLTPLHCAAR  302

Query  169  AGHADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLESGAHVEDHNENGHTP  228
            +GH  +V LL+  GA +++++ +G  PL  A  G H D  R LL   A V+D   +  TP
Sbjct  303  SGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTP  362

Query  229  LMEAASAGHVGVARTLLERGAGINTHS-------------NEFK----------------  259
            L  AA  GHV VA+ LL+R A  N+ +             N  K                
Sbjct  363  LHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATT  422

Query  260  ESALT---LACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEASMDGHVDVARLLLNSGA  316
            ES LT   +A + G + +V +LL+ GA+ + +T    T L  A+     DV R+L+ +GA
Sbjct  423  ESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGA  482

Query  317  QVNMPADSFESPLTLAACGGHVELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVAL  376
            +V+  A   ++PL +A+  G+ ++ +LL++ GAN      + Y+PL  AA+EG EE+  +
Sbjct  483  KVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGI  542

Query  377  LLSQGALINAQTDETQE--TALTLACCGGFPEVAEFLVKAGADIEL--------------  420
            LL   A    +T  T++  T L LA   G  EV   L++ G  +++              
Sbjct  543  LLDHNA---DKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAH  599

Query  421  -------------GAS---------TPLMESAQEGHLELVRFLLESEASVEAQTQTGDTA  458
                         GAS         TPL  +A++  +E+   LL+ +A   A+++ G T 
Sbjct  600  YNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTP  659

Query  459  LTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKGASVNRST  518
            L  + + GH +++ LL+E G+++  ++  G T +    +  H    Q L + GA +N S 
Sbjct  660  LHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEIN-SK  718

Query  519  TNNDHTPLSLACAGGHLAVVEMLLASAADPYHKLKDNSTMVIESAKGGHTAVVQMLLD  576
            TN  +TPL +AC  G L +V+ L+ + AD   K + + T + ++A+ GH   V+ LL+
Sbjct  719  TNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776


 Score = 209 bits (531),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 164/484 (34%), Positives = 245/484 (51%), Gaps = 11/484 (2%)

Query  95   SLAEACSDGDVGAVQKLLDEGGNVQETTEEGESLLSLACSAGYYELAQVLLAMRANVEDR  154
            S   A   GD+  V +LL  G ++  +   G + L LA   G+ E+ + L+  +A V+  
Sbjct  36   SFLRAARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAA  95

Query  155  GVKGDCTPLMEAASAGHADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLES  214
              KG+ T L  A+ AG + IV +L+ +GA+VN QS +G TPL  A    HE+VV+ LL+ 
Sbjct  96   TRKGN-TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKH  154

Query  215  GAHVEDHNENGHTPLMEAASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEM  274
            GA+     E+G TPL  A   GH  V   LLE     N    + +  AL +A  K     
Sbjct  155  GANQALSTEDGFTPLAVALQQGHDRVVAVLLE-----NDSKGKVRLPALHIAAKKDDTTA  209

Query  275  VRFLLEAGADQEHKTDEMHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAAC  334
               LL+   + +  +    T L  A+  GH +V +LLL  GA VN  A    SPL +A  
Sbjct  210  ATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATK  269

Query  335  GGHVELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQET  394
             G   +A LL+ RGA I+    +  TPL  AAR GH+++V LL+ QGA I+A+T +    
Sbjct  270  WGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKT-KNGLA  328

Query  395  ALTLACCGGFPEVAEFLVKAGA---DIELGASTPLMESAQEGHLELVRFLLESEASVEAQ  451
             L +A  G   + A  L+   A   D+ +   TPL  +A  GH+ + + LL+  A   ++
Sbjct  329  PLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSR  388

Query  452  TQTGDTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKG  511
               G T L  AC+     V  LLL+Y A +E  +E G TPL  A   G    V +LL +G
Sbjct  389  ALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQG  448

Query  512  ASVNRSTTNNDHTPLSLACAGGHLAVVEMLLASAADPYHKLKDNSTMVIESAKGGHTAVV  571
            A+ +  T   + TPL LA       VV +L+ + A    + ++  T +  +++ G+T +V
Sbjct  449  ANPDVETVRGE-TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV  507

Query  572  QMLL  575
             +LL
Sbjct  508  ILLL  511


 Score = 179 bits (455),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 139/412 (34%), Positives = 211/412 (51%), Gaps = 6/412 (1%)

Query  99   ACSDGDVGAVQKLLDEGGNVQETTEEGESLLSLACSAGYYELAQVLLAMRANVEDRGVKG  158
            AC    +  V+ LL     ++ TTE G + L +A   G   +   LL   AN +   V+G
Sbjct  399  ACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRG  458

Query  159  DCTPLMEAASAGHADIVRLLIAHGADVNSQSSSGNTPLMYACAGGHEDVVRVLLESGAHV  218
            + TPL  AA A   D+VR+LI +GA V++Q+    TPL  A   G+ D+V +LL++GA+ 
Sbjct  459  E-TPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANS  517

Query  219  EDHNENGHTPLMEAASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEMVRFL  278
                 + ++PL  AA  G   VA  LL+  A   T   +   + L LA   G+LE+VR L
Sbjct  518  NATTRDNYSPLHIAAKEGQEEVAGILLDHNAD-KTLLTKKGFTPLHLASKYGNLEVVRLL  576

Query  279  LEAGADQEHKTDEMHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAACGGHV  338
            LE G   + +     T L  A+   +  VA LLL +GA     A +  +PL +AA    +
Sbjct  577  LERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQM  636

Query  339  ELAMLLIERGANIEEVNDEGYTPLMEAAREGHEEMVALLLSQGALINAQTDETQETALTL  398
            E+A  L++  A+    +  G+TPL  +A+EGH+E+  LL+  G+ + A+ +    TA+ L
Sbjct  637  EIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGL-TAMHL  695

Query  399  ACCGGFPEVAEFLVKAGADIELGAS---TPLMESAQEGHLELVRFLLESEASVEAQTQTG  455
                    VA+ L   GA+I    +   TPL  +   G L +V+FL+E+ A V  +T+  
Sbjct  696  CAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRAS  755

Query  456  DTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFL  507
             T L  A + GH +    LLE GA    ++  G+TPL  A R G+   V+ L
Sbjct  756  YTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIAQRLGYVSVVETL  807


 Score = 142 bits (358),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 130/419 (31%), Positives = 200/419 (48%), Gaps = 60/419 (14%)

Query  225  GHTPLMEAASAGHVGVARTLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGAD  284
            G    + AA AG +     LL  G  INT SN    ++L LA  +GH E+VR L++  A 
Sbjct  33   GSASFLRAARAGDLEKVLELLRAGTDINT-SNANGLNSLHLASKEGHSEVVRELIKRQAQ  91

Query  285  QEHKTDEMHTALMEASMDGHVDVARLLLNSGAQVNMPADSFESPLTLAACGGHVELAMLL  344
             +  T + +TAL  AS+ G   +  +L+ +GA VN+ + +  +PL +AA   H E+   L
Sbjct  92   VDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYL  151

Query  345  IERGANIEEVNDEGYTPLMEAAREGHEEMVALLL---SQGAL------INAQTDETQETA  395
            ++ GAN     ++G+TPL  A ++GH+ +VA+LL   S+G +      I A+ D+T    
Sbjct  152  LKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKGKVRLPALHIAAKKDDTTAAT  211

Query  396  LTLACCGGFPEVAEFLVKAGADIELGASTPLMESAQEGHLELVRFLLESEASVEAQTQTG  455
            L L      P+V     K+G        TPL  +A  GH  + + LLE  A+V  Q +  
Sbjct  212  LLLQNEHN-PDVTS---KSGF-------TPLHIAAHYGHENVGQLLLEKGANVNYQARHN  260

Query  456  DTALTYACENGHTDVAALLLEYGAELEHESEGGRTPLMKACRAGHACTVQFLLSKGASVN  515
             + L  A + G T++A LLL  GA ++  ++   TPL  A R+GH   V  L+ +GA ++
Sbjct  261  ISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPIS  320

Query  516  RSTTN----------NDH----------------------TPLSLACAGGHLAVVEMLLA  543
              T N           DH                      TPL +A   GH+ V ++LL 
Sbjct  321  AKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLD  380

Query  544  SAADPYHKLKDNSTMVIESAKGGHTAVVQMLLDYPHSI-------VMSAHGAAAAAALN  595
             +ADP  +  +  T +  + K     VV++LL Y  +I       +   H AA   A+N
Sbjct  381  RSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAIN  439


 Score = 118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 131/250 (52%), Gaps = 21/250 (8%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L +A   GH  + +LL+ R +D   R   GFTPL +       KVVE+LL + + IEA
Sbjct  361   TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEA  420

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
              +E +  TPL +A   G   +V  LL +G+N +   V   TPL LAA     +++++L+ 
Sbjct  421   TTE-SGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIR  479

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSS  1530
             +GA+++++   REL             TPL  A+  G  D+  +LL   A+ NA    ++
Sbjct  480   NGAKVDAQ--AREL------------QTPLHIASRLGNTDIVILLLQAGANSNA----TT  521

Query  1531  RD--TALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGA  1588
             RD  + L IAA +G      +L+  NA   +  KKG TPL LA   G+LEV +LL  +G 
Sbjct  522   RDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGT  581

Query  1589  NIDSQDNRKV  1598
              +D +   +V
Sbjct  582   PVDIEGKNQV  591


 Score = 101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 91/298 (31%), Positives = 140/298 (47%), Gaps = 41/298 (14%)

Query  1353  LTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEAQS  1412
             L  A AG  ++++ELL + G+DI   +  G   L L +  GH +VV  L+   ++++A +
Sbjct  38    LRAARAGDLEKVLELLRA-GTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAAT  96

Query  1413  ERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLSHG  1472
              R  +T L +A   G+  +V +L+  G+N   ++V+ +TPL +AA   +  ++K LL HG
Sbjct  97    -RKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHG  155

Query  1473  AEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSSRD  1532
             A     T              + G TPL  A   G+  V  VLL+ ++          R 
Sbjct  156   ANQALST--------------EDGFTPLAVALQQGHDRVVAVLLENDSKGKV------RL  195

Query  1533  TALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGANIDS  1592
              AL IAA K       LL+    + +V +K G TPL +A + GH  V QLL  +GAN++ 
Sbjct  196   PALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANVNY  255

Query  1593  QDNRKV--------------ANTLYII-QCISSQTSCLM----AAFRKGHVRVVKWMV  1631
             Q    +              AN L      I S+T  L+     A R GH +VV  +V
Sbjct  256   QARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVVDLLV  313


 Score = 101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 130/482 (27%), Positives = 197/482 (41%), Gaps = 79/482 (16%)

Query  1320  QQQQQQQQQ-QQPQPA-------------------AVPML----DVDCETESNHDTALTL  1355
             Q + Q+ Q    P+P                     + +L    D++  + +N   +L L
Sbjct  14    QPESQEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDINT-SNANGLNSLHL  72

Query  1356  ACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEAQSERT  1415
             A   GH E+V  LI R + ++   +KG T L + + AG   +V IL+ +G+ +  QS   
Sbjct  73    ASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQS-VN  131

Query  1416  KDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS-----  1470
               TPL +A      EVV+ LL  G+N+       +TPL++A   G+  ++ +LL      
Sbjct  132   GFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLENDSKG  191

Query  1471  -------HGAEINSRTAGRELIMLICH---FILKTGLTPLMEAASGGYVDVGKVLLDKNA  1520
                    H A     T    L++   H      K+G TPL  AA  G+ +VG++LL+K A
Sbjct  192   KVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGA  251

Query  1521  DVNAAPVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVA  1580
             +VN         + L +A   G      LL+SR A I+ R K   TPL  A   GH +V 
Sbjct  252   NVNYQ--ARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCAARSGHDQVV  309

Query  1581  QLLFSQGANIDSQ--------------DNRKVANTLY-----IIQCISSQTSCLMAAFRK  1621
              LL  QGA I ++              D+   A TL      +        + L  A   
Sbjct  310   DLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHC  369

Query  1622  GHVRVVKWMVKHVTQFPNDYEMKRY--MSTVSDKELLKKCEQCFEVIAAAKAKQAA----  1675
             GHVRV K ++      PN   +  +  +     K  +K  E   +  AA +A   +    
Sbjct  370   GHVRVAKLLLDRSAD-PNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTP  428

Query  1676  -------EANKIATILLEE---IDMEKSREESKRLAAARRRERKRKRRLEKKEEKRKAQE  1725
                     A  I   LL++    D+E  R E+    AAR  +    R L +   K  AQ 
Sbjct  429   LHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQA  488

Query  1726  ME  1727
              E
Sbjct  489   RE  490


 Score = 101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 124/246 (50%), Gaps = 17/246 (7%)

Query  1345  TESNHDTALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNH  1404
             T  ++ + L +A   G +E+  +L+   +D     KKGFTPL L +  G+ +VV +LL  
Sbjct  520   TTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLER  579

Query  1405  GSEIEAQSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNI  1464
             G+ ++ +  + + TPL +A      +V  LLL  G++ +    + YTPL +AA    + I
Sbjct  580   GTPVDIEG-KNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEI  638

Query  1465  IKLLLSHGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNA  1524
                LL   A+ N+++              + G TPL  +A  G+ ++  +L++  +DV A
Sbjct  639   ASTLLQFKADPNAKS--------------RAGFTPLHLSAQEGHKEISGLLIENGSDVGA  684

Query  1525  APVPSSRDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLF  1584
                 ++  TA+ + A + H    ++L +  A I  +   G TPL +AC+ G L + + L 
Sbjct  685   K--ANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLV  742

Query  1585  SQGANI  1590
               GA++
Sbjct  743   ENGADV  748


 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 84/285 (29%), Positives = 136/285 (48%), Gaps = 35/285 (12%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L +A   G+ ++V LL+  G++     +  ++PL + A  G E+V  ILL+H ++   
Sbjct  493   TPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTL  552

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
              +++   TPL LA   G  EVV LLL RG+  +    +  TPL +AA      +  LLL 
Sbjct  553   LTKKGF-TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLE  611

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSS  1530
             +GA  +++ A             K G TPL  AA    +++   LL   AD NA     S
Sbjct  612   NGA--SAKAAA------------KNGYTPLHIAAKKNQMEIASTLLQFKADPNA----KS  653

Query  1531  RD--TALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGA  1588
             R   T L ++A +GH     LL+   + +  +   G T + L     H+ VAQ+L++ GA
Sbjct  654   RAGFTPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGA  713

Query  1589  NIDSQDNRKVANTLYIIQCISSQTSCLMAAFRKGHVRVVKWMVKH  1633
              I+S+ N              +  + L  A   G + +VK++V++
Sbjct  714   EINSKTN--------------AGYTPLHVACHFGQLNMVKFLVEN  744


 Score = 88.2 bits (217),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 85/165 (52%), Gaps = 15/165 (9%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L L+   GH E+  LLI  GSD+  +   G T + L A   H  V +IL N+G+EI +
Sbjct  658   TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINS  717

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
             ++     TPL +AC  G+  +V+ L+  G++   +  + YTPL  AA  G+ N ++ LL 
Sbjct  718   KTN-AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLE  776

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVL  1515
             +GA  N +TA              TG TPL  A   GYV V + L
Sbjct  777   NGASPNEQTA--------------TGQTPLSIAQRLGYVSVVETL  807


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/243 (27%), Positives = 117/243 (48%), Gaps = 17/243 (7%)

Query  1351  TALTLACAGGHDELVELLISRGSDIEHRDKKGFTPLILGATAGHEKVVEILLNHGSEIEA  1410
             T L LA   G+ E+V LL+ RG+ ++   K   TPL + A   ++KV  +LL +G+  +A
Sbjct  559   TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA  618

Query  1411  QSERTKDTPLSLACSGGRYEVVELLLNRGSNKEHRNVSDYTPLSLAASGGYVNIIKLLLS  1470
              + +   TPL +A    + E+   LL   ++   ++ + +TPL L+A  G+  I  LL+ 
Sbjct  619   AA-KNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIE  677

Query  1471  HGAEINSRTAGRELIMLICHFILKTGLTPLMEAASGGYVDVGKVLLDKNADVNAAPVPSS  1530
             +G+++ ++                 GLT +   A   +V V ++L +  A++N+    ++
Sbjct  678   NGSDVGAKA--------------NNGLTAMHLCAQEDHVPVAQILYNNGAEINSKT--NA  721

Query  1531  RDTALTIAADKGHYRFVELLVSRNAHIEVRNKKGNTPLWLACNGGHLEVAQLLFSQGANI  1590
               T L +A   G    V+ LV   A +  + +   TPL  A   GH    + L   GA+ 
Sbjct  722   GYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASP  781

Query  1591  DSQ  1593
             + Q
Sbjct  782   NEQ  784



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000068-PA

Length=1427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JUY3_DROME  unnamed protein product                                 1569    0.0  
RPC1_TRYBB  unnamed protein product                                   942     0.0  
RPB1_DICDI  unnamed protein product                                   604     0.0  


>A8JUY3_DROME unnamed protein product
Length=1383

 Score = 1569 bits (4063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/1399 (57%), Positives = 993/1399 (71%), Gaps = 77/1399 (6%)

Query  58    MVKEQFRETDVLRKISHVQFGVQNAQQMQQQAHLHVVAKNLYNQDAQRTPVPFGILDRRM  117
             M KEQFR + + +KISHVQFG+  A ++QQ+A + +++KNLY   AQR PVP+G+LDRRM
Sbjct  1     MPKEQFRASALNKKISHVQFGISGADEIQQEALVRIISKNLYQ--AQRQPVPYGVLDRRM  58

Query  118   GLCQKEDKCATCGLQLFDCVGHYGYIDLELPVFHVGYFGAVINILQSVCKTCSNMLLPPD  177
             G+  K+  C TCG  L +C+GH+GY+DL LPVFH+G+F + INILQ +CK C++++L P+
Sbjct  59    GISTKDAMCETCGQGLNECIGHFGYLDLALPVFHIGHFRSTINILQMICKVCAHVMLKPE  118

Query  178   EKFQYRSKVQNPNLPYLIKKALRKKILDRCKKITRCSSCGDRNGVVKKA-GLLKISHEKF  236
             ++  Y  K+ NPN  YL KKAL  ++L + KK+T+C  CG  NG VKK  GLLKI H+ +
Sbjct  119   DRQLYEKKLHNPNFSYLGKKALHVQMLAKAKKVTKCPHCGSPNGGVKKGPGLLKILHDPY  178

Query  237   RNARKHDMALLEQLAEYDDAIEANKEIDTLLGN-TLVHLMNPQEVLNILERIPEEDIPFL  295
             +  RK D      + E   + + N+++++ LGN +    + P  VL++ E+IP+ D+  L
Sbjct  179   K-GRKMDSLFTSNMNEMLRSTQTNRDLNSTLGNYSTAEELTPLMVLDLFEQIPQRDVALL  237

Query  296   LMNPDYGKPKDLILTRIPVPPICIRPSVISDLKSGTNEDDLTMKLTEIVFLNDVIVKHRQ  355
              M      PK LI+TR+ VPP CIRPSV+S++K+GT EDDLTMK +EI+ +NDVI +H  
Sbjct  238   GMCSHDAHPKHLIVTRVFVPPACIRPSVLSEVKAGTTEDDLTMKQSEILLINDVIQRHMA  297

Query  356   SGAKVQMINEDWDFLQLQCALYINSETSGIPPNMQPKKASRGFVQRLKGKQGRFRGNLSG  415
             +G K+++I+EDWDFLQL  ALY +SE SGIP NM PKK +RG VQRLKGKQGRFR NLSG
Sbjct  298   TGGKIELIHEDWDFLQLHVALYFHSEISGIPINMAPKKTTRGIVQRLKGKQGRFRCNLSG  357

Query  416   KRVDFTSRTVISPDPNLRIDEVGVPKLVAKTLTYPARVNPSNIELMRKLVINGPDVHPGA  475
             KRVDF+ RTVISPDPNL I++VGVP  VAK LTYP RVNP+NI  MR+LV NGP +HPGA
Sbjct  358   KRVDFSGRTVISPDPNLMINQVGVPVRVAKILTYPERVNPANIRHMRELVRNGPSMHPGA  417

Query  476   NFVELRPTGPNQPAGVKKFLRYGNRNRIAQELKPGDIVERHLMDGDMVLFNRQPSLHKLS  535
             N+V+ R +        KK+L YGNR ++AQELK GD+VERHL DGD+VLFNRQPSLHK+S
Sbjct  418   NYVQQRGSS------FKKYLAYGNREKVAQELKCGDVVERHLRDGDIVLFNRQPSLHKMS  471

Query  536   IMCHRAKVLEHRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEAYVLMGNTSNLVTP  595
             IMCHRAKV   RTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEA +LMGN SNLVTP
Sbjct  472   IMCHRAKVQPQRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEALILMGNQSNLVTP  531

Query  596   RNGELLIAAIQDFITGSYLLTQKDTFFDKAKACQIASYLLAGDDLGMKIDFPPPAIMKPV  655
             +NGE+LIAA QDFITG YLLTQK+ F  K +A Q+A+  LA +D  M I  PPPA++KP 
Sbjct  532   KNGEILIAATQDFITGGYLLTQKEVFLTKEEAMQLAACFLANEDSTMHIKLPPPALLKPR  591

Query  656   ALWTGKQIFIVV----------------------------------IRNSELLAGTMDKA  681
              LWTGKQ+F ++                                  IRNSEL+ G MDKA
Sbjct  592   RLWTGKQMFSLLMRPNDDSQVRLNMVNKGRNYTRNKDLCSNDSWIHIRNSELMCGVMDKA  651

Query  682   TLGSGSKSSIFYILLRDWGKEEAARAMWRLGRVCSYFLMNRGFSIGIGDVTPGAGLLKAK  741
             T+GSG+K  IFY+LLRD+G+  A +AMWRL R+ SYFL NRGFS GI DVTP   LL+ K
Sbjct  652   TMGSGTKQCIFYLLLRDFGESHATKAMWRLARIASYFLQNRGFSFGISDVTPSKKLLQHK  711

Query  742   RNLLEDGYTNCDKYIRQLNEGKLQSQPGCSEEETLEAVILKELSVIRDHAGKACLQANFS  801
               LL +GY  C++YI  L  G LQ QPGC+ EETLE+V+L+ELS IR+ A K C      
Sbjct  712   ELLLNNGYAKCNEYIELLKAGTLQCQPGCTPEETLESVMLRELSAIREQAAKTCFA----  767

Query  802   LSRQELHKSNSPLIMAVCGSKGSFINISQMIACVGQQAISGKRVPNGFEDRALPHFERHS  861
                 ELH +NS LIMA+ GSKGS INISQMIACVGQQAISGKRVPNGFE+RALPHFERHS
Sbjct  768   ----ELHPTNSALIMALSGSKGSNINISQMIACVGQQAISGKRVPNGFENRALPHFERHS  823

Query  862   KIPAAKGFVENSFYSGLTPTEFFFHTMGGREGLVDTAVKTAETGYMQRRLMKVSEEGGEM  921
              IPAA+GFV+NSFYSGLTPTEFFFHTM GREGLVDTAVKTAETGY+QRRL+K        
Sbjct  824   AIPAARGFVQNSFYSGLTPTEFFFHTMAGREGLVDTAVKTAETGYLQRRLVKC-------  876

Query  922   GSTCKNLEDLFSHYDMTVRSSKGDIIQFCYGGDGLDPTYMEGKDRPVDFARVLDHVKAVY  981
                   LEDL  HYD TVR++  +++   YGGDGLDP  ME +++PVD     D+++A +
Sbjct  877   ------LEDLVVHYDGTVRNAVNEMVDTIYGGDGLDPVSMETRNKPVDLVHQYDNLRAQH  930

Query  982   PFPNEESLDAQSILKAAEELTNVEDAMGGCGKEFKDEVMKFVQGVAAKVQKVWDEHGLHQ  1041
             P   +  L+A+ + +A E L    +       +FK +V   +  V+ ++ +      L +
Sbjct  931   PQGKDRPLNAEEMSEALETLLRTPE-FAEARDDFKLDVRNHINTVSKRIGQ------LQK  983

Query  1042  KNEAGKITKVENYLQRITVSQLVEFFQTCREKYMHARIEPGTAVGALAGQSIGEPGTQMT  1101
             + E  K   + + ++ +T  QL++F +   ++Y  A  EPGTAVGA+A QSIGEPGTQMT
Sbjct  984   RYE--KCIDLCHQIECLTTEQLLQFVRRINDRYNRAVTEPGTAVGAIAAQSIGEPGTQMT  1041

Query  1102  LKTFHFAGVASMNITLGVPRIKEIINASRNISTPIISVQLANNRDQEFARRVKGRIEKTT  1161
             LKTFHFAGVASMNIT GVPRI EIINA++ ISTPII+ +L N    EFAR+VK RIEKTT
Sbjct  1042  LKTFHFAGVASMNITQGVPRIVEIINATKTISTPIITAELENCHSMEFARQVKARIEKTT  1101

Query  1162  LGEICEYLEEVYVQDDAFLLIKLDMDRIRLLKLEVDVDTIRYSILTSRLKVKPGDV-TCR  1220
             L E+  Y+E V      +L I +DM RI+LL L +D+DTI +SIL SR++VKP  V    
Sbjct  1102  LAELSSYVEVVCGPYSCYLAIGVDMARIKLLGLHIDLDTIVFSILKSRMRVKPTQVEVVA  1161

Query  1221  SETLITVRPSESKNAPNIYYALEHLKMQVPKVVVKGLPTVDRAVIHVDDTGPVLTFKLYV  1280
             S++ I VR  E+     I   L  L + +  VVV GLP ++RAVI VDD     T+KL +
Sbjct  1162  SQSRIVVR-VEATRTSTINAELARLALSLQNVVVAGLPNINRAVIAVDDARQPPTYKLCI  1220

Query  1281  EGDNLREVIATRGVNGTATTSNNTMEVFSTLGIEAARATIINEIQYTMESHGMSIDIRHL  1340
             EG  LR+VIAT GV G  T SNN  E++ TLGIEAAR  I++EI   ME HGMS+D RH+
Sbjct  1221  EGYGLRDVIATYGVVGKRTRSNNICEIYQTLGIEAARTIIMSEITEVMEGHGMSVDWRHI  1280

Query  1341  MLVADLMTCRGEVLGITRQGLAKMKESVLMLASFEKTSDHLFDAAYYGQKDVISGVSECI  1400
             ML+A  MT RGEVLGITR GLAKM+ESV  LASFEKT+DHLFDAAYYGQ D I+GVSE I
Sbjct  1281  MLLASQMTARGEVLGITRHGLAKMRESVFNLASFEKTADHLFDAAYYGQTDAINGVSERI  1340

Query  1401  IMGIPMMLGTGLFKLLHKY  1419
             I+G+P  +GTG+FKLL ++
Sbjct  1341  ILGMPACIGTGIFKLLQQH  1359


>RPC1_TRYBB unnamed protein product
Length=1530

 Score = 942 bits (2435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/1469 (39%), Positives = 811/1469 (55%), Gaps = 204/1469 (14%)

Query  110   FGILDRRMGLCQKEDKCATCGLQLFDCVGHYGYIDLELPVFHVGYFGAVINILQSVCKTC  169
             +G+ D R+G+C +   C TCGL   +CVGH G+IDLE PVFH+G+F  V+ I +++CK C
Sbjct  58    YGVNDARLGVCDRLSICETCGLNSIECVGHPGHIDLEAPVFHLGFFTTVLRICRTICKRC  117

Query  170   SNMLLPPDEKFQYRSKVQNPNLPYLIKKALRKKILDRCKKITRCSSCGDRNGVVKKAGLL  229
             S++LL   E   Y+ ++ + +L  L +  L K I     K   C  CG  NGVV++   +
Sbjct  118   SHVLLDDTEIDYYKRRLSSSSLEPLQRTMLIKTIQTDAYKTRVCLKCGGLNGVVRRVRPM  177

Query  230   KISHEKFRNARKHDMALLEQLAEYDDA-IEANKEIDTLLGNT--LVH-LMNPQEVLNILE  285
             ++ HEK+    +      E    + DA +      + ++G     VH  ++P  V  +  
Sbjct  178   RLVHEKYHVEPRRGEGPRENPGGFFDAELRTACAYNKVVGECREFVHDFLDPVRVRQLFL  237

Query  286   RIPEEDIPFLLMNPDYGKPKDLILTRIPVPPICIRPSVISDLKSGTNEDDLTMKLTEIVF  345
              +P  ++  L + P    P DL++T + VPP+ +RP   +   +   +DDLT +  +I+ 
Sbjct  238   AVPPGEVILLGLAPGV-SPTDLLMTTLLVPPVPVRPRGCAGTTT-VRDDDLTAQYNDILV  295

Query  346   LNDVIVKHRQSGA-KVQMINEDWDFLQLQCALYINSETSGIPPNMQPKKASRGFVQRLKG  404
               D +    Q G+       E W+ LQ++ A  ++S   G PPN++     + + QRLK 
Sbjct  296   STDTM----QDGSLDATRYTETWEMLQMRAARLLDSSLPGFPPNVRTSDL-KSYAQRLKS  350

Query  405   KQGRFRGNLSGKRVDFTSRTVISPDPNLRIDEVGVPKLVAKTLTYPARVNPSNIELMRKL  464
             K GRFR NLSGKRVD++ R+VISPDPNL +DE+ VP  VA+ LTYP RV  +N ELMR+L
Sbjct  351   KHGRFRCNLSGKRVDYSGRSVISPDPNLDVDELAVPLHVARVLTYPQRVFKANHELMRRL  410

Query  465   VINGPDVHPGANFVELRPTGPNQPAGVKKFLRYGNRNRIAQELKPGDIVERHLMDGDMVL  524
             V NGP VHPGA  V L   G       K      +R+R+A  L  GDIVERH+M+GD+VL
Sbjct  411   VRNGPHVHPGATTVYLAQEGSK-----KSLKNERDRHRLAARLAVGDIVERHVMNGDLVL  465

Query  525   FNRQPSLHKLSIMCHRAKVLEHRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEAYV  584
             FNRQPSLH++S+M HRA+VL  RTFRFNEC C PYNADFDGDEMN+H  QTE+ARAEA  
Sbjct  466   FNRQPSLHRVSMMAHRARVLPFRTFRFNECCCAPYNADFDGDEMNVHFVQTEKARAEALQ  525

Query  585   LMGNTSNLVTPRNGELLIAAIQDFITGSYLLTQKDTFFDKAKACQIASYLLAGDDLGMKI  644
             LM    N+++ +NGE +IA  QDF+  +YL+T +D FFD+ +  Q+ S+ L       + 
Sbjct  526   LMSTARNIISAKNGEPIIACTQDFLAAAYLVTSRDVFFDRGEFSQMVSHWLGP---VTQF  582

Query  645   DFPPPAIMKPVALWTGKQIFIVVIR-----------------------------------  669
               P PAI+KPV LWTGKQ+F +++R                                   
Sbjct  583   RLPIPAILKPVELWTGKQLFELIVRPSPEVDVLLSFEAPTKFYTRKGKHDCAEEGYVAFL  642

Query  670   NSELLAGTMDKATLGSGSKSSIFYILLRDWGKEEAARAMWRLGRVCSYFLMNRGFSIGIG  729
             +S  ++G +DK  LG G+K  +F  L    G    AR M R+ +  S +L N GFS+G+G
Sbjct  643   DSCFISGRLDKKLLGGGAKDGLFARLHTIAGGGYTARVMSRIAQFTSRYLTNYGFSLGLG  702

Query  730   DVTPGAGLLKAKRNLLEDGYTNCDKYIRQLNEGKLQSQPGCSEEETLEAVILKELSVIRD  789
             DV P   L K K  +L      CD  I+    G++   PG + +++LEA +  ELS +RD
Sbjct  703   DVAPTPELNKQKAAVLARSVEVCDGLIKSAKTGRMIPLPGLTVKQSLEARLNTELSKVRD  762

Query  790   HAGKACLQANFSLSRQELHKSNSPLIMAVCGSKGSFINISQMIACVGQQAISGKRVPNGF  849
               G A +Q   +LS   +H +N+PLIM   GSKGS +NI+QM+ACVGQQ +SGKR+ + F
Sbjct  763   ECGTAAVQ---TLS---IH-NNTPLIMVQSGSKGSALNIAQMMACVGQQTVSGKRILDAF  815

Query  850   EDRALPHFERHSKIPAAKGFVENSFYSGLTPTEFFFHTMGGREGLVDTAVKTAETGYMQR  909
             +DR+LPHF R  + PAA+GFV NSFYSGL+PTEFFFHTM GREGLVDTAVKTAETGY+ R
Sbjct  816   QDRSLPHFHRFEEAPAARGFVANSFYSGLSPTEFFFHTMAGREGLVDTAVKTAETGYIYR  875

Query  910   RLMKVSEEGGEMGSTCKNLEDLFSHYDMTVRSSKGDIIQFCYGGDGLDPTYMEGKD-RPV  968
             RLMK              +E+L   YD TVR++KGD+IQ  +G DGLDP  MEG    P+
Sbjct  876   RLMKA-------------MENLSVRYDGTVRNTKGDVIQLRFGEDGLDPQLMEGNSGTPL  922

Query  969   DFARVLDHVKAVY--------------------------------------PFPNEESLD  990
             +  +    V+A Y                                      P   E  L+
Sbjct  923   NLEQEWLSVRAAYARWVVGLLAGSKTASDGNAIRDNENYFNEFISMLPTEGPSFVEACLN  982

Query  991   A-QSILKAAEELTNVEDAMGG-----------------------------CGKEFKDEVM  1020
               Q  LK  EE  + EDA+                               C ++FKD++ 
Sbjct  983   GDQEALKVCEEQESREDALHNSNGKTNDRESRPRTGRLRRAVLISHLVKVCSRKFKDDIQ  1042

Query  1021  KFVQGVAAKVQKVWDEHGL----HQKNEAG---------KIT-------KVENYLQRITV  1060
              F      + Q++ +   L     ++ E G         K T       KV++  +   V
Sbjct  1043  DFFVKKVREQQRIRNLLNLPNTSRERTEGGGDNSGPIANKRTKKRAPSLKVKDSKEGGRV  1102

Query  1061  SQL--VEFFQT----------------CREKYMHARIEPGTAVGALAGQSIGEPGTQMTL  1102
             S+L  +E  QT                C  KY+    EPGT  GA+A QS+GEP TQMTL
Sbjct  1103  SELRDLEMLQTELLPLTRGMVTRFIAQCASKYLRKACEPGTPCGAIAAQSVGEPSTQMTL  1162

Query  1103  KTFHFAGVASMNITLGVPRIKEIINASRNISTPIISVQL-----ANNRDQEF---ARRVK  1154
             +TFHFAGVASM+IT GVPR+ E+INA+RNI+TP+++  +       N  + F   AR VK
Sbjct  1163  RTFHFAGVASMSITQGVPRLVEVINANRNIATPVVTAPVLLMEGEENHCEIFRKRARFVK  1222

Query  1155  GRIEKTTLGEICEYLEEVYVQDDAFLLIKLDMDRIRLLKLEVDVDTIRYSILT------S  1208
              +IE+  L E+   + EV    + +L + L+M  I  L L ++  T+R  IL       S
Sbjct  1223  AQIERVLLREVVSEIVEVCSDTEFYLRVHLNMSVITKLHLPINAITVRQRILAAAGHTMS  1282

Query  1209  RLKVKPGD-VTCRSETLITVRPSESKNAPNIYYALEHLKMQVPKVVVKGLPTVDRAVIHV  1267
              L++   D +   S   + V P   ++A  ++++L  +   +P VVV G+  ++RA+I  
Sbjct  1283  PLRMLNEDCIEVFSLDTLAVYP-HFQDARWVHFSLRRILGLLPDVVVGGIGGINRAMISS  1341

Query  1268  DDTGPVLTFKLYVEGDNLREVIATRGVNGTATTSNNTMEVFSTLGIEAARATIINEIQYT  1327
             + T      ++  EG  LR V+   GV+ T    N+   V   LGIEAAR  I++EIQ  
Sbjct  1342  NGT------EVLAEGAELRAVMNLWGVDSTRVVCNHVAVVERVLGIEAARRVIVDEIQNI  1395

Query  1328  MESHGMSIDIRHLMLVADLMTCRGEVLGITRQGLAKMKESVLMLASFEKTSDHLFDAAYY  1387
             ++++ +SID+RH+ L+ADLMT RG VLGITR G+ KM  +VL +ASFE+T+DHL++AA  
Sbjct  1396  LKAYSLSIDVRHVYLLADLMTQRGVVLGITRYGIQKMNFNVLTMASFERTTDHLYNAAAT  1455

Query  1388  GQKDVISGVSECIIMGIPMMLGTGLFKLL  1416
              + D    VS+ II+G P+ LGT  F LL
Sbjct  1456  QRVDRDLSVSDSIIVGKPVPLGTTSFDLL  1484


>RPB1_DICDI unnamed protein product
Length=1727

 Score = 604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/940 (39%), Positives = 523/940 (56%), Gaps = 105/940 (11%)

Query  69   LRKISHVQFGVQNAQQMQQQAHLHVVAKNLYNQDAQRTPVPFGILDRRMGLCQKEDKCAT  128
            LRK+  VQFG+ +  +++  +   V     Y       P   G+LD  MG   K  +C T
Sbjct  12   LRKVKRVQFGILSPDEIRNMSVARVEHPETYENGK---PKAGGLLDPAMGTIDKTQRCQT  68

Query  129  CGLQLFDCVGHYGYIDLELPVFHVGYFGAVINILQSVCKTCSNMLLPPDE-KFQYRSKVQ  187
            C   + +C GH+G+I+L  PVFH+G+   V+ IL+ VC  CS +L   +E  F+   K++
Sbjct  69   CSGTMAECPGHFGHIELAKPVFHIGFIDTVLKILRCVCYHCSKLLTDTNEHSFRQALKIR  128

Query  188  NPNLPYLIKKALRKKILDRCKKITRCSSCGDRNGVVKKAGLLKISHEKFRNARKH-----  242
            N       +K     ++D CK    C+  G+     ++   L  + E+     KH     
Sbjct  129  N-------QKHRLNAVVDCCKNKKVCAIGGEE----EEEHDLSKTDEELDKPVKHGGCGN  177

Query  243  -----DMALLEQLAEYDDAIEANKEIDTLLGNTLVHLMNPQEVLNILERIPEEDIPFLLM  297
                     L+ + E+ D  + + E  ++L        + + VLNIL+RI +ED   + +
Sbjct  178  VLPKITKEDLKIIVEFKDVTDESIEKKSVL--------SAERVLNILKRIKDEDSRAMGI  229

Query  298  NPDYGKPKDLILTRIPVPPICIRPSVISDLKSGTNEDDLTMKLTEIVFLNDVIVKHRQSG  357
            NPD+ +   +I T +PVPP  +RPS++ D  S   EDDLT KL +IV  N  + +  ++G
Sbjct  230  NPDWARADWMIATVLPVPPPPVRPSIMMD-TSTRGEDDLTHKLADIVKANRELQRQEKNG  288

Query  358  AKVQMINEDWDFLQLQCALYINSETSGIPPNMQ----PKKASRGFVQRLKGKQGRFRGNL  413
            A   +I E   FLQ   A Y+++E  G+P   Q    P K+ R   QRLKGK+GR RGNL
Sbjct  289  APAHIIAEATQFLQFHVATYVDNEIPGLPQAQQRSGRPLKSIR---QRLKGKEGRIRGNL  345

Query  414  SGKRVDFTSRTVISPDPNLRIDEVGVPKLVAKTLTYPARVNPSNIELMRKLVINGPDVHP  473
             GKRVDF++RTVI+ DPNL ID+VGVP+ +A  LTYP  V P NI+ MR+L+ NGP  HP
Sbjct  346  MGKRVDFSARTVITADPNLSIDQVGVPRSIALNLTYPETVTPFNIDKMRELIRNGPSEHP  405

Query  474  GANFVELRPTGPNQPAGVKKFLRYGNRNRIAQELKPGDIVERHLMDGDMVLFNRQPSLHK  533
            GA ++        +  G +  LR+  +      L+ G  VERH+ DGD+V+FNRQPSLHK
Sbjct  406  GAKYII-------REDGTRFDLRFVKKVSDTH-LECGYKVERHINDGDVVIFNRQPSLHK  457

Query  534  LSIMCHRAKVLEHRTFRFNECACTPYNADFDGDEMNLHLPQTEEARAEAYVLMGNTSNLV  593
            +S+M HR KV+ + TFR N    +PYNADFDGDEMNLH+PQT E RAE   +M     +V
Sbjct  458  MSMMGHRIKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQTLETRAEVIEIMMVPRQIV  517

Query  594  TPRNGELLIAAIQDFITGSYLLTQKDTFFDKAKACQIASYLLAGDDLGMKIDFPPPAIMK  653
            +P++   ++  +QD + GS L T++D F +K     I  +L + D        PPPAI+K
Sbjct  518  SPQSNRPVMGIVQDTLLGSRLFTKRDCFMEKDLVMNILMWLPSWDG-----KVPPPAILK  572

Query  654  PVALWTGKQIFI-----------------------------VVIRNSELLAGTMDKATLG  684
            P  LWTGKQ+F                              V+I   ELLAG + K +LG
Sbjct  573  PKQLWTGKQLFSLIIPDINLIRFTSTHNDKEPNECSAGDTRVIIERGELLAGILCKRSLG  632

Query  685  SGSKSSIFYILLRDWGKEEAARAMWRLGRVCSYFLMNRGFSIGIGDVTPGAGLLKAKRNL  744
            + +  SI ++++ + G +     + +   V +++L+NRGF++GIGD    +  +      
Sbjct  633  AAN-GSIIHVVMNEHGHDTCRLFIDQTQTVVNHWLINRGFTMGIGDTIADSATMAKVTLT  691

Query  745  LEDGYTNCDKYIRQLNEGKLQSQPGCSEEETLEAVILKELSVIRDHAGKACLQANFSLSR  804
            +        + I +    + + QPG S  ET E  + + L+  RD AG        S ++
Sbjct  692  ISSAKNQVKELIIKAQNKQFECQPGKSVIETFEQKVNQVLNKARDTAG--------SSAQ  743

Query  805  QELHKSNSPLIMAVCGSKGSFINISQMIACVGQQAISGKRVPNGFEDRALPHFERHSKIP  864
              L + N+   M   GSKGSFINISQM+ACVGQQ + GKR+P GF+ R LPHF +    P
Sbjct  744  DSLSEDNNLKAMVTAGSKGSFINISQMMACVGQQNVEGKRIPFGFQSRTLPHFTKDDYGP  803

Query  865  AAKGFVENSFYSGLTPTEFFFHTMGGREGLVDTAVKTAETGYMQRRLMKVSEEGGEMGST  924
             ++GFVENS+  GLTP EFFFH MGGREGL+DTAVKT+ETGY+QRRL+K           
Sbjct  804  ESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKA----------  853

Query  925  CKNLEDLFSHYDMTVRSSKGDIIQFCYGGDGLDPTYMEGK  964
               +ED+   YD TVR+S GD+IQF YG DG+D  ++E +
Sbjct  854  ---MEDVSIKYDATVRNSLGDVIQFAYGEDGIDGCFVENQ  890


 Score = 202 bits (514),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/404 (33%), Positives = 211/404 (52%), Gaps = 55/404 (14%)

Query  1066  FFQTCRE---KYMHARIEPGTAVGALAGQSIGEPGTQMTLKTFHFAGVASMNITLGVPRI  1122
             F   C E   K++ A   PG  VGALA QSIGEP TQMTL TFH+AGV+S N+TLGVPR+
Sbjct  1061  FLWVCGEIESKFLQALAHPGEMVGALAAQSIGEPATQMTLNTFHYAGVSSKNVTLGVPRL  1120

Query  1123  KEIINASRNISTPIISVQLANN--RDQEFARRVKGRIEKTTLGEICEYLEEVYVQDDAFL  1180
             KEIIN ++ + TP +++ L  +  RD + A+ VK ++E TTL  +    E  Y  D    
Sbjct  1121  KEIINIAKQVKTPSLTIYLKPHMARDMDRAKIVKSQLEYTTLANVTSATEIYYDPDPQNT  1180

Query  1181  LIKLDMDRI----RLLKLEVDVDTIRYSILTSRLKVKPGDVTCRSETLITVRPS------  1230
             +I  D + +     L   E+DV ++   +L  R+++  G VT +  T+  +         
Sbjct  1181  IISEDAEFVNSYFELPDEEIDVHSMSPWLL--RIELDRGMVTDKKLTMADITQCVVRDFG  1238

Query  1231  -------ESKNAPNIYYALEHLKMQVPK---------------------VVVKGLPTVDR  1262
                       NA  +   +  ++ Q  K                     +V++G+  + +
Sbjct  1239  LSLNCIFSDDNAEKLILRIRMVESQETKGTDNDDDDQFLRRIESNMLSEMVLRGIKGIKK  1298

Query  1263  AVIHVDDTGPVLT----------FKLYVEGDNLREVIATRGVNGTATTSNNTMEVFSTLG  1312
               +  DD  P +T          + L  +G +L EV++   V+ T TTSN+ +E+   LG
Sbjct  1299  VFMRTDDKIPKVTENGGFGVREEWILDTDGVSLLEVMSHPDVDHTRTTSNDIVEIIQVLG  1358

Query  1313  IEAARATIINEIQYTMESHGMSIDIRHLMLVADLMTCRGEVLGITRQGLAKMKESVLMLA  1372
             IEA R  ++ E++  +   G  ++ RHL ++AD+MT RG ++ ITR G+ +++   LM  
Sbjct  1359  IEAVRNALLKELRAVISFDGSYVNYRHLAILADVMTYRGHLMAITRHGINRVETGPLMRC  1418

Query  1373  SFEKTSDHLFDAAYYGQKDVISGVSECIIMGIPMMLGTGLFKLL  1416
             SFE+T + L DAA + + D + GV+E II+G    LGTG F++ 
Sbjct  1419  SFEETVEILMDAAMFSETDDVKGVTENIILGQLPPLGTGSFEVF  1462



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


Query= CAQU000069-PA

Length=1228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WAPL_DROME  unnamed protein product                                   481     3e-145
WAPL_CAEEL  unnamed protein product                                   199     9e-53 


>WAPL_DROME unnamed protein product
Length=1741

 Score = 481 bits (1237),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 260/576 (45%), Positives = 365/576 (63%), Gaps = 59/576 (10%)

Query  638   VKINRTAKAYYTVVRNVKNAHQIQESGEFQELNDDVEYILDALQENNPIATRCLSAVSLA  697
             V+++R  K YY VVRNVK AHQIQE GE+QE++DDVEYILDALQ +NP ATRCLSA+ LA
Sbjct  1137  VRVDRKTKDYYPVVRNVKTAHQIQEIGEYQEMDDDVEYILDALQPHNPPATRCLSALQLA  1196

Query  698   AKCMAPAFRMHVRAHGTVAKFFRALNDSPKNPSLSLCTATVMFVLSQDRLNMDLDRDSLE  757
             AKCM PAFRMHVRAHG V KFF+AL+D+ K+ SL LCT+ +M++LSQ+ LNMDLDRDSLE
Sbjct  1197  AKCMMPAFRMHVRAHGVVTKFFKALSDANKDLSLGLCTSAIMYILSQEGLNMDLDRDSLE  1256

Query  758   LMLNLLDTDSASAPGNNGNGGNGNGGEEAAPASPTASANSSGGPTPLTKDVVLPAELLKN  817
             LM+NLL+ D             G GG           +  +G P     D        +N
Sbjct  1257  LMINLLEAD-------------GVGG-----------STETGHPDRAGYD--------RN  1284

Query  818   KQRVRELCWQMQEKGHAKHLNLDNITAGQLAMETLLSLTSRRAGEWFKEELRTLGGLDHL  877
             KQ+VRELC +++ +G   HLN+D++T G LAMETLLSLTS+RAGEWFKE+LR LGGL+H+
Sbjct  1285  KQKVRELCEEIKAQGKGTHLNVDSLTVGTLAMETLLSLTSKRAGEWFKEDLRKLGGLEHI  1344

Query  878   VQTLCD-CISFLSGVNDLDMRTDPYLDKLRKVDRCLRVLENVTLQNEENQEYLLQHKSGV  936
             ++T+ D C   ++   ++D +    LD ++ V RCLRVLENVT  NE NQ Y+L    G 
Sbjct  1345  IKTISDFCRPVIACDTEIDWQPT-LLDNMQTVARCLRVLENVTQHNETNQRYMLTSGQGK  1403

Query  937   VMTVVYQLFRICSEEIRIYPT-IDPNDKESTGVFVREALISTMKVLLNLTHDFSNH--SI  993
              +  + QL+R+CS +I ++P+    ++KE  GV +RE L+  +KVL+NLTH F+    S+
Sbjct  1404  AVETLCQLYRLCSRQIMLHPSDGGGSNKEHPGVAMRELLVPVLKVLINLTHTFNEAQPSL  1463

Query  994   GSLMAGRKIGFIDTTLNSLLRLPDYVPEEKKFDVIILSTGLIINLVENVDDNRKALVS--  1051
             G+ + G++   ++T+   LL   +Y+P++  F++ IL   L+INL  +   NR AL+   
Sbjct  1464  GAELLGQRGDVVETSFRLLLLSANYIPDQCVFELSILVLTLLINLCMHTVPNRAALMQAA  1523

Query  1052  ------CQAPPLHDSLFEKKQSAVEALIELFYVKEASARVEEAKTDDILDGKKDEVEAEQ  1105
                      PP   S+     SA++AL+E FY  E  AR+ E  TD  L+          
Sbjct  1524  APAEYVADNPPAQGSV-----SALQALLEYFYKCEELARLVEKNTDAFLE--------SN  1570

Query  1106  EKQKSQEEFIEETIAKLLQKAGRHMENTMIAAYVALLIGYLMMEDEAYQMEVRSMLPDKN  1165
             EK K ++E +EET+  L+Q+AG HME+T+  +Y A+L+G L+ ++E Y+  VR  L   +
Sbjct  1571  EKGKKKQEEVEETVNNLVQRAGHHMEHTLKGSYAAILVGNLIADNELYESVVRRQLRGNS  1630

Query  1166  YKIMIAVLNKLYDFMRLTAT-NACSTKGMKAIKLTI  1200
             +K +I VL K + FM LT++  A     MK+ K  I
Sbjct  1631  FKEIIGVLEKYHTFMNLTSSLEAAFVAHMKSTKRII  1666


 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 25/41 (61%), Gaps = 2/41 (5%)

Query  20  VQFDTLFRE--NATRPSATKSAGSIGKWGVTSFTSIRSTNI  58
           V  D+L +E  N  RP+  +S G++GKWG   FTS R+  +
Sbjct  10  VPLDSLCKEKENTNRPTVARSVGTVGKWGKMGFTSTRTYTL  50


 Score = 32.7 bits (73),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 34/62 (55%), Gaps = 12/62 (19%)

Query  530   KKKGSIFKSRTLSNAGSKKRLGLYKHKLWHHD-------DGG-----AAAAAAAAAGMSG  577
             KKKGSIFKSR L  +   ++  + K  L+ H        +GG     A+ A+A+  G++G
Sbjct  970   KKKGSIFKSRALVPSDQAEQATVAKRHLYKHSWDAALEANGGGTNSDASNASASGVGVAG  1029

Query  578   SQ  579
             ++
Sbjct  1030  AK  1031


>WAPL_CAEEL unnamed protein product
Length=748

 Score = 199 bits (506),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 156/608 (26%), Positives = 295/608 (49%), Gaps = 111/608 (18%)

Query  644   AKAYYTVVRNVKNAHQIQESGEFQELNDDVEYILDALQENNP-IATRCLSAVSLAAKCMA  702
             A  Y + VR++K A++++ESGE+ +   D+ YIL +LQ ++  +  +CLSA+SLA KC++
Sbjct  208   ASGYGSRVRHIKEANELRESGEYDDFKQDLVYILSSLQSSDASMKVKCLSAISLAKKCVS  267

Query  703   PAFRMHVRAHGTVAKFFRALNDSPKNPSLSLCTATVMFVLSQDRLNMDLDRDSLELMLNL  762
             P FR  +++        +AL DSP++   +L  +TV+++L++D  ++ +D  SL L+  L
Sbjct  268   PDFRQFIKSENMTKSIVKALMDSPEDDLFALAASTVLYLLTRDFNSIKIDFPSLRLVSQL  327

Query  763   LDTDSASAPGNNGNGGNGNGGEEAAPASPTASANSSGGPTPLTKDVVLPAELLKNKQRVR  822
             L  +                  E  P                           ++K +V 
Sbjct  328   LRIEKF----------------EQRP---------------------------EDKDKVV  344

Query  823   ELCWQM-------QEKGHAK---HLNLDNITAGQLAMETLLSLTSRRAGE-WFKEELRTL  871
              + W++       QE G  K    +  +++T   L +E L+ + SR   +   K EL  L
Sbjct  345   NMVWEVFNSYIEKQEVGGQKVSFDMRKESLTPSSLIIEALVFICSRSVNDDNLKSELLNL  404

Query  872   GGLDHLVQTLCDCISFLSGVNDLDMRTDPYLDKLRKVDRCLRVLENVTLQNEENQEYLLQ  931
             G L  +V  +   ++ ++     D   D Y   +  ++RC R+LE+ ++ +++NQ +L+ 
Sbjct  405   GILQFVVAKIETNVNLIA-----DNADDTY--SILILNRCFRILESSSVFHKKNQAFLIS  457

Query  932   HKSGVVMTVVYQLFRICSEEIRIYPTIDPNDKESTGVFVREALISTMKVLLNLTHDFSNH  991
             H+S ++++ + +  ++  +  R++   +   K+        AL+   ++L+N++HD   +
Sbjct  458   HRSNILISSLAKFLQVILD--RVHQLAEEEVKKYISCL---ALMC--RLLINISHD---N  507

Query  992   SIGSLMAGRKIGFIDTTLNSLLRLPDYVPEEKKFDVIILSTGLIINLVENVDDNRKALVS  1051
              +     G+  GF+   + +   L     +E  +D+ ++ T L+ NLVE  + NRK L++
Sbjct  508   ELCCSKLGQIEGFLPNAITTFTYLAPKFGKENSYDINVMMTSLLTNLVERCNANRKVLIA  567

Query  1052  CQAP---PLHDSLFEKKQSAVEALIELFYVKEASARVEEAKTDDIL--------------  1094
                    P HD    ++  A+EA+  LF   E+ A++ +A  D  L              
Sbjct  568   QTVKMVIPGHDV---EEVPALEAITRLFVYHESQAQIVDADLDRELAFDEGGCGDEEEEE  624

Query  1095  --------------DGKKDEVEAEQEKQKSQEEFIEETIAKLLQKAGRHMENTMIAAYVA  1140
                           DG+ D  + ++  Q      +   + +++ KA  HME ++IA+Y A
Sbjct  625   EGGDESSDEDGVRKDGRLDRNKMDRMDQVD----VVHALQQVMNKASAHMEGSVIASYHA  680

Query  1141  LLIGYLMMEDEAYQMEVRSMLPDKNYKIMIAVLNKLYDFMRLT-ATNACSTKGMKAIKLT  1199
             LL+G+++ ++E +  EVR  LP KN++ MI+ L +LYDF + T A    S  G +AI+  
Sbjct  681   LLVGFVLQQNEDHLDEVRKHLPGKNFQNMISQLKRLYDFTKATMAKRVESNSGFRAIERV  740

Query  1200  IKMMEACE  1207
             I+ +E  E
Sbjct  741   IEYLERLE  748



Lambda      K        H
   0.319    0.135    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8445098610


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  12:13 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000070-PA

Length=828
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PKD2_CAEEL  unnamed protein product                                   231     4e-65
Q9VK95_DROME  unnamed protein product                                 213     8e-58
Q6T3S5_DROME  unnamed protein product                                 212     3e-57


>PKD2_CAEEL unnamed protein product
Length=716

 Score = 231 bits (590),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 157/441 (36%), Positives = 241/441 (55%), Gaps = 38/441 (9%)

Query  354  NARCCCTLTFEFPPIGGVITSSTLHTVKLIRYVTPSDYFILACELAYILFIMYYLAEEIM  413
            N  C   L FE P  GGVIT+  L T  L+ Y T     ++  E  +  FI+Y++ EE+ 
Sbjct  284  NLFCVVKLLFELPASGGVITTPKLMTYDLLTYQTSGGTRMMIFEGIFCGFILYFIFEELF  343

Query  414  EIKTIGSVRHLRDFFNALDIIVILISIVCIAFSVFRYILVGRTLKGLLDSPDEFANFEFL  473
             I     + +L  F+N +D++++  S+  I  SV R       +  ++++    A F+ +
Sbjct  344  AIGR-HRLHYLTQFWNLVDVVLLGFSVATIILSVNRTKTGVNRVNSVIENGLTNAPFDDV  402

Query  474  GFWQTQFNNVIALCVFFAWIKLFKYISFNKTMTQLSSTLSRCAKDVAGFAVMFFIVFFAF  533
               +  + N+ A  VF AW+K+FK+IS NKTM+QLSSTL+R AKD+ GFAVMF + FFAF
Sbjct  403  TSSENSYLNIKACVVFVAWVKVFKFISVNKTMSQLSSTLTRSAKDIGGFAVMFAVFFFAF  462

Query  534  AQLGYLLFGTQVQGYSQFGNSVFTLLRTILGDFDFAQIEAANRVLGPIFFLAYVFFVFFV  593
            AQ GYL FGTQ+  YS   NS F LLR ILGDF+F+ +E+ NR  GP FF+AYVFFV F+
Sbjct  463  AQFGYLCFGTQIADYSNLYNSAFALLRLILGDFNFSALESCNRFFGPAFFIAYVFFVSFI  522

Query  594  LLNMFLAIINDTYSEVKEEIAAQKNEFEIADYFRRGYNNLLGKMGKRDRLMDVQGALKLA  653
            LLNMFLAIIND+Y EVK E+A +K+   I D+F     N +  + KR +  D  G     
Sbjct  523  LLNMFLAIINDSYVEVKAELARKKDGEGILDWFM----NKVRGLTKRGKRPDAPG-----  573

Query  654  AADNRITYEEIRHNLRKCNFSDVEIEMFMARYDMDGDKNLSEEETRRMLGDLEGQRLELE  713
                  TYE+ +  L +  +++ +I     R+++        E+    + D   +  E +
Sbjct  574  ---EDATYEDYKLMLYRAGYAEKDINEAFTRFNVTSMTEHVPEKVAEDIADEVARMTEQK  630

Query  714  RDITKETEAAKAGQIEGQPGQGMPIGNGVTYEEFAQLQRRVDRMETSIGAIIAKIDTVLV  773
            R+  +                         + ++A L RRVD+M+ S+ +I+ +I+ V  
Sbjct  631  RNYME------------------------NHRDYANLNRRVDQMQESVFSIVDRIEGVNA  666

Query  774  TMGHVESAKSKRRKHLGKMLD  794
            T+  +E  + +++   G ++D
Sbjct  667  TLQTIEKQRVQQQDG-GNLMD  686


 Score = 169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/287 (34%), Positives = 148/287 (52%), Gaps = 22/287 (8%)

Query  63   VTFGMTSATMYYYTKVLSDLFVESDNGR----FRTANTMGDFWKFAEGPMLDGLYWEYWY  118
            V F   S   YYY+KV+SDLFV S        F +  +M + W +    ++ G+YW    
Sbjct  90   VAFAQNSIQSYYYSKVMSDLFVASTGASGAPAFGSCTSMDNIWDWLSQVLIPGIYW----  145

Query  119  AQDVAVSNISKEDSNILYENRLLGVPRLRQYAEDTEEFGPAKDTNSECP--------PKE  170
                  SN +  ++ I YENRLLG PR+R      +     K    E            E
Sbjct  146  ---TETSNSTDNENMIYYENRLLGEPRIRMLKVTNDSCTVMKSFQREIKECFANYEEKLE  202

Query  171  DR--IKRHICTEWTHYTEKALKGSSHWGLMGTYSGGGYFKDLR-KTKNESREIIADLKKN  227
            D+  +       + + T K L+     G + +Y GGG+ + L      E++  IA LK N
Sbjct  203  DKTMVGDGSVDAFIYATAKELENLKTVGTIASYGGGGFVQRLPVAGSTEAQSAIATLKAN  262

Query  228  LWLDRGTRVVFLDFTVYNANINLFCVVKMVFEFPPSGGMMTSSTFRTVKLLRYVTAMDYF  287
             W+DRG+R + +DF +YNANINLFCVVK++FE P SGG++T+    T  LL Y T+    
Sbjct  263  RWIDRGSRAIIVDFALYNANINLFCVVKLLFELPASGGVITTPKLMTYDLLTYQTSGGTR  322

Query  288  VLACEGIYCLFILYYLIEEIIEIKIGGCAYFKSMWSILDIIVLLVSL  334
            ++  EGI+C FILY++ EE+  I      Y    W+++D+++L  S+
Sbjct  323  MMIFEGIFCGFILYFIFEELFAIGRHRLHYLTQFWNLVDVVLLGFSV  369


>Q9VK95_DROME unnamed protein product
Length=924

 Score = 213 bits (543),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 111/274 (41%), Positives = 165/274 (60%), Gaps = 3/274 (1%)

Query  361  LTFEFPPIGGVITSSTLHTVKLIRYVTPSDYFILACELAYILFIMYYLAEEIMEIKTIGS  420
            L  E PP GGVI  + L TVK+  + T     +    + + + ++YY   EI EI+  G 
Sbjct  556  LIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTIYEITEIRKSGI  615

Query  421  VRHLRDFFNALDIIVILISIVCIAFSVFRYILVGRTLKGLLDSPDEFANFEFLGFWQTQF  480
              +     N LD  ++L   + + ++++    V  +L     S   + + + L FW   +
Sbjct  616  KIYFCSMLNILDCAILLGCYLALVYNIWHSFKV-MSLTARAHSDVTYQSLDVLCFWNIIY  674

Query  481  NNVIALCVFFAWIKLFKYISFNKTMTQLSSTLSRCAKDVAGFAVMFFIVFFAFAQLGYLL  540
             +++A+  F  WIK+FK+ISFNKT+ Q ++TL RC+KD+AGF++MF IVF A+AQLG LL
Sbjct  675  VDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLL  734

Query  541  FGTQVQGYSQFGNSVFTLLRTILGDFDFAQIEAANRVLGPIFFLAYVFFVFFVLLNMFLA  600
            FGT+   +  F  S+ T++R ILGDF +  IE ANRVLGPI+FL Y+  VFF+LLNMFLA
Sbjct  735  FGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLA  794

Query  601  IINDTYSEVKEEIAAQKNEFEIADYFRRGYNNLL  634
            II +TY+ VK EI   ++   +  Y  R  + +L
Sbjct  795  IIMETYNTVKGEITQGRS--HLGSYIYRKLSGML  826


 Score = 115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 121/242 (50%), Gaps = 20/242 (8%)

Query  135  LYENRLLGVPRLRQ--------YAEDT--EEFGPAKDTNSECPPKEDRIKRHICTEWTHY  184
            LYEN LLG PRLRQ        Y  D     F       S     EDR   H  + +   
Sbjct  429  LYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSG--AEDRKPMHKGSPFR--  484

Query  185  TEKALKGSSHWGLMGTYSGGGYFKDLRKTKNESREIIADLKKNLWLDRGTRVVFLDFTVY  244
            T   L  +  W ++  Y  GGY  +L   K+ + +II DLK   WLDRG+R+  ++F ++
Sbjct  485  TMHDLDSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLF  544

Query  245  NANINLFCVVKMVFEFPPSGGMMTSSTFRTVKLLRYVTAMDYFVLACEGIYCLFILYYLI  304
            N N ++F  +K++ E PP+GG++  +  +TVK+  + T     +      + + ++YY I
Sbjct  545  NENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYYTI  604

Query  305  EEIIEIKIGGCA-YFKSMWSILDIIVLLVSLLWCYVCLLHRMLHC-PSLYHNARCCCTLT  362
             EI EI+  G   YF SM +ILD  +    LL CY+ L++ + H    +   AR    +T
Sbjct  605  YEITEIRKSGIKIYFCSMLNILDCAI----LLGCYLALVYNIWHSFKVMSLTARAHSDVT  660

Query  363  FE  364
            ++
Sbjct  661  YQ  662


>Q6T3S5_DROME unnamed protein product
Length=924

 Score = 212 bits (539),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/274 (40%), Positives = 165/274 (60%), Gaps = 3/274 (1%)

Query  361  LTFEFPPIGGVITSSTLHTVKLIRYVTPSDYFILACELAYILFIMYYLAEEIMEIKTIGS  420
            L  E PP GGVI  + L TVK+  + T     +    + + + ++Y+   EI EI+  G 
Sbjct  556  LIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYHTIYEITEIRKSGI  615

Query  421  VRHLRDFFNALDIIVILISIVCIAFSVFRYILVGRTLKGLLDSPDEFANFEFLGFWQTQF  480
              +     N LD  ++L   + + ++++    V  +L     S   + + + L FW   +
Sbjct  616  KIYFCSMLNILDCAILLGCYLALVYNIWHSFKV-MSLTARAHSDVTYQSLDVLCFWNIIY  674

Query  481  NNVIALCVFFAWIKLFKYISFNKTMTQLSSTLSRCAKDVAGFAVMFFIVFFAFAQLGYLL  540
             +++A+  F  WIK+FK+ISFNKT+ Q ++TL RC+KD+AGF++MF IVF A+AQLG LL
Sbjct  675  VDMMAILAFLVWIKIFKFISFNKTLVQFTTTLKRCSKDLAGFSLMFGIVFLAYAQLGLLL  734

Query  541  FGTQVQGYSQFGNSVFTLLRTILGDFDFAQIEAANRVLGPIFFLAYVFFVFFVLLNMFLA  600
            FGT+   +  F  S+ T++R ILGDF +  IE ANRVLGPI+FL Y+  VFF+LLNMFLA
Sbjct  735  FGTKHPDFRNFITSILTMIRMILGDFQYNLIEQANRVLGPIYFLTYILLVFFILLNMFLA  794

Query  601  IINDTYSEVKEEIAAQKNEFEIADYFRRGYNNLL  634
            II +TY+ VK EI   ++   +  Y  R  + +L
Sbjct  795  IIMETYNTVKGEITQGRS--HLGSYIYRKLSGML  826


 Score = 113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 77/242 (32%), Positives = 121/242 (50%), Gaps = 20/242 (8%)

Query  135  LYENRLLGVPRLRQ--------YAEDT--EEFGPAKDTNSECPPKEDRIKRHICTEWTHY  184
            LYEN LLG PRLRQ        Y  D     F       S     EDR   H  + +   
Sbjct  429  LYENLLLGPPRLRQIRVRKESCYVNDAFIRYFNTCYAAYSSG--AEDRKPMHKGSPFR--  484

Query  185  TEKALKGSSHWGLMGTYSGGGYFKDLRKTKNESREIIADLKKNLWLDRGTRVVFLDFTVY  244
            T   L  +  W ++  Y  GGY  +L   K+ + +II DLK   WLDRG+R+  ++F ++
Sbjct  485  TMHDLDSTPIWTVLAFYRTGGYTVNLDYDKDRNVKIINDLKDIHWLDRGSRLCLVEFNLF  544

Query  245  NANINLFCVVKMVFEFPPSGGMMTSSTFRTVKLLRYVTAMDYFVLACEGIYCLFILYYLI  304
            N N ++F  +K++ E PP+GG++  +  +TVK+  + T     +      + + ++Y+ I
Sbjct  545  NENTDIFQSIKLIAEIPPTGGVIPQAHLQTVKMYSFFTDRSMLMTVIYIFWYIMVIYHTI  604

Query  305  EEIIEIKIGGCA-YFKSMWSILDIIVLLVSLLWCYVCLLHRMLHC-PSLYHNARCCCTLT  362
             EI EI+  G   YF SM +ILD  +    LL CY+ L++ + H    +   AR    +T
Sbjct  605  YEITEIRKSGIKIYFCSMLNILDCAI----LLGCYLALVYNIWHSFKVMSLTARAHSDVT  660

Query  363  FE  364
            ++
Sbjct  661  YQ  662



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000071-PA

Length=163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JUS1_DROME  unnamed protein product                                 66.2    3e-13
A8WH76_DROME  unnamed protein product                                 37.0    7e-04
M9PCJ6_DROME  unnamed protein product                                 27.3    7.3  


>A8JUS1_DROME unnamed protein product
Length=353

 Score = 66.2 bits (160),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 1/60 (2%)

Query  13  SAEHNDIRLAGDDAKDRLYEPKQ-NKKISRILTVLAYVFSVSLAAILLSIYYVFLWDPKI  71
           S+    ++L   +   R Y+P+Q N+K+ RILTV  YV  VSLAAI+LS+YY+F+WDP I
Sbjct  6   SSLEEKVKLPPTETISRCYQPQQSNRKVIRILTVAVYVLCVSLAAIMLSLYYIFIWDPTI  65


>A8WH76_DROME unnamed protein product
Length=81

 Score = 37.0 bits (84),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (57%), Gaps = 5/58 (9%)

Query  25  DAKDR-LYEPKQNK----KISRILTVLAYVFSVSLAAILLSIYYVFLWDPKITSTPTM  77
           +AKD  +  PK N     K  R+LT+L Y+  VS   + L++YY+F+WD ++   P  
Sbjct  17  EAKDEEIPMPKSNDFFESKTFRLLTLLLYMGGVSGMGLTLAVYYLFIWDSRMPPLPVF  74


>M9PCJ6_DROME unnamed protein product
Length=18641

 Score = 27.3 bits (59),  Expect = 7.3, Method: Composition-based stats.
 Identities = 12/32 (38%), Positives = 18/32 (56%), Gaps = 3/32 (9%)

Query  109    TPAPPVPSST---IFATTQQPSIMHIDKAAPP  137
              TP+PP P +    ++   QQP I++I  A  P
Sbjct  14461  TPSPPYPVAIPDLVYVQQQQPGIVNIPSAPQP  14492



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000072-PA

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JR96_DROME  unnamed protein product                                 175     2e-52
Q8MSD9_DROME  unnamed protein product                                 170     2e-52
Q86IF6_DICDI  unnamed protein product                                 49.7    1e-06


>Q7JR96_DROME unnamed protein product
Length=407

 Score = 175 bits (444),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/210 (43%), Positives = 137/210 (65%), Gaps = 14/210 (7%)

Query  35   RRMSTSGLGDGAGQLTCSTPVRSSSLETSQLSLSPMAFSPLPDSSALINSVDSQNAPTTI  94
            RRMS   LG      + S    S+S+  SQ++LS  +  P  D +A++           +
Sbjct  178  RRMSECSLGYSQ---SSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLR----------V  224

Query  95   PIIGYEIMEERARFTVYKLRVENPVTSESWMVLRRYTDFVRLHAKLREEFSSTKLPLPPK  154
            PIIGYE+MEERARFT YKLRVENP T++ W+V+RRYTDFVRL++KL++ F +  L LP K
Sbjct  225  PIIGYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLMLPRK  284

Query  155  RWLRDNFETSFLEDRLQALQRLVDAIIQKPQLRQSNLVKEFFCLEEPPLCAADNLEESRV  214
            +   DNF   FL++R+Q LQ  V++++ K +LR+  LV+EFFCL+EPP   ++++EE R 
Sbjct  285  KLFGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPP-SYSESMEECRA  343

Query  215  LLEIVEDSVLQLQRQVRERDEKIKELTQAV  244
            + E  E+++  L+ Q+R +++ I  L Q +
Sbjct  344  IFEAQEETIEHLKLQIRNKNDLILSLQQKL  373


>Q8MSD9_DROME unnamed protein product
Length=228

 Score = 170 bits (430),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 135/208 (65%), Gaps = 14/208 (7%)

Query  37   MSTSGLGDGAGQLTCSTPVRSSSLETSQLSLSPMAFSPLPDSSALINSVDSQNAPTTIPI  96
            MS   LG      + S    S+S+  SQ++LS  +  P  D +A++           +PI
Sbjct  1    MSECSLGYSQ---SSSRHTGSNSMFASQMTLSSGSVVPPVDPNAVLR----------VPI  47

Query  97   IGYEIMEERARFTVYKLRVENPVTSESWMVLRRYTDFVRLHAKLREEFSSTKLPLPPKRW  156
            IGYE+MEERARFT YKLRVENP T++ W+V+RRYTDFVRL++KL++ F +  L LP K+ 
Sbjct  48   IGYEVMEERARFTAYKLRVENPETNDYWLVMRRYTDFVRLNSKLKQAFPNLTLMLPRKKL  107

Query  157  LRDNFETSFLEDRLQALQRLVDAIIQKPQLRQSNLVKEFFCLEEPPLCAADNLEESRVLL  216
              DNF   FL++R+Q LQ  V++++ K +LR+  LV+EFFCL+EPP   ++++EE R + 
Sbjct  108  FGDNFNAVFLDNRVQGLQIFVNSVMAKEELRKCKLVREFFCLDEPP-SYSESMEECRAIF  166

Query  217  EIVEDSVLQLQRQVRERDEKIKELTQAV  244
            E  E+++  L+ Q+R +++ I  L Q +
Sbjct  167  EAQEETIEHLKLQIRNKNDLILSLQQKL  194


>Q86IF6_DICDI unnamed protein product
Length=545

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 54/111 (49%), Gaps = 5/111 (5%)

Query  101  IMEERARFTVYKLRV-----ENPVTSESWMVLRRYTDFVRLHAKLREEFSSTKLPLPPKR  155
            + E    + +YK+       ENP   +   V RRY+DF+ L   L+E      +P  P++
Sbjct  153  VGEGMGAYAIYKIVTKSALNENPDYKKEVSVNRRYSDFLWLRNALKETRKGCIIPQLPEK  212

Query  156  WLRDNFETSFLEDRLQALQRLVDAIIQKPQLRQSNLVKEFFCLEEPPLCAA  206
             + +N    FLE R + L++ ++ +++   L QSN +  F    +  L AA
Sbjct  213  AVLNNRNKDFLEQRRRDLEKFLNRVVESNSLAQSNEILTFLEGSDEQLNAA  263



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000073-PA

Length=213
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EFG0_CAEEL  unnamed protein product                                 38.1    0.004
G5EE91_CAEEL  unnamed protein product                                 31.6    0.54 
TRPG_CAEEL  unnamed protein product                                   31.6    0.55 


>G5EFG0_CAEEL unnamed protein product
Length=685

 Score = 38.1 bits (87),  Expect = 0.004, Method: Composition-based stats.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 2/106 (2%)

Query  105  HHIYAHLGDSHAQHSLGQRYLQ-GKGVDQDHSKAMEWFRKAADQGHPHAAYNLAAGHMQG  163
            + + A  GD+ AQ  LGQ YL  G+G++Q+   A  +   AA+ G   A   L   ++ G
Sbjct  280  YKMLADKGDTSAQLGLGQIYLAGGRGLNQNFELAFRYLLAAAESGSADALTYLGKMYLDG  339

Query  164  YTDDLKP-GEAHDLIRHAASFGIPEAKAALQHICSKGYCINQDEEK  208
                 K   ++ + +  +A    P A+A L  +  KG  + ++ EK
Sbjct  340  TPFTPKDYQKSFEYLMKSADKSSPSAQAVLGAMYMKGKGVKKNYEK  385


 Score = 35.0 bits (79),  Expect = 0.041, Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 46/102 (45%), Gaps = 1/102 (1%)

Query  109  AHLGDSHAQHSLGQRYLQGKG-VDQDHSKAMEWFRKAADQGHPHAAYNLAAGHMQGYTDD  167
            A  G + A   LG+ YL G     +D+ K+ E+  K+AD+  P A   L A +M+G    
Sbjct  321  AESGSADALTYLGKMYLDGTPFTPKDYQKSFEYLMKSADKSSPSAQAVLGAMYMKGKGVK  380

Query  168  LKPGEAHDLIRHAASFGIPEAKAALQHICSKGYCINQDEEKD  209
                +A  L+  +A     + +  L  +  KG   N+   +D
Sbjct  381  KNYEKALKLLTLSADKKNADGQMYLAELHYKGVPTNKGVHRD  422


 Score = 33.9 bits (76),  Expect = 0.085, Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 4/76 (5%)

Query  113  DSHAQHSLGQRYLQG----KGVDQDHSKAMEWFRKAADQGHPHAAYNLAAGHMQGYTDDL  168
            ++  Q  L + + +G    KGV +D  K+++ ++ A+  GH  A YNLA  H  G     
Sbjct  398  NADGQMYLAELHYKGVPTNKGVHRDFKKSVKLYQLASQNGHILAYYNLAQMHAAGTGVPR  457

Query  169  KPGEAHDLIRHAASFG  184
                A DL +  A  G
Sbjct  458  SCSHAVDLFKSVAERG  473


 Score = 28.9 bits (63),  Expect = 3.9, Method: Composition-based stats.
 Identities = 25/97 (26%), Positives = 41/97 (42%), Gaps = 2/97 (2%)

Query  113  DSHAQHSLGQRYLQ-GKGVDQD-HSKAMEWFRKAADQGHPHAAYNLAAGHMQGYTDDLKP  170
            ++ A+   G  Y++ GKG  ++    A   F +AA QGH  A   +A   M G       
Sbjct  92   EAEAEFQRGMAYIERGKGHGREGRVAAHRVFERAAAQGHQEARKAVAFSQMFGDYSRWSI  151

Query  171  GEAHDLIRHAASFGIPEAKAALQHICSKGYCINQDEE  207
             EA  +       G P+A+ AL  +   G  + +  +
Sbjct  152  QEAKTVFEDLEKNGSPDAQLALGFMHGAGIGVEKSNQ  188


>G5EE91_CAEEL unnamed protein product
Length=1931

 Score = 31.6 bits (70),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 35/81 (43%), Gaps = 9/81 (11%)

Query  50    EDWDDDLPYGGKVLVARGKKPDPC----WVLLLQVSVIVFLVLILVLAFLNPDLFHFHAH  105
             E WD  L  GG V++  G     C    W+  L ++  + +  IL+++ L         +
Sbjct  1401  EAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIAIF-----N  1455

Query  106   HIYAHLGDSHAQHSLGQRYLQ  126
             HI+    +   Q  L QRY Q
Sbjct  1456  HIFDATDEMSQQIWLFQRYKQ  1476


>TRPG_CAEEL unnamed protein product
Length=2032

 Score = 31.6 bits (70),  Expect = 0.55, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (46%), Gaps = 9/81 (11%)

Query  50    EDWDDDLPYGGKVLVARGKKPDPC----WVLLLQVSVIVFLVLILVLAFLNPDLFHFHAH  105
             E WD  L  GG V++  G     C    W+  L ++  + +  IL+++ L   +F    +
Sbjct  1502  EAWDQHLENGGPVILGNGTTGLSCVPGYWIPPLLMTFFLLIANILLMSMLIA-IF----N  1556

Query  106   HIYAHLGDSHAQHSLGQRYLQ  126
             HI+    +   Q  L QRY Q
Sbjct  1557  HIFDATDEMSQQIWLFQRYKQ  1577



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000074-PA

Length=465
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UGDH_DROME  unnamed protein product                                   676     0.0  
UGDH_CAEEL  unnamed protein product                                   572     0.0  
Q57VV4_TRYB2  unnamed protein product                                 34.3    0.20 


>UGDH_DROME unnamed protein product
Length=476

 Score = 676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/472 (69%), Positives = 376/472 (80%), Gaps = 40/472 (8%)

Query  26   VCCIGAGYVGGPTCSVIALKCPNITVTVVDKSIERIAQWNSDRLPIYEPGLDEVVKECRG  85
            VCCIGAGYVGGPTC+V+ALKCP+I +T+VDKS ERIAQWNSD+LPIYEPGLDEVVK+CR 
Sbjct  3    VCCIGAGYVGGPTCAVMALKCPDIVITLVDKSSERIAQWNSDKLPIYEPGLDEVVKKCRN  62

Query  86   RNLFFSTDMDSTIKEADLIFISVNTPTKTFGIGKGRAADLKYVESAARKIAEV-------  138
             NLFFSTD+++ IKEADLIFISVNTPTKT G GKGRAADLKYVESAAR IAE+       
Sbjct  63   VNLFFSTDIETAIKEADLIFISVNTPTKTCGNGKGRAADLKYVESAARMIAEIAQSNKIV  122

Query  139  ------------------------------LSNPEFLAEGTAVNDLVNADRVLIGGEETP  168
                                          LSNPEFLAEGTA+NDL+NADRVLIGGEETP
Sbjct  123  VEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRVLIGGEETP  182

Query  169  EGRKAVEQLSWLYQHWIPRERIITMNTWSSELSKLAANAFLAQRISSINALSAVCEASGA  228
            EG +AVE+LSW+Y+HWIP++ I+T NTWSSELSKLAANAFLAQRISSIN+LSAVCEA+GA
Sbjct  183  EGHQAVEKLSWIYEHWIPKQNILTTNTWSSELSKLAANAFLAQRISSINSLSAVCEATGA  242

Query  229  DISEVAKAIGMDSRIGPKFLQASVGFGGSCFQKDILNLVYISECLNLPEVAAYWQGVIDI  288
            D+SEVA+A+G+DSRIG KFLQASVGFGGSCFQKDILNL+YI E LNLPEVAAYWQ VID+
Sbjct  243  DVSEVARAVGLDSRIGSKFLQASVGFGGSCFQKDILNLIYICENLNLPEVAAYWQQVIDM  302

Query  289  NEYQKSRFAGRVVESLFNTVTGKRIALLGFAFKKNTADTRESPAIHVSRYLLEEGAFLRV  348
            NEYQK RF+ +++ESLFNTV+ KRIA+LGFAFKKNT DTRE+ AI V + LLEEGA L +
Sbjct  303  NEYQKRRFSQKIIESLFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDI  362

Query  349  YDPKVEPIQIMRDLAQEMPQEAHEGDGDLHRLVSVHSDPYDAATQAHALVICTEWDEFLS  408
            YDPKVEP QI+ DL      E+ E    + + V +HSDPY A    HALVICTEWDEF+ 
Sbjct  363  YDPKVEPEQIIDDLTHPSVTESPE---KVKKAVQIHSDPYSAVRATHALVICTEWDEFVD  419

Query  409  LDYHKLYANMQKPAYIFDGRKILDHAELVKIGFHVETIGKRLVRNALTRGWG  460
            LD+ ++Y +M KPAYIFDGRKILDH  L +IGFHV+TIGK+  R  L R WG
Sbjct  420  LDFKRIYQSMMKPAYIFDGRKILDHERLQQIGFHVQTIGKKYQRTGLLRSWG  471


>UGDH_CAEEL unnamed protein product
Length=481

 Score = 572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/464 (61%), Positives = 341/464 (73%), Gaps = 45/464 (10%)

Query  23   IKNVCCIGAGYVGGPTCSVIALKCPNITVTVVDKSIERIAQWNSDRLPIYEPGLDEVVKE  82
            +  V C+GAGYVGGPTC++IA KCP+ITVTVVD +  +IA+WNSD+LPIYEPGLDE+V  
Sbjct  9    VSKVVCVGAGYVGGPTCAMIAHKCPHITVTVVDMNTAKIAEWNSDKLPIYEPGLDEIVFA  68

Query  83   CRGRNLFFSTDMDSTIKEADLIFISVNTPTKTFGIGKGRAADLKYVESAARKIAE-----  137
             RGRNLFFS+D+   I EADLIFISVNTPTK +G GKG A DLKYVES +R IA+     
Sbjct  69   ARGRNLFFSSDIPKAIAEADLIFISVNTPTKMYGRGKGMAPDLKYVESVSRTIAQYAGGP  128

Query  138  ----------------------------------VLSNPEFLAEGTAVNDLVNADRVLIG  163
                                              VLSNPEFLAEGTA+ DL N DRVLIG
Sbjct  129  KIVVEKSTVPVKAAESIGCILREAQKNNENLKFQVLSNPEFLAEGTAMKDLANPDRVLIG  188

Query  164  GEETPEGRKAVEQLSWLYQHWIPRERIITMNTWSSELSKLAANAFLAQRISSINALSAVC  223
            GE +PEG +AV +L  +Y++W+PR RIIT NTWSSELSKL ANAFLAQRISSIN++SAVC
Sbjct  189  GESSPEGLQAVAELVRIYENWVPRNRIITTNTWSSELSKLVANAFLAQRISSINSISAVC  248

Query  224  EASGADISEVAKAIGMDSRIGPKFLQASVGFGGSCFQKDILNLVYISECLNLPEVAAYWQ  283
            EA+GA+ISEVA A+G D+RIG KFLQASVGFGGSCFQKD+L+LVY+ E LNLP+VA YWQ
Sbjct  249  EATGAEISEVAHAVGYDTRIGSKFLQASVGFGGSCFQKDVLSLVYLCESLNLPQVADYWQ  308

Query  284  GVIDINEYQKSRFAGRVVESLFNTVTGKRIALLGFAFKKNTADTRESPAIHVSRYLLEEG  343
            GVI+IN +Q+ RFA +++  LFNTVT K+IA+ GFAFKKNT DTRES AIHV ++L+EE 
Sbjct  309  GVININNWQRRRFADKIIAELFNTVTDKKIAIFGFAFKKNTGDTRESSAIHVIKHLMEEH  368

Query  344  AFLRVYDPKVEPIQIMRDLAQEMPQEAHEGDGDLHRLVSVHSDPYDAATQAHALVICTEW  403
            A L VYDPKV+  Q++ DLA     +      D+ RL++V SDPY AA  AHA+V+ TEW
Sbjct  369  AKLSVYDPKVQKSQMLNDLASVTSAQ------DVERLITVESDPYAAARGAHAIVVLTEW  422

Query  404  DEFLSLDYHKLYANMQKPAYIFDGRKILDHAELVKIGFHVETIG  447
            DEF+ L+Y +++ +MQ PA IFDGR ILD   L +IGF    IG
Sbjct  423  DEFVELNYSQIHNDMQHPAAIFDGRLILDQKALREIGFRTFAIG  466


>Q57VV4_TRYB2 unnamed protein product
Length=403

 Score = 34.3 bits (77),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 22/89 (25%), Positives = 46/89 (52%), Gaps = 0/89 (0%)

Query  145  LAEGTAVNDLVNADRVLIGGEETPEGRKAVEQLSWLYQHWIPRERIITMNTWSSELSKLA  204
            + E   ++ LVN + + +GG         +E+L+ L Q W+ + +I ++ T   +L  L 
Sbjct  195  IKEVKNLDSLVNLELLELGGNRLRAIGSGLEKLTKLKQLWLGKNKISSIGTALHKLVSLE  254

Query  205  ANAFLAQRISSINALSAVCEASGADISEV  233
              +  A RI+S++A + +   +  ++ EV
Sbjct  255  ILSLQANRITSVDAENFLGAKANPNLREV  283



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000075-PA

Length=194
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q22355_CAEEL  unnamed protein product                                 194     7e-61
ETS6_DROME  unnamed protein product                                   187     3e-57
ELG_DROME  unnamed protein product                                    140     2e-39


>Q22355_CAEEL unnamed protein product
Length=377

 Score = 194 bits (492),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 93/110 (85%), Gaps = 0/110 (0%)

Query  1    MFGPTSSRLASSGSGQIQLWQFLLELLSDSSNANCITWEGTNGEFKLTDPDEVARRWGER  60
            + GPTS  LA SGSGQ QLWQFLLELLSD   +  ITWEGT GEFKL DPDEVAR+WGER
Sbjct  198  ILGPTSKNLAHSGSGQTQLWQFLLELLSDKRYSEVITWEGTQGEFKLVDPDEVARKWGER  257

Query  61   KSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAAA  110
            KSKPNMNYDK+SRALRYYYDKNIM KVHGKRYAYKFDFQG+A A QP  A
Sbjct  258  KSKPNMNYDKMSRALRYYYDKNIMAKVHGKRYAYKFDFQGIAQALQPPTA  307


>ETS6_DROME unnamed protein product
Length=475

 Score = 187 bits (474),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 98/117 (84%), Gaps = 3/117 (3%)

Query  1    MFGPTSSRLASSGSG-QIQLWQFLLELLSDSSNANCITWEGTNGEFKLTDPDEVARRWGE  59
            +    S RL + GSG QIQLWQFLLELL+DSSNAN I+WEG +GEF+L DPDEVARRWGE
Sbjct  238  LLNAASHRLVAQGSGGQIQLWQFLLELLADSSNANAISWEGQSGEFRLIDPDEVARRWGE  297

Query  60   RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFQGLAAATQPAA--ADPAA  114
            RK+KPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDF GL AA Q  A   DPA+
Sbjct  298  RKAKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGLMAACQAQAQGGDPAS  354


>ELG_DROME unnamed protein product
Length=464

 Score = 140 bits (352),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 74/89 (83%), Gaps = 0/89 (0%)

Query  9    LASSGSGQIQLWQFLLELLSDSSNANCITWEGTNGEFKLTDPDEVARRWGERKSKPNMNY  68
            + S  +GQ+QLWQFLLE+L+D  + + I W GT GEFKLTDPD VAR WGE+K+KP MNY
Sbjct  338  IGSGNNGQVQLWQFLLEILTDCEHTDVIEWVGTEGEFKLTDPDRVARLWGEKKNKPAMNY  397

Query  69   DKLSRALRYYYDKNIMTKVHGKRYAYKFD  97
            +KLSRALRYYYD ++++KV GKR+AYKFD
Sbjct  398  EKLSRALRYYYDGDMISKVSGKRFAYKFD  426



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000076-PA

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q384A6_TRYB2  unnamed protein product                                 34.7    0.35 
Q8WRU7_9TRYP  unnamed protein product                                 34.7    0.35 
UNC89_CAEEL  unnamed protein product                                  31.6    3.8  


>Q384A6_TRYB2 unnamed protein product
Length=977

 Score = 34.7 bits (78),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 65/144 (45%), Gaps = 25/144 (17%)

Query  176  RRLCIVEVQVAQYLIQTDD--VLHYCFQLLSHSMLAQTASEFIEQLVLLRKDVLQLSTVP  233
            RRL  +E  + Q++  T    +L++ F++ S           + + +  R+++L+L +V 
Sbjct  161  RRLDFLEKVLRQHIKSTKSAAILNFTFEVAS----------VLLRDIAFRREILKLLSVL  210

Query  234  HLRQLLANLDVNQVAQFCPVLAVTISDLDMFEN--RSSLYAQNKMKQSEGYQSTRDL---  288
            + +  L  +D    AQ    L  +    D+ E+  RS         ++  YQ   DL   
Sbjct  211  YAQGGLTTVDYFSQAQCLLFLGDSTGTADLIEDLIRSG-------DKATAYQLAFDLHEY  263

Query  289  -NQEFLLSVPGLVSKLAEYACRLP  311
             NQEFL +V GL+ K A  +   P
Sbjct  264  GNQEFLSAVAGLIEKRATLSIPAP  287


>Q8WRU7_9TRYP unnamed protein product
Length=977

 Score = 34.7 bits (78),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 37/144 (26%), Positives = 65/144 (45%), Gaps = 25/144 (17%)

Query  176  RRLCIVEVQVAQYLIQTDD--VLHYCFQLLSHSMLAQTASEFIEQLVLLRKDVLQLSTVP  233
            RRL  +E  + Q++  T    +L++ F++ S           + + +  R+++L+L +V 
Sbjct  161  RRLDFLEKVLRQHIKSTKSAAILNFTFEVAS----------VLLRDIAFRREILKLLSVL  210

Query  234  HLRQLLANLDVNQVAQFCPVLAVTISDLDMFEN--RSSLYAQNKMKQSEGYQSTRDL---  288
            + +  L  +D    AQ    L  +    D+ E+  RS         ++  YQ   DL   
Sbjct  211  YAQGGLTTVDYFSQAQCLLFLGDSTGTADLIEDLIRSG-------DKATAYQLAFDLHEY  263

Query  289  -NQEFLLSVPGLVSKLAEYACRLP  311
             NQEFL +V GL+ K A  +   P
Sbjct  264  GNQEFLSAVAGLIEKRATLSIPAP  287


>UNC89_CAEEL unnamed protein product
Length=8081

 Score = 31.6 bits (70),  Expect = 3.8, Method: Composition-based stats.
 Identities = 28/105 (27%), Positives = 42/105 (40%), Gaps = 19/105 (18%)

Query  22   LAGAITGRGMDSIIQVPGTCLEGSKSPEFPPVLLPALVGLAKAATQQGPDAETIQSHLRL  81
            L     GRG  +  ++    + GS+S  +P  +         A     PD E +++   +
Sbjct  41   LTSRTDGRGRSTSSEI----IAGSESRSYPVYI---------AIQDYTPDKEDVEA---I  84

Query  82   VLDQLQFLE---RDASSSWLEREDRNPPSSGGSNASSAPGPPEVY  123
             L+Q Q +E   +  S  WL R    PP SG    S    P E Y
Sbjct  85   PLEQGQIVEVLDKKNSVRWLVRTKARPPRSGWVPGSYFETPTEFY  129



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000077-PA

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q93716_CAEEL  unnamed protein product                                 299     9e-104
Q57WN8_TRYB2  unnamed protein product                                 94.4    8e-23 
Q7YU48_DROME  unnamed protein product                                 30.4    1.5   


>Q93716_CAEEL unnamed protein product
Length=227

 Score = 299 bits (766),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 158/191 (83%), Gaps = 0/191 (0%)

Query  34   LNRTINLYPLTNYTFGTKEPLFEKDPSVPARFQRMREEFEKIGMRRSVEGVLLVHEHGLP  93
             NRTIN+YPLTNYTFGTK+   EKD SVP RF+RM++E+E +GMRRSVE VL+VHEH LP
Sbjct  30   FNRTINVYPLTNYTFGTKDAQAEKDKSVPERFKRMKDEYEVMGMRRSVEAVLIVHEHSLP  89

Query  94   HVLLLQLGTTFFKLPGGELNPAEDEVEGLKRLLTETLGRQDGVPQEWVVEDTIGNWWRPN  153
            H+LLLQ+GTTF+KLPGGEL   EDE+ G+ RLL ETLGR DG   EW +ED IGNWWRPN
Sbjct  90   HILLLQIGTTFYKLPGGELELGEDEISGVTRLLNETLGRTDGETNEWTIEDEIGNWWRPN  149

Query  154  FEPPQYPYIPPHITKPKEHKKLFLVQLAEKALFAVPKNYKLVAAPLFELYDNAQGYGPII  213
            F+PP+YPYIP H+TKPKEH KL LVQL  K+ F VPKN+KLVAAPLFELYDNA  YGP+I
Sbjct  150  FDPPRYPYIPAHVTKPKEHTKLLLVQLPSKSTFCVPKNFKLVAAPLFELYDNAAAYGPLI  209

Query  214  SSLPQALCRYN  224
            SSLP  L R+N
Sbjct  210  SSLPTTLSRFN  220


>Q57WN8_TRYB2 unnamed protein product
Length=300

 Score = 94.4 bits (233),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/232 (31%), Positives = 106/232 (46%), Gaps = 59/232 (25%)

Query  44   TNYTFGTKEPLFEKDPSVPARFQRMREEFEKIGMRRSVEGVLLVHEHGLPHVLLLQL---  100
            TN     K PL EK  S+ AR +    E +++   +SVEGVLLVH H  PHVLLL+    
Sbjct  72   TNSERRIKTPL-EKLMSLRARCR----EQQRV---QSVEGVLLVHAHDHPHVLLLRHNVK  123

Query  101  --------------GTTFFKLPGGELNPAE------------DEVEGLKRLLTETLGRQD  134
                           T  ++LPGG     E            D +   KRL + +   ++
Sbjct  124  TTNRSRVLPATNTNSTAVYRLPGGRCRNGEPEELCLLRKLGRDLLNESKRLTSSSTAEEE  183

Query  135  -------------------GVPQEWVVEDTIGNWWRPNFEPPQYPYIPPHITKP--KEHK  173
                                    + V + +  W+RP+F+P  YPY+P H+ +   +E +
Sbjct  184  RSEVVVDVGSAHPNGTAVTASSSSFRVGEVLARWYRPHFDPLMYPYVPAHVAENDVREVR  243

Query  174  KLFLVQLAEKALF-AVPKNYKLVAAPLFELYDNAQGYGPIISSLPQALCRYN  224
             +FLV +  + L      + +LVAAPLF+LYDN   YG +I+S+P  L R N
Sbjct  244  TIFLVHMPPRMLLTGTYGDEELVAAPLFDLYDNTAKYGVLIASIPTLLSRVN  295


>Q7YU48_DROME unnamed protein product
Length=1071

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 0/56 (0%)

Query  6    AMKGTGWPRGAGQPIFANKIGITSQSITLNRTINLYPLTNYTFGTKEPLFEKDPSV  61
            A  G G   GAGQP + ++ GI  Q+          P      GT +P +   P V
Sbjct  504  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGV  559


 Score = 30.0 bits (66),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 0/56 (0%)

Query  6    AMKGTGWPRGAGQPIFANKIGITSQSITLNRTINLYPLTNYTFGTKEPLFEKDPSV  61
            A  G G   GAGQP + ++ GI  Q+          P      GT +P +   P V
Sbjct  555  AQPGVGTQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGTGQPGYGAQPGV  610


 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 0/53 (0%)

Query  9    GTGWPRGAGQPIFANKIGITSQSITLNRTINLYPLTNYTFGTKEPLFEKDPSV  61
            G G   GAGQP + ++ GI  Q+          P+     GT +P +   P V
Sbjct  184  GIGGQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPVVGAQTGTGQPGYGAQPGV  236


 Score = 29.6 bits (65),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 25/59 (42%), Gaps = 0/59 (0%)

Query  6    AMKGTGWPRGAGQPIFANKIGITSQSITLNRTINLYPLTNYTFGTKEPLFEKDPSVPAR  64
            A  G G   GAGQP + ++ GI  Q+          P      G ++P +   P V A+
Sbjct  385  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGIGGQTGARQPGYGSQPGVGAQ  443


 Score = 29.3 bits (64),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 24/59 (41%), Gaps = 0/59 (0%)

Query  6    AMKGTGWPRGAGQPIFANKIGITSQSITLNRTINLYPLTNYTFGTKEPLFEKDPSVPAR  64
            A  G G   GAGQP + ++ GI  Q+          P      G  +P +   P V A+
Sbjct  334  AQPGVGTQTGAGQPGYGSQPGIGGQTGAGQPGYGTQPGVGAQTGAGQPGYGAQPGVGAQ  392


 Score = 29.3 bits (64),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 24/59 (41%), Gaps = 0/59 (0%)

Query  6    AMKGTGWPRGAGQPIFANKIGITSQSITLNRTINLYPLTNYTFGTKEPLFEKDPSVPAR  64
            A  G G   GAGQP + ++ GI  Q+          P      G  +P +   P V A+
Sbjct  453  AQPGVGAQTGAGQPGYGSQPGIGGQTGAGQPGYGSQPGVGAQTGAGQPGYGAQPGVGAQ  511



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000078-PA

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8Q7_DROME  unnamed protein product                                 87.4    6e-18
Q7JUM5_DROME  unnamed protein product                                 87.4    7e-18
A5YTR9_DROME  unnamed protein product                                 87.4    9e-18


>A1Z8Q7_DROME unnamed protein product
Length=779

 Score = 87.4 bits (215),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 0/114 (0%)

Query  56   PAALGNLLRGVVAHVDVRTENHNKSAAVEKMLLELGAKVERRLNSKVTHVVFKDGSKKLY  115
            P +L  LL+ +V +V+VRT N N+S  V+ ++ ++GA+V+ RL    THVVFKDG    Y
Sbjct  130  PPSLPELLKDIVVYVEVRTGNDNRSEGVKSIIAKMGAQVKDRLTRTTTHVVFKDGLLSTY  189

Query  116  DNAKRQNLRLVAVRWIEACKEKRKMVKESEYPPVCAQEYDSPLFPDKPKRVRIL  169
              A   N+ +V++ WIEACK + K+    ++P    + Y+ P    K  RV+ +
Sbjct  190  KKATEWNIPVVSILWIEACKVQLKICDPKQFPISNIRMYEYPELFGKMPRVKFM  243


>Q7JUM5_DROME unnamed protein product
Length=826

 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 0/114 (0%)

Query  56   PAALGNLLRGVVAHVDVRTENHNKSAAVEKMLLELGAKVERRLNSKVTHVVFKDGSKKLY  115
            P +L  LL+ +V +V+VRT N N+S  V+ ++ ++GA+V+ RL    THVVFKDG    Y
Sbjct  177  PPSLPELLKDIVVYVEVRTGNDNRSEGVKSIIAKMGAQVKDRLTRTTTHVVFKDGLLSTY  236

Query  116  DNAKRQNLRLVAVRWIEACKEKRKMVKESEYPPVCAQEYDSPLFPDKPKRVRIL  169
              A   N+ +V++ WIEACK + K+    ++P    + Y+ P    K  RV+ +
Sbjct  237  KKATEWNIPVVSILWIEACKVQLKICDPKQFPISNIRMYEYPELFGKMPRVKFM  290


>A5YTR9_DROME unnamed protein product
Length=981

 Score = 87.4 bits (215),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 68/114 (60%), Gaps = 0/114 (0%)

Query  56   PAALGNLLRGVVAHVDVRTENHNKSAAVEKMLLELGAKVERRLNSKVTHVVFKDGSKKLY  115
            P +L  LL+ +V +V+VRT N N+S  V+ ++ ++GA+V+ RL    THVVFKDG    Y
Sbjct  130  PPSLPELLKDIVVYVEVRTGNDNRSEGVKSIIAKMGAQVKDRLTRTTTHVVFKDGLLSTY  189

Query  116  DNAKRQNLRLVAVRWIEACKEKRKMVKESEYPPVCAQEYDSPLFPDKPKRVRIL  169
              A   N+ +V++ WIEACK + K+    ++P    + Y+ P    K  RV+ +
Sbjct  190  KKATEWNIPVVSILWIEACKVQLKICDPKQFPISNIRMYEYPELFGKMPRVKFM  243


 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 1/66 (2%)

Query  456  SVVCTSVTNNQNEAVRAVIKALGGFMLRNTCDITTTHIVTGVATRRTLNMLRGLARGCWI  515
            ++V T++   Q   +R  ++ L G  L  T    TTH+V+ +  RRTLN+LRGL RG WI
Sbjct  757  TLVHTNMHQEQINVIRKALRKLRGMRLDPTVTQHTTHLVS-LEPRRTLNLLRGLMRGVWI  815

Query  516  VSLEWV  521
            VS +WV
Sbjct  816  VSYQWV  821



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000079-PA

Length=881
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYSP1_DROME  unnamed protein product                                  1048    0.0   
MYSP_CAEEL  unnamed protein product                                   751     0.0   
MYSP2_DROME  unnamed protein product                                  491     1e-163


>MYSP1_DROME unnamed protein product
Length=879

 Score = 1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/877 (65%), Positives = 723/877 (82%), Gaps = 1/877 (0%)

Query  1    MSGVTTKTSRSYVYKSSGGGTRGDADVTIEYSTDLTALSRLEDKIRLLQEDLEAERELRQ  60
            MS      S  Y Y+++  G  G ADV IEY  DL++LSRLEDKIRLLQ+DLE ERELRQ
Sbjct  1    MSSSQAVRSSKYSYRATSTGP-GTADVNIEYIQDLSSLSRLEDKIRLLQDDLEVERELRQ  59

Query  61   RIEREKADYSVQVLQLSERLEEAEGGVEGQLEINRKRDAELAKLRKLLEDVHMESEETVH  120
            RIEREKAD SVQV+Q+SERLEEAEGG E Q E NRKRDAEL KLRKLLEDVH+ESEET  
Sbjct  60   RIEREKADLSVQVIQMSERLEEAEGGAEHQFEANRKRDAELLKLRKLLEDVHLESEETTL  119

Query  121  ILRRKHQEAVADFQEQIDQLAKIKSKAEKEKTKFQQEVFELLSQVEIINKEKVVAVKQVE  180
            +L++KH E + DFQEQ++ L K K++AEK+K KFQ EV+ELLSQ+E  NKEK+V+ K + 
Sbjct  120  LLKKKHNEIITDFQEQVEILTKNKARAEKDKAKFQTEVYELLSQIESYNKEKIVSEKHIS  179

Query  181  KLEIHVHELNIKIEEYNRTIVDITNIKARISQENIELVKEVQDLKVSIEHITYQRSQVVS  240
            KLE+ + ELN+KIEE NRT++DI++ ++R+SQENIEL K+VQDLKV ++ +++ +SQV+S
Sbjct  180  KLEVSISELNVKIEELNRTVIDISSHRSRLSQENIELTKDVQDLKVQLDTVSFSKSQVIS  239

Query  241  QLEEARRRLEDEDRRRSTLESQLHTVELELESVRVQLEEEAEARLDMERQLMKATGDVQA  300
            QLE+ARRRLEDEDRRRS LES LH VE+EL+SVR QLEEE+EAR+D+ERQL+KA  D  +
Sbjct  240  QLEDARRRLEDEDRRRSLLESSLHQVEIELDSVRNQLEEESEARIDLERQLVKANADATS  299

Query  301  WRTKYEAEAHARHEELEEMRRKFQARLTEQEEHISALMAKVGGLEKQKSRLQSEVEVLII  360
            W+ K+ +E  AR EE+EE+RRK+Q R+TE EEHI +L+ KV  LEK K+RL SEVEVLII
Sbjct  300  WQNKWNSEVAARAEEVEEIRRKYQVRITELEEHIESLIVKVNNLEKMKTRLASEVEVLII  359

Query  361  DLEKANNTARELQKRSEQLERLTIDLRSKLEELTVLYETSTKELRVKTQMLTQITHELDK  420
            DLEK+NN+ REL K    LE+  ++L+S+L+E  +LYETS ++L+ K   L +  HELDK
Sbjct  360  DLEKSNNSCRELTKSVNTLEKHNVELKSRLDETIILYETSQRDLKNKHADLVRTVHELDK  419

Query  421  TREHKDALARENKKLTDDLHDTKNQLTDYTRKYHELEIECRRLENERDELSAAYREAEAG  480
             +++ + L RENKKL DDLH+ K  + +  R+ HELE+E RRLENERDEL+AAY+EAEAG
Sbjct  420  VKDNNNQLTRENKKLGDDLHEAKGAINELNRRLHELELELRRLENERDELTAAYKEAEAG  479

Query  481  RKAEEQRAQRMSAEMAQYRHDMERRLTEKEEEVEALRKQMSIEIEQLNSRLVEAETRLKT  540
            RKAEEQR QR++A+  QYRHD ERRL EK+EE+EA+RKQ SIEIEQLN+R++EAETRLKT
Sbjct  480  RKAEEQRGQRLAADFNQYRHDAERRLAEKDEEIEAIRKQTSIEIEQLNARVIEAETRLKT  539

Query  541  EVTRIKKKMTITITELEMSLDVANKNNIELQKTVKRQSLQLTELQGHYDEIQRQLQVTLD  600
            EVTRIKKK+ I ITELEMSLDVANK NI+LQK +K+QSLQLTELQ HY+++QRQLQ TLD
Sbjct  540  EVTRIKKKLQIQITELEMSLDVANKTNIDLQKVIKKQSLQLTELQAHYEDVQRQLQATLD  599

Query  601  QYGAAQRRLQSLTAEMEEVRGNMDAALRGRRAAELSLEEASTRINELTTMNVNLTSTKSR  660
            QY  AQRRL  L  E+EEVR ++D+A R +R  EL  EEA++RINELTT NV+L S KS+
Sbjct  600  QYAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRINELTTANVSLVSIKSK  659

Query  661  LEQELGTISSDYEEVSKELKLVDERYQKVSIEFKRSVEILHEEQERIVKIESIKKSLEIE  720
            LEQEL  ++SDYEEVSKEL++ DERYQKV +E K  VE +HEEQERIVK+E+IKKSLE+E
Sbjct  660  LEQELSVVASDYEEVSKELRISDERYQKVQVELKHVVEQVHEEQERIVKLETIKKSLEVE  719

Query  721  VKNLTIRLEEVEANALAGGRRIISKLEARVRDMEMELDEEKRRHSETTKILRKKERVVKE  780
            VKNL+IRLEEVE NA+AG +RIISKLEAR+RD+E+EL+EEKRRH+ET KILRKKER VKE
Sbjct  720  VKNLSIRLEEVELNAVAGSKRIISKLEARIRDLELELEEEKRRHAETIKILRKKERTVKE  779

Query  781  LQIQFEDDHKNVVMLQEALDKTGQKVSIYKRQLQEQEGMSQQSLTRVRRFQRELDAAEER  840
            + +Q E+D KN+++LQ+ALDK+  K++IY+RQL EQEG+SQQ+ TRVRRFQREL+AAE+R
Sbjct  780  VLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQEGVSQQTTTRVRRFQRELEAAEDR  839

Query  841  AESAESNLSLIRAKHRSFVTSTVAPAGSVMVVQETRT  877
            A++AES+L++IRAKHR+FVT++  P   V + + TRT
Sbjct  840  ADTAESSLNIIRAKHRTFVTTSTVPGSQVYIQETTRT  876


>MYSP_CAEEL unnamed protein product
Length=872

 Score = 751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/860 (49%), Positives = 602/860 (70%), Gaps = 6/860 (1%)

Query  15   KSSGGGTRGDADVTIEYSTDLTALSRLEDKIRLLQEDLEAERELRQRIEREKADYSVQVL  74
            +++ G   G   V      DL +L+RLEDKIRLLQEDLE+ERELR R+ERE+AD SVQV+
Sbjct  17   QAAFGAPFGSMSVA-----DLGSLTRLEDKIRLLQEDLESERELRNRVERERADLSVQVI  71

Query  75   QLSERLEEAEGGVEGQLEINRKRDAELAKLRKLLEDVHMESEETVHILRRKHQEAVADFQ  134
             L++RLE+AEG  + Q+E NRKR+ EL+KLRKLLE+  +ESE+ +++LR+KHQ++  D+Q
Sbjct  72   ALTDRLEDAEGTTDSQIESNRKREGELSKLRKLLEESQLESEDAMNVLRKKHQDSCLDYQ  131

Query  135  EQIDQLAKIKSKAEKEKTKFQQEVFELLSQVEIINKEKVVAVKQVEKLEIHVHELNIKIE  194
            +QI+QL K  +K ++E+ + Q EV EL + ++ + K+K  A K  E+ E   +EL  K+E
Sbjct  132  DQIEQLQKKNAKIDRERQRVQHEVIELTATIDQLQKDKHTAEKAAERFEAQANELANKVE  191

Query  195  EYNRTIVDITNIKARISQENIELVKEVQDLKVSIEHITYQRSQVVSQLEEARRRLEDEDR  254
            + N+ + D+   + R+  EN +L+KEV D KV ++++ + +  +  QLEEARRRLED +R
Sbjct  192  DLNKHVNDLAQQRQRLQAENNDLLKEVHDQKVQLDNLQHVKYTLAQQLEEARRRLEDAER  251

Query  255  RRSTLESQLHTVELELESVRVQLEEEAEARLDMERQLMKATGDVQAWRTKYEAEAHARHE  314
             RS L+SQLH V+LEL+SVR  L+EE+ AR D E +L  A  ++  W++K++AE    HE
Sbjct  252  ERSQLQSQLHQVQLELDSVRTALDEESIARSDAEHKLNLANTEITQWKSKFDAEVALHHE  311

Query  315  ELEEMRRKFQARLTEQEEHISALMAKVGGLEKQKSRLQSEVEVLIIDLEKANNTARELQK  374
            E+E++R+K   +  E EE I  ++ K+  LEK KSRLQSEVEVLI+DLEKA NT   L++
Sbjct  312  EVEDLRKKMLQKQAEYEEQIEIMLQKISQLEKAKSRLQSEVEVLIVDLEKAQNTIALLER  371

Query  375  RSEQLERLTIDLRSKLEELTVLYETSTKELRVKTQMLTQITHELDKTREHKDALARENKK  434
              EQLER   +L+ +++E+TV  E + +ELR     L ++ H  +K  E K+ALARENKK
Sbjct  372  AREQLERQVGELKVRIDEITVELEAAQRELRAVNAELQKMKHLYEKAVEQKEALARENKK  431

Query  435  LTDDLHDTKNQLTDYTRKYHELEIECRRLENERDELSAAYREAEAGRKAEEQRAQRMSAE  494
            L D+LH+ K  L D  RK HEL++E  RL  E  EL  A +EA+A R+  E RAQR  AE
Sbjct  432  LHDELHEAKEALADANRKLHELDLENARLAGEIRELQTALKEADAQRRDAENRAQRALAE  491

Query  495  MAQYRHDMERRLTEKEEEVEALRKQMSIEIEQLNSRLVEAETRLKTEVTRIKKKMTITIT  554
            +   R +MERRL EKEEE+EALRK +  EI++L + L +AE R+K+E++R+KKK    I 
Sbjct  492  LQALRIEMERRLQEKEEEMEALRKNLQFEIDRLIAALADAEARMKSEISRLKKKYQAEIA  551

Query  555  ELEMSLDVANKNNIELQKTVKRQSLQLTELQGHYDEIQRQLQVTLDQYGAAQRRLQSLTA  614
            ELEM++D  N+ NIE QKT+K+QS QL  LQ   ++ QRQLQ  LDQY  AQR++ +L+A
Sbjct  552  ELEMTVDNLNRANIEAQKTIKKQSEQLKILQASLEDTQRQLQQVLDQYALAQRKVAALSA  611

Query  615  EMEEVRGNMDAALRGRRAAELSLEEASTRINELTTMNVNLTSTKSRLEQELGTISSDYEE  674
            E+EE +  +D A+R R+ AE+ LEEA+ RI++L ++N NLTS K++LE EL T  +D +E
Sbjct  612  ELEECKTALDNAIRARKQAEVDLEEANGRISDLISINNNLTSIKNKLETELSTAQADLDE  671

Query  675  VSKELKLVDERYQKVSIEFKRSVEILHEEQERIVKIESIKKSLEIEVKNLTIRLEEVEAN  734
            V+KEL   DER  +   +  R+VE LHEEQE  +KI++++KSLE +VK L ++++E EA 
Sbjct  672  VTKELHAADERANRALADAARAVEQLHEEQEHSMKIDALRKSLEEQVKQLQVQIQEAEAA  731

Query  735  ALAGGRRIISKLEARVRDMEMELDEEKRRHSETTKILRKKERVVKELQIQFEDDHKNVVM  794
            AL GG+R+I+KLE R+RD+E  LDEE RRH ET   LRKK+R +KE+Q   +++HKN VM
Sbjct  732  ALLGGKRVIAKLETRIRDLETALDEETRRHKETQNALRKKDRRIKEVQQLVDEEHKNFVM  791

Query  795  LQEALDKTGQKVSIYKRQLQEQEGMSQQSLTRVRRFQRELDAAEERAESAESNLSLIRAK  854
             Q+  D+  +K++I KRQL E E ++ Q+L RVRR+Q EL+ AE RA+ AES+L LIRAK
Sbjct  792  AQDTADRLTEKLNIQKRQLAESESVTMQNLQRVRRYQHELEDAEGRADQAESSLHLIRAK  851

Query  855  HRSFVTSTVAPAGSVMVVQE  874
            HRS V  T   +  + V ++
Sbjct  852  HRSSVV-TGKSSSKIFVTED  870


>MYSP2_DROME unnamed protein product
Length=640

 Score = 491 bits (1265),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 249/360 (69%), Positives = 310/360 (86%), Gaps = 0/360 (0%)

Query  518  KQMSIEIEQLNSRLVEAETRLKTEVTRIKKKMTITITELEMSLDVANKNNIELQKTVKRQ  577
            KQ SIEIEQLN+R++EAETRLKTEVTRIKKK+ I ITELEMSLDVANK NI+LQK +K+Q
Sbjct  278  KQTSIEIEQLNARVIEAETRLKTEVTRIKKKLQIQITELEMSLDVANKTNIDLQKVIKKQ  337

Query  578  SLQLTELQGHYDEIQRQLQVTLDQYGAAQRRLQSLTAEMEEVRGNMDAALRGRRAAELSL  637
            SLQLTELQ HY+++QRQLQ TLDQY  AQRRL  L  E+EEVR ++D+A R +R  EL  
Sbjct  338  SLQLTELQAHYEDVQRQLQATLDQYAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQY  397

Query  638  EEASTRINELTTMNVNLTSTKSRLEQELGTISSDYEEVSKELKLVDERYQKVSIEFKRSV  697
            EEA++RINELTT NV+L S KS+LEQEL  ++SDYEEVSKEL++ DERYQKV +E K  V
Sbjct  398  EEAASRINELTTANVSLVSIKSKLEQELSVVASDYEEVSKELRISDERYQKVQVELKHVV  457

Query  698  EILHEEQERIVKIESIKKSLEIEVKNLTIRLEEVEANALAGGRRIISKLEARVRDMEMEL  757
            E +HEEQERIVK+E+IKKSLE+EVKNL+IRLEEVE NA+AG +RIISKLEAR+RD+E+EL
Sbjct  458  EQVHEEQERIVKLETIKKSLEVEVKNLSIRLEEVELNAVAGSKRIISKLEARIRDLELEL  517

Query  758  DEEKRRHSETTKILRKKERVVKELQIQFEDDHKNVVMLQEALDKTGQKVSIYKRQLQEQE  817
            +EEKRRH+ET KILRKKER VKE+ +Q E+D KN+++LQ+ALDK+  K++IY+RQL EQE
Sbjct  518  EEEKRRHAETIKILRKKERTVKEVLVQCEEDQKNLILLQDALDKSTAKINIYRRQLSEQE  577

Query  818  GMSQQSLTRVRRFQRELDAAEERAESAESNLSLIRAKHRSFVTSTVAPAGSVMVVQETRT  877
            G+SQQ+ TRVRRFQREL+AAE+RA++AES+L++IRAKHR+FVT++  P   V + + TRT
Sbjct  578  GVSQQTTTRVRRFQRELEAAEDRADTAESSLNIIRAKHRTFVTTSTVPGSQVYIQETTRT  637


 Score = 30.4 bits (67),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 46/204 (23%), Positives = 98/204 (48%), Gaps = 5/204 (2%)

Query  348  KSRLQSEVEVLIIDLEKANNTARELQKRSEQLERLTIDLRSKLEELTVLYETSTKELRVK  407
            K +LQ ++  L + L+ AN T  +LQK  ++      +L++  E++    + +  +  V 
Sbjct  306  KKKLQIQITELEMSLDVANKTNIDLQKVIKKQSLQLTELQAHYEDVQRQLQATLDQYAVA  365

Query  408  TQMLTQITHELDKTREHKDALARENKKLTDDLHDTKNQLTDYTRKYHELEIECRRLENER  467
             + L  +  EL++ R H D+  R  + +     +  +++ + T     L     +LE E 
Sbjct  366  QRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRINELTTANVSLVSIKSKLEQEL  425

Query  468  DELSAAYREAEAGRKAEEQRAQRMSAEMAQYRHDMERRLTEKEE--EVEALRKQMSIEIE  525
              +++ Y E     +  ++R Q++  E+   +H +E+   E+E   ++E ++K + +E++
Sbjct  426  SVVASDYEEVSKELRISDERYQKVQVEL---KHVVEQVHEEQERIVKLETIKKSLEVEVK  482

Query  526  QLNSRLVEAETRLKTEVTRIKKKM  549
             L+ RL E E        RI  K+
Sbjct  483  NLSIRLEEVELNAVAGSKRIISKL  506



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000080-PA

Length=358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RDX_DROME  unnamed protein product                                    191     3e-54
MEL26_CAEEL  unnamed protein product                                  98.6    8e-23
K8F7T2_CAEEL  unnamed protein product                                 94.7    2e-21


>RDX_DROME unnamed protein product
Length=829

 Score = 191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 122/344 (35%), Positives = 181/344 (53%), Gaps = 27/344 (8%)

Query  20   RVVKFRYKWSVRSFIGRREKTGHKMSAPAFLTEPLVRASWSLDLYPRGDGQESQDYLSIH  79
            +VVKF Y W++ +F   RE+ G  + +  F      +  W L + P+G  +ES+DYLS++
Sbjct  483  KVVKFSYMWTINNFSFCREEMGEVLKSSTFSAGANDKLKWCLRVNPKGLDEESKDYLSLY  542

Query  80   LRLLDADNFEAASVKVAFSILDYRGDTLLTTLADRLVSNGRPVGWGWSRFVRRDMLMKKD  139
            L L+  +  E  + K  FSIL+ + +      + R     +   WG+ +F+RRD L+ + 
Sbjct  543  LLLVSCNKSEVRA-KFKFSILNAKREETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEA  601

Query  140  LGLLAKDGTLNLMCEVSVAEDPTAAPSQQVLSPGPAPGNPM-EDLGSLLNSPRFSDVVLV  198
             GLL +D  L + CEVSV  D      Q  +     P   + EDLG+L ++ +FSDV L 
Sbjct  602  NGLLPED-KLTIFCEVSVVADSVNISGQSNIVQFKVPECKLSEDLGNLFDNEKFSDVTLS  660

Query  199  PS-----------------FGIIFESDALKDETNDEKRDTKVVEIPDVTPEVLEQMLHYI  241
                               F  +FE +        E+R    V I DV  EVL++ML +I
Sbjct  661  VGGREFQAHKAILAARSDVFAAMFEHEM-------EERKLNRVAITDVDHEVLKEMLRFI  713

Query  242  YTGRIPRLDSLGRQLLVAAEKYGLDKMKEVCEGNLMRAFTVSNAVDLLDLADMHDADMLK  301
            YTG+ P L+ +   LL AA+KY L+K+K +CE  L    +V  A + L LAD+H AD LK
Sbjct  714  YTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQLK  773

Query  302  GAVIEFINRNAAEVMATEAWKAMIVSRPQLLADLFKALADPDIP  345
               I+FIN +A +VM T  W+ MI +   L+A+ F+ALA   IP
Sbjct  774  AQTIDFINTHATDVMETSGWQNMITTHSHLIAEAFRALATQQIP  817


>MEL26_CAEEL unnamed protein product
Length=395

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 72/337 (21%), Positives = 158/337 (47%), Gaps = 32/337 (9%)

Query  20   RVVKFRYKWSVRSFIGRREKTGHKMSAPAFLTEPLVRASWSLDLYPRGDGQESQDYLSIH  79
            +V K ++ W+V++F    ++    +    +L     + +WS+ +YP+G+G+ ++D++ + 
Sbjct  38   KVEKVQHTWTVKNFSHCYQEY---LENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLC  94

Query  80   LRLLDADNFEAASVKVAFSILDYRGDTLLTTLADRLVS---NGRPVGWGWSRFVRRDMLM  136
            L  +  +N +A  +        ++    L T  ++ +    +  P    +  +++RD+L 
Sbjct  95   LNRVINNNVKAGKI-------GFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLF  147

Query  137  KKDLGLLAKDGTLNLMCEVSVAEDPTAAPSQQV-LSPGPAPGNPMEDLGSLLNSPRFSDV  195
             +   ++ +D  + +  E+ VA +     ++ +   P  +    +ED   L +     D 
Sbjct  148  PQ---IMPRDMII-VNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDF  203

Query  196  VLVPSFGIIFESDA------------LKDETNDEKRDTKVVEIPDVTPEVLEQMLHYIYT  243
             +  +  II    A            L  +  DE + + ++ I D+  +V+ +M++YIY 
Sbjct  204  AINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAK-SSMMYINDMDYDVIYEMVYYIYC  262

Query  244  GRIPR-LDSLGRQLLVAAEKYGLDKMKEVCEGNLMRAFTVSNAVDLLDLADMHDADMLKG  302
            GR  + +  +   LL+AA+KY L+++K  CE  L+    + NA  LL + D++ A  L+ 
Sbjct  263  GRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRK  322

Query  303  AVIEFINRNAAEVMATEAWKAMIVSRPQLLADLFKAL  339
              + +I      V  T  W+ ++   P L+ D+F  +
Sbjct  323  RAVTYILARPKNVTGTPGWEDILKGHPNLITDIFSQI  359


>K8F7T2_CAEEL unnamed protein product
Length=399

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/341 (21%), Positives = 161/341 (47%), Gaps = 36/341 (11%)

Query  20   RVVKFRYKWSVRSFIGRREKTGHKMSAPAFLTEPLVRASWSLDLYPRGDGQESQDYLSIH  79
            +V K ++ W+V++F    ++    +    +L     + +WS+ +YP+G+G+ ++D++ + 
Sbjct  38   KVEKVQHTWTVKNFSHCYQEY---LENFVYLQRGDEQLTWSIKIYPKGNGENNKDFVFLC  94

Query  80   LRLLDADNFEAASVKVAFSILDYRGDTLLTTLADRLVS---NGRPVGWGWSRFVRRDMLM  136
            L  +  +N +A  +        ++    L T  ++ +    +  P    +  +++RD+L 
Sbjct  95   LNRVINNNVKAGKI-------GFKSQFKLRTAENKDIEMRIHPNPSHSDYVSYIKRDVLF  147

Query  137  KKDLGLLAKDGTLNLMCEVSVAEDPTAAPSQQV-LSPGPAPGNPMEDLGSLLNSPRFSDV  195
             +   ++ +D  + +  E+ VA +     ++ +   P  +    +ED   L +     D 
Sbjct  148  PQ---IMPRDMII-VNVEIDVAVETITTTNEPIQFEPTNSEQQLIEDYQRLFSQELLCDF  203

Query  196  VLVPSFGIIFESDA------------LKDETNDEKRDTKVVEIPDVTPEVLEQMLHYIYT  243
             +  +  II    A            L  +  DE + + ++ I D+  +V+ +M++YIY 
Sbjct  204  AINVNGKIIRAHKAVLAARSPVFNAMLTHQDTDEAK-SSMMYINDMDYDVIYEMVYYIYC  262

Query  244  GRIPR-LDSLGRQLLVAAEKYGLDKMKEVCEGNLMRAFTVSNAVDLLDLADMHDADMLK-  301
            GR  + +  +   LL+AA+KY L+++K  CE  L+    + NA  LL + D++ A  L+ 
Sbjct  263  GRCNKDITDMATALLIAADKYRLEELKSHCEKYLVENINIENACSLLIIGDLYSAPKLRK  322

Query  302  ---GAVIEFINRNAAEVMATEAWKAMIVSRPQLLADLFKAL  339
                +++++I      V  T  W+ ++   P L+ D+F  +
Sbjct  323  RAVTSLLQYILARPKNVTGTPGWEDILKGHPNLITDIFSQI  363



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000081-PA

Length=766


***** No hits found *****



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000082-PA

Length=827
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NFP9_DROME  unnamed protein product                                 417     4e-130
Q9VSQ0_DROME  unnamed protein product                                 417     5e-129
Q8SY43_DROME  unnamed protein product                                 417     5e-129


>M9NFP9_DROME unnamed protein product
Length=1152

 Score = 417 bits (1072),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 239/417 (57%), Positives = 298/417 (71%), Gaps = 35/417 (8%)

Query  13   LDDTALQLYKDGDYGTYLDLEASISEQHEDFEGFQNNRKNAIVLRTQLSVRVHTIIEKLL  72
            +DD A+Q+YKDGDYG YLDLE+S++EQ E+ EG   +RKN++V+RTQL+VRV  IIEKLL
Sbjct  64   IDDAAIQVYKDGDYGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLL  123

Query  73   NSEGRDLRRALFSLKQIFQEDKDLVHEFVQNEGLACLMKVGSEADQNYQNYILRGKCVVL  132
            +++G DLRRALFSLKQ+FQEDKDLVH FV   GL CL++VG+ ADQNYQNYILR      
Sbjct  124  SAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILR------  177

Query  133  ALGQVMLYVDGMNGVMEHNETVQWLYSLVASKFRLVVKTALKLLLVFVEYVESNCMLLIR  192
            ALGQVMLYVDGMNGVM+H  T+QWLYSL+AS +R VVKTALKLLLVFVEY ESNC +L+ 
Sbjct  178  ALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYAESNCYVLVS  237

Query  193  AVHSVDTSRGLLPWHNVMRLLKENDTTDTELLVFAMTLVNKVLNATNDQDTYYDQVDKME  252
            A+H+VD S+G LPW N+MRLLK+ D  D EL+++A +L+NK L   NDQD++YD+ D +E
Sbjct  238  AIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLE  297

Query  253  EQGMEQIIHCYMSKPGVDLDLLCQFQLYEAVLRHEDGEEENVPIKLDDSTRQKLKSRKSV  312
            +QGME +I  YMSKPG DLDLL Q QLYEAVL+ EDGE +   +   +S R+  + R   
Sbjct  298  QQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGESDGQRLP-QNSMRKTQRYRPG-  355

Query  313  LDVESTERRKSRRHSTNSYSSPNNNNSSGPVLV---TPQQNQIRRVSREESGSSSETSSS  369
                +TERRKSRRHST+  +SP +     P  V   TP Q     V  + SGS++ T  S
Sbjct  356  --ANTTERRKSRRHSTD--NSPASLTKVLPTTVLRMTPTQAT---VDEDSSGSTNSTEFS  408

Query  370  HSASPAPNDRSIAIHMNGSCNDRSVGD-AGVTPALRRRRERVQRQRSFLKEQQESAA  425
                             G  N++   D AGVTP LRRRRER +R +SFLKEQQE+AA
Sbjct  409  ----------------GGLFNEKKPRDGAGVTPGLRRRRERAERHKSFLKEQQEAAA  449


 Score = 219 bits (558),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 193/322 (60%), Gaps = 45/322 (14%)

Query  508  VIQLTRENTVKDLTQKLS-AGQSPQGTGPEEKAARIGDLSGIISKAKEGLAKSKSRPDLK  566
            ++QL R++TVKDLTQKLS    SP  T      A +GD+SG+ISKAKEGLAKSKS+ ++ 
Sbjct  472  LLQLKRDHTVKDLTQKLSNLPMSP--TQDSANRALVGDMSGLISKAKEGLAKSKSKGEIS  529

Query  567  APTSPPALDIGKPEPPKKSENELQWESLVTNLTRPLFLCDLDFSDLKSEDDVSVLVSEAV  626
              +S    D+ K EP KKSENEL WE LV N+TRPL LCDLDF+DL+ +D+  VL   ++
Sbjct  530  RSSSVDQ-DVKKSEP-KKSENELHWEELVRNMTRPLNLCDLDFTDLRDDDEKDVLAPRSL  587

Query  627  SNGLPPPPPPPPGVAPPPPPPAKVPPALPSTPTTPSNSSFGVSLRH--HQLCGS---GLR  681
                       P   PP       PP +P +   P    +G SL +  + L GS    L 
Sbjct  588  GA-------GIPPPPPPLGGAIAPPPMMPPSLAPPPMYGYGGSLTNSVNSLNGSINGELV  640

Query  682  NANSQPQPPAQPQPPPPPKKTKKTVKLFWKEVRDDPCAAVKLQKSGLIWDDITPVQLDVQ  741
            N N+              KK KKTVKLFWKEVR+D    V       IWD++    +D Q
Sbjct  641  NGNN------------TIKKNKKTVKLFWKEVREDMIPQV---VGKTIWDELPDANVDTQ  685

Query  742  RLEHLFENRAKDLLSKNIQVCKHCHFSMQKQQEMNKAKEITVLDPKRSNAINIGMTKLPP  801
            +LEHLFE+RAKDL++K             KQQE+NK+KEI VLD KRSNAINI +TKLPP
Sbjct  686  KLEHLFESRAKDLMTK-------------KQQELNKSKEIIVLDHKRSNAINIAITKLPP  732

Query  802  SRTIKGAIMKMDISIINREGIE  823
             R IK AI+KMD +++ REGI+
Sbjct  733  PRAIKTAILKMDATVVTREGID  754


>Q9VSQ0_DROME unnamed protein product
Length=1294

 Score = 417 bits (1072),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 239/417 (57%), Positives = 298/417 (71%), Gaps = 35/417 (8%)

Query  13   LDDTALQLYKDGDYGTYLDLEASISEQHEDFEGFQNNRKNAIVLRTQLSVRVHTIIEKLL  72
            +DD A+Q+YKDGDYG YLDLE+S++EQ E+ EG   +RKN++V+RTQL+VRV  IIEKLL
Sbjct  64   IDDAAIQVYKDGDYGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLL  123

Query  73   NSEGRDLRRALFSLKQIFQEDKDLVHEFVQNEGLACLMKVGSEADQNYQNYILRGKCVVL  132
            +++G DLRRALFSLKQ+FQEDKDLVH FV   GL CL++VG+ ADQNYQNYILR      
Sbjct  124  SAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILR------  177

Query  133  ALGQVMLYVDGMNGVMEHNETVQWLYSLVASKFRLVVKTALKLLLVFVEYVESNCMLLIR  192
            ALGQVMLYVDGMNGVM+H  T+QWLYSL+AS +R VVKTALKLLLVFVEY ESNC +L+ 
Sbjct  178  ALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYAESNCYVLVS  237

Query  193  AVHSVDTSRGLLPWHNVMRLLKENDTTDTELLVFAMTLVNKVLNATNDQDTYYDQVDKME  252
            A+H+VD S+G LPW N+MRLLK+ D  D EL+++A +L+NK L   NDQD++YD+ D +E
Sbjct  238  AIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLE  297

Query  253  EQGMEQIIHCYMSKPGVDLDLLCQFQLYEAVLRHEDGEEENVPIKLDDSTRQKLKSRKSV  312
            +QGME +I  YMSKPG DLDLL Q QLYEAVL+ EDGE +   +   +S R+  + R   
Sbjct  298  QQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGESDGQRLP-QNSMRKTQRYRPG-  355

Query  313  LDVESTERRKSRRHSTNSYSSPNNNNSSGPVLV---TPQQNQIRRVSREESGSSSETSSS  369
                +TERRKSRRHST+  +SP +     P  V   TP Q     V  + SGS++ T  S
Sbjct  356  --ANTTERRKSRRHSTD--NSPASLTKVLPTTVLRMTPTQ---ATVDEDSSGSTNSTEFS  408

Query  370  HSASPAPNDRSIAIHMNGSCNDRSVGD-AGVTPALRRRRERVQRQRSFLKEQQESAA  425
                             G  N++   D AGVTP LRRRRER +R +SFLKEQQE+AA
Sbjct  409  ----------------GGLFNEKKPRDGAGVTPGLRRRRERAERHKSFLKEQQEAAA  449


 Score = 112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 5/116 (4%)

Query  508  VIQLTRENTVKDLTQKLS-AGQSPQGTGPEEKAARIGDLSGIISKAKEGLAKSKSRPDLK  566
            ++QL R++TVKDLTQKLS    SP  T      A +GD+SG+ISKAKEGLAKSKS+ ++ 
Sbjct  713  LLQLKRDHTVKDLTQKLSNLPMSP--TQDSANRALVGDMSGLISKAKEGLAKSKSKGEIS  770

Query  567  APTSPPALDIGKPEPPKKSENELQWESLVTNLTRPLFLCDLDFSDLKSEDDVSVLV  622
              +S    D+ K EP KKSENEL WE LV N+TRPL LCDLDF+DL+ +D+  VL 
Sbjct  771  RSSSVDQ-DVKKSEP-KKSENELHWEELVRNMTRPLNLCDLDFTDLRDDDEKDVLA  824


>Q8SY43_DROME unnamed protein product
Length=1294

 Score = 417 bits (1072),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 239/417 (57%), Positives = 298/417 (71%), Gaps = 35/417 (8%)

Query  13   LDDTALQLYKDGDYGTYLDLEASISEQHEDFEGFQNNRKNAIVLRTQLSVRVHTIIEKLL  72
            +DD A+Q+YKDGDYG YLDLE+S++EQ E+ EG   +RKN++V+RTQL+VRV  IIEKLL
Sbjct  64   IDDAAIQVYKDGDYGAYLDLESSLAEQAEEIEGVNVSRKNSLVVRTQLNVRVQAIIEKLL  123

Query  73   NSEGRDLRRALFSLKQIFQEDKDLVHEFVQNEGLACLMKVGSEADQNYQNYILRGKCVVL  132
            +++G DLRRALFSLKQ+FQEDKDLVH FV   GL CL++VG+ ADQNYQNYILR      
Sbjct  124  SAQGSDLRRALFSLKQVFQEDKDLVHAFVALGGLNCLVRVGNCADQNYQNYILR------  177

Query  133  ALGQVMLYVDGMNGVMEHNETVQWLYSLVASKFRLVVKTALKLLLVFVEYVESNCMLLIR  192
            ALGQVMLYVDGMNGVM+H  T+QWLYSL+AS +R VVKTALKLLLVFVEY ESNC +L+ 
Sbjct  178  ALGQVMLYVDGMNGVMKHEPTMQWLYSLIASNYRSVVKTALKLLLVFVEYAESNCYVLVS  237

Query  193  AVHSVDTSRGLLPWHNVMRLLKENDTTDTELLVFAMTLVNKVLNATNDQDTYYDQVDKME  252
            A+H+VD S+G LPW N+MRLLK+ D  D EL+++A +L+NK L   NDQD++YD+ D +E
Sbjct  238  AIHAVDASQGTLPWSNIMRLLKDYDNADAELVIYATSLINKTLAGLNDQDSFYDESDLLE  297

Query  253  EQGMEQIIHCYMSKPGVDLDLLCQFQLYEAVLRHEDGEEENVPIKLDDSTRQKLKSRKSV  312
            +QGME +I  YMSKPG DLDLL Q QLYEAVL+ EDGE +   +   +S R+  + R   
Sbjct  298  QQGMETVIQRYMSKPGTDLDLLDQLQLYEAVLKFEDGESDGQRLP-QNSMRKTQRYRPG-  355

Query  313  LDVESTERRKSRRHSTNSYSSPNNNNSSGPVLV---TPQQNQIRRVSREESGSSSETSSS  369
                +TERRKSRRHST+  +SP +     P  V   TP Q     V  + SGS++ T  S
Sbjct  356  --ANTTERRKSRRHSTD--NSPASLTKVLPTTVLRMTPTQ---ATVDEDSSGSTNSTEFS  408

Query  370  HSASPAPNDRSIAIHMNGSCNDRSVGD-AGVTPALRRRRERVQRQRSFLKEQQESAA  425
                             G  N++   D AGVTP LRRRRER +R +SFLKEQQE+AA
Sbjct  409  ----------------GGLFNEKKPRDGAGVTPGLRRRRERAERHKSFLKEQQEAAA  449


 Score = 112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 5/116 (4%)

Query  508  VIQLTRENTVKDLTQKLS-AGQSPQGTGPEEKAARIGDLSGIISKAKEGLAKSKSRPDLK  566
            ++QL R++TVKDLTQKLS    SP  T      A +GD+SG+ISKAKEGLAKSKS+ ++ 
Sbjct  713  LLQLKRDHTVKDLTQKLSNLPMSP--TQDSANRALVGDMSGLISKAKEGLAKSKSKGEIS  770

Query  567  APTSPPALDIGKPEPPKKSENELQWESLVTNLTRPLFLCDLDFSDLKSEDDVSVLV  622
              +S    D+ K EP KKSENEL WE LV N+TRPL LCDLDF+DL+ +D+  VL 
Sbjct  771  RSSSVDQ-DVKKSEP-KKSENELHWEELVRNMTRPLNLCDLDFTDLRDDDEKDVLA  824



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000083-PA

Length=3301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY08_DROME  unnamed protein product                                 581     0.0   
Q6NR10_DROME  unnamed protein product                                 581     0.0   
Q9VY02_DROME  unnamed protein product                                 513     1e-160


>Q9VY08_DROME unnamed protein product
Length=703

 Score = 581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/573 (50%), Positives = 384/573 (67%), Gaps = 15/573 (3%)

Query  639   YGEFDFVVVGGGSAGAVLANRLSEVPEWKVLLVEAGGEEPRIAQVPYLAPILQKTDIDWS  698
             Y E+DF+VVG GSAGAV+ANRLSEV +WKVLL+EAG +E  I+ VP LA  LQ + +DW+
Sbjct  54    YPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWA  113

Query  699   YYTEKDGSTCLSLDNEVSFWPRGKVLGGSSVLNYMQYVRGNRRDYDLWESLGNPKWGYDD  758
             Y TE     CL + N    WPRG+VLGGSSVLNYM YVRGNR DYD W SLGNP W YD+
Sbjct  114   YKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDN  173

Query  759   VLPYFKKSEDFQGEKDHPEDMDYHGKGGYLTVQGTGTFKTPLADILLEGAKAMGYEIRDC  818
             VL YFKKSED      +  +  YHG+GG LTVQ +  + +PL    +E    +GY+ RD 
Sbjct  174   VLRYFKKSED--NRNPYLANNKYHGRGGLLTVQES-PWHSPLVAAFVEAGTQLGYDNRDI  230

Query  819   NGKTQTGFMLSQRTTRDGERCSTAKAFIDPIRGRRNLHISTFSHVHRIHIDAETKQAKAV  878
             NG  Q GFM++Q T R G RCSTAKAF+ PIR R+N H+S  SHV R+ I+  T +A+AV
Sbjct  231   NGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAV  290

Query  879   VFKKDGRLFVARARKEIVLSAGSIGSPQLLLLSGVGPKKHLDDIGVLVVQDLPGVGQNLQ  938
              F K G+++   AR+E+++SAG+I +PQL++LSG+GP+KHL+  G+ V+QDLP VG+N+Q
Sbjct  291   EFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQ  349

Query  939   DHVTTALLFMGETGGIMDVPKALHPHNL------LSWLSHRSSPLSVPATIDVMGFFHTK  992
             DHV      MG    ++D P A+             ++     P++    ++ + F HT 
Sbjct  350   DHVG-----MGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTP  404

Query  993   YSNPSEDWPDVQFIALSTSVLGDPSAMERPPYSIAKDAFQSNFGDIMGKEAWSAVPILMR  1052
             YSN S DWPD+QF     S+  D  A  +    + +  +Q  +  I  K++W+ +P+L+R
Sbjct  405   YSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLR  464

Query  1053  PKSRGYLQLKSLDPESHPVMYPNYYSDEQDVKTMVEGCKFLAELARTEPLQGIKSEIWKR  1112
             P+SRG ++L+S +P  +P++  NY+ D  D KT+VEG K    +A  +  +   S +W++
Sbjct  465   PRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRK  524

Query  1113  PFPGCEGHEFGSDDFWECHIRHLTMTTYHPVGTCKMGPDTDDQAVLDPRLRVRGIKGLRV  1172
             P P C+ H+F SD + ECH+R ++MT YHP GT KMGP  D +AV+DPRLRV G++GLRV
Sbjct  525   PLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRV  584

Query  1173  VDASIMPTLVSGNTNAPTIMIGEKGADLIKEDW  1205
             +DASIMPT+ SGNTNAP IMI EKGADLIKEDW
Sbjct  585   IDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


 Score = 547 bits (1410),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 280/576 (49%), Positives = 373/576 (65%), Gaps = 6/576 (1%)

Query  1811  QVTPYGEFDFIVVGAGSAGAVVANRLSEVPEWKVLLVEAGGEAPRMTDVPYLALVAQRTP  1870
             Q+  Y E+DFIVVG+GSAGAVVANRLSEV +WKVLL+EAG +   ++DVP LA   Q + 
Sbjct  50    QLNLYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSK  109

Query  1871  IDWGYYPEKDGRTCLSLDNQTSYWPRGKVLGGTSVLNFMQYVRGNRHDYDLWRSLGNPGW  1930
             +DW Y  E   + CL + N    WPRG+VLGG+SVLN+M YVRGNRHDYD W SLGNPGW
Sbjct  110   LDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGW  169

Query  1931  GYDDVLPYFKKSEDYQGETCGVNMEYHGKGGYLGVQGSDPFKSKLADILIEAGKEMGYPK  1990
              YD+VL YFKKSED +      N +YHG+GG L VQ S P+ S L    +EAG ++GY  
Sbjct  170   DYDNVLRYFKKSEDNRNPYLA-NNKYHGRGGLLTVQES-PWHSPLVAAFVEAGTQLGYDN  227

Query  1991  RDCNGMNQTGFMFMQRTTRGGARSSTARAFLDPIKGRRNLHIATFAQVVKIHIDERTKQA  2050
             RD NG  Q GFM  Q T R G+R STA+AFL PI+ R+N H++  + V ++ I+  T +A
Sbjct  228   RDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRA  287

Query  2051  HGVFFRQDGKIFLALVRKEVILCAGAIGSPHLLMLSGIGPKKNLQDAGVQVIHDLPGVGQ  2110
               V F + GK++    R+EVI+ AGAI +P L+MLSG+GP+K+L+  G++V+ DLP VG+
Sbjct  288   QAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGE  346

Query  2111  NLQDHVATF-LYVLANTGGALEPLSALHPFSV-LAWLAQMPSPLSTPGGGEVMGFVHTKY  2168
             N+QDHV    L  L +   A+      +P +V   ++ +   P++T GG E + FVHT Y
Sbjct  347   NMQDHVGMGGLTFLVDKPVAIVQ-DRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPY  405

Query  2169  SNPSEDWPDIQFITLSTSPLGDPTAPARPPFAVSKEAFSAVYGEIMGKEAWLLAPLLLRP  2228
             SN S DWPDIQF     S   D  A  +    + +  +  VY  I  K++W + PLLLRP
Sbjct  406   SNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRP  465

Query  2229  ESRGQLILKSSDPDVHPVIYPNYFTHEKDIKVLIEGCKIAEQMTRTRALQGINSQIWMKP  2288
              SRG + L+S++P  +P+I  NYF    D K L+EG KIA ++   +  +   S++W KP
Sbjct  466   RSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKP  525

Query  2289  FPGCENHVPHTDDFWECMLRHKTLTVYHPVGTCKMGHDSDPGAVLDPLLRVRGIRGLRVA  2348
              P C+ H   +D + EC +R  ++T+YHP GT KMG   DP AV+DP LRV G+RGLRV 
Sbjct  526   LPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVI  585

Query  2349  DCAIMPTLVSANTNAGAIMIGEKASDLIKDSWPHKP  2384
             D +IMPT+ S NTNA  IMI EK +DLIK+ W   P
Sbjct  586   DASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNP  621


 Score = 539 bits (1388),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 286/613 (47%), Positives = 382/613 (62%), Gaps = 14/613 (2%)

Query  1200  LIKEDWGAELNGSYSASMMMMVLLTALTASVDMTEGSSP------YGEFDFIVVGAGSAG  1253
             +IK  +G    G +   +M+  +      +VD    S P      Y E+DFIVVG+GSAG
Sbjct  11    VIKSTFGVVTTGLWLIPLMLAAITYYRYDAVD--PESRPLDQLNLYPEYDFIVVGSGSAG  68

Query  1254  AVVANRLSEVPEWKVLLIEAGGEAPRMTDVPFLALLGQRTPIDWGYYPEKDGRTCLALDN  1313
             AVVANRLSEV +WKVLLIEAG +   ++DVP LA   Q + +DW Y  E   + CL + N
Sbjct  69    AVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYKTEPSTKACLGMQN  128

Query  1314  QTSYWARGKVLGGSSVLNYMQYVRGNRHDYDLWRSLGNPGWGYDDLLPYFKKSEDYSGDM  1373
                 W RG+VLGGSSVLNYM YVRGNRHDYD W SLGNPGW YD++L YFKKSED     
Sbjct  129   NRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPY  188

Query  1374  DGVDMEYHGKGGYLGVQGSDPFKSKLADILIEAGKEMGYPKRDCNGMNQTGFMLMQRTTR  1433
                + +YHG+GG L VQ S P+ S L    +EAG ++GY  RD NG  Q GFM+ Q T R
Sbjct  189   LA-NNKYHGRGGLLTVQES-PWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIR  246

Query  1434  GGARCSTARAFLDPIKGRRNLHIATFAQALKVHIDEKTRQAKGVFFRHDGKVFLALARKE  1493
              G+RCSTA+AFL PI+ R+N H++  +   +V I+  T +A+ V F   GKV+   AR+E
Sbjct  247   RGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVYRIAARRE  306

Query  1494  VILCAGAIGSPHLLMLSGIGPKKNMQDAGVQAIHDLPGVGQNLQDHVATF-LYVLANTGG  1552
             VI+ AGAI +P L+MLSG+GP+K+++  G++ + DLP VG+N+QDHV    L  L +   
Sbjct  307   VIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGMGGLTFLVDKPV  365

Query  1553  ALEPLSALHPFSV-LTWMAHAPSALSTPGGAEVMGFVHTKYSNPDKDWPDIQIITISTSP  1611
             A+      +P +V   ++      ++T GG E + FVHT YSN   DWPDIQ      S 
Sbjct  366   AIVQ-DRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASI  424

Query  1612  LGDPMAPMRPPFALSKKAFMAVYGDILEREAWLSAPVLLRPKSRGQLLLKSSDPDVHPVI  1671
               D  A ++    L +  +  VY  I  +++W   P+LLRP+SRG + L+S++P  +P+I
Sbjct  425   NSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLI  484

Query  1672  YPNYFTHEDDMKVLIEGCKIAEQMTRTRALQAIKADLWMKPFPGCENHVPFTDGYWECML  1731
               NYF    D K L+EG KIA ++   +  +   + LW KP P C+ H   +D Y EC +
Sbjct  485   NANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHV  544

Query  1732  LHHTLTVYHPVGTCKMGHDSDPGAVLDPLLRVRGIRGLRVADCAIMPTLVSGNTNAPAIM  1791
                ++T+YHP GT KMG   DP AV+DP LRV G+RGLRV D +IMPT+ SGNTNAP IM
Sbjct  545   RTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIM  604

Query  1792  IGEKASDLIKDSW  1804
             I EK +DLIK+ W
Sbjct  605   IAEKGADLIKEDW  617


 Score = 486 bits (1251),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 250/577 (43%), Positives = 352/577 (61%), Gaps = 25/577 (4%)

Query  2412  ETDFVIVGAGSAGSVVANRLSEITGWDVVVMEAGCHASIVADIPYLAIYLQYTAMDWSYY  2471
             E DF++VG+GSAG+VVANRLSE+  W V+++EAG   + ++D+P LA YLQ + +DW+Y 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  2472  TETDGTYCKSMYKGTCYWPRGLCLGGSGQHNYMQYVRGNRRDYDSWASLGNTGWAYDDVL  2531
             TE     C  M    C WPRG  LGGS   NYM YVRGNR DYD WASLGN GW YD+VL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  2532  QYFIKSEDMRPNGVDYIEKEYHGTGGYMTVQGRCRFESDLAPRLLEAGQQLGYPVRDCNG  2591
             +YF KSED R   +     +YHG GG +TVQ    + S L    +EAG QLGY  RD NG
Sbjct  176   RYFKKSEDNRNPYL--ANNKYHGRGGLLTVQ-ESPWHSPLVAAFVEAGTQLGYDNRDING  232

Query  2592  ANQTGFMLLQSTVRDGRRCGPYESFLEPVKHRQNLHIICYARAEKILFENIGENKRASGV  2651
             A Q GFM+ Q T+R G RC   ++FL P++ R+N H+   +   +++ E      RA  V
Sbjct  233   AKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIE--PGTMRAQAV  290

Query  2652  VFKKDGKRYVVKARKEVILCAGSIGSPHLLMVSGVGPKEDLEQAGVTLVHPNAAVGKNLQ  2711
              F K GK Y + AR+EVI+ AG+I +P L+M+SG+GP++ LE+ G+ ++  +  VG+N+Q
Sbjct  291   EFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQ-DLPVGENMQ  349

Query  2712  DHVA---------APFFILADHNGDLDPLAALSPTSV-LNWTLKKPSPLDCPGACEVIGF  2761
             DHV           P  I+ D           +PT+V   + L++  P+   G  E + F
Sbjct  350   DHVGMGGLTFLVDKPVAIVQDR---------FNPTAVTFQYVLRERGPMTTLGGVEGLAF  400

Query  2762  VHTPSSDISKDPPNIQIIPLSTTTFMDATSLTHTPFSIDTATYRKLYANYTLQRGMIGAP  2821
             VHTP S+ S D P+IQ      +   D  +       +  + Y+++Y     +      P
Sbjct  401   VHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMP  460

Query  2822  VLLHPKSRGCLRIKSGNIWEHPELTPNYFYDPEDMKVLMEGCRIFVNLTKMPALQKINAR  2881
             +LL P+SRG ++++S N + +P +  NYF DP D K L+EG +I + + +    ++  +R
Sbjct  461   LLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSR  520

Query  2882  VVETAPEPCQKYPFNSDQYWDCFIRHFTLTLYHQVGTCKMGPDSDPEAVVSPRLSLYGVQ  2941
             +       C+++ F SD Y +C +R  ++T+YH  GT KMGP  DPEAVV PRL +YGV+
Sbjct  521   LWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVR  580

Query  2942  GLRVVDASVMPTLPSGNTNAPTTMIAEKASDMIKEDW  2978
             GLRV+DAS+MPT+ SGNTNAP  MIAEK +D+IKEDW
Sbjct  581   GLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


 Score = 454 bits (1169),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 253/573 (44%), Positives = 337/573 (59%), Gaps = 38/573 (7%)

Query  34   EYDFVVVGAGSAGAVMARRLSENSKWSVLVLDAGGPAQSAGPVAWLSCRIPYTAFMVQHS  93
            EYDF+VVG+GSAGAV+A RLSE  KW VL+++AG        V       P  A  +Q S
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDV-------PSLAAYLQLS  108

Query  94   PLDFAYYARCPEDTCGAMAGRRSFWPRGKGLGGSSLLNYMLYVRGNRRDYDRWESLGNTG  153
             LD+AY        C  M   R  WPRG+ LGGSS+LNYMLYVRGNR DYD W SLGN G
Sbjct  109  KLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPG  168

Query  154  WGYSEALRYFKKAEGWRRPPADSPPLEKDDHEYFHGTVGPLTV-ETVDKSEMARRFLQAG  212
            W Y   LRYFKK+E  R P           +  +HG  G LTV E+   S +   F++AG
Sbjct  169  WDYDNVLRYFKKSEDNRNPYLA--------NNKYHGRGGLLTVQESPWHSPLVAAFVEAG  220

Query  213  KEMGYAVRDLNGRHQVGFMPAQTTTRDGGRCDTDTAFLNPIRGSRRPNLHVATFATVHKV  272
             ++GY  RD+NG  Q GFM AQ T R G RC T  AFL PIR   R N H++  + V +V
Sbjct  221  TQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIR--MRKNFHLSMNSHVTRV  278

Query  273  LINPKDKKAYGVSYKQDGVIRTVRARKEVILSAGAVGSPQLLLLSGVGPKDHLEDVGVPL  332
            +I P   +A  V + + G +  + AR+EVI+SAGA+ +PQL++LSG+GP+ HLE  G+ +
Sbjct  279  IIEPGTMRAQAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRV  338

Query  333  VHHSPGVGANLQDHL-VAPMIYLTDIEIDSSPKNALTIPSFWVGIVRLFKVTMDGIIENW  391
            +   P VG N+QDH+ +  + +L D                 V IV+  +     +   +
Sbjct  339  LQDLP-VGENMQDHVGMGGLTFLVDKP---------------VAIVQ-DRFNPTAVTFQY  381

Query  392  LMNGKGLLTSAGGVEVLAFVNTD-ANKDKEWPDIQIHFQSTSFLA-LGEIKPTPFGLDPQ  449
            ++  +G +T+ GGVE LAFV+T  +N+  +WPDIQ H    S  +  G       GL   
Sbjct  382  VLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKES  441

Query  450  VYHASFSQHFGRESWVIIPTLLRPKSRGHLRLSSNDPEAYPDIQTNYFQHPDDVATLVRG  509
            VY   +     ++SW I+P LLRP+SRG ++L S +P  YP I  NYF  P D  TLV G
Sbjct  442  VYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEG  501

Query  510  IQLSTKVGEAPALSSLNATLWTGPFPGCEKHKPGTDAFWECYVRQFTMTLYHPVGTCKMG  569
             +++ +V EA       + LW  P P C++HK  +DA+ EC+VR  +MT+YHP GT KMG
Sbjct  502  AKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMG  561

Query  570  PDSDKEAVLDPRLRVRGVEGLRVVDASVMPELS  602
            P  D EAV+DPRLRV GV GLRV+DAS+MP +S
Sbjct  562  PAWDPEAVVDPRLRVYGVRGLRVIDASIMPTIS  594


 Score = 149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 118/215 (55%), Gaps = 6/215 (3%)

Query  3093  VDRAIYTEPDDRTCLSLTKKASLWRRG--NVLGGSSVVNFMIDP----AQDWPDIQITTE  3146
             VD+ +    D     ++T +  L  RG    LGG   + F+  P    + DWPDIQ    
Sbjct  361   VDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMA  420

Query  3147  SRSPLTNAGLMDNPPFSIEKEAFRTVYSEAMGQPSWIAFPTLLRPQSRGHLQLKSTDPED  3206
               S  ++ G        +++  ++ VY     + SW   P LLRP+SRG ++L+S +P  
Sbjct  421   PASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFH  480

Query  3207  NPIIFANYFDDERDLKVLIEGVKIALELSKTKPLYSINTTIWKKPYPGCENYEFDSDEFW  3266
              P+I ANYFDD  D K L+EG KIAL +++ +      + +W+KP P C+ ++F SD + 
Sbjct  481   YPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYL  540

Query  3267  ECHLRHMTLTFYHYSGTCKMGPKSDEYGVLDSRLR  3301
             ECH+R +++T YH  GT KMGP  D   V+D RLR
Sbjct  541   ECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLR  575


 Score = 109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 88/142 (62%), Gaps = 8/142 (6%)

Query  2999  LTTLLRNALFQVM----VLTTLFAVLVAFRLPLVARSEHP----TLYGEYDFVVVGAGSS  3050
             +TT++++    V     ++  + A +  +R   V     P     LY EYDF+VVG+GS+
Sbjct  8     ITTVIKSTFGVVTTGLWLIPLMLAAITYYRYDAVDPESRPLDQLNLYPEYDFIVVGSGSA  67

Query  3051  GAVLANRLSEVPEWQVLLLEAGGEAPRMARVPFLSPFLQNTDVDRAIYTEPDDRTCLSLT  3110
             GAV+ANRLSEV +W+VLL+EAG +   ++ VP L+ +LQ + +D A  TEP  + CL + 
Sbjct  68    GAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYKTEPSTKACLGMQ  127

Query  3111  KKASLWRRGNVLGGSSVVNFMI  3132
                  W RG VLGGSSV+N+M+
Sbjct  128   NNRCNWPRGRVLGGSSVLNYML  149


>Q6NR10_DROME unnamed protein product
Length=703

 Score = 581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/573 (50%), Positives = 384/573 (67%), Gaps = 15/573 (3%)

Query  639   YGEFDFVVVGGGSAGAVLANRLSEVPEWKVLLVEAGGEEPRIAQVPYLAPILQKTDIDWS  698
             Y E+DF+VVG GSAGAV+ANRLSEV +WKVLL+EAG +E  I+ VP LA  LQ + +DW+
Sbjct  54    YPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWA  113

Query  699   YYTEKDGSTCLSLDNEVSFWPRGKVLGGSSVLNYMQYVRGNRRDYDLWESLGNPKWGYDD  758
             Y TE     CL + N    WPRG+VLGGSSVLNYM YVRGNR DYD W SLGNP W YD+
Sbjct  114   YKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDN  173

Query  759   VLPYFKKSEDFQGEKDHPEDMDYHGKGGYLTVQGTGTFKTPLADILLEGAKAMGYEIRDC  818
             VL YFKKSED      +  +  YHG+GG LTVQ +  + +PL    +E    +GY+ RD 
Sbjct  174   VLRYFKKSED--NRNPYLANNKYHGRGGLLTVQES-PWHSPLVAAFVEAGTQLGYDNRDI  230

Query  819   NGKTQTGFMLSQRTTRDGERCSTAKAFIDPIRGRRNLHISTFSHVHRIHIDAETKQAKAV  878
             NG  Q GFM++Q T R G RCSTAKAF+ PIR R+N H+S  SHV R+ I+  T +A+AV
Sbjct  231   NGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAV  290

Query  879   VFKKDGRLFVARARKEIVLSAGSIGSPQLLLLSGVGPKKHLDDIGVLVVQDLPGVGQNLQ  938
              F K G+++   AR+E+++SAG+I +PQL++LSG+GP+KHL+  G+ V+QDLP VG+N+Q
Sbjct  291   EFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQ  349

Query  939   DHVTTALLFMGETGGIMDVPKALHPHNL------LSWLSHRSSPLSVPATIDVMGFFHTK  992
             DHV      MG    ++D P A+             ++     P++    ++ + F HT 
Sbjct  350   DHVG-----MGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTP  404

Query  993   YSNPSEDWPDVQFIALSTSVLGDPSAMERPPYSIAKDAFQSNFGDIMGKEAWSAVPILMR  1052
             YSN S DWPD+QF     S+  D  A  +    + +  +Q  +  I  K++W+ +P+L+R
Sbjct  405   YSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLR  464

Query  1053  PKSRGYLQLKSLDPESHPVMYPNYYSDEQDVKTMVEGCKFLAELARTEPLQGIKSEIWKR  1112
             P+SRG ++L+S +P  +P++  NY+ D  D KT+VEG K    +A  +  +   S +W++
Sbjct  465   PRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRK  524

Query  1113  PFPGCEGHEFGSDDFWECHIRHLTMTTYHPVGTCKMGPDTDDQAVLDPRLRVRGIKGLRV  1172
             P P C+ H+F SD + ECH+R ++MT YHP GT KMGP  D +AV+DPRLRV G++GLRV
Sbjct  525   PLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRV  584

Query  1173  VDASIMPTLVSGNTNAPTIMIGEKGADLIKEDW  1205
             +DASIMPT+ SGNTNAP IMI EKGADLIKEDW
Sbjct  585   IDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


 Score = 547 bits (1410),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 280/576 (49%), Positives = 373/576 (65%), Gaps = 6/576 (1%)

Query  1811  QVTPYGEFDFIVVGAGSAGAVVANRLSEVPEWKVLLVEAGGEAPRMTDVPYLALVAQRTP  1870
             Q+  Y E+DFIVVG+GSAGAVVANRLSEV +WKVLL+EAG +   ++DVP LA   Q + 
Sbjct  50    QLNLYPEYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSK  109

Query  1871  IDWGYYPEKDGRTCLSLDNQTSYWPRGKVLGGTSVLNFMQYVRGNRHDYDLWRSLGNPGW  1930
             +DW Y  E   + CL + N    WPRG+VLGG+SVLN+M YVRGNRHDYD W SLGNPGW
Sbjct  110   LDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGW  169

Query  1931  GYDDVLPYFKKSEDYQGETCGVNMEYHGKGGYLGVQGSDPFKSKLADILIEAGKEMGYPK  1990
              YD+VL YFKKSED +      N +YHG+GG L VQ S P+ S L    +EAG ++GY  
Sbjct  170   DYDNVLRYFKKSEDNRNPYLA-NNKYHGRGGLLTVQES-PWHSPLVAAFVEAGTQLGYDN  227

Query  1991  RDCNGMNQTGFMFMQRTTRGGARSSTARAFLDPIKGRRNLHIATFAQVVKIHIDERTKQA  2050
             RD NG  Q GFM  Q T R G+R STA+AFL PI+ R+N H++  + V ++ I+  T +A
Sbjct  228   RDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRA  287

Query  2051  HGVFFRQDGKIFLALVRKEVILCAGAIGSPHLLMLSGIGPKKNLQDAGVQVIHDLPGVGQ  2110
               V F + GK++    R+EVI+ AGAI +P L+MLSG+GP+K+L+  G++V+ DLP VG+
Sbjct  288   QAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGE  346

Query  2111  NLQDHVATF-LYVLANTGGALEPLSALHPFSV-LAWLAQMPSPLSTPGGGEVMGFVHTKY  2168
             N+QDHV    L  L +   A+      +P +V   ++ +   P++T GG E + FVHT Y
Sbjct  347   NMQDHVGMGGLTFLVDKPVAIVQ-DRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPY  405

Query  2169  SNPSEDWPDIQFITLSTSPLGDPTAPARPPFAVSKEAFSAVYGEIMGKEAWLLAPLLLRP  2228
             SN S DWPDIQF     S   D  A  +    + +  +  VY  I  K++W + PLLLRP
Sbjct  406   SNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRP  465

Query  2229  ESRGQLILKSSDPDVHPVIYPNYFTHEKDIKVLIEGCKIAEQMTRTRALQGINSQIWMKP  2288
              SRG + L+S++P  +P+I  NYF    D K L+EG KIA ++   +  +   S++W KP
Sbjct  466   RSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKP  525

Query  2289  FPGCENHVPHTDDFWECMLRHKTLTVYHPVGTCKMGHDSDPGAVLDPLLRVRGIRGLRVA  2348
              P C+ H   +D + EC +R  ++T+YHP GT KMG   DP AV+DP LRV G+RGLRV 
Sbjct  526   LPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVI  585

Query  2349  DCAIMPTLVSANTNAGAIMIGEKASDLIKDSWPHKP  2384
             D +IMPT+ S NTNA  IMI EK +DLIK+ W   P
Sbjct  586   DASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNP  621


 Score = 539 bits (1388),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 286/613 (47%), Positives = 382/613 (62%), Gaps = 14/613 (2%)

Query  1200  LIKEDWGAELNGSYSASMMMMVLLTALTASVDMTEGSSP------YGEFDFIVVGAGSAG  1253
             +IK  +G    G +   +M+  +      +VD    S P      Y E+DFIVVG+GSAG
Sbjct  11    VIKSTFGVVTTGLWLIPLMLAAITYYRYDAVD--PESRPLDQLNLYPEYDFIVVGSGSAG  68

Query  1254  AVVANRLSEVPEWKVLLIEAGGEAPRMTDVPFLALLGQRTPIDWGYYPEKDGRTCLALDN  1313
             AVVANRLSEV +WKVLLIEAG +   ++DVP LA   Q + +DW Y  E   + CL + N
Sbjct  69    AVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYKTEPSTKACLGMQN  128

Query  1314  QTSYWARGKVLGGSSVLNYMQYVRGNRHDYDLWRSLGNPGWGYDDLLPYFKKSEDYSGDM  1373
                 W RG+VLGGSSVLNYM YVRGNRHDYD W SLGNPGW YD++L YFKKSED     
Sbjct  129   NRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVLRYFKKSEDNRNPY  188

Query  1374  DGVDMEYHGKGGYLGVQGSDPFKSKLADILIEAGKEMGYPKRDCNGMNQTGFMLMQRTTR  1433
                + +YHG+GG L VQ S P+ S L    +EAG ++GY  RD NG  Q GFM+ Q T R
Sbjct  189   LA-NNKYHGRGGLLTVQES-PWHSPLVAAFVEAGTQLGYDNRDINGAKQAGFMIAQGTIR  246

Query  1434  GGARCSTARAFLDPIKGRRNLHIATFAQALKVHIDEKTRQAKGVFFRHDGKVFLALARKE  1493
              G+RCSTA+AFL PI+ R+N H++  +   +V I+  T +A+ V F   GKV+   AR+E
Sbjct  247   RGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKHGKVYRIAARRE  306

Query  1494  VILCAGAIGSPHLLMLSGIGPKKNMQDAGVQAIHDLPGVGQNLQDHVATF-LYVLANTGG  1552
             VI+ AGAI +P L+MLSG+GP+K+++  G++ + DLP VG+N+QDHV    L  L +   
Sbjct  307   VIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGMGGLTFLVDKPV  365

Query  1553  ALEPLSALHPFSV-LTWMAHAPSALSTPGGAEVMGFVHTKYSNPDKDWPDIQIITISTSP  1611
             A+      +P +V   ++      ++T GG E + FVHT YSN   DWPDIQ      S 
Sbjct  366   AIVQ-DRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASI  424

Query  1612  LGDPMAPMRPPFALSKKAFMAVYGDILEREAWLSAPVLLRPKSRGQLLLKSSDPDVHPVI  1671
               D  A ++    L +  +  VY  I  +++W   P+LLRP+SRG + L+S++P  +P+I
Sbjct  425   NSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLI  484

Query  1672  YPNYFTHEDDMKVLIEGCKIAEQMTRTRALQAIKADLWMKPFPGCENHVPFTDGYWECML  1731
               NYF    D K L+EG KIA ++   +  +   + LW KP P C+ H   +D Y EC +
Sbjct  485   NANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHV  544

Query  1732  LHHTLTVYHPVGTCKMGHDSDPGAVLDPLLRVRGIRGLRVADCAIMPTLVSGNTNAPAIM  1791
                ++T+YHP GT KMG   DP AV+DP LRV G+RGLRV D +IMPT+ SGNTNAP IM
Sbjct  545   RTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIM  604

Query  1792  IGEKASDLIKDSW  1804
             I EK +DLIK+ W
Sbjct  605   IAEKGADLIKEDW  617


 Score = 486 bits (1251),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 250/577 (43%), Positives = 352/577 (61%), Gaps = 25/577 (4%)

Query  2412  ETDFVIVGAGSAGSVVANRLSEITGWDVVVMEAGCHASIVADIPYLAIYLQYTAMDWSYY  2471
             E DF++VG+GSAG+VVANRLSE+  W V+++EAG   + ++D+P LA YLQ + +DW+Y 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  2472  TETDGTYCKSMYKGTCYWPRGLCLGGSGQHNYMQYVRGNRRDYDSWASLGNTGWAYDDVL  2531
             TE     C  M    C WPRG  LGGS   NYM YVRGNR DYD WASLGN GW YD+VL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  2532  QYFIKSEDMRPNGVDYIEKEYHGTGGYMTVQGRCRFESDLAPRLLEAGQQLGYPVRDCNG  2591
             +YF KSED R   +     +YHG GG +TVQ    + S L    +EAG QLGY  RD NG
Sbjct  176   RYFKKSEDNRNPYL--ANNKYHGRGGLLTVQ-ESPWHSPLVAAFVEAGTQLGYDNRDING  232

Query  2592  ANQTGFMLLQSTVRDGRRCGPYESFLEPVKHRQNLHIICYARAEKILFENIGENKRASGV  2651
             A Q GFM+ Q T+R G RC   ++FL P++ R+N H+   +   +++ E      RA  V
Sbjct  233   AKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIE--PGTMRAQAV  290

Query  2652  VFKKDGKRYVVKARKEVILCAGSIGSPHLLMVSGVGPKEDLEQAGVTLVHPNAAVGKNLQ  2711
              F K GK Y + AR+EVI+ AG+I +P L+M+SG+GP++ LE+ G+ ++  +  VG+N+Q
Sbjct  291   EFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQ-DLPVGENMQ  349

Query  2712  DHVA---------APFFILADHNGDLDPLAALSPTSV-LNWTLKKPSPLDCPGACEVIGF  2761
             DHV           P  I+ D           +PT+V   + L++  P+   G  E + F
Sbjct  350   DHVGMGGLTFLVDKPVAIVQDR---------FNPTAVTFQYVLRERGPMTTLGGVEGLAF  400

Query  2762  VHTPSSDISKDPPNIQIIPLSTTTFMDATSLTHTPFSIDTATYRKLYANYTLQRGMIGAP  2821
             VHTP S+ S D P+IQ      +   D  +       +  + Y+++Y     +      P
Sbjct  401   VHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMP  460

Query  2822  VLLHPKSRGCLRIKSGNIWEHPELTPNYFYDPEDMKVLMEGCRIFVNLTKMPALQKINAR  2881
             +LL P+SRG ++++S N + +P +  NYF DP D K L+EG +I + + +    ++  +R
Sbjct  461   LLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSR  520

Query  2882  VVETAPEPCQKYPFNSDQYWDCFIRHFTLTLYHQVGTCKMGPDSDPEAVVSPRLSLYGVQ  2941
             +       C+++ F SD Y +C +R  ++T+YH  GT KMGP  DPEAVV PRL +YGV+
Sbjct  521   LWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVR  580

Query  2942  GLRVVDASVMPTLPSGNTNAPTTMIAEKASDMIKEDW  2978
             GLRV+DAS+MPT+ SGNTNAP  MIAEK +D+IKEDW
Sbjct  581   GLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


 Score = 454 bits (1169),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 253/573 (44%), Positives = 337/573 (59%), Gaps = 38/573 (7%)

Query  34   EYDFVVVGAGSAGAVMARRLSENSKWSVLVLDAGGPAQSAGPVAWLSCRIPYTAFMVQHS  93
            EYDF+VVG+GSAGAV+A RLSE  KW VL+++AG        V       P  A  +Q S
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDV-------PSLAAYLQLS  108

Query  94   PLDFAYYARCPEDTCGAMAGRRSFWPRGKGLGGSSLLNYMLYVRGNRRDYDRWESLGNTG  153
             LD+AY        C  M   R  WPRG+ LGGSS+LNYMLYVRGNR DYD W SLGN G
Sbjct  109  KLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPG  168

Query  154  WGYSEALRYFKKAEGWRRPPADSPPLEKDDHEYFHGTVGPLTV-ETVDKSEMARRFLQAG  212
            W Y   LRYFKK+E  R P           +  +HG  G LTV E+   S +   F++AG
Sbjct  169  WDYDNVLRYFKKSEDNRNPYLA--------NNKYHGRGGLLTVQESPWHSPLVAAFVEAG  220

Query  213  KEMGYAVRDLNGRHQVGFMPAQTTTRDGGRCDTDTAFLNPIRGSRRPNLHVATFATVHKV  272
             ++GY  RD+NG  Q GFM AQ T R G RC T  AFL PIR   R N H++  + V +V
Sbjct  221  TQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPIR--MRKNFHLSMNSHVTRV  278

Query  273  LINPKDKKAYGVSYKQDGVIRTVRARKEVILSAGAVGSPQLLLLSGVGPKDHLEDVGVPL  332
            +I P   +A  V + + G +  + AR+EVI+SAGA+ +PQL++LSG+GP+ HLE  G+ +
Sbjct  279  IIEPGTMRAQAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRV  338

Query  333  VHHSPGVGANLQDHL-VAPMIYLTDIEIDSSPKNALTIPSFWVGIVRLFKVTMDGIIENW  391
            +   P VG N+QDH+ +  + +L D                 V IV+  +     +   +
Sbjct  339  LQDLP-VGENMQDHVGMGGLTFLVDKP---------------VAIVQ-DRFNPTAVTFQY  381

Query  392  LMNGKGLLTSAGGVEVLAFVNTD-ANKDKEWPDIQIHFQSTSFLA-LGEIKPTPFGLDPQ  449
            ++  +G +T+ GGVE LAFV+T  +N+  +WPDIQ H    S  +  G       GL   
Sbjct  382  VLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKES  441

Query  450  VYHASFSQHFGRESWVIIPTLLRPKSRGHLRLSSNDPEAYPDIQTNYFQHPDDVATLVRG  509
            VY   +     ++SW I+P LLRP+SRG ++L S +P  YP I  NYF  P D  TLV G
Sbjct  442  VYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEG  501

Query  510  IQLSTKVGEAPALSSLNATLWTGPFPGCEKHKPGTDAFWECYVRQFTMTLYHPVGTCKMG  569
             +++ +V EA       + LW  P P C++HK  +DA+ EC+VR  +MT+YHP GT KMG
Sbjct  502  AKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMG  561

Query  570  PDSDKEAVLDPRLRVRGVEGLRVVDASVMPELS  602
            P  D EAV+DPRLRV GV GLRV+DAS+MP +S
Sbjct  562  PAWDPEAVVDPRLRVYGVRGLRVIDASIMPTIS  594


 Score = 149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/215 (37%), Positives = 118/215 (55%), Gaps = 6/215 (3%)

Query  3093  VDRAIYTEPDDRTCLSLTKKASLWRRG--NVLGGSSVVNFMIDP----AQDWPDIQITTE  3146
             VD+ +    D     ++T +  L  RG    LGG   + F+  P    + DWPDIQ    
Sbjct  361   VDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNRSLDWPDIQFHMA  420

Query  3147  SRSPLTNAGLMDNPPFSIEKEAFRTVYSEAMGQPSWIAFPTLLRPQSRGHLQLKSTDPED  3206
               S  ++ G        +++  ++ VY     + SW   P LLRP+SRG ++L+S +P  
Sbjct  421   PASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRGSVKLRSANPFH  480

Query  3207  NPIIFANYFDDERDLKVLIEGVKIALELSKTKPLYSINTTIWKKPYPGCENYEFDSDEFW  3266
              P+I ANYFDD  D K L+EG KIAL +++ +      + +W+KP P C+ ++F SD + 
Sbjct  481   YPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPNCKQHKFLSDAYL  540

Query  3267  ECHLRHMTLTFYHYSGTCKMGPKSDEYGVLDSRLR  3301
             ECH+R +++T YH  GT KMGP  D   V+D RLR
Sbjct  541   ECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLR  575


 Score = 109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 88/142 (62%), Gaps = 8/142 (6%)

Query  2999  LTTLLRNALFQVM----VLTTLFAVLVAFRLPLVARSEHP----TLYGEYDFVVVGAGSS  3050
             +TT++++    V     ++  + A +  +R   V     P     LY EYDF+VVG+GS+
Sbjct  8     ITTVIKSTFGVVTTGLWLIPLMLAAITYYRYDAVDPESRPLDQLNLYPEYDFIVVGSGSA  67

Query  3051  GAVLANRLSEVPEWQVLLLEAGGEAPRMARVPFLSPFLQNTDVDRAIYTEPDDRTCLSLT  3110
             GAV+ANRLSEV +W+VLL+EAG +   ++ VP L+ +LQ + +D A  TEP  + CL + 
Sbjct  68    GAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYKTEPSTKACLGMQ  127

Query  3111  KKASLWRRGNVLGGSSVVNFMI  3132
                  W RG VLGGSSV+N+M+
Sbjct  128   NNRCNWPRGRVLGGSSVLNYML  149


>Q9VY02_DROME unnamed protein product
Length=633

 Score = 513 bits (1320),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 263/581 (45%), Positives = 368/581 (63%), Gaps = 14/581 (2%)

Query  642   FDFVVVGGGSAGAVLANRLSEVPEWKVLLVEAGGEEPRIAQVPYLAPILQKTDIDWSYYT  701
             +DF+V+GGGSAG VLA RLSE PEW VLL+EAGG+EP +  +P L P+ Q++  DW Y T
Sbjct  57    YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLT  116

Query  702   EKDGSTCLSLDNEVSFWPRGKVLGGSSVLNYMQYVRGNRRDYDLWESLGNPKWGYDDVLP  761
             E     CL+++++  FWPR KVLGG S +N M Y+RGNRRDYD W +LGNP W YD++L 
Sbjct  117   EPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILH  176

Query  762   YFKKSEDFQ--GEKDHPEDMDYHGKGGYLTVQGTGTFKTPLADILLEGAKAMG--YEIRD  817
             YF+K ED +  G +  P    YHG GG ++V+    F +PL DI +  A+ +G  +   D
Sbjct  177   YFRKLEDMRVPGFEHSP----YHGHGGPISVERY-RFPSPLLDIFMRAAQQLGMVHPDGD  231

Query  818   CNGKTQTGFMLSQRTTRDGERCSTAKAFIDPIRGRRNLHISTFSHVHRIHIDAETKQAKA  877
              NG++QTGF     + RDG RCS  K +I     R NL I   + V RI ID ++ +A  
Sbjct  232   FNGRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIG  291

Query  878   VVFKKDGRLFVARARKEIVLSAGSIGSPQLLLLSGVGPKKHLDDIGVLVVQDLPGVGQNL  937
             V+F+        RA++E++LSAGS+ SPQLL++SGVGP+  L+  G+ VVQ LPGVG NL
Sbjct  292   VIFEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNL  351

Query  938   QDHVTTA-LLFMGETGG----IMDVPKALHPHNLLSWLSHRSSPLSVPATIDVMGFFHTK  992
             QDH++T+  ++  ++G        VP+ ++   +  ++    S        +VMGFF T+
Sbjct  352   QDHISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTR  411

Query  993   YSNPSEDWPDVQFIALSTSVLGDPSAMERPPYSIAKDAFQSNFGDIMGKEAWSAVPILMR  1052
             Y +P  DWPDVQ    S     D   + R   +I  D +   F  ++ ++++   P+LMR
Sbjct  412   YQDPRLDWPDVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQDSFVIAPLLMR  471

Query  1053  PKSRGYLQLKSLDPESHPVMYPNYYSDEQDVKTMVEGCKFLAELARTEPLQGIKSEIWKR  1112
             P+SRGYLQL+S DP+ HP+++ NYY D  D+  MVEG K    L +T  +Q + + +   
Sbjct  472   PRSRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIY  531

Query  1113  PFPGCEGHEFGSDDFWECHIRHLTMTTYHPVGTCKMGPDTDDQAVLDPRLRVRGIKGLRV  1172
              +  C   E+ SD FWEC  R  + T YHPVGTCKM P +D   V+DPRLRVRG++GLRV
Sbjct  532   EWRNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRGLRV  591

Query  1173  VDASIMPTLVSGNTNAPTIMIGEKGADLIKEDWGAELNGSY  1213
             +DASIMPT+ +GNTNAPT+M+ E+GAD+IKEDW    +G +
Sbjct  592   IDASIMPTIPTGNTNAPTLMLAERGADIIKEDWRHYRDGGW  632


 Score = 469 bits (1206),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 244/573 (43%), Positives = 353/573 (62%), Gaps = 11/573 (2%)

Query  1242  FDFIVVGAGSAGAVVANRLSEVPEWKVLLIEAGGEAPRMTDVPFLALLGQRTPIDWGYYP  1301
             +DFIV+G GSAG V+A RLSE PEW VLL+EAGG+ P + D+P L  + QR+P DW Y  
Sbjct  57    YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLT  116

Query  1302  EKDGRTCLALDNQTSYWARGKVLGGSSVLNYMQYVRGNRHDYDLWRSLGNPGWGYDDLLP  1361
             E   R CLA+++Q  +W R KVLGG S +N M Y+RGNR DYD W +LGNPGW YD++L 
Sbjct  117   EPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILH  176

Query  1362  YFKKSEDYSGDMDGVDME-YHGKGGYLGVQGSDPFKSKLADILIEAGKEMG--YPKRDCN  1418
             YF+K ED    + G +   YHG GG + V+    F S L DI + A +++G  +P  D N
Sbjct  177   YFRKLEDMR--VPGFEHSPYHGHGGPISVERYR-FPSPLLDIFMRAAQQLGMVHPDGDFN  233

Query  1419  GMNQTGFMLMQRTTRGGARCSTARAFLDPIKGRRNLHIATFAQALKVHIDEKTRQAKGVF  1478
             G +QTGF     + R G RCS  + ++     R NL I   A   ++ ID ++ +A GV 
Sbjct  234   GRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVI  293

Query  1479  FRHDGKVFLALARKEVILCAGAIGSPHLLMLSGIGPKKNMQDAGVQAIHDLPGVGQNLQD  1538
             F +        A++EVIL AG++ SP LLM+SG+GP+  ++  G+  +  LPGVG NLQD
Sbjct  294   FEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQD  353

Query  1539  HVATFLYVLANTGGALEPLSALHP-----FSVLTWMAHAPSALSTPGGAEVMGFVHTKYS  1593
             H++T   +     G    LS + P      +V  ++  + S       +EVMGF  T+Y 
Sbjct  354   HISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTRYQ  413

Query  1594  NPDKDWPDIQIITISTSPLGDPMAPMRPPFALSKKAFMAVYGDILEREAWLSAPVLLRPK  1653
             +P  DWPD+QI   S     D     R   A++   +   +  +L +++++ AP+L+RP+
Sbjct  414   DPRLDWPDVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQDSFVIAPLLMRPR  473

Query  1654  SRGQLLLKSSDPDVHPVIYPNYFTHEDDMKVLIEGCKIAEQMTRTRALQAIKADLWMKPF  1713
             SRG L L+S+DP VHP+I+ NY+    DM V++EG K+A ++T+T  +Q++ A + +  +
Sbjct  474   SRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYEW  533

Query  1714  PGCENHVPFTDGYWECMLLHHTLTVYHPVGTCKMGHDSDPGAVLDPLLRVRGIRGLRVAD  1773
               C      +D +WEC+   ++ T+YHPVGTCKM   SDP  V+DP LRVRG+RGLRV D
Sbjct  534   RNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRGLRVID  593

Query  1774  CAIMPTLVSGNTNAPAIMIGEKASDLIKDSWPH  1806
              +IMPT+ +GNTNAP +M+ E+ +D+IK+ W H
Sbjct  594   ASIMPTIPTGNTNAPTLMLAERGADIIKEDWRH  626


 Score = 464 bits (1195),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 244/572 (43%), Positives = 349/572 (61%), Gaps = 9/572 (2%)

Query  1818  FDFIVVGAGSAGAVVANRLSEVPEWKVLLVEAGGEAPRMTDVPYLALVAQRTPIDWGYYP  1877
             +DFIV+G GSAG V+A RLSE PEW VLL+EAGG+ P + D+P L  V QR+P DW Y  
Sbjct  57    YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLT  116

Query  1878  EKDGRTCLSLDNQTSYWPRGKVLGGTSVLNFMQYVRGNRHDYDLWRSLGNPGWGYDDVLP  1937
             E   R CL++++Q  +WPR KVLGG S +N M Y+RGNR DYD W +LGNPGW YD++L 
Sbjct  117   EPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILH  176

Query  1938  YFKKSEDYQGETCGVNMEYHGKGGYLGVQGSDPFKSKLADILIEAGKEMG--YPKRDCNG  1995
             YF+K ED +      +  YHG GG + V+    F S L DI + A +++G  +P  D NG
Sbjct  177   YFRKLEDMRVPGFE-HSPYHGHGGPISVERYR-FPSPLLDIFMRAAQQLGMVHPDGDFNG  234

Query  1996  MNQTGFMFMQRTTRGGARSSTARAFLDPIKGRRNLHIATFAQVVKIHIDERTKQAHGVFF  2055
              +QTGF     + R G R S  + ++     R NL I   A V +I ID ++ +A GV F
Sbjct  235   RSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVIF  294

Query  2056  RQDGKIFLALVRKEVILCAGAIGSPHLLMLSGIGPKKNLQDAGVQVIHDLPGVGQNLQDH  2115
                        ++EVIL AG++ SP LLM+SG+GP+  L+  G+ V+  LPGVG NLQDH
Sbjct  295   EYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQDH  354

Query  2116  VATFLYVLANTGGALEPLSALHP-----FSVLAWLAQMPSPLSTPGGGEVMGFVHTKYSN  2170
             ++T   +     G    LS + P      +V  ++    S        EVMGF  T+Y +
Sbjct  355   ISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTRYQD  414

Query  2171  PSEDWPDIQFITLSTSPLGDPTAPARPPFAVSKEAFSAVYGEIMGKEAWLLAPLLLRPES  2230
             P  DWPD+Q    S     D     R   A++ + ++  +  ++ ++++++APLL+RP S
Sbjct  415   PRLDWPDVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQDSFVIAPLLMRPRS  474

Query  2231  RGQLILKSSDPDVHPVIYPNYFTHEKDIKVLIEGCKIAEQMTRTRALQGINSQIWMKPFP  2290
             RG L L+S+DP VHP+I+ NY+    D+ V++EG K+A ++T+T  +Q +N+ + +  + 
Sbjct  475   RGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYEWR  534

Query  2291  GCENHVPHTDDFWECMLRHKTLTVYHPVGTCKMGHDSDPGAVLDPLLRVRGIRGLRVADC  2350
              C      +D FWEC+ R  + T+YHPVGTCKM   SDP  V+DP LRVRG+RGLRV D 
Sbjct  535   NCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRGLRVIDA  594

Query  2351  AIMPTLVSANTNAGAIMIGEKASDLIKDSWPH  2382
             +IMPT+ + NTNA  +M+ E+ +D+IK+ W H
Sbjct  595   SIMPTIPTGNTNAPTLMLAERGADIIKEDWRH  626


 Score = 442 bits (1138),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 237/574 (41%), Positives = 337/574 (59%), Gaps = 12/574 (2%)

Query  2414  DFVIVGAGSAGSVVANRLSEITGWDVVVMEAGCHASIVADIPYLAIYLQYTAMDWSYYTE  2473
             DF+++G GSAG V+A RLSE   W V+++EAG    ++ D+P L    Q +  DW Y TE
Sbjct  58    DFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLTE  117

Query  2474  TDGTYCKSMYKGTCYWPRGLCLGGSGQHNYMQYVRGNRRDYDSWASLGNTGWAYDDVLQY  2533
                 YC +M    C+WPR   LGG    N M Y+RGNRRDYD WA+LGN GW YD++L Y
Sbjct  118   PSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILHY  177

Query  2534  FIKSEDMRPNGVDYIEKEYHGTGGYMTVQGRCRFESDLAPRLLEAGQQLG--YPVRDCNG  2591
             F K EDMR  G ++    YHG GG ++V+ R RF S L    + A QQLG  +P  D NG
Sbjct  178   FRKLEDMRVPGFEH--SPYHGHGGPISVE-RYRFPSPLLDIFMRAAQQLGMVHPDGDFNG  234

Query  2592  ANQTGFMLLQSTVRDGRRCGPYESFLEPVKHRQNLHIICYARAEKILFENIGENKRASGV  2651
              +QTGF     ++RDG RC   + ++     R NL I+  A  E+I+ +   ++ RA GV
Sbjct  235   RSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDP--QSHRAIGV  292

Query  2652  VFKKDGKRYVVKARKEVILCAGSIGSPHLLMVSGVGPKEDLEQAGVTLVHPNAAVGKNLQ  2711
             +F+    ++ V+A++EVIL AGS+ SP LLMVSGVGP++ LE  G+ +V     VG NLQ
Sbjct  293   IFEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQ  352

Query  2712  DHVAAPFFILADHNGDLDPLAALSP-----TSVLNWTLKKPSPLDCPGACEVIGFVHTPS  2766
             DH++    I    +G    L+ + P      +V ++     S        EV+GF  T  
Sbjct  353   DHISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTRY  412

Query  2767  SDISKDPPNIQIIPLSTTTFMDATSLTHTPFSIDTATYRKLYANYTLQRGMIGAPVLLHP  2826
              D   D P++QI   S     D   +     +I    Y + +     Q   + AP+L+ P
Sbjct  413   QDPRLDWPDVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQDSFVIAPLLMRP  472

Query  2827  KSRGCLRIKSGNIWEHPELTPNYFYDPEDMKVLMEGCRIFVNLTKMPALQKINARVVETA  2886
             +SRG L+++S +   HP +  NY+ DP DM V++EG ++   LT+ P +Q +NA +    
Sbjct  473   RSRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYE  532

Query  2887  PEPCQKYPFNSDQYWDCFIRHFTLTLYHQVGTCKMGPDSDPEAVVSPRLSLYGVQGLRVV  2946
                C +  + SD +W+C  R ++ T+YH VGTCKM P SDP  VV PRL + G++GLRV+
Sbjct  533   WRNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRGLRVI  592

Query  2947  DASVMPTLPSGNTNAPTTMIAEKASDMIKEDWKE  2980
             DAS+MPT+P+GNTNAPT M+AE+ +D+IKEDW+ 
Sbjct  593   DASIMPTIPTGNTNAPTLMLAERGADIIKEDWRH  626


 Score = 424 bits (1090),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 236/576 (41%), Positives = 339/576 (59%), Gaps = 37/576 (6%)

Query  33   DEYDFVVVGAGSAGAVMARRLSENSKWSVLVLDAGGPAQSAGPVAWLSCRIPYTAFMVQH  92
            + YDF+V+G GSAG V+A RLSEN +WSVL+L+AGG          L   +P    + Q 
Sbjct  55   ESYDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEP-------LLIDLPQLYPVFQR  107

Query  93   SPLDFAYYARCPEDTCGAMAGRRSFWPRGKGLGGSSLLNYMLYVRGNRRDYDRWESLGNT  152
            SP D+ Y     +  C AM  +R FWPR K LGG S +N M+Y+RGNRRDYD+W +LGN 
Sbjct  108  SPWDWKYLTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNP  167

Query  153  GWGYSEALRYFKKAEGWRRPPADSPPLEKDDHEYFHGTVGPLTVETVD-KSEMARRFLQA  211
            GW Y   L YF+K E  R P  +  P        +HG  GP++VE     S +   F++A
Sbjct  168  GWNYDNILHYFRKLEDMRVPGFEHSP--------YHGHGGPISVERYRFPSPLLDIFMRA  219

Query  212  GKEMG--YAVRDLNGRHQVGFMPAQTTTRDGGRCDTDTAFLNPIRGSRRPNLHVATFATV  269
             +++G  +   D NGR Q GF P   + RDG RC  +  ++   R  +RPNL +   A V
Sbjct  220  AQQLGMVHPDGDFNGRSQTGFAPPHGSLRDGLRCSANKGYIR--RSWQRPNLDIVLKAFV  277

Query  270  HKVLINPKDKKAYGVSYKQDGVIRTVRARKEVILSAGAVGSPQLLLLSGVGPKDHLEDVG  329
             +++I+P+  +A GV ++   +  TVRA++EVILSAG++ SPQLL++SGVGP+D LE  G
Sbjct  278  ERIVIDPQSHRAIGVIFEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQG  337

Query  330  VPLVHHSPGVGANLQDHLVAPMIYLTDIEIDSSPKNALTIPSFWVGIVRLFKVTMDGIIE  389
            +P+V H PGVG NLQDH+       T    DS     L   SF V      ++  +  +E
Sbjct  338  IPVVQHLPGVGGNLQDHISTSGAIYT---FDSGQNRHL---SFIVP-----EMMNEQAVE  386

Query  390  NWLMNGKGLLTSAGGVEVLAFVNTDANKDK-EWPDIQIHFQSTSFLALGEI---KPTPFG  445
            +++        +    EV+ F +T     + +WPD+QI   S  + A G +   +     
Sbjct  387  DFVQGSDSFFYAMPVSEVMGFFSTRYQDPRLDWPDVQIFMGSYGYGADGGMIGRRGAAIT  446

Query  446  LDPQVYHASFSQHFGRESWVIIPTLLRPKSRGHLRLSSNDPEAYPDIQTNYFQHPDDVAT  505
            LD   Y  +F     ++S+VI P L+RP+SRG+L+L S DP+ +P I  NY+  P D+A 
Sbjct  447  LDN--YAEAFEPVLYQDSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPHDMAV  504

Query  506  LVRGIQLSTKVGEAPALSSLNATLWTGPFPGCEKHKPGTDAFWECYVRQFTMTLYHPVGT  565
            +V G++L+ ++ + P + SLNAT+    +  C + +  +DAFWEC  R ++ T+YHPVGT
Sbjct  505  MVEGLKLAHRLTQTPVMQSLNATMNIYEWRNCPEVEYLSDAFWECLARFYSQTIYHPVGT  564

Query  566  CKMGPDSDKEAVLDPRLRVRGVEGLRVVDASVMPEL  601
            CKM P SD   V+DPRLRVRG+ GLRV+DAS+MP +
Sbjct  565  CKMAPASDPAGVVDPRLRVRGMRGLRVIDASIMPTI  600


 Score = 145 bits (365),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/169 (41%), Positives = 103/169 (61%), Gaps = 0/169 (0%)

Query  3133  DPAQDWPDIQITTESRSPLTNAGLMDNPPFSIEKEAFRTVYSEAMGQPSWIAFPTLLRPQ  3192
             DP  DWPD+QI   S     + G++     +I  + +   +   + Q S++  P L+RP+
Sbjct  414   DPRLDWPDVQIFMGSYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQDSFVIAPLLMRPR  473

Query  3193  SRGHLQLKSTDPEDNPIIFANYFDDERDLKVLIEGVKIALELSKTKPLYSINTTIWKKPY  3252
             SRG+LQL+S DP+ +P+I ANY+DD  D+ V++EG+K+A  L++T  + S+N T+    +
Sbjct  474   SRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATMNIYEW  533

Query  3253  PGCENYEFDSDEFWECHLRHMTLTFYHYSGTCKMGPKSDEYGVLDSRLR  3301
               C   E+ SD FWEC  R  + T YH  GTCKM P SD  GV+D RLR
Sbjct  534   RNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLR  582


 Score = 100 bits (249),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 61/97 (63%), Gaps = 0/97 (0%)

Query  3036  LYGEYDFVVVGAGSSGAVLANRLSEVPEWQVLLLEAGGEAPRMARVPFLSPFLQNTDVDR  3095
             L   YDF+V+G GS+G VLA RLSE PEW VLLLEAGG+ P +  +P L P  Q +  D 
Sbjct  53    LRESYDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDW  112

Query  3096  AIYTEPDDRTCLSLTKKASLWRRGNVLGGSSVVNFMI  3132
                TEP DR CL++  +   W R  VLGG S +N M+
Sbjct  113   KYLTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMM  149



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


Query= CAQU000084-PA

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NFP9_DROME  unnamed protein product                                 489     7e-164
Q8T4F5_DROME  unnamed protein product                                 489     2e-163
Q9VSQ1_DROME  unnamed protein product                                 490     6e-162


>M9NFP9_DROME unnamed protein product
Length=1152

 Score = 489 bits (1259),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 247/404 (61%), Positives = 304/404 (75%), Gaps = 31/404 (8%)

Query  1     LLTMLPTEEERSKIQEAQLANPDVPLGSAEQFLITLAS----------------------  38
             LL MLPT+EER KIQEAQL+NP++PLGSAEQFL+TLAS                      
Sbjct  756   LLNMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEK  815

Query  39    EVAEPLMDLKQGMEALQNNKTFRHILAALLSIGNFLNGVEAKGFQIEYLAKVPEVKDTVH  98
             E+AEPLMDLKQG+E L+ N+TFR IL+ LLS+G FLNG   KGFQIEYLAKVPEVKDTVH
Sbjct  816   EIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVH  875

Query  99    KHTLLHHLSHTIMEKFPDSTDLYSEVGAITRASRVDFDEVASSIQKMETECKASWDHLKV  158
             KH+LLHHL H +ME   D++DLYSE+G ITRAS+ DF ++A ++ ++E ECKA WD LK+
Sbjct  876   KHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKL  935

Query  159   IAKHDGNASTIKVKMSDFLSDCAERIIVLGIVHRRVMNRFYKFMLWLGVPLHQIPHTKPN  218
             IAKHD     +K K+ DFL+DCAERII+L IVHRRVMNR+ KF+LWLG+P H +  ++PN
Sbjct  936   IAKHDC-PPPLKQKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPN  994

Query  219   VFSKIISEFALEYRTTRDRVIQQMEKKANHRERNKTRGKMITEMAKFKTKEDKADAELRQ  278
              F + +SEFALEYRTTR+RV QQ+EKKANHRERNKTRGK+I +MAKFKTK+D AD EL++
Sbjct  995   EFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMAKFKTKDDVADDELKK  1054

Query  279   LLGSDVSDTESVRGTWGSLRPKRDSGRASLKYYGGKKAECVGDPDRDDEILESLVKTATK  338
             LL  D S  +   GT    R + +  R+ +     ++       D DDEILESLVKTATK
Sbjct  1055  LL--DTSSADQADGTLTWRRRRAEQLRSPITRQSEEQFT-----DGDDEILESLVKTATK  1107

Query  339   APD-RSTPRERKRTRNTDRKSLRRTLRNGLSEEERKHLAAFIST  381
             AP  R+TPRERKRTR+ DRKSLRRTL+NGL+EEE++H+AA I T
Sbjct  1108  APGTRTTPRERKRTRHADRKSLRRTLKNGLTEEEKQHVAALIQT  1151


>Q8T4F5_DROME unnamed protein product
Length=1211

 Score = 489 bits (1260),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 247/404 (61%), Positives = 304/404 (75%), Gaps = 31/404 (8%)

Query  1     LLTMLPTEEERSKIQEAQLANPDVPLGSAEQFLITLAS----------------------  38
             LL MLPT+EER KIQEAQL+NP++PLGSAEQFL+TLAS                      
Sbjct  815   LLNMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEK  874

Query  39    EVAEPLMDLKQGMEALQNNKTFRHILAALLSIGNFLNGVEAKGFQIEYLAKVPEVKDTVH  98
             E+AEPLMDLKQG+E L+ N+TFR IL+ LLS+G FLNG   KGFQIEYLAKVPEVKDTVH
Sbjct  875   EIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVH  934

Query  99    KHTLLHHLSHTIMEKFPDSTDLYSEVGAITRASRVDFDEVASSIQKMETECKASWDHLKV  158
             KH+LLHHL H +ME   D++DLYSE+G ITRAS+ DF ++A ++ ++E ECKA WD LK+
Sbjct  935   KHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKL  994

Query  159   IAKHDGNASTIKVKMSDFLSDCAERIIVLGIVHRRVMNRFYKFMLWLGVPLHQIPHTKPN  218
             IAKHD     +K K+ DFL+DCAERII+L IVHRRVMNR+ KF+LWLG+P H +  ++PN
Sbjct  995   IAKHDC-PPPLKQKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPN  1053

Query  219   VFSKIISEFALEYRTTRDRVIQQMEKKANHRERNKTRGKMITEMAKFKTKEDKADAELRQ  278
              F + +SEFALEYRTTR+RV QQ+EKKANHRERNKTRGK+I +MAKFKTK+D AD EL++
Sbjct  1054  EFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMAKFKTKDDVADDELKK  1113

Query  279   LLGSDVSDTESVRGTWGSLRPKRDSGRASLKYYGGKKAECVGDPDRDDEILESLVKTATK  338
             LL  D S  +   GT    R + +  R+ +     ++       D DDEILESLVKTATK
Sbjct  1114  LL--DTSSADQADGTLTWRRRRAEQLRSPITRQSEEQFT-----DGDDEILESLVKTATK  1166

Query  339   APD-RSTPRERKRTRNTDRKSLRRTLRNGLSEEERKHLAAFIST  381
             AP  R+TPRERKRTR+ DRKSLRRTL+NGL+EEE++H+AA I T
Sbjct  1167  APGTRTTPRERKRTRHADRKSLRRTLKNGLTEEEKQHVAALIQT  1210


>Q9VSQ1_DROME unnamed protein product
Length=1393

 Score = 490 bits (1261),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 247/404 (61%), Positives = 304/404 (75%), Gaps = 31/404 (8%)

Query  1     LLTMLPTEEERSKIQEAQLANPDVPLGSAEQFLITLAS----------------------  38
             LL MLPT+EER KIQEAQL+NP++PLGSAEQFL+TLAS                      
Sbjct  997   LLNMLPTDEERGKIQEAQLSNPELPLGSAEQFLLTLASISELEARLKLWAFRLDFDNSEK  1056

Query  39    EVAEPLMDLKQGMEALQNNKTFRHILAALLSIGNFLNGVEAKGFQIEYLAKVPEVKDTVH  98
             E+AEPLMDLKQG+E L+ N+TFR IL+ LLS+G FLNG   KGFQIEYLAKVPEVKDTVH
Sbjct  1057  EIAEPLMDLKQGIEILRQNRTFRSILSTLLSVGIFLNGAPVKGFQIEYLAKVPEVKDTVH  1116

Query  99    KHTLLHHLSHTIMEKFPDSTDLYSEVGAITRASRVDFDEVASSIQKMETECKASWDHLKV  158
             KH+LLHHL H +ME   D++DLYSE+G ITRAS+ DF ++A ++ ++E ECKA WD LK+
Sbjct  1117  KHSLLHHLCHMVMESSSDTSDLYSEIGPITRASKADFTDLAHNLNQLEAECKACWDRLKL  1176

Query  159   IAKHDGNASTIKVKMSDFLSDCAERIIVLGIVHRRVMNRFYKFMLWLGVPLHQIPHTKPN  218
             IAKHD     +K K+ DFL+DCAERII+L IVHRRVMNR+ KF+LWLG+P H +  ++PN
Sbjct  1177  IAKHDC-PPPLKQKLVDFLADCAERIIILQIVHRRVMNRYRKFLLWLGMPQHSVAESRPN  1235

Query  219   VFSKIISEFALEYRTTRDRVIQQMEKKANHRERNKTRGKMITEMAKFKTKEDKADAELRQ  278
              F + +SEFALEYRTTR+RV QQ+EKKANHRERNKTRGK+I +MAKFKTK+D AD EL++
Sbjct  1236  EFCRTLSEFALEYRTTRERVQQQLEKKANHRERNKTRGKLIIDMAKFKTKDDVADDELKK  1295

Query  279   LLGSDVSDTESVRGTWGSLRPKRDSGRASLKYYGGKKAECVGDPDRDDEILESLVKTATK  338
             LL  D S  +   GT    R + +  R+ +     ++       D DDEILESLVKTATK
Sbjct  1296  LL--DTSSADQADGTLTWRRRRAEQLRSPITRQSEEQFT-----DGDDEILESLVKTATK  1348

Query  339   APD-RSTPRERKRTRNTDRKSLRRTLRNGLSEEERKHLAAFIST  381
             AP  R+TPRERKRTR+ DRKSLRRTL+NGL+EEE++H+AA I T
Sbjct  1349  APGTRTTPRERKRTRHADRKSLRRTLKNGLTEEEKQHVAALIQT  1392



Lambda      K        H
   0.325    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10314525390


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  12:13 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000085-PA

Length=1833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6NR10_DROME  unnamed protein product                                 520     4e-165
Q9VY08_DROME  unnamed protein product                                 520     4e-165
Q9VY02_DROME  unnamed protein product                                 457     7e-143


>Q6NR10_DROME unnamed protein product
Length=703

 Score = 520 bits (1340),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 269/583 (46%), Positives = 368/583 (63%), Gaps = 24/583 (4%)

Query  26   EYDFVVVGGGSAGSVAANRLSEESAWSVLLLEAGREAPDNHVSSLPYLAGRTQNSDMDWG  85
            EYDF+VVG GSAG+V ANRLSE   W VLL+EAG +  +N +S +P LA   Q S +DW 
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPD--ENEISDVPSLAAYLQLSKLDWA  113

Query  86   FRTEPDHRTSLSMNDTRSLWPRGKVLGGSSVLNCMMYVRGNRRDYDHWASLGNSGWGYDD  145
            ++TEP  +  L M + R  WPRG+VLGGSSVLN M+YVRGNR DYDHWASLGN GW YD+
Sbjct  114  YKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDN  173

Query  146  VLPYFKKSEDMLVPGLVDSPYHGAGGYLAVENPSYKTPLLDAYLAAGQAMGYEVRDSNGE  205
            VL YFKKSED   P L ++ YHG GG L V+   + +PL+ A++ AG  +GY+ RD NG 
Sbjct  174  VLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGA  233

Query  206  KQTGFTVAPCNTKKGVRWDTSRAFLRPVRGRPNLKVITRAHVHRVLLEEG--KAVGVELK  263
            KQ GF +A    ++G R  T++AFLRP+R R N  +   +HV RV++E G  +A  VE  
Sbjct  234  KQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFV  293

Query  264  HDGQLKVVTARKEVILSAGALGSPHLLMLSGIGPERHLEDKGVPVEVHLSGVGQNLQDHV  323
              G++  + AR+EVI+SAGA+ +P L+MLSG+GP +HLE  G+ V   L  VG+N+QDHV
Sbjct  294  KHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHV  352

Query  324  ST-ALPFLVKKDVTMNDARVVTQLNLERWLTNGTGPISSPCSVEAMAFVNTHRHLDLYSN  382
                L FLV K V +   R        +++    GP+++   VE +AFV+T         
Sbjct  353  GMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHT---------  403

Query  383  GEPIARPEDYDNEDYPDIQLMIGSKSLFSEKSVGENPIPPYGFSKEAFLSAYGPVIGRDS  442
                  P    + D+PDIQ  +   S+ S+       +   G  +  +   Y P+  +DS
Sbjct  404  ------PYSNRSLDWPDIQFHMAPASINSDNGARVKKV--LGLKESVYQEVYHPIANKDS  455

Query  443  WMMMVTLLRPKSRGSLELSSSDPQSHPVIRPNYLVHPQDTTVLTRGARLGVAISKTQPLQ  502
            W +M  LLRP+SRGS++L S++P  +P+I  NY   P D   L  GA++ + +++ Q  +
Sbjct  456  WTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFK  515

Query  503  SEYESSFWPGPLPGCEQFQMGSLPFWECYVRHFTKTLYHPAGTCKMGPEDDPEAVVDSRL  562
             ++ S  W  PLP C+Q +  S  + EC+VR  + T+YHP GT KMGP  DPEAVVD RL
Sbjct  516  -QFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRL  574

Query  563  RVRGIQGLRVVDASVMPTLPSAPINAAVIMVAEKASDLIKQDW  605
            RV G++GLRV+DAS+MPT+ S   NA VIM+AEK +DLIK+DW
Sbjct  575  RVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


 Score = 490 bits (1261),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 266/604 (44%), Positives = 359/604 (59%), Gaps = 28/604 (5%)

Query  1237  EYDFVVVGAGSAGAVMARRLSENSKWSVLVLDAGGPAHSAGPVAWLSCRIPYTAFMVQHS  1296
             EYDF+VVG+GSAGAV+A RLSE  KW VL+++AG   +    V       P  A  +Q S
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDV-------PSLAAYLQLS  108

Query  1297  PLDFAYYARCPEDTCGAMAGRRSFWPRGKGLGGSSLLNYMLYVRGNRRDYDRWESLGNTG  1356
              LD+AY        C  M   R  WPRG+ LGGSS+LNYMLYVRGNR DYD W SLGN G
Sbjct  109   KLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPG  168

Query  1357  WGYSEALRYFKKAEGWRRPPADSPPLEKDDHEYFHGTVGPLTV-ETVDKSEMARRFLQAG  1415
             W Y   LRYFKK+E  R P           +  +HG  G LTV E+   S +   F++AG
Sbjct  169   WDYDNVLRYFKKSEDNRNPYLA--------NNKYHGRGGLLTVQESPWHSPLVAAFVEAG  220

Query  1416  KEMGYSVRDINGRHQVGFTPAQTTTRDGGRCDTDKAFLAPVWGSLRPNLHVATFATVHKV  1475
              ++GY  RDING  Q GF  AQ T R G RC T KAFL P+   +R N H++  + V +V
Sbjct  221   TQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPI--RMRKNFHLSMNSHVTRV  278

Query  1476  LINTKDKKAYGVSYKQDGVIRTVRARKEVILSAGSVGSPQLLLLSGVGPKDHLEDVGVPL  1535
             +I     +A  V + + G +  + AR+EVI+SAG++ +PQL++LSG+GP+ HLE  G+ +
Sbjct  279   IIEPGTMRAQAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRV  338

Query  1536  VHHSPGVGANLQDHV-MVPMIYLTEAEIDANPKNALTISSFWNWLVRGKGLLTSAGGVEI  1594
             +   P VG N+QDHV M  + +L +  +          +  + +++R +G +T+ GGVE 
Sbjct  339   LQDLP-VGENMQDHVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEG  397

Query  1595  IAFVSTDL-NKDKEWPDIQIYFQSGSFLAMGEVRPSP-FGLDTQVYQSSFSQHFGRESWI  1652
             +AFV T   N+  +WPDIQ +    S  +    R     GL   VYQ  +     ++SW 
Sbjct  398   LAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWT  457

Query  1653  VFPALLHPKSRGHLRLSSNDPEAYPDIQTNYLQHPDDVATLLRGIQLSSKVGEAPALSSL  1712
             + P LL P+SRG ++L S +P  YP I  NY   P D  TL+ G +++ +V EA      
Sbjct  458   IMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQF  517

Query  1713  NATLWTGPFPGCEKHKPGTDSFWECYVRQFTMTLYHPVGTCKMGPDSDKEAVLDPRLRVR  1772
              + LW  P P C++HK  +D++ EC+VR  +MT+YHP GT KMGP  D EAV+DPRLRV 
Sbjct  518   GSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVY  577

Query  1773  GVEGLRVVDASVMPEVVSGNTNAPAIMIAEKAADMIKEDW------KAAGQQPKPKQPSP  1826
             GV GLRV+DAS+MP + SGNTNAP IMIAEK AD+IKEDW      K   Q  + + P P
Sbjct  578   GVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVKRQANRLRDPDP  637

Query  1827  KKAD  1830
               ++
Sbjct  638   ASSN  641


 Score = 485 bits (1248),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 256/545 (47%), Positives = 343/545 (63%), Gaps = 28/545 (5%)

Query  666   EYDFIVVGAGSAGAVVANRLSENPDWSVLLLEAGGEASAISSLPYFFGRTMQTDMDWQFY  725
             EYDFIVVG+GSAGAVVANRLSE   W VLL+EAG + + IS +P        + +DW + 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  726   AESDGKNCLSMKDGRSFWPRGKVLGGSSVLNCMVYIRGNRHDYDHWASLGNPGWSYENVL  785
              E   K CL M++ R  WPRG+VLGGSSVLN M+Y+RGNRHDYDHWASLGNPGW Y+NVL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  786   PYFKKSEDNRAPDLADSPYHGKGGYLTVEHPQEQTPLLEAYLEAGQEMGYPIRDCNGEHQ  845
              YFKKSEDNR P LA++ YHG+GG LTV+     +PL+ A++EAG ++GY  RD NG  Q
Sbjct  176   RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  846   TGFMVNQCTTRNGVRWSTAKAFLEPIKGRRNLRISPHSQVHRVILEQG--RAVGVEFKRD  903
              GFM+ Q T R G R STAKAFL PI+ R+N  +S +S V RVI+E G  RA  VEF + 
Sbjct  236   AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  904   GQIRRVTARKEIVLSAGAVGSPHLLLLSGIGPEKHLQDMGVPVAVHLPGVGQNLQDHVA-  962
             G++ R+ AR+E+++SAGA+ +P L++LSG+GP KHL+  G+ V   LP VG+N+QDHV  
Sbjct  296   GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGM  354

Query  963   APINFVVKENVAVNDARVFTQLNVEKWLTNGTGPLSIPCALEAIGFVDTKRAVGGHESED  1022
               + F+V + VA+   R        +++    GP++    +E + FV T  +   + S D
Sbjct  355   GGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYS---NRSLD  411

Query  1023  YPDIQIHFLSRTFFSDAEIREDLQPPFGLTAENFIKAFGPALGQDSWTTLATLLRPRSRG  1082
             +PDIQ H    +  SD   R  ++   GL    + + + P   +DSWT +  LLRPRSRG
Sbjct  412   WPDIQFHMAPASINSDNGAR--VKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRG  469

Query  1083  SIELSSKDPEAYPKIYPNYYSHQQDLDDMIQAGVLVHRLSRTKALQDGFESKLWSGPLPG  1142
             S++L S +P  YP I  NY+    D   +++   +  R++  +  +  F S+LW  PLP 
Sbjct  470   SVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQ-FGSRLWRKPLPN  528

Query  1143  CEG--------FEDQV----------AGTCKMGPDSDPESVVDSRLRVRGIKGLRVADAS  1184
             C+          E  V           GT KMGP  DPE+VVD RLRV G++GLRV DAS
Sbjct  529   CKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDAS  588

Query  1185  IMPTL  1189
             IMPT+
Sbjct  589   IMPTI  593


>Q9VY08_DROME unnamed protein product
Length=703

 Score = 520 bits (1340),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 269/583 (46%), Positives = 368/583 (63%), Gaps = 24/583 (4%)

Query  26   EYDFVVVGGGSAGSVAANRLSEESAWSVLLLEAGREAPDNHVSSLPYLAGRTQNSDMDWG  85
            EYDF+VVG GSAG+V ANRLSE   W VLL+EAG +  +N +S +P LA   Q S +DW 
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPD--ENEISDVPSLAAYLQLSKLDWA  113

Query  86   FRTEPDHRTSLSMNDTRSLWPRGKVLGGSSVLNCMMYVRGNRRDYDHWASLGNSGWGYDD  145
            ++TEP  +  L M + R  WPRG+VLGGSSVLN M+YVRGNR DYDHWASLGN GW YD+
Sbjct  114  YKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDN  173

Query  146  VLPYFKKSEDMLVPGLVDSPYHGAGGYLAVENPSYKTPLLDAYLAAGQAMGYEVRDSNGE  205
            VL YFKKSED   P L ++ YHG GG L V+   + +PL+ A++ AG  +GY+ RD NG 
Sbjct  174  VLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGA  233

Query  206  KQTGFTVAPCNTKKGVRWDTSRAFLRPVRGRPNLKVITRAHVHRVLLEEG--KAVGVELK  263
            KQ GF +A    ++G R  T++AFLRP+R R N  +   +HV RV++E G  +A  VE  
Sbjct  234  KQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFV  293

Query  264  HDGQLKVVTARKEVILSAGALGSPHLLMLSGIGPERHLEDKGVPVEVHLSGVGQNLQDHV  323
              G++  + AR+EVI+SAGA+ +P L+MLSG+GP +HLE  G+ V   L  VG+N+QDHV
Sbjct  294  KHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHV  352

Query  324  ST-ALPFLVKKDVTMNDARVVTQLNLERWLTNGTGPISSPCSVEAMAFVNTHRHLDLYSN  382
                L FLV K V +   R        +++    GP+++   VE +AFV+T         
Sbjct  353  GMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHT---------  403

Query  383  GEPIARPEDYDNEDYPDIQLMIGSKSLFSEKSVGENPIPPYGFSKEAFLSAYGPVIGRDS  442
                  P    + D+PDIQ  +   S+ S+       +   G  +  +   Y P+  +DS
Sbjct  404  ------PYSNRSLDWPDIQFHMAPASINSDNGARVKKV--LGLKESVYQEVYHPIANKDS  455

Query  443  WMMMVTLLRPKSRGSLELSSSDPQSHPVIRPNYLVHPQDTTVLTRGARLGVAISKTQPLQ  502
            W +M  LLRP+SRGS++L S++P  +P+I  NY   P D   L  GA++ + +++ Q  +
Sbjct  456  WTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFK  515

Query  503  SEYESSFWPGPLPGCEQFQMGSLPFWECYVRHFTKTLYHPAGTCKMGPEDDPEAVVDSRL  562
             ++ S  W  PLP C+Q +  S  + EC+VR  + T+YHP GT KMGP  DPEAVVD RL
Sbjct  516  -QFGSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRL  574

Query  563  RVRGIQGLRVVDASVMPTLPSAPINAAVIMVAEKASDLIKQDW  605
            RV G++GLRV+DAS+MPT+ S   NA VIM+AEK +DLIK+DW
Sbjct  575  RVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDW  617


 Score = 489 bits (1260),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 266/604 (44%), Positives = 359/604 (59%), Gaps = 28/604 (5%)

Query  1237  EYDFVVVGAGSAGAVMARRLSENSKWSVLVLDAGGPAHSAGPVAWLSCRIPYTAFMVQHS  1296
             EYDF+VVG+GSAGAV+A RLSE  KW VL+++AG   +    V       P  A  +Q S
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDV-------PSLAAYLQLS  108

Query  1297  PLDFAYYARCPEDTCGAMAGRRSFWPRGKGLGGSSLLNYMLYVRGNRRDYDRWESLGNTG  1356
              LD+AY        C  M   R  WPRG+ LGGSS+LNYMLYVRGNR DYD W SLGN G
Sbjct  109   KLDWAYKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPG  168

Query  1357  WGYSEALRYFKKAEGWRRPPADSPPLEKDDHEYFHGTVGPLTV-ETVDKSEMARRFLQAG  1415
             W Y   LRYFKK+E  R P           +  +HG  G LTV E+   S +   F++AG
Sbjct  169   WDYDNVLRYFKKSEDNRNPYLA--------NNKYHGRGGLLTVQESPWHSPLVAAFVEAG  220

Query  1416  KEMGYSVRDINGRHQVGFTPAQTTTRDGGRCDTDKAFLAPVWGSLRPNLHVATFATVHKV  1475
              ++GY  RDING  Q GF  AQ T R G RC T KAFL P+   +R N H++  + V +V
Sbjct  221   TQLGYDNRDINGAKQAGFMIAQGTIRRGSRCSTAKAFLRPI--RMRKNFHLSMNSHVTRV  278

Query  1476  LINTKDKKAYGVSYKQDGVIRTVRARKEVILSAGSVGSPQLLLLSGVGPKDHLEDVGVPL  1535
             +I     +A  V + + G +  + AR+EVI+SAG++ +PQL++LSG+GP+ HLE  G+ +
Sbjct  279   IIEPGTMRAQAVEFVKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRV  338

Query  1536  VHHSPGVGANLQDHV-MVPMIYLTEAEIDANPKNALTISSFWNWLVRGKGLLTSAGGVEI  1594
             +   P VG N+QDHV M  + +L +  +          +  + +++R +G +T+ GGVE 
Sbjct  339   LQDLP-VGENMQDHVGMGGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEG  397

Query  1595  IAFVSTDL-NKDKEWPDIQIYFQSGSFLAMGEVRPSP-FGLDTQVYQSSFSQHFGRESWI  1652
             +AFV T   N+  +WPDIQ +    S  +    R     GL   VYQ  +     ++SW 
Sbjct  398   LAFVHTPYSNRSLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWT  457

Query  1653  VFPALLHPKSRGHLRLSSNDPEAYPDIQTNYLQHPDDVATLLRGIQLSSKVGEAPALSSL  1712
             + P LL P+SRG ++L S +P  YP I  NY   P D  TL+ G +++ +V EA      
Sbjct  458   IMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQF  517

Query  1713  NATLWTGPFPGCEKHKPGTDSFWECYVRQFTMTLYHPVGTCKMGPDSDKEAVLDPRLRVR  1772
              + LW  P P C++HK  +D++ EC+VR  +MT+YHP GT KMGP  D EAV+DPRLRV 
Sbjct  518   GSRLWRKPLPNCKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVY  577

Query  1773  GVEGLRVVDASVMPEVVSGNTNAPAIMIAEKAADMIKEDW------KAAGQQPKPKQPSP  1826
             GV GLRV+DAS+MP + SGNTNAP IMIAEK AD+IKEDW      K   Q  + + P P
Sbjct  578   GVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVKRQANRLRDPDP  637

Query  1827  KKAD  1830
               ++
Sbjct  638   ASSN  641


 Score = 484 bits (1247),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 256/545 (47%), Positives = 343/545 (63%), Gaps = 28/545 (5%)

Query  666   EYDFIVVGAGSAGAVVANRLSENPDWSVLLLEAGGEASAISSLPYFFGRTMQTDMDWQFY  725
             EYDFIVVG+GSAGAVVANRLSE   W VLL+EAG + + IS +P        + +DW + 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  726   AESDGKNCLSMKDGRSFWPRGKVLGGSSVLNCMVYIRGNRHDYDHWASLGNPGWSYENVL  785
              E   K CL M++ R  WPRG+VLGGSSVLN M+Y+RGNRHDYDHWASLGNPGW Y+NVL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  786   PYFKKSEDNRAPDLADSPYHGKGGYLTVEHPQEQTPLLEAYLEAGQEMGYPIRDCNGEHQ  845
              YFKKSEDNR P LA++ YHG+GG LTV+     +PL+ A++EAG ++GY  RD NG  Q
Sbjct  176   RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  846   TGFMVNQCTTRNGVRWSTAKAFLEPIKGRRNLRISPHSQVHRVILEQG--RAVGVEFKRD  903
              GFM+ Q T R G R STAKAFL PI+ R+N  +S +S V RVI+E G  RA  VEF + 
Sbjct  236   AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  904   GQIRRVTARKEIVLSAGAVGSPHLLLLSGIGPEKHLQDMGVPVAVHLPGVGQNLQDHVA-  962
             G++ R+ AR+E+++SAGA+ +P L++LSG+GP KHL+  G+ V   LP VG+N+QDHV  
Sbjct  296   GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGM  354

Query  963   APINFVVKENVAVNDARVFTQLNVEKWLTNGTGPLSIPCALEAIGFVDTKRAVGGHESED  1022
               + F+V + VA+   R        +++    GP++    +E + FV T  +   + S D
Sbjct  355   GGLTFLVDKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYS---NRSLD  411

Query  1023  YPDIQIHFLSRTFFSDAEIREDLQPPFGLTAENFIKAFGPALGQDSWTTLATLLRPRSRG  1082
             +PDIQ H    +  SD   R  ++   GL    + + + P   +DSWT +  LLRPRSRG
Sbjct  412   WPDIQFHMAPASINSDNGAR--VKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSRG  469

Query  1083  SIELSSKDPEAYPKIYPNYYSHQQDLDDMIQAGVLVHRLSRTKALQDGFESKLWSGPLPG  1142
             S++L S +P  YP I  NY+    D   +++   +  R++  +  +  F S+LW  PLP 
Sbjct  470   SVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQ-FGSRLWRKPLPN  528

Query  1143  CEG--------FEDQV----------AGTCKMGPDSDPESVVDSRLRVRGIKGLRVADAS  1184
             C+          E  V           GT KMGP  DPE+VVD RLRV G++GLRV DAS
Sbjct  529   CKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDAS  588

Query  1185  IMPTL  1189
             IMPT+
Sbjct  589   IMPTI  593


>Q9VY02_DROME unnamed protein product
Length=633

 Score = 457 bits (1176),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 249/592 (42%), Positives = 357/592 (60%), Gaps = 35/592 (6%)

Query  1236  DEYDFVVVGAGSAGAVMARRLSENSKWSVLVLDAGGPAHSAGPVAWLSCRIPYTAFMVQH  1295
             + YDF+V+G GSAG V+A RLSEN +WSVL+L+AGG          L   +P    + Q 
Sbjct  55    ESYDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEP-------LLIDLPQLYPVFQR  107

Query  1296  SPLDFAYYARCPEDTCGAMAGRRSFWPRGKGLGGSSLLNYMLYVRGNRRDYDRWESLGNT  1355
             SP D+ Y     +  C AM  +R FWPR K LGG S +N M+Y+RGNRRDYD+W +LGN 
Sbjct  108   SPWDWKYLTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNP  167

Query  1356  GWGYSEALRYFKKAEGWRRPPADSPPLEKDDHEYFHGTVGPLTVETVD-KSEMARRFLQA  1414
             GW Y   L YF+K E  R P  +  P        +HG  GP++VE     S +   F++A
Sbjct  168   GWNYDNILHYFRKLEDMRVPGFEHSP--------YHGHGGPISVERYRFPSPLLDIFMRA  219

Query  1415  GKEMG--YSVRDINGRHQVGFTPAQTTTRDGGRCDTDKAFLAPVWGSLRPNLHVATFATV  1472
              +++G  +   D NGR Q GF P   + RDG RC  +K ++   W   RPNL +   A V
Sbjct  220   AQQLGMVHPDGDFNGRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQ--RPNLDIVLKAFV  277

Query  1473  HKVLINTKDKKAYGVSYKQDGVIRTVRARKEVILSAGSVGSPQLLLLSGVGPKDHLEDVG  1532
              +++I+ +  +A GV ++   +  TVRA++EVILSAGS+ SPQLL++SGVGP+D LE  G
Sbjct  278   ERIVIDPQSHRAIGVIFEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQG  337

Query  1533  VPLVHHSPGVGANLQDHVMVP-MIYLTEAEIDANPKNALTISSFWNW-----LVRGKGLL  1586
             +P+V H PGVG NLQDH+     IY  ++    N   +  +    N       V+G    
Sbjct  338   IPVVQHLPGVGGNLQDHISTSGAIYTFDS--GQNRHLSFIVPEMMNEQAVEDFVQGSDSF  395

Query  1587  TSAGGV-EIIAFVSTDLNKDK-EWPDIQIYFQSGSFLAMGEV---RPSPFGLDTQVYQSS  1641
               A  V E++ F ST     + +WPD+QI+  S  + A G +   R +   LD   Y  +
Sbjct  396   FYAMPVSEVMGFFSTRYQDPRLDWPDVQIFMGSYGYGADGGMIGRRGAAITLDN--YAEA  453

Query  1642  FSQHFGRESWIVFPALLHPKSRGHLRLSSNDPEAYPDIQTNYLQHPDDVATLLRGIQLSS  1701
             F     ++S+++ P L+ P+SRG+L+L S DP+ +P I  NY   P D+A ++ G++L+ 
Sbjct  454   FEPVLYQDSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAH  513

Query  1702  KVGEAPALSSLNATLWTGPFPGCEKHKPGTDSFWECYVRQFTMTLYHPVGTCKMGPDSDK  1761
             ++ + P + SLNAT+    +  C + +  +D+FWEC  R ++ T+YHPVGTCKM P SD 
Sbjct  514   RLTQTPVMQSLNATMNIYEWRNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDP  573

Query  1762  EAVLDPRLRVRGVEGLRVVDASVMPEVVSGNTNAPAIMIAEKAADMIKEDWK  1813
               V+DPRLRVRG+ GLRV+DAS+MP + +GNTNAP +M+AE+ AD+IKEDW+
Sbjct  574   AGVVDPRLRVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGADIIKEDWR  625


 Score = 455 bits (1171),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 245/594 (41%), Positives = 352/594 (59%), Gaps = 31/594 (5%)

Query  22   DAGSEYDFVVVGGGSAGSVAANRLSEESAWSVLLLEAGREAPDNHVSSLPYLAGRTQNSD  81
            D    YDF+V+GGGSAG V A RLSE   WSVLLLEAG + P   +  LP L    Q S 
Sbjct  52   DLRESYDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEP--LLIDLPQLYPVFQRSP  109

Query  82   MDWGFRTEPDHRTSLSMNDTRSLWPRGKVLGGSSVLNCMMYVRGNRRDYDHWASLGNSGW  141
             DW + TEP  R  L+M D R  WPR KVLGG S +N MMY+RGNRRDYD WA+LGN GW
Sbjct  110  WDWKYLTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGW  169

Query  142  GYDDVLPYFKKSEDMLVPGLVDSPYHGAGGYLAVENPSYKTPLLDAYLAAGQAMG--YEV  199
             YD++L YF+K EDM VPG   SPYHG GG ++VE   + +PLLD ++ A Q +G  +  
Sbjct  170  NYDNILHYFRKLEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPD  229

Query  200  RDSNGEKQTGFTVAPCNTKKGVRWDTSRAFLRPVRGRPNLKVITRAHVHRVLL--EEGKA  257
             D NG  QTGF     + + G+R   ++ ++R    RPNL ++ +A V R+++  +  +A
Sbjct  230  GDFNGRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRA  289

Query  258  VGVELKHDGQLKVVTARKEVILSAGALGSPHLLMLSGIGPERHLEDKGVPVEVHLSGVGQ  317
            +GV  ++      V A++EVILSAG+L SP LLM+SG+GP   LE +G+PV  HL GVG 
Sbjct  290  IGVIFEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGG  349

Query  318  NLQDHVSTALPFLV-----KKDVTMNDARVVTQLNLERWLTNGTGPISSPCSVEAMAFVN  372
            NLQDH+ST+           + ++     ++ +  +E ++        +    E M F +
Sbjct  350  NLQDHISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFS  409

Query  373  THRHLDLYSNGEPIARPEDYDNEDYPDIQLMIGSKSLFSEKS-VGENPIPPYGFSKEAFL  431
            T R+ D                 D+PD+Q+ +GS    ++   +G         + + + 
Sbjct  410  T-RYQD--------------PRLDWPDVQIFMGSYGYGADGGMIGRRGA---AITLDNYA  451

Query  432  SAYGPVIGRDSWMMMVTLLRPKSRGSLELSSSDPQSHPVIRPNYLVHPQDTTVLTRGARL  491
             A+ PV+ +DS+++   L+RP+SRG L+L S+DP+ HP+I  NY   P D  V+  G +L
Sbjct  452  EAFEPVLYQDSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKL  511

Query  492  GVAISKTQPLQSEYESSFWPGPLPGCEQFQMGSLPFWECYVRHFTKTLYHPAGTCKMGPE  551
               +++T P+     ++        C + +  S  FWEC  R +++T+YHP GTCKM P 
Sbjct  512  AHRLTQT-PVMQSLNATMNIYEWRNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPA  570

Query  552  DDPEAVVDSRLRVRGIQGLRVVDASVMPTLPSAPINAAVIMVAEKASDLIKQDW  605
             DP  VVD RLRVRG++GLRV+DAS+MPT+P+   NA  +M+AE+ +D+IK+DW
Sbjct  571  SDPAGVVDPRLRVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGADIIKEDW  624


 Score = 407 bits (1046),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 229/552 (41%), Positives = 323/552 (59%), Gaps = 31/552 (6%)

Query  664   QDEYDFIVVGAGSAGAVVANRLSENPDWSVLLLEAGGEASAISSLPYFFGRTMQTDMDWQ  723
             ++ YDFIV+G GSAG V+A RLSENP+WSVLLLEAGG+   +  LP  +    ++  DW+
Sbjct  54    RESYDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWK  113

Query  724   FYAESDGKNCLSMKDGRSFWPRGKVLGGSSVLNCMVYIRGNRHDYDHWASLGNPGWSYEN  783
             +  E   + CL+M+D R FWPR KVLGG S +N M+YIRGNR DYD WA+LGNPGW+Y+N
Sbjct  114   YLTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDN  173

Query  784   VLPYFKKSEDNRAPDLADSPYHGKGGYLTVEHPQEQTPLLEAYLEAGQEMG--YPIRDCN  841
             +L YF+K ED R P    SPYHG GG ++VE  +  +PLL+ ++ A Q++G  +P  D N
Sbjct  174   ILHYFRKLEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFN  233

Query  842   GEHQTGFMVNQCTTRNGVRWSTAKAFLEPIKGRRNLRISPHSQVHRVIL--EQGRAVGVE  899
             G  QTGF     + R+G+R S  K ++     R NL I   + V R+++  +  RA+GV 
Sbjct  234   GRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVI  293

Query  900   FKRDGQIRRVTARKEIVLSAGAVGSPHLLLLSGIGPEKHLQDMGVPVAVHLPGVGQNLQD  959
             F+       V A++E++LSAG++ SP LL++SG+GP   L+  G+PV  HLPGVG NLQD
Sbjct  294   FEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQD  353

Query  960   HVA---APINFVVKEN--VAVNDARVFTQLNVEKWLTNGTGPLSIPCALEAIGFVDTKRA  1014
             H++   A   F   +N  ++     +  +  VE ++             E +GF  T+  
Sbjct  354   HISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFSTRYQ  413

Query  1015  VGGHESEDYPDIQIHFLSRTFFSDAEIREDLQPPFGLTAENFIKAFGPALGQDSWTTLAT  1074
                    D+PD+QI   S  + +D  +    +    +T +N+ +AF P L QDS+     
Sbjct  414   ---DPRLDWPDVQIFMGSYGYGADGGMIG--RRGAAITLDNYAEAFEPVLYQDSFVIAPL  468

Query  1075  LLRPRSRGSIELSSKDPEAYPKIYPNYYSHQQDLDDMIQAGVLVHRLSRTKALQ------  1128
             L+RPRSRG ++L S DP+ +P I+ NYY    D+  M++   L HRL++T  +Q      
Sbjct  469   LMRPRSRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVMQSLNATM  528

Query  1129  ------DGFESKLWSGPLPGCEG-FEDQV----AGTCKMGPDSDPESVVDSRLRVRGIKG  1177
                   +  E +  S     C   F  Q      GTCKM P SDP  VVD RLRVRG++G
Sbjct  529   NIYEWRNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRLRVRGMRG  588

Query  1178  LRVADASIMPTL  1189
             LRV DASIMPT+
Sbjct  589   LRVIDASIMPTI  600



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000086-PA

Length=1798
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY08_DROME  unnamed protein product                                 565     0.0   
Q6NR10_DROME  unnamed protein product                                 564     0.0   
Q9VY02_DROME  unnamed protein product                                 466     2e-146


>Q9VY08_DROME unnamed protein product
Length=703

 Score = 565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/595 (49%), Positives = 387/595 (65%), Gaps = 28/595 (5%)

Query  590   EFDFIVVGAGSAGAVVANRLSEEPEWTVLLLEAGGEPTRLSDAPYFMDRAQHSHIDWEFY  649
             E+DFIVVG+GSAGAVVANRLSE  +W VLL+EAG +   +SD P      Q S +DW + 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  650   AEKDGKTCLSMKDGRSFWPRGKVLGGSSVLNANMYIRGNRRDYDRWTALGNPGWSYDEVL  709
              E   K CL M++ R  WPRG+VLGGSSVLN  +Y+RGNR DYD W +LGNPGW YD VL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  710   PYFKKSEDNLVPELADSQYHGKGGYLSVEHSPHKTPLLDAILEAGQELGYSTIDCNGEHQ  769
              YFKKSEDN  P LA+++YHG+GG L+V+ SP  +PL+ A +EAG +LGY   D NG  Q
Sbjct  176   RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  770   TGFMLTQQTTRKGVRCNTARAFLDPVRGRPNLRIATHSQVHRVLVEGG--KVTGVEFKQE  827
              GFM+ Q T R+G RC+TA+AFL P+R R N  ++ +S V RV++E G  +   VEF + 
Sbjct  236   AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  828   GGEVKRVRARKEVVLSAGAVQSPQLLMLSGIGPRKHLENVGIPVVHDLPGVGRNLQDHVS  887
              G+V R+ AR+EV++SAGA+ +PQL+MLSG+GPRKHLE  GI V+ DLP VG N+QDHV 
Sbjct  296   -GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVG  353

Query  888   T--MIPFISKKDVFIDDAHVGTQLNFEKWLTNGTGPISLATTIEAMAFVHTKRHPDLDKD  945
                +   + K    + D    T + F+ ++    GP++    +E +AFVHT   P  ++ 
Sbjct  354   MGGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVHT---PYSNR-  408

Query  946   GVEAAAEDLLDSDYPDIQFHVGSRSIFSDKELREDLHPPFGLSKEAFIAAYGPVIGTTSW  1005
                         D+PDIQFH+   SI SD   R  +    GL +  +   Y P+    SW
Sbjct  409   ----------SLDWPDIQFHMAPASINSDNGAR--VKKVLGLKESVYQEVYHPIANKDSW  456

Query  1006  ANVVTLLRPRSVGSIELASADPEDYPVIRANYYTDEEGRDLSDMIQGARIALRFSKAEAL  1065
               +  LLRPRS GS++L SA+P  YP+I ANY+ D    D   +++GA+IALR ++A+  
Sbjct  457   TIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDP--LDAKTLVEGAKIALRVAEAQVF  514

Query  1066  QKGYESSMWSGPLPGCEEFEDQVDSRAFWECYLRHFTMTLYHPSGTCKMGPDSDPEAVLD  1125
              K + S +W  PLP C++ +   D  A+ EC++R  +MT+YHP GT KMGP  DPEAV+D
Sbjct  515   -KQFGSRLWRKPLPNCKQHKFLSD--AYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVD  571

Query  1126  PRLRVRGIEGLRVVDCSVMPNLVSGNTNAPTIMIGEKASDLIKEDWGKKPSLTPK  1180
             PRLRV G+ GLRV+D S+MP + SGNTNAP IMI EK +DLIKEDW   P    K
Sbjct  572   PRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVK  626


 Score = 560 bits (1443),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 296/597 (50%), Positives = 389/597 (65%), Gaps = 30/597 (5%)

Query  1197  EFDFIVVGAGSAGAVVANRLSEESEWTVLLLEAGGEPPHLTDVPYFADRSKYTDIDWQFY  1256
             E+DFIVVG+GSAGAVVANRLSE  +W VLL+EAG +   ++DVP  A   + + +DW + 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  1257  AEKDENTFLSMKDGRSFWPRGKVLGGSSVMNSMVYIRGNRHDYDRWAALGNPGWSYDEVL  1316
              E      L M++ R  WPRG+VLGGSSV+N M+Y+RGNRHDYD WA+LGNPGW YD VL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  1317  PYFKKSEDNLVPELADSPYHGRGGYLSVEHSSYRTPLMDAFLEAGKELGYSTIDSNGEHQ  1376
              YFKKSEDN  P LA++ YHGRGG L+V+ S + +PL+ AF+EAG +LGY   D NG  Q
Sbjct  176   RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  1377  SGFMVPQFSTKNGVRCSTARAFLDPVRGRPNLRIATHSQVHRMLVEGG--KVTGVEFKQE  1434
             +GFM+ Q + + G RCSTA+AFL P+R R N  ++ +S V R+++E G  +   VEF + 
Sbjct  236   AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  1435  GGEVKRVRARKEVVLSAGAVQSPQLLMLSGIGPRKHLEDVGIPVVHDLPGVGRNLQDHVS  1494
              G+V R+ AR+EV++SAGA+ +PQL+MLSG+GPRKHLE  GI V+ DLP VG N+QDHV 
Sbjct  296   -GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVG  353

Query  1495  T-LLSFIMKKTV-FHNDAHFATQLNFERWLTNGTGPLALPASVETNAYVHPKRHHDLDRD  1552
                L+F++ K V    D    T + F+ ++    GP+     VE  A+VH          
Sbjct  354   MGGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVH----------  402

Query  1553  DGESPTPSEESHDQDYPDIAFHFGSRSIFSDSGTRDDLPLPFALSKEAFQGAYGTVIGKD  1612
                  TP   +   D+PDI FH    SI SD+G R    L   L +  +Q  Y  +  KD
Sbjct  403   -----TP-YSNRSLDWPDIQFHMAPASINSDNGARVKKVL--GLKESVYQEVYHPIANKD  454

Query  1613  SWSMSVTLLRPRSVGSIKLASADPEDHPIIRPNYYSDEQGRDLADVIQGARLALRLSKTE  1672
             SW++   LLRPRS GS+KL SA+P  +P+I  NY+ D    D   +++GA++ALR+++ +
Sbjct  455   SWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPL--DAKTLVEGAKIALRVAEAQ  512

Query  1673  ALQKDYESSFWYGPFPGCEEFQDKVGSRAFWECYLRHFTMTLFHPVGTCKMGPDSDPEAV  1732
                K + S  W  P P C+  Q K  S A+ EC++R  +MT++HP GT KMGP  DPEAV
Sbjct  513   VF-KQFGSRLWRKPLPNCK--QHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAV  569

Query  1733  LDPRLRVRGVEGLRVADASIMPKLVSGNTNAPTIMIGEKAADLIKEDWGKKPSLAPK  1789
             +DPRLRV GV GLRV DASIMP + SGNTNAP IMI EK ADLIKEDW   P    K
Sbjct  570   VDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVK  626


 Score = 479 bits (1232),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 265/601 (44%), Positives = 362/601 (60%), Gaps = 35/601 (6%)

Query  21   EFDFIVVGAGSAGAVVANRLSEETEWTVLLLEAGGELPHTHLTDVPYFTDRSKHTDIDWQ  80
            E+DFIVVG+GSAGAVVANRLSE  +W VLL+EAG +     ++DVP      + + +DW 
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPD--ENEISDVPSLAAYLQLSKLDWA  113

Query  81   FYAENDGKTSLSMKDGRSFWPRGKVLGGSSVMNSMLYIRGNRRDYDLWETLGNPGWSYED  140
            +  E   K  L M++ R  WPRG+VLGGSSV+N MLY+RGNR DYD W +LGNPGW Y++
Sbjct  114  YKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDN  173

Query  141  VLPYFKKSEDNSMPELQDSPYHGKGGYLSVEHSSYRTPLLDPFLQAGVELGYPTIDCNGE  200
            VL YFKKSEDN  P L ++ YHG+GG L+V+ S + +PL+  F++AG +LGY   D NG 
Sbjct  174  VLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGA  233

Query  201  KQTGFMVSQVASRNGVRCSTARAFLDPVRGRPNLRIATHSQVHRVLVEGG--KVTGVEFK  258
            KQ GFM++Q   R G RCSTA+AFL P+R R N  ++ +S V RV++E G  +   VEF 
Sbjct  234  KQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFV  293

Query  259  QEGGEVKRVRARKEVVLSAGAVQSPQLLMLSGIGPRKHLEDVGIPVVHDLPGVGRNLQDH  318
            +  G+V R+ AR+EV++SAGA+ +PQL+MLSG+GPRKHLE  GI V+ DLP VG N+QDH
Sbjct  294  KH-GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDH  351

Query  319  VST-ILPFVTMKTV-FNNDGYIATQLNFERWLTNGTGPLAMPGSLEGKAFVHTKRHQDLD  376
            V    L F+  K V    D +  T + F+ ++    GP+   G +EG AFVHT       
Sbjct  352  VGMGGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVHTPYSN---  407

Query  377  RDKGETIPSKDFTDQDYPDIQFHFVSRSFFSDPELPVDLPPPFGLSREAYMATYGSVLGR  436
                           D+PDIQFH    S  SD    V      GL    Y   Y  +  +
Sbjct  408  ------------RSLDWPDIQFHMAPASINSDNGARVK--KVLGLKESVYQEVYHPIANK  453

Query  437  DSWHMVVTLLRPKSVGSIELASADPEAYPVIRPNYFTDEHDLDLADMIQGVRLGHRLSKT  496
            DSW ++  LLRP+S GS++L SA+P  YP+I  NYF D   LD   +++G ++  R+++ 
Sbjct  454  DSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDP--LDAKTLVEGAKIALRVAEA  511

Query  497  DALQKDYESSFWYGPFPGCEEFQDKVGSRAFWECYLRHFTMTLFHPVGTCKMGPDSDPEA  556
                K + S  W  P P C+  Q K  S A+ EC++R  +MT++HP GT KMGP  DPEA
Sbjct  512  QVF-KQFGSRLWRKPLPNCK--QHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEA  568

Query  557  VLDPRLRTSWRMATCLVLVVTAGYIIASVAGETEFDFIVVGAGSAGAVVANRLSEEPEWT  616
            V+DPRLR         + V+ A  +    +G T    I++    A  +  + L+  PE+ 
Sbjct  569  VVDPRLRV---YGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLT-NPEYK  624

Query  617  V  617
            V
Sbjct  625  V  625


>Q6NR10_DROME unnamed protein product
Length=703

 Score = 564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/595 (49%), Positives = 387/595 (65%), Gaps = 28/595 (5%)

Query  590   EFDFIVVGAGSAGAVVANRLSEEPEWTVLLLEAGGEPTRLSDAPYFMDRAQHSHIDWEFY  649
             E+DFIVVG+GSAGAVVANRLSE  +W VLL+EAG +   +SD P      Q S +DW + 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  650   AEKDGKTCLSMKDGRSFWPRGKVLGGSSVLNANMYIRGNRRDYDRWTALGNPGWSYDEVL  709
              E   K CL M++ R  WPRG+VLGGSSVLN  +Y+RGNR DYD W +LGNPGW YD VL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  710   PYFKKSEDNLVPELADSQYHGKGGYLSVEHSPHKTPLLDAILEAGQELGYSTIDCNGEHQ  769
              YFKKSEDN  P LA+++YHG+GG L+V+ SP  +PL+ A +EAG +LGY   D NG  Q
Sbjct  176   RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  770   TGFMLTQQTTRKGVRCNTARAFLDPVRGRPNLRIATHSQVHRVLVEGG--KVTGVEFKQE  827
              GFM+ Q T R+G RC+TA+AFL P+R R N  ++ +S V RV++E G  +   VEF + 
Sbjct  236   AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  828   GGEVKRVRARKEVVLSAGAVQSPQLLMLSGIGPRKHLENVGIPVVHDLPGVGRNLQDHVS  887
              G+V R+ AR+EV++SAGA+ +PQL+MLSG+GPRKHLE  GI V+ DLP VG N+QDHV 
Sbjct  296   -GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVG  353

Query  888   T--MIPFISKKDVFIDDAHVGTQLNFEKWLTNGTGPISLATTIEAMAFVHTKRHPDLDKD  945
                +   + K    + D    T + F+ ++    GP++    +E +AFVHT   P  ++ 
Sbjct  354   MGGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVHT---PYSNR-  408

Query  946   GVEAAAEDLLDSDYPDIQFHVGSRSIFSDKELREDLHPPFGLSKEAFIAAYGPVIGTTSW  1005
                         D+PDIQFH+   SI SD   R  +    GL +  +   Y P+    SW
Sbjct  409   ----------SLDWPDIQFHMAPASINSDNGAR--VKKVLGLKESVYQEVYHPIANKDSW  456

Query  1006  ANVVTLLRPRSVGSIELASADPEDYPVIRANYYTDEEGRDLSDMIQGARIALRFSKAEAL  1065
               +  LLRPRS GS++L SA+P  YP+I ANY+ D    D   +++GA+IALR ++A+  
Sbjct  457   TIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDP--LDAKTLVEGAKIALRVAEAQVF  514

Query  1066  QKGYESSMWSGPLPGCEEFEDQVDSRAFWECYLRHFTMTLYHPSGTCKMGPDSDPEAVLD  1125
              K + S +W  PLP C++ +   D  A+ EC++R  +MT+YHP GT KMGP  DPEAV+D
Sbjct  515   -KQFGSRLWRKPLPNCKQHKFLSD--AYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVD  571

Query  1126  PRLRVRGIEGLRVVDCSVMPNLVSGNTNAPTIMIGEKASDLIKEDWGKKPSLTPK  1180
             PRLRV G+ GLRV+D S+MP + SGNTNAP IMI EK +DLIKEDW   P    K
Sbjct  572   PRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVK  626


 Score = 559 bits (1441),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 296/597 (50%), Positives = 389/597 (65%), Gaps = 30/597 (5%)

Query  1197  EFDFIVVGAGSAGAVVANRLSEESEWTVLLLEAGGEPPHLTDVPYFADRSKYTDIDWQFY  1256
             E+DFIVVG+GSAGAVVANRLSE  +W VLL+EAG +   ++DVP  A   + + +DW + 
Sbjct  56    EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  1257  AEKDENTFLSMKDGRSFWPRGKVLGGSSVMNSMVYIRGNRHDYDRWAALGNPGWSYDEVL  1316
              E      L M++ R  WPRG+VLGGSSV+N M+Y+RGNRHDYD WA+LGNPGW YD VL
Sbjct  116   TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  1317  PYFKKSEDNLVPELADSPYHGRGGYLSVEHSSYRTPLMDAFLEAGKELGYSTIDSNGEHQ  1376
              YFKKSEDN  P LA++ YHGRGG L+V+ S + +PL+ AF+EAG +LGY   D NG  Q
Sbjct  176   RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  1377  SGFMVPQFSTKNGVRCSTARAFLDPVRGRPNLRIATHSQVHRMLVEGG--KVTGVEFKQE  1434
             +GFM+ Q + + G RCSTA+AFL P+R R N  ++ +S V R+++E G  +   VEF + 
Sbjct  236   AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  1435  GGEVKRVRARKEVVLSAGAVQSPQLLMLSGIGPRKHLEDVGIPVVHDLPGVGRNLQDHVS  1494
              G+V R+ AR+EV++SAGA+ +PQL+MLSG+GPRKHLE  GI V+ DLP VG N+QDHV 
Sbjct  296   -GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVG  353

Query  1495  T-LLSFIMKKTV-FHNDAHFATQLNFERWLTNGTGPLALPASVETNAYVHPKRHHDLDRD  1552
                L+F++ K V    D    T + F+ ++    GP+     VE  A+VH          
Sbjct  354   MGGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVH----------  402

Query  1553  DGESPTPSEESHDQDYPDIAFHFGSRSIFSDSGTRDDLPLPFALSKEAFQGAYGTVIGKD  1612
                  TP   +   D+PDI FH    SI SD+G R    L   L +  +Q  Y  +  KD
Sbjct  403   -----TP-YSNRSLDWPDIQFHMAPASINSDNGARVKKVL--GLKESVYQEVYHPIANKD  454

Query  1613  SWSMSVTLLRPRSVGSIKLASADPEDHPIIRPNYYSDEQGRDLADVIQGARLALRLSKTE  1672
             SW++   LLRPRS GS+KL SA+P  +P+I  NY+ D    D   +++GA++ALR+++ +
Sbjct  455   SWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDPL--DAKTLVEGAKIALRVAEAQ  512

Query  1673  ALQKDYESSFWYGPFPGCEEFQDKVGSRAFWECYLRHFTMTLFHPVGTCKMGPDSDPEAV  1732
                K + S  W  P P C+  Q K  S A+ EC++R  +MT++HP GT KMGP  DPEAV
Sbjct  513   VF-KQFGSRLWRKPLPNCK--QHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAV  569

Query  1733  LDPRLRVRGVEGLRVADASIMPKLVSGNTNAPTIMIGEKAADLIKEDWGKKPSLAPK  1789
             +DPRLRV GV GLRV DASIMP + SGNTNAP IMI EK ADLIKEDW   P    K
Sbjct  570   VDPRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYKVK  626


 Score = 478 bits (1230),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 265/601 (44%), Positives = 362/601 (60%), Gaps = 35/601 (6%)

Query  21   EFDFIVVGAGSAGAVVANRLSEETEWTVLLLEAGGELPHTHLTDVPYFTDRSKHTDIDWQ  80
            E+DFIVVG+GSAGAVVANRLSE  +W VLL+EAG +     ++DVP      + + +DW 
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPD--ENEISDVPSLAAYLQLSKLDWA  113

Query  81   FYAENDGKTSLSMKDGRSFWPRGKVLGGSSVMNSMLYIRGNRRDYDLWETLGNPGWSYED  140
            +  E   K  L M++ R  WPRG+VLGGSSV+N MLY+RGNR DYD W +LGNPGW Y++
Sbjct  114  YKTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDN  173

Query  141  VLPYFKKSEDNSMPELQDSPYHGKGGYLSVEHSSYRTPLLDPFLQAGVELGYPTIDCNGE  200
            VL YFKKSEDN  P L ++ YHG+GG L+V+ S + +PL+  F++AG +LGY   D NG 
Sbjct  174  VLRYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGA  233

Query  201  KQTGFMVSQVASRNGVRCSTARAFLDPVRGRPNLRIATHSQVHRVLVEGG--KVTGVEFK  258
            KQ GFM++Q   R G RCSTA+AFL P+R R N  ++ +S V RV++E G  +   VEF 
Sbjct  234  KQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFV  293

Query  259  QEGGEVKRVRARKEVVLSAGAVQSPQLLMLSGIGPRKHLEDVGIPVVHDLPGVGRNLQDH  318
            +  G+V R+ AR+EV++SAGA+ +PQL+MLSG+GPRKHLE  GI V+ DLP VG N+QDH
Sbjct  294  KH-GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDH  351

Query  319  VST-ILPFVTMKTV-FNNDGYIATQLNFERWLTNGTGPLAMPGSLEGKAFVHTKRHQDLD  376
            V    L F+  K V    D +  T + F+ ++    GP+   G +EG AFVHT       
Sbjct  352  VGMGGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVHTPYSN---  407

Query  377  RDKGETIPSKDFTDQDYPDIQFHFVSRSFFSDPELPVDLPPPFGLSREAYMATYGSVLGR  436
                           D+PDIQFH    S  SD    V      GL    Y   Y  +  +
Sbjct  408  ------------RSLDWPDIQFHMAPASINSDNGARVK--KVLGLKESVYQEVYHPIANK  453

Query  437  DSWHMVVTLLRPKSVGSIELASADPEAYPVIRPNYFTDEHDLDLADMIQGVRLGHRLSKT  496
            DSW ++  LLRP+S GS++L SA+P  YP+I  NYF D   LD   +++G ++  R+++ 
Sbjct  454  DSWTIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDP--LDAKTLVEGAKIALRVAEA  511

Query  497  DALQKDYESSFWYGPFPGCEEFQDKVGSRAFWECYLRHFTMTLFHPVGTCKMGPDSDPEA  556
                K + S  W  P P C+  Q K  S A+ EC++R  +MT++HP GT KMGP  DPEA
Sbjct  512  QVF-KQFGSRLWRKPLPNCK--QHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEA  568

Query  557  VLDPRLRTSWRMATCLVLVVTAGYIIASVAGETEFDFIVVGAGSAGAVVANRLSEEPEWT  616
            V+DPRLR         + V+ A  +    +G T    I++    A  +  + L+  PE+ 
Sbjct  569  VVDPRLRV---YGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLT-NPEYK  624

Query  617  V  617
            V
Sbjct  625  V  625


>Q9VY02_DROME unnamed protein product
Length=633

 Score = 466 bits (1200),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 262/589 (44%), Positives = 363/589 (62%), Gaps = 27/589 (5%)

Query  1198  FDFIVVGAGSAGAVVANRLSEESEWTVLLLEAGGEPPHLTDVPYFADRSKYTDIDWQFYA  1257
             +DFIV+G GSAG V+A RLSE  EW+VLLLEAGG+ P L D+P      + +  DW++  
Sbjct  57    YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLT  116

Query  1258  EKDENTFLSMKDGRSFWPRGKVLGGSSVMNSMVYIRGNRHDYDRWAALGNPGWSYDEVLP  1317
             E  +   L+M+D R FWPR KVLGG S +N+M+YIRGNR DYD+WAALGNPGW+YD +L 
Sbjct  117   EPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILH  176

Query  1318  YFKKSEDNLVPELADSPYHGRGGYLSVEHSSYRTPLMDAFLEAGKELG--YSTIDSNGEH  1375
             YF+K ED  VP    SPYHG GG +SVE   + +PL+D F+ A ++LG  +   D NG  
Sbjct  177   YFRKLEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFNGRS  236

Query  1376  QSGFMVPQFSTKNGVRCSTARAFLDPVRGRPNLRIATHSQVHRMLV--EGGKVTGVEFKQ  1433
             Q+GF  P  S ++G+RCS  + ++     RPNL I   + V R+++  +  +  GV F  
Sbjct  237   QTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVIF--  294

Query  1434  EGGEVKR-VRARKEVVLSAGAVQSPQLLMLSGIGPRKHLEDVGIPVVHDLPGVGRNLQDH  1492
             E G +K  VRA++EV+LSAG++ SPQLLM+SG+GPR  LE  GIPVV  LPGVG NLQDH
Sbjct  295   EYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQDH  354

Query  1493  VSTLLSFIMKKTVFHNDAHFATQLNF-ERWLTNGTGPLALPASVETNAYVHPKRHHDLDR  1551
             +ST         ++  D+     L+F    + N           ++  Y  P     +  
Sbjct  355   IST------SGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMP-----VSE  403

Query  1552  DDGESPTPSEESHDQDYPDIAFHFGSRSIFSDSGTRDDLPLPFALSKEAFQGAYGTVIGK  1611
               G   T  ++    D+PD+    GS    +D G         A++ + +  A+  V+ +
Sbjct  404   VMGFFSTRYQDPR-LDWPDVQIFMGSYGYGADGGMIGRRGA--AITLDNYAEAFEPVLYQ  460

Query  1612  DSWSMSVTLLRPRSVGSIKLASADPEDHPIIRPNYYSDEQGRDLADVIQGARLALRLSKT  1671
             DS+ ++  L+RPRS G ++L SADP+ HP+I  NYY D    D+A +++G +LA RL++T
Sbjct  461   DSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPH--DMAVMVEGLKLAHRLTQT  518

Query  1672  EALQKDYESSFWYGPFPGCEEFQDKVGSRAFWECYLRHFTMTLFHPVGTCKMGPDSDPEA  1731
               +Q    +   Y  +  C E +    S AFWEC  R ++ T++HPVGTCKM P SDP  
Sbjct  519   PVMQSLNATMNIY-EWRNCPEVE--YLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAG  575

Query  1732  VLDPRLRVRGVEGLRVADASIMPKLVSGNTNAPTIMIGEKAADLIKEDW  1780
             V+DPRLRVRG+ GLRV DASIMP + +GNTNAPT+M+ E+ AD+IKEDW
Sbjct  576   VVDPRLRVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGADIIKEDW  624


 Score = 464 bits (1195),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 261/598 (44%), Positives = 353/598 (59%), Gaps = 47/598 (8%)

Query  591   FDFIVVGAGSAGAVVANRLSEEPEWTVLLLEAGGEPTRLSDAPYFMDRAQHSHIDWEFYA  650
             +DFIV+G GSAG V+A RLSE PEW+VLLLEAGG+   L D P      Q S  DW++  
Sbjct  57    YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLT  116

Query  651   EKDGKTCLSMKDGRSFWPRGKVLGGSSVLNANMYIRGNRRDYDRWTALGNPGWSYDEVLP  710
             E   + CL+M+D R FWPR KVLGG S +NA MYIRGNRRDYD+W ALGNPGW+YD +L 
Sbjct  117   EPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILH  176

Query  711   YFKKSEDNLVPELADSQYHGKGGYLSVEHSPHKTPLLDAILEAGQELG--YSTIDCNGEH  768
             YF+K ED  VP    S YHG GG +SVE     +PLLD  + A Q+LG  +   D NG  
Sbjct  177   YFRKLEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFNGRS  236

Query  769   QTGFMLTQQTTRKGVRCNTARAFLDPVRGRPNLRIATHSQVHRVLV--EGGKVTGVEFKQ  826
             QTGF     + R G+RC+  + ++     RPNL I   + V R+++  +  +  GV F  
Sbjct  237   QTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVIF--  294

Query  827   EGGEVKR-VRARKEVVLSAGAVQSPQLLMLSGIGPRKHLENVGIPVVHDLPGVGRNLQDH  885
             E G +K  VRA++EV+LSAG++ SPQLLM+SG+GPR  LE  GIPVV  LPGVG NLQDH
Sbjct  295   EYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQDH  354

Query  886   VSTMIPFISKKDVFIDDAHVGTQLNF-----------EKWLTNGTGPISLATTIEAMAFV  934
             +ST         ++  D+     L+F           E ++             E M F 
Sbjct  355   IST------SGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFF  408

Query  935   HTK-RHPDLDKDGVEAAAEDLLDSDYPDIQFHVGSRSIFSDKELREDLHPPFGLSKEAFI  993
              T+ + P L               D+PD+Q  +GS    +D  +         ++ + + 
Sbjct  409   STRYQDPRL---------------DWPDVQIFMGSYGYGADGGMIGRRGA--AITLDNYA  451

Query  994   AAYGPVIGTTSWANVVTLLRPRSVGSIELASADPEDYPVIRANYYTDEEGRDLSDMIQGA  1053
              A+ PV+   S+     L+RPRS G ++L SADP+ +P+I ANYY D    D++ M++G 
Sbjct  452   EAFEPVLYQDSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPH--DMAVMVEGL  509

Query  1054  RIALRFSKAEALQKGYESSMWSGPLPGCEEFEDQVDSRAFWECYLRHFTMTLYHPSGTCK  1113
             ++A R ++   +Q    ++M       C E E   D  AFWEC  R ++ T+YHP GTCK
Sbjct  510   KLAHRLTQTPVMQS-LNATMNIYEWRNCPEVEYLSD--AFWECLARFYSQTIYHPVGTCK  566

Query  1114  MGPDSDPEAVLDPRLRVRGIEGLRVVDCSVMPNLVSGNTNAPTIMIGEKASDLIKEDW  1171
             M P SDP  V+DPRLRVRG+ GLRV+D S+MP + +GNTNAPT+M+ E+ +D+IKEDW
Sbjct  567   MAPASDPAGVVDPRLRVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGADIIKEDW  624


 Score = 404 bits (1037),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 237/554 (43%), Positives = 332/554 (60%), Gaps = 38/554 (7%)

Query  22   FDFIVVGAGSAGAVVANRLSEETEWTVLLLEAGGELPHTHLTDVPYFTDRSKHTDIDWQF  81
            +DFIV+G GSAG V+A RLSE  EW+VLLLEAGG+ P   L D+P      + +  DW++
Sbjct  57   YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPL--LIDLPQLYPVFQRSPWDWKY  114

Query  82   YAENDGKTSLSMKDGRSFWPRGKVLGGSSVMNSMLYIRGNRRDYDLWETLGNPGWSYEDV  141
              E   +  L+M+D R FWPR KVLGG S +N+M+YIRGNRRDYD W  LGNPGW+Y+++
Sbjct  115  LTEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNI  174

Query  142  LPYFKKSEDNSMPELQDSPYHGKGGYLSVEHSSYRTPLLDPFLQAGVELG--YPTIDCNG  199
            L YF+K ED  +P  + SPYHG GG +SVE   + +PLLD F++A  +LG  +P  D NG
Sbjct  175  LHYFRKLEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFNG  234

Query  200  EKQTGFMVSQVASRNGVRCSTARAFLDPVRGRPNLRIATHSQVHRVLV--EGGKVTGVEF  257
              QTGF     + R+G+RCS  + ++     RPNL I   + V R+++  +  +  GV F
Sbjct  235  RSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVIF  294

Query  258  KQEGGEVKR-VRARKEVVLSAGAVQSPQLLMLSGIGPRKHLEDVGIPVVHDLPGVGRNLQ  316
              E G +K  VRA++EV+LSAG++ SPQLLM+SG+GPR  LE  GIPVV  LPGVG NLQ
Sbjct  295  --EYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQ  352

Query  317  DHVSTILPFVTMKTVFNND-GYIATQLNFERWL---TNGTGPL--AMPGSLEGKAFVHTK  370
            DH+ST     T  +  N    +I  ++  E+ +     G+     AMP S E   F  T 
Sbjct  353  DHISTSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVS-EVMGFFST-  410

Query  371  RHQDLDRDKGETIPSKDFTDQDYPDIQFHFVSRSFFSDPELPVDLPPPFGLSREAYMATY  430
            R+QD                 D+PD+Q    S  + +D  +         ++ + Y   +
Sbjct  411  RYQD--------------PRLDWPDVQIFMGSYGYGADGGMIGRRGA--AITLDNYAEAF  454

Query  431  GSVLGRDSWHMVVTLLRPKSVGSIELASADPEAYPVIRPNYFTDEHDLDLADMIQGVRLG  490
              VL +DS+ +   L+RP+S G ++L SADP+ +P+I  NY+ D H  D+A M++G++L 
Sbjct  455  EPVLYQDSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPH--DMAVMVEGLKLA  512

Query  491  HRLSKTDALQKDYESSFWYGPFPGCEEFQDKVGSRAFWECYLRHFTMTLFHPVGTCKMGP  550
            HRL++T  +Q    +   Y  +  C E +    S AFWEC  R ++ T++HPVGTCKM P
Sbjct  513  HRLTQTPVMQSLNATMNIY-EWRNCPEVE--YLSDAFWECLARFYSQTIYHPVGTCKMAP  569

Query  551  DSDPEAVLDPRLRT  564
             SDP  V+DPRLR 
Sbjct  570  ASDPAGVVDPRLRV  583



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000087-PA

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY08_DROME  unnamed protein product                                 559     0.0   
Q6NR10_DROME  unnamed protein product                                 559     0.0   
Q9VY02_DROME  unnamed protein product                                 491     5e-167


>Q9VY08_DROME unnamed protein product
Length=703

 Score = 559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/593 (49%), Positives = 392/593 (66%), Gaps = 28/593 (5%)

Query  25   EYDFIVVGGGSAGAVVANRLSEEPEWSVLLLEAGGEVPHMGDVPYFADRVQHSHVDWEFF  84
            EYDFIVVG GSAGAVVANRLSE  +W VLL+EAG +   + DVP  A  +Q S +DW + 
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  85   TEPDGTTCLSMKDGRSFWPRGKVLGGTSVLNSLMYIRGNRKDYDIWESMGNPGWSYEDVL  144
            TEP    CL M++ R  WPRG+VLGG+SVLN ++Y+RGNR DYD W S+GNPGW Y++VL
Sbjct  116  TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  145  PYFKKSEDNRMPDLQHSLYHGKGGYLSIEHPSYNTPLLEAYLEAGRELGYPVTDCNGESQ  204
             YFKKSEDNR P L ++ YHG+GG L+++   +++PL+ A++EAG +LGY   D NG  Q
Sbjct  176  RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  205  TGFMVAQYTSRNGERCHTAKAFLDPVRGRPNLEISTRAHVHRVLLEDG--KAAGVEFKQG  262
             GFM+AQ T R G RC TAKAFL P+R R N  +S  +HV RV++E G  +A  VEF + 
Sbjct  236  AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  263  GKLKRVRARKEVVLSAGALGSPQLLMLSGIGPEKHLKDVGIPVVHHLPGVGQNLQDHTAT  322
            GK+ R+ AR+EV++SAGA+ +PQL+MLSG+GP KHL+  GI V+  LP VG+N+QDH   
Sbjct  296  GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGM  354

Query  323  -VVPFVIQKSVS-NNDDLVATQLNFERWLTNGTGPISMPVSVEAKAFLDTKRHDDLDKDA  380
              + F++ K V+   D    T + F+ ++    GP++    VE  AF+ T          
Sbjct  355  GGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVHTP---------  404

Query  381  DETSEGESFRDEDFPDIEFHLVSRSMFSDKSLRDDLHPPYGMSEEAYLAAYGPVLGKDSW  440
                   S R  D+PDI+FH+   S+ SD   R  +    G+ E  Y   Y P+  KDSW
Sbjct  405  ------YSNRSLDWPDIQFHMAPASINSDNGAR--VKKVLGLKESVYQEVYHPIANKDSW  456

Query  441  MNVISLLRPKSIGSIELASADPEAHPTIRPNYYSDKEGYDMRTMIQGARLAHRMARTQAL  500
              +  LLRP+S GS++L SA+P  +P I  NY+ D    D +T+++GA++A R+A  Q  
Sbjct  457  TIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDP--LDAKTLVEGAKIALRVAEAQVF  514

Query  501  QKKYESTLWYGPHPGCEEFQDQVGSRAFWECYLRRITMTTYHPVGTCKMGPDSDKDAVLD  560
             K++ S LW  P P C+  Q +  S A+ EC++R I+MT YHP GT KMGP  D +AV+D
Sbjct  515  -KQFGSRLWRKPLPNCK--QHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVD  571

Query  561  PRLRVRGIQGLRVVDASVMPVMVSGNVNAPIIMIGEKGSDLIKEDWGKRPSHQ  613
            PRLRV G++GLRV+DAS+MP + SGN NAP+IMI EKG+DLIKEDW   P ++
Sbjct  572  PRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYK  624


>Q6NR10_DROME unnamed protein product
Length=703

 Score = 559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/593 (49%), Positives = 392/593 (66%), Gaps = 28/593 (5%)

Query  25   EYDFIVVGGGSAGAVVANRLSEEPEWSVLLLEAGGEVPHMGDVPYFADRVQHSHVDWEFF  84
            EYDFIVVG GSAGAVVANRLSE  +W VLL+EAG +   + DVP  A  +Q S +DW + 
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLSKLDWAYK  115

Query  85   TEPDGTTCLSMKDGRSFWPRGKVLGGTSVLNSLMYIRGNRKDYDIWESMGNPGWSYEDVL  144
            TEP    CL M++ R  WPRG+VLGG+SVLN ++Y+RGNR DYD W S+GNPGW Y++VL
Sbjct  116  TEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWASLGNPGWDYDNVL  175

Query  145  PYFKKSEDNRMPDLQHSLYHGKGGYLSIEHPSYNTPLLEAYLEAGRELGYPVTDCNGESQ  204
             YFKKSEDNR P L ++ YHG+GG L+++   +++PL+ A++EAG +LGY   D NG  Q
Sbjct  176  RYFKKSEDNRNPYLANNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDINGAKQ  235

Query  205  TGFMVAQYTSRNGERCHTAKAFLDPVRGRPNLEISTRAHVHRVLLEDG--KAAGVEFKQG  262
             GFM+AQ T R G RC TAKAFL P+R R N  +S  +HV RV++E G  +A  VEF + 
Sbjct  236  AGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEFVKH  295

Query  263  GKLKRVRARKEVVLSAGALGSPQLLMLSGIGPEKHLKDVGIPVVHHLPGVGQNLQDHTAT  322
            GK+ R+ AR+EV++SAGA+ +PQL+MLSG+GP KHL+  GI V+  LP VG+N+QDH   
Sbjct  296  GKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLP-VGENMQDHVGM  354

Query  323  -VVPFVIQKSVS-NNDDLVATQLNFERWLTNGTGPISMPVSVEAKAFLDTKRHDDLDKDA  380
              + F++ K V+   D    T + F+ ++    GP++    VE  AF+ T          
Sbjct  355  GGLTFLVDKPVAIVQDRFNPTAVTFQ-YVLRERGPMTTLGGVEGLAFVHTP---------  404

Query  381  DETSEGESFRDEDFPDIEFHLVSRSMFSDKSLRDDLHPPYGMSEEAYLAAYGPVLGKDSW  440
                   S R  D+PDI+FH+   S+ SD   R  +    G+ E  Y   Y P+  KDSW
Sbjct  405  ------YSNRSLDWPDIQFHMAPASINSDNGAR--VKKVLGLKESVYQEVYHPIANKDSW  456

Query  441  MNVISLLRPKSIGSIELASADPEAHPTIRPNYYSDKEGYDMRTMIQGARLAHRMARTQAL  500
              +  LLRP+S GS++L SA+P  +P I  NY+ D    D +T+++GA++A R+A  Q  
Sbjct  457  TIMPLLLRPRSRGSVKLRSANPFHYPLINANYFDDP--LDAKTLVEGAKIALRVAEAQVF  514

Query  501  QKKYESTLWYGPHPGCEEFQDQVGSRAFWECYLRRITMTTYHPVGTCKMGPDSDKDAVLD  560
             K++ S LW  P P C+  Q +  S A+ EC++R I+MT YHP GT KMGP  D +AV+D
Sbjct  515  -KQFGSRLWRKPLPNCK--QHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVD  571

Query  561  PRLRVRGIQGLRVVDASVMPVMVSGNVNAPIIMIGEKGSDLIKEDWGKRPSHQ  613
            PRLRV G++GLRV+DAS+MP + SGN NAP+IMI EKG+DLIKEDW   P ++
Sbjct  572  PRLRVYGVRGLRVIDASIMPTISSGNTNAPVIMIAEKGADLIKEDWLTNPEYK  624


>Q9VY02_DROME unnamed protein product
Length=633

 Score = 491 bits (1263),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 266/591 (45%), Positives = 367/591 (62%), Gaps = 33/591 (6%)

Query  26   YDFIVVGGGSAGAVVANRLSEEPEWSVLLLEAGGEVPHMGDVPYFADRVQHSHVDWEFFT  85
            YDFIV+GGGSAG V+A RLSE PEWSVLLLEAGG+ P + D+P      Q S  DW++ T
Sbjct  57   YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPWDWKYLT  116

Query  86   EPDGTTCLSMKDGRSFWPRGKVLGGTSVLNSLMYIRGNRKDYDIWESMGNPGWSYEDVLP  145
            EP    CL+M+D R FWPR KVLGG S +N++MYIRGNR+DYD W ++GNPGW+Y+++L 
Sbjct  117  EPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAALGNPGWNYDNILH  176

Query  146  YFKKSEDNRMPDLQHSLYHGKGGYLSIEHPSYNTPLLEAYLEAGRELG--YPVTDCNGES  203
            YF+K ED R+P  +HS YHG GG +S+E   + +PLL+ ++ A ++LG  +P  D NG S
Sbjct  177  YFRKLEDMRVPGFEHSPYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFNGRS  236

Query  204  QTGFMVAQYTSRNGERCHTAKAFLDPVRGRPNLEISTRAHVHRVLL--EDGKAAGVEFKQ  261
            QTGF     + R+G RC   K ++     RPNL+I  +A V R+++  +  +A GV F+ 
Sbjct  237  QTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVIFEY  296

Query  262  GGKLKRVRARKEVVLSAGALGSPQLLMLSGIGPEKHLKDVGIPVVHHLPGVGQNLQDHTA  321
            G     VRA++EV+LSAG+L SPQLLM+SG+GP   L+  GIPVV HLPGVG NLQDH +
Sbjct  297  GLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQDHIS  356

Query  322  TVVPFVIQKSVSNND-DLVATQLNFERWL---TNGTGPI--SMPVSVEAKAFLDTKRHDD  375
            T        S  N     +  ++  E+ +     G+     +MPVS E   F  T+  D 
Sbjct  357  TSGAIYTFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVS-EVMGFFSTRYQDP  415

Query  376  LDKDADETSEGESFRDEDFPDIEFHLVSRSMFSDKSLRDDLHPPYGMSEEAYLAAYGPVL  435
                             D+PD++  + S    +D  +         ++ + Y  A+ PVL
Sbjct  416  ---------------RLDWPDVQIFMGSYGYGADGGMIGRRGA--AITLDNYAEAFEPVL  458

Query  436  GKDSWMNVISLLRPKSIGSIELASADPEAHPTIRPNYYSDKEGYDMRTMIQGARLAHRMA  495
             +DS++    L+RP+S G ++L SADP+ HP I  NYY D   +DM  M++G +LAHR+ 
Sbjct  459  YQDSFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDP--HDMAVMVEGLKLAHRLT  516

Query  496  RTQALQKKYESTLWYGPHPGCEEFQDQVGSRAFWECYLRRITMTTYHPVGTCKMGPDSDK  555
            +T  +Q    +T+       C E   +  S AFWEC  R  + T YHPVGTCKM P SD 
Sbjct  517  QTPVMQ-SLNATMNIYEWRNCPEV--EYLSDAFWECLARFYSQTIYHPVGTCKMAPASDP  573

Query  556  DAVLDPRLRVRGIQGLRVVDASVMPVMVSGNVNAPIIMIGEKGSDLIKEDW  606
              V+DPRLRVRG++GLRV+DAS+MP + +GN NAP +M+ E+G+D+IKEDW
Sbjct  574  AGVVDPRLRVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGADIIKEDW  624



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000088-PA

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TL5B_TACTR  unnamed protein product                                   201     2e-64
TL5A_TACTR  unnamed protein product                                   185     2e-58
SCA_DROME  unnamed protein product                                    125     4e-33


>TL5B_TACTR unnamed protein product
Length=316

 Score = 201 bits (511),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 128/191 (67%), Gaps = 2/191 (1%)

Query  5    VLCDLETDGGGWTVIQRRGDVSPEQQLDFFGTWNDYRWGFGELRSEFWIGLETIHLITSG  64
            V CD+ET GGGWTVIQRRGD     Q +F+ TW  Y+ GFG L  EFW+G + I ++T+ 
Sbjct  122  VFCDMETAGGGWTVIQRRGDFGQPIQ-NFYQTWESYKNGFGNLTKEFWLGNDIIFVLTNQ  180

Query  65   ESQSMRVDLEDFGGERKHALYRNFRLADNDDNFRLHVSGYSGNAGDSLSYHSEMPFSTKD  124
            +S  +RVDLEDF G R++A    F +    + +++    Y G+AGDSLS H+ MPF+TKD
Sbjct  181  DSVVLRVDLEDFEGGRRYAEAVEFLVRSEIELYKMSFKTYKGDAGDSLSQHNNMPFTTKD  240

Query  125  RDNDVYHTGSCARLYRGAWWYRSCHKVNLNGLYLRGEHITYADGINWKDWHGYHYSLKAS  184
            RDND +   +CA  Y+G WWY +CH  NLNG+YLRG H   A G+NW  W G++YSLK S
Sbjct  241  RDNDKWEK-NCAEAYKGGWWYNACHHSNLNGMYLRGPHEESAVGVNWYQWRGHNYSLKVS  299

Query  185  KMMVRPTGFLA  195
            +M +RP  F+ 
Sbjct  300  EMKIRPIIFVP  310


>TL5A_TACTR unnamed protein product
Length=292

 Score = 185 bits (470),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 125/189 (66%), Gaps = 2/189 (1%)

Query  5    VLCDLETDGGGWTVIQRRGDVSPEQQLDFFGTWNDYRWGFGELRSEFWIGLETIHLITSG  64
            V CD+ETDGGGWTVIQRRG+        F+  W +Y+ GFG +  +FW+G + I  +T+ 
Sbjct  101  VYCDMETDGGGWTVIQRRGNYGNPSDY-FYKPWKNYKLGFGNIEKDFWLGNDRIFALTNQ  159

Query  65   ESQSMRVDLEDFGGERKHALYRNFRLADNDDNFRLHVSGYSGNAGDSLSYHSEMPFSTKD  124
             +  +R DL+D   + ++A+Y++F + + D  + LH+  YSG+AG+S   H+   FST D
Sbjct  160  RNYMIRFDLKDKENDTRYAIYQDFWIENEDYLYCLHIGNYSGDAGNSFGRHNGHNFSTID  219

Query  125  RDNDVYHTGSCARLYRGAWWYRSCHKVNLNGLYLRGEHITYADGINWKDWHGYHYSLKAS  184
            +D+D + T  CA+ Y+G WWY  CH+ NLNGLYL GEH +YADGI W+ W GYHYSL   
Sbjct  220  KDHDTHET-HCAQTYKGGWWYDRCHESNLNGLYLNGEHNSYADGIEWRAWKGYHYSLPQV  278

Query  185  KMMVRPTGF  193
            +M +RP  F
Sbjct  279  EMKIRPVEF  287


>SCA_DROME unnamed protein product
Length=799

 Score = 125 bits (313),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 68/175 (39%), Positives = 95/175 (54%), Gaps = 12/175 (7%)

Query  15   GWTVIQRRGDVSPEQQLDFFGTWNDYRWGFGELRSEFWIGLETIHLITSGESQSMRVDLE  74
            GWT +QRR D S     DF  +W DY  GFG    EFWIG E +H +T      ++V ++
Sbjct  572  GWTTVQRRFDGSA----DFNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQ  627

Query  75   DFGGERKHALYRNFRLADNDDNFRLHVSGYSGNAGDSLSYHSEMPFSTKDRDNDVYHTGS  134
            D       A Y+ F ++   D +RLH++ YSGNA D+L+Y   M FS  D D D+  T  
Sbjct  628  DIYDNVWVAEYKRFYISSRADGYRLHIAEYSGNASDALNYQQGMQFSAIDDDRDISQT-H  686

Query  135  CARLYRGAWWYRSCHKVNLNGLYLRGEHITYADGINWKDWHGYHYSLKASKMMVR  189
            CA  Y G WW+  C   NLNG Y  G  +T+ D     +W     ++K+S+M+V+
Sbjct  687  CAANYEGGWWFSHCQHANLNGRYNLG--LTWFDAAR-NEW----IAVKSSRMLVK  734



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000089-PA

Length=1205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDT5_DROME  unnamed protein product                                 160     8e-42
Q94269_CAEEL  unnamed protein product                                 69.3    2e-11
Q38CD7_TRYB2  unnamed protein product                                 58.9    1e-08


>Q9VDT5_DROME unnamed protein product
Length=482

 Score = 160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 139/240 (58%), Gaps = 16/240 (7%)

Query  365  KYVPALSHKIHMSNPT--ANVTINYKGMAVGDGWSDPMSMEDYGLYLYYIGLLDENEAQY  422
            KYVPAL++ IH         V +  KG+A+G+G SDP+    YG YLY +GL+DE+  Q 
Sbjct  221  KYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLSDPLHQLKYGDYLYQLGLIDEHGLQS  280

Query  423  FQQAAQNIRDLIQQKKWVEANNVYNSLFDN-------YTTLTGFENYYNYLFAKQPDDTS  475
            F  A     + I+      A +V++SL +        ++ LTG+  YYNYL  K  DD  
Sbjct  281  FHDAEAKGAECIKSHDMECAFDVFDSLINGDLTNGSLFSNLTGYNWYYNYL--KTHDDDG  338

Query  476  YN-GSFIQDLYFRQAIHVGNQTY---SSGEKVEEKLQADEMQSVKPWIEALLDSDYKILF  531
             N G F+Q    R+AIHVGN+T+       KVE  L+ D M SV PWI  LL + Y +  
Sbjct  339  ANLGEFLQAGATRRAIHVGNKTFHDLDKENKVELHLKKDIMDSVAPWIAELL-AHYTVCI  397

Query  532  YSGQMDIIVAHTLTQNFIKTLKWKGASEYSTSKKMIWRVDDDIAGYAKNVRNFTYVIIWN  591
            YSGQ+DIIVA+ LT+N++  LK+ G+ +Y  + + +WRV  ++AGY K+  +   +++ N
Sbjct  398  YSGQLDIIVAYPLTRNYLNQLKFPGSDKYKVAPREVWRVGKEVAGYVKHAGHLVEIMVRN  457


 Score = 139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 104/159 (65%), Gaps = 5/159 (3%)

Query  1043  FVNMTGLEDEYNYLYTIDPTSHDKYSTFIQLPEIRKAIHVGNQPYSGGDE---VSDHLMV  1099
             F N+TG    YNYL T D    +    F+Q    R+AIHVGN+ +   D+   V  HL  
Sbjct  318   FSNLTGYNWYYNYLKTHDDDGAN-LGEFLQAGATRRAIHVGNKTFHDLDKENKVELHLKK  376

Query  1100  DFMQSVKPWVEQLLDNDYRVLLYSGQVDVIVAHTLTQNFISTLKWKGADEYASSAKTIWK  1159
             D M SV PW+ +LL + Y V +YSGQ+D+IVA+ LT+N+++ LK+ G+D+Y  + + +W+
Sbjct  377   DIMDSVAPWIAELLAH-YTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDKYKVAPREVWR  435

Query  1160  VGDQVAGYGRKGLNLEYIIVRNAGHMVPHDQPEWAHQMM  1198
             VG +VAGY +   +L  I+VRNAGHM PHDQP+W + M+
Sbjct  436   VGKEVAGYVKHAGHLVEIMVRNAGHMAPHDQPKWLYMMI  474


 Score = 132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/217 (37%), Positives = 118/217 (54%), Gaps = 13/217 (6%)

Query  1    MAIGSGWLDPINMMGHGTHLYNMGLLDAKESADFSAEESKIQELIDNEKWTEALTAFYDL  60
            +AIG+G  DP++ + +G +LY +GL+D      F   E+K  E I +     A   F  L
Sbjct  248  VAIGNGLSDPLHQLKYGDYLYQLGLIDEHGLQSFHDAEAKGAECIKSHDMECAFDVFDSL  307

Query  61   LDN-------YRNLTGFETYDSFMNTKPKWTTTYNENFLQKPQIRDAIHVGQLPFND---  110
            ++        + NLTG+  Y +++ T         E FLQ    R AIHVG   F+D   
Sbjct  308  INGDLTNGSLFSNLTGYNWYYNYLKTHDDDGANLGE-FLQAGATRRAIHVGNKTFHDLDK  366

Query  111  SSIVDSHLRSDIMQSVKPWIEELLNNDYRIMFYSGQMDMIAAHTLTQNLINDLDWNGAGE  170
             + V+ HL+ DIM SV PWI ELL + Y +  YSGQ+D+I A+ LT+N +N L + G+ +
Sbjct  367  ENKVELHLKKDIMDSVAPWIAELLAH-YTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDK  425

Query  171  YNETSKKIWRVDDDVAGYVKQARKYVPALSHKI-HMA  206
            Y    +++WRV  +VAGYVK A   V  +     HMA
Sbjct  426  YKVAPREVWRVGKEVAGYVKHAGHLVEIMVRNAGHMA  462


 Score = 130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 106/156 (68%), Gaps = 6/156 (4%)

Query  589  IWNELLNNDLRSSPSYFTNFTGFDNYYNYLYPESPADGSLYGKFIQMTPIRKAIHVGNLT  648
            +++ L+N DL +  S F+N TG++ YYNYL      DG+  G+F+Q    R+AIHVGN T
Sbjct  303  VFDSLINGDLTNG-SLFSNLTGYNWYYNYLKTHD-DDGANLGEFLQAGATRRAIHVGNKT  360

Query  649  YNDGDA---VEEHLLQDMLQSIKPWFQELLEANYKIMLYSGQMDIIVGHTLTQNFIRKLN  705
            ++D D    VE HL +D++ S+ PW  ELL A+Y + +YSGQ+DIIV + LT+N++ +L 
Sbjct  361  FHDLDKENKVELHLKKDIMDSVAPWIAELL-AHYTVCIYSGQLDIIVAYPLTRNYLNQLK  419

Query  706  WSGAKEFQATEKKIWRVGNDIAGYIKQSKNFSFVVV  741
            + G+ +++   +++WRVG ++AGY+K + +   ++V
Sbjct  420  FPGSDKYKVAPREVWRVGKEVAGYVKHAGHLVEIMV  455


 Score = 109 bits (273),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 89/128 (70%), Gaps = 4/128 (3%)

Query  749  IFPNVTGFDDYYNYLSPADPLQFKYPSFIELPKTRKSLHVGNQTYSD---GSQVLLYLRS  805
            +F N+TG++ YYNYL   D        F++   TR+++HVGN+T+ D    ++V L+L+ 
Sbjct  317  LFSNLTGYNWYYNYLKTHDDDGANLGEFLQAGATRRAIHVGNKTFHDLDKENKVELHLKK  376

Query  806  DLMKSVKPWVEQLLDNDYRVLLYSGQMDIIVAHTFTQNFISKLKWKGADEFAASGKTILR  865
            D+M SV PW+ +LL + Y V +YSGQ+DIIVA+  T+N++++LK+ G+D++  + + + R
Sbjct  377  DIMDSVAPWIAELLAH-YTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDKYKVAPREVWR  435

Query  866  VGDQLAGY  873
            VG ++AGY
Sbjct  436  VGKEVAGY  443


 Score = 108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 89/140 (64%), Gaps = 5/140 (4%)

Query  895   FENMTGFENHYNYLYAVDPTLQDKYSTFVQLPEIRKAIHVGNQKYSDGDE---VNTHLMG  951
             F N+TG+  +YNYL   D    +    F+Q    R+AIHVGN+ + D D+   V  HL  
Sbjct  318   FSNLTGYNWYYNYLKTHDDDGAN-LGEFLQAGATRRAIHVGNKTFHDLDKENKVELHLKK  376

Query  952   DFMKSVKPWVEQLLDNDYRVLLYSGQVDVIVAHTLTQNFISTSKWKGADEYASSAKTIWK  1011
             D M SV PW+ +LL + Y V +YSGQ+D+IVA+ LT+N+++  K+ G+D+Y  + + +W+
Sbjct  377   DIMDSVAPWIAELLAH-YTVCIYSGQLDIIVAYPLTRNYLNQLKFPGSDKYKVAPREVWR  435

Query  1012  VGDQVAGYGRKGLNLEYIIV  1031
             VG +VAGY +   +L  I+V
Sbjct  436   VGKEVAGYVKHAGHLVEIMV  455


 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 80/174 (46%), Gaps = 13/174 (7%)

Query  192  ARKYVPALSHKIH-MANPITANVTINYKGIAAGDGWRWNPISLEDLGSSLYGLGVFDSSE  250
            A KYVPAL++ IH + N I   V +  KG+A G+G   +P+     G  LY LG+ D   
Sbjct  219  AGKYVPALAYHIHKVQNAIETRVYVPLKGVAIGNGLS-DPLHQLKYGDYLYQLGLIDEHG  277

Query  251  SKYFQRVAQNISELIQQDKWTEAELVYDALSNN-------YTRQTGIGDYYHYLFAKLPG  303
             + F       +E I+      A  V+D+L N        ++  TG   YY+YL      
Sbjct  278  LQSFHDAEAKGAECIKSHDMECAFDVFDSLINGDLTNGSLFSNLTGYNWYYNYLKTH-DD  336

Query  304  DTSYEGSFIQNPYFRQCIHVGNLTY---NSGNKVEERYQVEEAWLAGQWMNEFF  354
            D +  G F+Q    R+ IHVGN T+   +  NKVE   + +       W+ E  
Sbjct  337  DGANLGEFLQAGATRRAIHVGNKTFHDLDKENKVELHLKKDIMDSVAPWIAELL  390


>Q94269_CAEEL unnamed protein product
Length=2314

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 75/147 (51%), Gaps = 10/147 (7%)

Query  1068  STFIQLPEIRKAIHVGNQP--YSGGDEVSDHLMVDFMQSVKPWVEQLLDNDY--RVLLYS  1123
             + +I LP++R A+HV +    +S  ++  + L V          + +LD+ Y  RVL+Y+
Sbjct  903   ANWINLPDVRSALHVSSAAGAWSACNDTINGLYVQQHNDTTSVFQHILDSKYPLRVLIYN  962

Query  1124  GQVDVIVAHTLTQNFISTLKWKGADEYASSAKTIWKVGDQVAGYGRK-----GLNLEYII  1178
             G VD    +   Q FI     K      +  +  W+   Q+AGY +K     G +++ I 
Sbjct  963   GDVDQACNYLGDQWFIEAFALKNQLP-VTKPRADWRYMTQIAGYAKKFDNNAGFSVDLIT  1021

Query  1179  VRNAGHMVPHDQPEWAHQMMKSFLAHE  1205
             V+ AGH+VP D+P  A QM+ +F  ++
Sbjct  1022  VKGAGHLVPTDRPGPALQMIANFFRNQ  1048


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 49/90 (54%), Gaps = 7/90 (8%)

Query  1118  RVLLYSGQVDVIVAHTLTQNFISTLKWKGADEYASS-AKTIWKVGDQVAGYGRK----GL  1172
             +VL+Y+G VD + +    ++ I+   +  A  + S+  +  W  G Q+ GY +K     +
Sbjct  2055  KVLIYNGDVDSVCSMFEAESMIN--NFAAAQTFVSNQPRGSWMYGGQIGGYVQKFQKNNM  2112

Query  1173  NLEYIIVRNAGHMVPHDQPEWAHQMMKSFL  1202
              ++ + V+ AGHM P D+P    QMM +F+
Sbjct  2113  TIDLLTVKGAGHMSPTDRPGPVLQMMNNFV  2142


 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 77/167 (46%), Gaps = 22/167 (13%)

Query  1054  NYLYTIDPTSHDKYSTFIQLPEIRKAIHV-GNQPY--SGGDEVSDHLMVDFMQSVKPWVE  1110
             NY   ID    D  + ++   ++R A+H+    P      D+++    +       P  +
Sbjct  375   NYPCYID----DATTAWLGRTDVRSALHIPAAAPVWQECSDDINAKYYIQQYPDTTPVFQ  430

Query  1111  QLLDNDY--RVLLYSGQVDVIVAHTLTQNFISTLKWKGADEYASSAKTIW---KVGDQ--  1163
              L+D+ Y  +VL+Y+G VD+   +   Q F+  L         ++ +  W   + G Q  
Sbjct  431   FLVDSGYPLKVLIYNGDVDLACNYLGDQWFVENLATVSYQMTLTTPRQQWNFTRAGTQNK  490

Query  1164  ----VAGYGR----KGLNLEYIIVRNAGHMVPHDQPEWAHQMMKSFL  1202
                 +AGY +    +  +++ + V+ AGHMVP D+P  A Q+  ++L
Sbjct  491   YIPTLAGYLKSWNYQQFSIDLLTVKGAGHMVPMDRPGPALQIFYNYL  537


 Score = 37.4 bits (85),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 36/153 (24%), Positives = 67/153 (44%), Gaps = 22/153 (14%)

Query  1070  FIQLPEIRKAIHVGNQ-PYSGGDEVSDHLMVDFMQS---VKPWVEQLLDNDY--RVLLYS  1123
             ++ LPE+R A+H+    PY    + +D++  +++Q           +    Y  R L+Y+
Sbjct  1481  YMNLPEVRTALHIPTSLPY--WTDCNDNMNENYIQQHNDTSSVFTDIFATGYPLRFLIYN  1538

Query  1124  GQVDVIVAHTLTQNFISTLKWKGA----DEYASSAKTIWKVGDQVAGYGRK---------  1170
             G VD+       Q F+  L          ++     T  +   +V GY ++         
Sbjct  1539  GDVDMACQFLGDQWFLEKLAKDNGLAVTRQHGPWNYTQGQFLPRVGGYWKQFTYTNTAKN  1598

Query  1171  -GLNLEYIIVRNAGHMVPHDQPEWAHQMMKSFL  1202
               +  + + V+ AGH VP D+P  A QM+ +F+
Sbjct  1599  TKVVFDQLTVKGAGHFVPQDRPGPALQMIYNFV  1631


 Score = 37.4 bits (85),  Expect = 0.090, Method: Compositional matrix adjust.
 Identities = 31/121 (26%), Positives = 55/121 (45%), Gaps = 10/121 (8%)

Query  920   STFVQLPEIRKAIHVGNQ--KYSDGDEVNTHLMGDFMKSVKPWVEQLLDNDY--RVLLYS  975
             + ++ LP++R A+HV +    +S  ++    L            + +LD+ Y  RVL+Y+
Sbjct  903   ANWINLPDVRSALHVSSAAGAWSACNDTINGLYVQQHNDTTSVFQHILDSKYPLRVLIYN  962

Query  976   GQVDVIVAHTLTQNFISTSKWKGADEYASSAKTIWKVGDQVAGYGRK-----GLNLEYII  1030
             G VD    +   Q FI     K      +  +  W+   Q+AGY +K     G +++ I 
Sbjct  963   GDVDQACNYLGDQWFIEAFALKNQLP-VTKPRADWRYMTQIAGYAKKFDNNAGFSVDLIT  1021

Query  1031  V  1031
             V
Sbjct  1022  V  1022


 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 69/187 (37%), Gaps = 30/187 (16%)

Query  426   AAQNIRDLIQQKKWVEANNVYNSLFDNYTT-----------------LTGFENYYNYLFA  468
              A  + DL QQ+ W   N+VYN   D Y                   + GF +    +  
Sbjct  826   CANKVADLGQQRFWNSLNDVYNIYQDCYQQADRAFGSRMSIKQKKEHMRGFIDQGAKIST  885

Query  469   KQPDD--------TSYNGSFIQDLYFRQAIHVGNQT--YSSGEKVEEKLQADEMQSVKPW  518
                D+        T+   ++I     R A+HV +    +S+       L   +       
Sbjct  886   SSTDNQGGLACYGTTQAANWINLPDVRSALHVSSAAGAWSACNDTINGLYVQQHNDTTSV  945

Query  519   IEALLDSDY--KILFYSGQMDIIVAHTLTQNFIKTLKWKGASEYSTSKKMIWRVDDDIAG  576
              + +LDS Y  ++L Y+G +D    +   Q FI+    K      T  +  WR    IAG
Sbjct  946   FQHILDSKYPLRVLIYNGDVDQACNYLGDQWFIEAFALKNQLPV-TKPRADWRYMTQIAG  1004

Query  577   YAKNVRN  583
             YAK   N
Sbjct  1005  YAKKFDN  1011


 Score = 31.2 bits (69),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 34/127 (27%), Positives = 58/127 (46%), Gaps = 21/127 (17%)

Query  633   IQMTPIRKAIHVGNLT-----YND---GDAVEEHLLQDMLQSIKPWFQELLEANY--KIM  682
             I +  +R A+HV +        ND   G  V++H            FQ +L++ Y  +++
Sbjct  906   INLPDVRSALHVSSAAGAWSACNDTINGLYVQQH------NDTTSVFQHILDSKYPLRVL  959

Query  683   LYSGQMDIIVGHTLTQNFIRKLNWSGAKEFQATEKKI-WRVGNDIAGYIKQSKNFSFVVV  741
             +Y+G +D    +   Q FI    ++   +   T+ +  WR    IAGY K+  N +   V
Sbjct  960   IYNGDVDQACNYLGDQWFIEA--FALKNQLPVTKPRADWRYMTQIAGYAKKFDNNAGFSV  1017

Query  742   WLNLITV  748
               +LITV
Sbjct  1018  --DLITV  1022


>Q38CD7_TRYB2 unnamed protein product
Length=464

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 73/144 (51%), Gaps = 8/144 (6%)

Query  1070  FIQLPEIRKAIHVGNQPYSGGD-EVSDHLMVDFMQSVKPWVEQLLDNDYRVLLYSGQVDV  1128
             F+   ++++++ V    +   + EV+    VD+ ++    +  LL++  RV++Y+G +D 
Sbjct  318   FMNREDVQRSLGVDPMTWQACNMEVNLMFAVDWFKNFNYTISGLLEDGVRVMIYAGDMDF  377

Query  1129  IVAHTLTQNFISTLKWKGADEYASSAKTIWKVGD-QVAGYGR------KGLNLEYIIVRN  1181
             I      + +   L+W G++E+  +  T +   D   AG  R        ++  ++ V  
Sbjct  378   ICNWIGNKEWTLALQWSGSEEFVKAPGTPFSSIDGSAAGLVRSVSSNTSSMHFSFVQVYG  437

Query  1182  AGHMVPHDQPEWAHQMMKSFLAHE  1205
             AGHMVP DQP  A  +++ F+ +E
Sbjct  438   AGHMVPMDQPAAASTIIEKFMRNE  461


 Score = 40.4 bits (93),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query  674  LLEANYKIMLYSGQMDIIVGHTLTQNFIRKLNWSGAKEF-QATEKKIWRVGNDIAGYIK-  731
            LLE   ++M+Y+G MD I      + +   L WSG++EF +A       +    AG ++ 
Sbjct  361  LLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEFVKAPGTPFSSIDGSAAGLVRS  420

Query  732  -----QSKNFSFVVVW  742
                  S +FSFV V+
Sbjct  421  VSSNTSSMHFSFVQVY  436


 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 47/100 (47%), Gaps = 2/100 (2%)

Query  775  SFIELPKTRKSLHVGNQTYSDGS-QVLLYLRSDLMKSVKPWVEQLLDNDYRVLLYSGQMD  833
            +F+     ++SL V   T+   + +V L    D  K+    +  LL++  RV++Y+G MD
Sbjct  317  NFMNREDVQRSLGVDPMTWQACNMEVNLMFAVDWFKNFNYTISGLLEDGVRVMIYAGDMD  376

Query  834  IIVAHTFTQNFISKLKWKGADEFA-ASGKTILRVGDQLAG  872
             I      + +   L+W G++EF  A G     +    AG
Sbjct  377  FICNWIGNKEWTLALQWSGSEEFVKAPGTPFSSIDGSAAG  416


 Score = 38.1 bits (87),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 34/162 (21%), Positives = 65/162 (40%), Gaps = 14/162 (9%)

Query  68   TGFETYD--SFMNTKPKWTTTYNENFLQKPQIRDAIHVGQLPFNDSSI-VDSHLRSDIMQ  124
            TG   YD     +    + TT  +NF+ +  ++ ++ V  + +   ++ V+     D  +
Sbjct  293  TGLNVYDIRKTCDGPLCYNTTGVDNFMNREDVQRSLGVDPMTWQACNMEVNLMFAVDWFK  352

Query  125  SVKPWIEELLNNDYRIMFYSGQMDMIAAHTLTQNLINDLDWNGAGEYNETSKKIW-RVDD  183
            +    I  LL +  R+M Y+G MD I      +     L W+G+ E+ +     +  +D 
Sbjct  353  NFNYTISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEFVKAPGTPFSSIDG  412

Query  184  DVAGYVKQARKYVPAL----------SHKIHMANPITANVTI  215
              AG V+       ++           H + M  P  A+  I
Sbjct  413  SAAGLVRSVSSNTSSMHFSFVQVYGAGHMVPMDQPAAASTII  454


 Score = 35.4 bits (80),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 32/146 (22%), Positives = 62/146 (42%), Gaps = 22/146 (15%)

Query  864   LRVGDQLAGYGWTGLNLQYIWRNLVAIARCTFENMTGFENHYNYLYAVDPTLQDKYSTFV  923
             +  G  +A +  TGLN+ Y  R       C   N TG +N                  F+
Sbjct  281   VTCGPMVALFSATGLNV-YDIRKTCDGPLCY--NTTGVDN------------------FM  319

Query  924   QLPEIRKAIHVGNQKYSDGD-EVNTHLMGDFMKSVKPWVEQLLDNDYRVLLYSGQVDVIV  982
                ++++++ V    +   + EVN     D+ K+    +  LL++  RV++Y+G +D I 
Sbjct  320   NREDVQRSLGVDPMTWQACNMEVNLMFAVDWFKNFNYTISGLLEDGVRVMIYAGDMDFIC  379

Query  983   AHTLTQNFISTSKWKGADEYASSAKT  1008
                  + +    +W G++E+  +  T
Sbjct  380   NWIGNKEWTLALQWSGSEEFVKAPGT  405


 Score = 34.7 bits (78),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 33/68 (49%), Gaps = 1/68 (1%)

Query  519  IEALLDSDYKILFYSGQMDIIVAHTLTQNFIKTLKWKGASEYSTSKKMIW-RVDDDIAGY  577
            I  LL+   +++ Y+G MD I      + +   L+W G+ E+  +    +  +D   AG 
Sbjct  358  ISGLLEDGVRVMIYAGDMDFICNWIGNKEWTLALQWSGSEEFVKAPGTPFSSIDGSAAGL  417

Query  578  AKNVRNFT  585
             ++V + T
Sbjct  418  VRSVSSNT  425



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000090-PA

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9V0_DROME  unnamed protein product                                 570     0.0  
WDR51_CAEEL  unnamed protein product                                  114     6e-28
WDS_DROME  unnamed protein product                                    109     2e-26


>Q9V9V0_DROME unnamed protein product
Length=424

 Score = 570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/424 (64%), Positives = 330/424 (78%), Gaps = 6/424 (1%)

Query  23   ESIDPKNVVKNRELLYRMIISQLFYDGHQSIAVTLSNAVQADPPCPPSDRLLHTMTLGLQ  82
            E +DP N+VKNRE+LYR++ISQL YDG +  A+ LS  V+AD  C PS+RLLH M  G+Q
Sbjct  4    EILDPSNLVKNREILYRLMISQLMYDGLEKFAMELSMLVKADQ-CAPSERLLHVMIAGMQ  62

Query  83   HEHENQKPTSKADLLLGPGLDLEYKTDVPPTAPEPAFYETAYVTSHKGNCRAGAFSVDGQ  142
               +  K T+  D+L  PG+DLE++ +    APEP  YETAYVTSHK  CRAGAFS DG 
Sbjct  63   TLSDKDK-TNSDDVL--PGIDLEFEPEASALAPEPHSYETAYVTSHKQACRAGAFSCDGS  119

Query  143  LVATGSVDASIKILDVDRMLAKSAPDAMESGGQLDQQGHPVIRTLYDHLEEVTCLEFHPR  202
            LVATGSVDASIKILDV+RMLAKSAP+ +E G +  QQGHPVIRTLYDH +EV+ LEFHP+
Sbjct  120  LVATGSVDASIKILDVERMLAKSAPEDIEPGRE--QQGHPVIRTLYDHTDEVSYLEFHPK  177

Query  203  EQVLVSGSRDFTVKLFDFSKASVKKAFKTITDSDQICCMSFHPSGDFLVVGANHNVVRLY  262
            E +L S SRD TVKLFD +K SVKKA K  TD + + C+SFHP+GD++ +G  HNV+R+Y
Sbjct  178  EHILASASRDGTVKLFDIAKPSVKKAHKVFTDCEPVLCLSFHPTGDYVAIGTEHNVLRVY  237

Query  263  DVNTAQCYVCNFPSHQHTDSVTCVKWSPDARMYVTGSRDGAIKLWDGVSSRCVNTFAKSH  322
            DV T QC+V   PS QH   VTCVK+SP  ++Y TGS DG IK+WDG+S RC+NT A++H
Sbjct  238  DVATTQCFVSAIPSQQHKAGVTCVKYSPTGKLYATGSYDGDIKIWDGISGRCINTIAEAH  297

Query  323  DGTNVCSVTFSRNGKYVLSSGKDSLVKLWELSTSRCLIAYTGAGTTGRQEHRAQAIFNHS  382
             G  +CS+ F+RNGKY+LSSG DSLV LWEL TSR +  YTGAGTTG+QEH+ +A+FNH+
Sbjct  298  GGAAICSLEFTRNGKYLLSSGMDSLVYLWELCTSRPIQTYTGAGTTGKQEHQTEAVFNHT  357

Query  383  EDFVMFPDEATTSLCCWDSRNASRKQLLSLGHNGPVRFIVHSPCSPSFLTCSDDFRARFW  442
            ED+V+FPDEATTSLC W+SRN  R  L SLGHNGPVR+I HSP  P+FLTCSDDFRARFW
Sbjct  358  EDYVLFPDEATTSLCSWNSRNGCRLTLNSLGHNGPVRYITHSPNGPAFLTCSDDFRARFW  417

Query  443  YRRS  446
            YRR+
Sbjct  418  YRRA  421


>WDR51_CAEEL unnamed protein product
Length=376

 Score = 114 bits (285),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/237 (30%), Positives = 118/237 (50%), Gaps = 26/237 (11%)

Query  128  HKGNCRAGAFSVDGQLVATGSVDASIKILDVDRMLAKSAPDAMESGGQLDQQGHPVIRTL  187
            H  +  +  FS  G+ + T S D ++KI ++D M+ +                    RTL
Sbjct  86   HTKSISSAKFSPCGKYLGTSSADKTVKIWNMDHMICE--------------------RTL  125

Query  188  YDHLEEVTCLEFHPREQVLVSGSRDFTVKLFDFSKASVKKAFKTITDSDQICCMSFHPSG  247
              H   V  + +    + +VS S D T+K+F+   + + K  K    ++ + C +F+P  
Sbjct  126  TGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKTLKG--HNNYVFCCNFNPQS  183

Query  248  DFLVVGANHNVVRLYDVNTAQCYVCNFPSHQHTDSVTCVKWSPDARMYVTGSRDGAIKLW  307
              +V G+    VR++DV T  C +   P+H  +D V+ V ++ D  +  +GS DG +++W
Sbjct  184  SLVVSGSFDESVRIWDVKTGMC-IKTLPAH--SDPVSAVSFNRDGSLIASGSYDGLVRIW  240

Query  308  DGVSSRCVNTFAKSHDGTNVCSVTFSRNGKYVLSSGKDSLVKLWELSTSRCLIAYTG  364
            D  + +C+ T     +   V  V FS NGKY+L+S  DS +KLW+ S  + L  YTG
Sbjct  241  DTANGQCIKTLVDDENPP-VAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTG  296


 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/246 (26%), Positives = 107/246 (43%), Gaps = 34/246 (14%)

Query  125  VTSHKGNCRAGAFSVDGQLVATGSVDASIKILDV--DRMLAKSAPDAMESGGQLDQQGHP  182
            +T HK      A+S D + V + S D ++KI ++   RM                     
Sbjct  125  LTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRM---------------------  163

Query  183  VIRTLYDHLEEVTCLEFHPREQVLVSGSRDFTVKLFDFSKASVKKAFKTITDSDQICCMS  242
              +TL  H   V C  F+P+  ++VSGS D +V+++D       K       SD +  +S
Sbjct  164  -TKTLKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPA--HSDPVSAVS  220

Query  243  FHPSGDFLVVGANHNVVRLYDVNTAQCYVCNFPSHQHTDSVTCVKWSPDARMYVTGSRDG  302
            F+  G  +  G+   +VR++D    QC             V  VK+SP+ +  +  + D 
Sbjct  221  FNRDGSLIASGSYDGLVRIWDTANGQCIKTLV--DDENPPVAFVKFSPNGKYILASNLDS  278

Query  303  AIKLWDGVSSRCVNTFAKSHDGTNVCS-VTFS-RNGKYVLSSGKDSLVKLWELSTS---R  357
             +KLWD    + +  +   H+ +  C    FS   GK+++S  +D  + +W L T    +
Sbjct  279  TLKLWDFSKGKTLKQYT-GHENSKYCIFANFSVTGGKWIISGSEDCKIYIWNLQTREIVQ  337

Query  358  CLIAYT  363
            CL  +T
Sbjct  338  CLEGHT  343


 Score = 57.8 bits (138),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 47/205 (23%), Positives = 83/205 (40%), Gaps = 11/205 (5%)

Query  238  ICCMSFHPSGDFLVVGANHNVVRLYDVNTAQCYVCNFPSHQHTDSVTCVKWSPDARMYVT  297
            I    F P G +L   +    V++++++     +C      H   V  + WS D+R  V+
Sbjct  90   ISSAKFSPCGKYLGTSSADKTVKIWNMDH---MICERTLTGHKLGVNDIAWSSDSRCVVS  146

Query  298  GSRDGAIKLWDGVSSRCVNTFAKSHDGTNVCSVTFSRNGKYVLSSGKDSLVKLWELSTSR  357
             S D  +K+++ V+SR   T  K H+    C   F+     V+S   D  V++W++ T  
Sbjct  147  ASDDKTLKIFEIVTSRMTKTL-KGHNNYVFC-CNFNPQSSLVVSGSFDESVRIWDVKTGM  204

Query  358  CLIAYTGAGTTGRQEHRAQAIFNHSEDFVMFPDEATTSLCCWDSRNASRKQLLSLGHNGP  417
            C+       T         A+  + +  ++        +  WD+ N    + L    N P
Sbjct  205  CI------KTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQCIKTLVDDENPP  258

Query  418  VRFIVHSPCSPSFLTCSDDFRARFW  442
            V F+  SP     L  + D   + W
Sbjct  259  VAFVKFSPNGKYILASNLDSTLKLW  283


 Score = 48.9 bits (115),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 80/185 (43%), Gaps = 27/185 (15%)

Query  127  SHKGNCRAGAFSVDGQLVATGSVDASIKILDVDRMLAKSAPDAMESGGQLDQQGHPVIRT  186
            +H     A +F+ DG L+A+GS D  ++I D              + GQ        I+T
Sbjct  211  AHSDPVSAVSFNRDGSLIASGSYDGLVRIWDT-------------ANGQ-------CIKT  250

Query  187  LYDHLEE-VTCLEFHPREQVLVSGSRDFTVKLFDFSKASVKKAFKTITDSDQICCMSFHP  245
            L D     V  ++F P  + +++ + D T+KL+DFSK    K +    +S      +F  
Sbjct  251  LVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCIFANFSV  310

Query  246  S-GDFLVVGANHNVVRLYDVNTAQCYVCNFPSHQHTDSVTCVKWSPDARMYVTGSR--DG  302
            + G +++ G+    + ++++ T +   C      HT  V      P   +  +G+   D 
Sbjct  311  TGGKWIISGSEDCKIYIWNLQTREIVQC---LEGHTQPVLASDCHPVQNIIASGALEPDN  367

Query  303  AIKLW  307
             I +W
Sbjct  368  KIHIW  372


>WDS_DROME unnamed protein product
Length=361

 Score = 109 bits (273),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 126/250 (50%), Gaps = 28/250 (11%)

Query  116  EPAFYETAYVTSHKGNCRAGAFSVDGQLVATGSVDASIKILDVDRMLAKSAPDAMESGGQ  175
            +P +     +  H     A  FS +G+ +A+ S D  IKI                  G 
Sbjct  59   KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIW-----------------GA  101

Query  176  LDQQGHPVIRTLYDHLEEVTCLEFHPREQVLVSGSRDFTVKLFDFSKASVKKAFKTITD-  234
             D +     +T+  H   ++ + +    ++LVSGS D T+K+++ S     K+ KT+   
Sbjct  102  YDGKFE---KTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTG---KSLKTLKGH  155

Query  235  SDQICCMSFHPSGDFLVVGANHNVVRLYDVNTAQCYVCNFPSHQHTDSVTCVKWSPDARM  294
            S+ + C +F+P  + +V G+    VR++DV T +C +   P+H  +D V+ V ++ D  +
Sbjct  156  SNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKC-LKTLPAH--SDPVSAVHFNRDGSL  212

Query  295  YVTGSRDGAIKLWDGVSSRCVNTFAKSHDGTNVCSVTFSRNGKYVLSSGKDSLVKLWELS  354
             V+ S DG  ++WD  S +C+ T     D   V  V FS NGKY+L++  D+ +KLW+ S
Sbjct  213  IVSSSYDGLCRIWDTASGQCLKTLIDD-DNPPVSFVKFSPNGKYILAATLDNTLKLWDYS  271

Query  355  TSRCLIAYTG  364
              +CL  YTG
Sbjct  272  KGKCLKTYTG  281


 Score = 87.4 bits (215),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/242 (25%), Positives = 111/242 (46%), Gaps = 27/242 (11%)

Query  125  VTSHKGNCRAGAFSVDGQLVATGSVDASIKILDVDRMLAKSAPDAMESGGQLDQQGHPVI  184
            ++ HK      A+S D +L+ +GS D ++K+ +            + +G  L        
Sbjct  110  ISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWE------------LSTGKSL--------  149

Query  185  RTLYDHLEEVTCLEFHPREQVLVSGSRDFTVKLFDFSKASVKKAFKTI-TDSDQICCMSF  243
            +TL  H   V C  F+P+  ++VSGS D +V+++D       K  KT+   SD +  + F
Sbjct  150  KTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTG---KCLKTLPAHSDPVSAVHF  206

Query  244  HPSGDFLVVGANHNVVRLYDVNTAQCYVCNFPSHQHTDSVTCVKWSPDARMYVTGSRDGA  303
            +  G  +V  +   + R++D  + QC             V+ VK+SP+ +  +  + D  
Sbjct  207  NRDGSLIVSSSYDGLCRIWDTASGQCLKTLI--DDDNPPVSFVKFSPNGKYILAATLDNT  264

Query  304  IKLWDGVSSRCVNTFAKSHDGTNVCSVTFS-RNGKYVLSSGKDSLVKLWELSTSRCLIAY  362
            +KLWD    +C+ T+    +        FS   GK+++S  +D++V +W L +   +   
Sbjct  265  LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKL  324

Query  363  TG  364
             G
Sbjct  325  QG  326


 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/208 (23%), Positives = 86/208 (41%), Gaps = 17/208 (8%)

Query  238  ICCMSFHPSGDFLVVGANHNVVRLYDVNTAQCYVCNFPS--HQHTDSVTCVKWSPDARMY  295
            +  + F P+G++L   +   +++++       Y   F      H   ++ V WS D+R+ 
Sbjct  75   VSAVKFSPNGEWLASSSADKLIKIWGA-----YDGKFEKTISGHKLGISDVAWSSDSRLL  129

Query  296  VTGSRDGAIKLWDGVSSRCVNTFAKSHDGTNVCSVTFSRNGKYVLSSGKDSLVKLWELST  355
            V+GS D  +K+W+  + + + T  K H     C   F+     ++S   D  V++W++ T
Sbjct  130  VSGSDDKTLKVWELSTGKSLKTL-KGHSNYVFC-CNFNPQSNLIVSGSFDESVRIWDVRT  187

Query  356  SRCLIAYTGAGTTGRQEHRAQAIFNHSEDFVMFPDEATTSLC-CWDSRNASRKQLLSLGH  414
             +CL             H     FN     ++    +   LC  WD+ +    + L    
Sbjct  188  GKCLKTLPAHSDPVSAVH-----FNRDGSLIV--SSSYDGLCRIWDTASGQCLKTLIDDD  240

Query  415  NGPVRFIVHSPCSPSFLTCSDDFRARFW  442
            N PV F+  SP     L  + D   + W
Sbjct  241  NPPVSFVKFSPNGKYILAATLDNTLKLW  268


 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 70/173 (40%), Gaps = 9/173 (5%)

Query  270  YVCNFPSHQHTDSVTCVKWSPDARMYVTGSRDGAIKLWDGVSSRCVNTFAKSHDGTNVCS  329
            Y   F    HT +V+ VK+SP+     + S D  IK+W     +   T +    G  +  
Sbjct  62   YTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLG--ISD  119

Query  330  VTFSRNGKYVLSSGKDSLVKLWELSTSRCLIAYTGAGTTGRQEHRAQAIFNHSEDFVMFP  389
            V +S + + ++S   D  +K+WELST + L         G   +     FN   + ++  
Sbjct  120  VAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTL-----KGHSNYVFCCNFNPQSNLIV-S  173

Query  390  DEATTSLCCWDSRNASRKQLLSLGHNGPVRFIVHSPCSPSFLTCSDDFRARFW  442
                 S+  WD R     + L   H+ PV  +  +      ++ S D   R W
Sbjct  174  GSFDESVRIWDVRTGKCLKTLP-AHSDPVSAVHFNRDGSLIVSSSYDGLCRIW  225


 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 40/98 (41%), Gaps = 25/98 (26%)

Query  126  TSHKGN--CRAGAFSV-DGQLVATGSVDASIKILDVDRMLAKSAPDAMESGGQLDQQGHP  182
            T HK    C    FSV  G+ + +GS D  + I ++                    Q   
Sbjct  280  TGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNL--------------------QSKE  319

Query  183  VIRTLYDHLEEVTCLEFHPREQVLVSGS--RDFTVKLF  218
            V++ L  H + V C   HP E ++ S +   D T+KL+
Sbjct  320  VVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW  357



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000091-PA

Length=363
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4V3E9_DROME  unnamed protein product                                 143     2e-38
E2QCM9_DROME  unnamed protein product                                 142     4e-38
A1Z9Q8_DROME  unnamed protein product                                 128     7e-33


>Q4V3E9_DROME unnamed protein product
Length=475

 Score = 143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 109/341 (32%), Positives = 171/341 (50%), Gaps = 54/341 (16%)

Query  33   ISRSGYTVSLVTLTVAFFILAFIKKLRCPRNMLHMHLFVSFIMRAFMALLKDSLFIEGVG  92
            I   GY +S  TL VA  I    K LRC RN +H +LF+++I  A + +L  +LF++ + 
Sbjct  164  IYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWIL--TLFLQVI-  220

Query  93   LSPDVVLEDGELAFVSENETWECRAITSLWQYFIMANYAWILMEGLYLHNLIFLAPFSDS  152
                           +E+    C  +  ++QYF + N+ W+ +EGLYL+ L+     SD+
Sbjct  221  --------------TTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDN  266

Query  153  SAITLYVGLGWGLPAISVVPWVILRA---TLDNTF-------CWTTNHNQVLFLIIRVPV  202
             +  +Y  +GWG PA+ ++ W I +A    L+N         C     + + + I +VP 
Sbjct  267  ISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDW-IFKVPA  325

Query  203  IVSIILNFALFINIVRVLLLKLRSSVSVETRKYRYRKWAKSTLVLVPLFGVHYMLFLGMS  262
             +++++N    I I+ VL+ KLRS+ ++ETR+  Y K +K+ LVL+PLFG+ Y+L L   
Sbjct  326  SLALLVNLVFLIRIMWVLITKLRSAHTLETRQ--YYKASKALLVLIPLFGITYLLVL---  380

Query  263  YSMGIDETVELVWLFCDQLFASFQVSSCSYLFDYAIFLKIFAGFFVAVLYCLLNGEVRAE  322
               G ++ +         LF + +            FL    GFFVA+ YC LN EVR  
Sbjct  381  --TGPEQGIS------RNLFEAIRA-----------FLISTQGFFVALFYCFLNSEVRQT  421

Query  323  LSKRCGRWRSFLWLHGASSCNCCQSGSSKDLLGCLRSVGQS  363
            L     RWR    +H  SS    +  +SKD    LRS  +S
Sbjct  422  LRHGFTRWRESRNIHRNSSIKNRRHRASKDY--SLRSRTES  460


>E2QCM9_DROME unnamed protein product
Length=476

 Score = 142 bits (358),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/336 (32%), Positives = 171/336 (51%), Gaps = 55/336 (16%)

Query  33   ISRSGYTVSLVTLTVAFFILAFIKKLRCPRNMLHMHLFVSFIMRAFMALLKDSLFIEGVG  92
            I   GY +S  TL VA  I    K LRC RN +H +LF+++I  A + +L  +LF++ + 
Sbjct  164  IYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWIL--TLFLQVI-  220

Query  93   LSPDVVLEDGELAFVSENETWECRAITSLWQYFIMANYAWILMEGLYLHNLIFLAPFSDS  152
                           +E+    C  +  ++QYF + N+ W+ +EGLYL+ L+     SD+
Sbjct  221  --------------TTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDN  266

Query  153  SAITLYVGLGWGLPAISVVPWVILRA---TLDNTF-------CWTTNHNQVLFLIIRVPV  202
             +  +Y  +GWG PA+ ++ W I +A    L+N         C     + + + I +VP 
Sbjct  267  ISFIIYALIGWGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRESHIDW-IFKVPA  325

Query  203  IVSIILNFALFINIVRVLLLKLRSSVSVETRKYRYRKWAKSTLVLVPLFGVHYMLFLGMS  262
             +++++N    I I+ VL+ KLRS+ ++ETR+  Y K +K+ LVL+PLFG+ Y+L L   
Sbjct  326  SLALLVNLVFLIRIMWVLITKLRSAHTLETRQ--YYKASKALLVLIPLFGITYLLVL---  380

Query  263  YSMGIDETVELVWLFCDQLFASFQVSSCSYLFDYAIFLKIFAGFFVAVLYCLLNGEVRAE  322
               G ++ +         LF + +            FL    GFFVA+ YC LN EVR  
Sbjct  381  --TGPEQGIS------RNLFEAIRA-----------FLISTQGFFVALFYCFLNSEVRQT  421

Query  323  LSKRCGRWRSFLWLHGASSCNCCQSGSSKDLLGCLR  358
            L     RWR    +H  SS    ++ S+++ + CLR
Sbjct  422  LRHGFTRWRESRNIHRNSS---IKNRSTEECVICLR  454


>A1Z9Q8_DROME unnamed protein product
Length=504

 Score = 128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 100/306 (33%), Positives = 152/306 (50%), Gaps = 54/306 (18%)

Query  37   GYTVSLVTLTVAFFILAFIKKLRCPRNMLHMHLFVSFIMRAFMALLKDSLFIE---GVGL  93
            GYT+SLV+L++A  + A+ K+LRC RN +H +LF ++IM A   +L  S+ I    GVG 
Sbjct  136  GYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWILLLSVQISIRSGVG-  194

Query  94   SPDVVLEDGELAFVSENETWECRAITSLWQYFIMANYAWILMEGLYLHNLIFLAPFSDSS  153
                                 C A+ +L+ +F + N+ W+L+EGLYL+ L+      D+ 
Sbjct  195  --------------------SCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNL  234

Query  154  AITLYVGLGWGLPAISVVPWVILRA---TLDNTFCWTTN----HNQVLFLIIRVPVIVSI  206
               +Y  +GWG PA+ VV W + ++   T      +  N        +  I + PV   +
Sbjct  235  RFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVDWIYQGPVCAVL  294

Query  207  ILNFALFINIVRVLLLKLRSSVSVETRKYRYRKWAKSTLVLVPLFGVHYMLFLGMSYSMG  266
            I+N    + I+ VL+ KLRS+ +VETR+  YRK AK+ LVL+PLFG+ Y++ L      G
Sbjct  295  IINLTFLLRIMWVLITKLRSANTVETRQ--YRKAAKALLVLIPLFGITYLVVLAGPSESG  352

Query  267  IDETVELVWLFCDQLFASFQVSSCSYLFDYAIFLKIFAGFFVAVLYCLLNGEVRAELSKR  326
            +             +FA  +          A+ L    GF V++ YC LN EVR  L   
Sbjct  353  L----------MGHMFAVLR----------AVLLST-QGFSVSLFYCFLNSEVRNALRHH  391

Query  327  CGRWRS  332
               WR 
Sbjct  392  ISTWRD  397



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000092-PA

Length=349
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4V3E9_DROME  unnamed protein product                                 131     2e-34
E2QCM9_DROME  unnamed protein product                                 130     8e-34
A1Z9Q8_DROME  unnamed protein product                                 124     1e-31


>Q4V3E9_DROME unnamed protein product
Length=475

 Score = 131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/323 (30%), Positives = 162/323 (50%), Gaps = 48/323 (15%)

Query  4    KLRCPRNMLHMHLFVSFIMRAFMALLKDSLFIEGVGLPSSIVMKDGQAAYMEEDDNWECK  63
             LRC RN +H +LF+++I  A + +L  +LF++ +   SS      QA          C 
Sbjct  188  DLRCLRNTIHANLFLTYITSALLWIL--TLFLQVITTESS------QAG---------CI  230

Query  64   AITSLWQYFIMANYSWILMEGLYLHNLIFLAPFSDSSAITLYVALGWGLPVVVVTPWIIA  123
             +  ++QYF + N+ W+ +EGLYL+ L+     SD+ +  +Y  +GWG P V +  W IA
Sbjct  231  TLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIA  290

Query  124  RATS-----------EDTLCWTTYANQVYFLIIRIPIVLSIVLNFLLFLNIVRVLLLKIR  172
            +A +           E    W   ++  +  I ++P  L++++N +  + I+ VL+ K+R
Sbjct  291  KAFAPHLENEHFNGLEIDCAWMRESHIDW--IFKVPASLALLVNLVFLIRIMWVLITKLR  348

Query  173  SSMSVETRKYRYRKWAKSTLVLVPLFGVHYMLFL-GMSYAIGVDEMVEIVWLFCDQLFAS  231
            S+ ++ETR+  Y K +K+ LVL+PLFG+ Y+L L G    I  + + E +  F      S
Sbjct  349  SAHTLETRQ--YYKASKALLVLIPLFGITYLLVLTGPEQGISRN-LFEAIRAF----LIS  401

Query  232  FQGFFVAVLYCLLNGEVRSEMGRKFNGCQVTPPRTPW-SATSLMSQSKMYFSRGRSSYPS  290
             QGFFVA+ YC LN EVR  +   F         T W  + ++   S +   R R+S   
Sbjct  402  TQGFFVALFYCFLNSEVRQTLRHGF---------TRWRESRNIHRNSSIKNRRHRASKDY  452

Query  291  THVANPEEVRIEEKSQTEMAEEE  313
            +  +  E +R+   S       E
Sbjct  453  SLRSRTESLRLTSTSPIPTGHYE  475


>E2QCM9_DROME unnamed protein product
Length=476

 Score = 130 bits (327),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 143/266 (54%), Gaps = 38/266 (14%)

Query  4    KLRCPRNMLHMHLFVSFIMRAFMALLKDSLFIEGVGLPSSIVMKDGQAAYMEEDDNWECK  63
             LRC RN +H +LF+++I  A + +L  +LF++ +   SS      QA          C 
Sbjct  188  DLRCLRNTIHANLFLTYITSALLWIL--TLFLQVITTESS------QAG---------CI  230

Query  64   AITSLWQYFIMANYSWILMEGLYLHNLIFLAPFSDSSAITLYVALGWGLPVVVVTPWIIA  123
             +  ++QYF + N+ W+ +EGLYL+ L+     SD+ +  +Y  +GWG P V +  W IA
Sbjct  231  TLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIA  290

Query  124  RATS-----------EDTLCWTTYANQVYFLIIRIPIVLSIVLNFLLFLNIVRVLLLKIR  172
            +A +           E    W   ++  +  I ++P  L++++N +  + I+ VL+ K+R
Sbjct  291  KAFAPHLENEHFNGLEIDCAWMRESHIDW--IFKVPASLALLVNLVFLIRIMWVLITKLR  348

Query  173  SSMSVETRKYRYRKWAKSTLVLVPLFGVHYMLFL-GMSYAIGVDEMVEIVWLFCDQLFAS  231
            S+ ++ETR+  Y K +K+ LVL+PLFG+ Y+L L G    I  + + E +  F      S
Sbjct  349  SAHTLETRQ--YYKASKALLVLIPLFGITYLLVLTGPEQGISRN-LFEAIRAF----LIS  401

Query  232  FQGFFVAVLYCLLNGEVRSEMGRKFN  257
             QGFFVA+ YC LN EVR  +   F 
Sbjct  402  TQGFFVALFYCFLNSEVRQTLRHGFT  427


>A1Z9Q8_DROME unnamed protein product
Length=504

 Score = 124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 140/261 (54%), Gaps = 40/261 (15%)

Query  4    KLRCPRNMLHMHLFVSFIMRAFMALLKDSLFIEGVGLPSSIVMKDGQAAYMEEDDNWECK  63
            +LRC RN +H +LF ++IM A   +L  S+          I ++ G  +         C 
Sbjct  156  ELRCLRNTIHANLFFTYIMSALFWILLLSV---------QISIRSGVGS---------CI  197

Query  64   AITSLWQYFIMANYSWILMEGLYLHNLIFLAPFSDSSAITLYVALGWGLPVVVVTPWIIA  123
            A+ +L+ +F + N+ W+L+EGLYL+ L+      D+    +Y ++GWG P + V  W +A
Sbjct  198  ALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVA  257

Query  124  RATS---------EDTLCW--TTYANQVYFLIIRIPIVLSIVLNFLLFLNIVRVLLLKIR  172
            ++ +         E    W   T+ + +Y    + P+   +++N    L I+ VL+ K+R
Sbjct  258  KSLTVTYSTPEKYEINCPWMQETHVDWIY----QGPVCAVLIINLTFLLRIMWVLITKLR  313

Query  173  SSMSVETRKYRYRKWAKSTLVLVPLFGVHYMLFL-GMSYAIGVDEMVEIVWLFCDQLFAS  231
            S+ +VETR+  YRK AK+ LVL+PLFG+ Y++ L G S +  +  M  ++      +  S
Sbjct  314  SANTVETRQ--YRKAAKALLVLIPLFGITYLVVLAGPSESGLMGHMFAVL----RAVLLS  367

Query  232  FQGFFVAVLYCLLNGEVRSEM  252
             QGF V++ YC LN EVR+ +
Sbjct  368  TQGFSVSLFYCFLNSEVRNAL  388



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000093-PA

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXF9_DROME  unnamed protein product                                 331     4e-110
Q38FA2_TRYB2  unnamed protein product                                 75.5    1e-14 
DDI1_CAEEL  unnamed protein product                                   57.0    1e-08 


>Q9VXF9_DROME unnamed protein product
Length=458

 Score = 331 bits (849),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 203/467 (43%), Positives = 270/467 (58%), Gaps = 90/467 (19%)

Query  19   MKITVTTLTDTIFTLDVSEDLELENFKAFCEVESGVPAPEIVILYNAVPLMDNKKSLKDH  78
            MKITVTT  D +F LDV++DLELEN KA C +E G    +I +++N   L  +K++L+  
Sbjct  1    MKITVTTSDDKVFCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSSDKQTLQQC  60

Query  79   GLKDGDVVMLQHLQPAQQS-GGGSGLPQFDFSEIQVPVSPTSAMAGPSHPRTA-------  130
            G+ DGD +ML+  + A +  GG   +   DFS I VP   TS+   P   R         
Sbjct  61   GVGDGDFIMLERRRSANRPVGGNPAISTLDFSNIAVP--GTSSGGSPPSRRVQQQGVQQP  118

Query  131  -----------------LDDNPAVIREMILGNPEQLALLKQNNPPLADALLSGDLEAFSR  173
                              DD+P  +R+M L +PE L+LL+Q NP LA+A+ SGD E F+R
Sbjct  119  QFNNLTDIPTTDEFNVNFDDDPETVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFAR  178

Query  174  VLKEQQEARAERERQRIRMLNADPFDTETQRLIADEIKQKNIEANMEAAIEFNPESFGTV  233
            +L+E    R  R   R+RMLNADPFD ETQRLIA+EIKQKNI+ NM AAIE+NPE FGTV
Sbjct  179  LLREHITERKRRNEHRMRMLNADPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTV  238

Query  234  VMLYINCR-----------------------------------------------KILGR  246
             MLYINC+                                                ILGR
Sbjct  239  TMLYINCKVNGIPVKAFVDSGAQTTIMSKDCAERCHVNRLIDTRWNGVAKGVGTQPILGR  298

Query  247  IHMVQIQIEGDFLTTSFSVLEEQPMDMLLGLDMLKRHQCVIDLKRGLLIIGTTGTETAFL  306
            IHMVQ+QIE D LT+SF+VL +QPMDMLLGLDMLKRHQC+IDL+R LLIIGTTGT T FL
Sbjct  299  IHMVQLQIENDHLTSSFTVLGQQPMDMLLGLDMLKRHQCLIDLQRNLLIIGTTGTTTPFL  358

Query  307  GESDLPECARLNSRSEEEVIRESAREAEDRDLARAIQQSAAGARRGNGSGDGMEVTSPAR  366
             ES+LP  ARL   SE+ + +E+        ++ AI+QS    R   G+G G     P  
Sbjct  359  PESELPVSARLTGNSEDSMEQEA--------ISNAIEQS---KRESGGAGGG-----PNT  402

Query  367  VRPEDKFTERDVRELVGMGFDQTQVISELRRFDGDKTQAMAALFAKS  413
            + P+++FTE+DV +L+ +G+ ++ V++ LR   G+K  A + L  ++
Sbjct  403  ISPQERFTEQDVTDLMALGYPRSDVLTVLRLCGGNKQAARSVLLHRN  449


>Q38FA2_TRYB2 unnamed protein product
Length=378

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 76/165 (46%), Gaps = 49/165 (30%)

Query  196  DPFDTETQRLIADEIKQKNIEANMEAAIEFNPESFGTVVMLYI-------------NC--  240
            D  D   Q  I +EI ++N+E N+  A+EF PE+F  V ML++             +C  
Sbjct  126  DETDPAIQSRIYEEISKRNVEENLANALEFAPEAFTRVSMLHVTVEINKVKVKALVDCGA  185

Query  241  --------------------------------RKILGRIHMVQIQIEGDFLTTSFSVLEE  268
                                            ++ LGRIH+ Q  + G F+  S  VLE 
Sbjct  186  QTSVVSAATAERCGINWLVDKRAVGTVHGVGEQRSLGRIHLTQANLGGLFIPISLVVLES  245

Query  269  QPMDMLLGLDMLKRHQCVIDLKRGLLIIGTTGTETAFLGESDLPE  313
            +  D+++GLD +K+H+ +IDLK   L +G  GT   FL +S++ E
Sbjct  246  ETFDLIIGLDQMKKHRMIIDLKDDCLRVG--GTAIPFLSDSEVSE  288


>DDI1_CAEEL unnamed protein product
Length=389

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 44/70 (63%), Gaps = 1/70 (1%)

Query  242  KILGRIHMVQIQIEGDFLTTSFSVLEEQPMDMLLGLDMLKRHQCVIDLKRGLLIIGTTGT  301
            KI G+IH+  +++E    +  F V+  + MD+L+GL++L++H C I+LK   L  G  GT
Sbjct  299  KIEGKIHLCDVKVEDAHFSCPFEVMARREMDLLIGLNVLRKHGCCINLKTSRLEFG-NGT  357

Query  302  ETAFLGESDL  311
             T FL  +++
Sbjct  358  TTPFLQSNEI  367



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000094-PA

Length=887
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q70GQ8_DROME  unnamed protein product                                 628     0.0  
A0A0B4KF15_DROME  unnamed protein product                             628     0.0  
B7YZT0_DROME  unnamed protein product                                 627     0.0  


>Q70GQ8_DROME unnamed protein product
Length=1073

 Score = 628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/868 (38%), Positives = 492/868 (57%), Gaps = 101/868 (12%)

Query  28   ITGDLMLGALFPIHKRGQGAQMACDGLQTDDGIQPLEAMLYTLDRINRNEDLLPGIHLGV  87
            + GD++LG L  +H R     + C  +    GIQ LEAML+T+DRINR E LLP I LG 
Sbjct  48   VEGDVILGGLMMVHSREDS--ITCGPIMPQGGIQALEAMLFTIDRINR-EQLLPNITLGA  104

Query  88   LAFDTCDSVSYALEQSLDFVKGFISHINEFHNREFRCNDGSAPSFRGGAFDSVVGVIGGQ  147
               D CD  SY LE ++DF+KG IS+I++    E+ CN       +      + GV+G  
Sbjct  105  HILDDCDKDSYGLEMAVDFIKGSISNIDD---AEYHCN-------KTQVRKVISGVVGAA  154

Query  148  SSSVSIQVATLLRLFKVPQISYLSTSASLSNRERFPYFFRTVPSDINQAQAILEILRRFN  207
            SS  SIQVA LLRLF++PQ+SY STS  LSN++RF YF RT+PSD  Q +A++EI++R  
Sbjct  155  SSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMG  214

Query  208  WSYVAVVYSDSEYGVHGFESLRDLAANYSVCFTVPQRIIRDQFTAED--YDQVIAKIEEK  265
            WSYV+++Y +S YG+  FE L +L A +++C  + +++++D   AED  YD ++ K+  K
Sbjct  215  WSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTK  274

Query  266  SLVRVVVVYAEKATTQLLMRAAGRRGVKGRFVWVGSDAWSSRD---SGQEETVEGTIAVQ  322
               R  +++      + +MRA  R    G F W+GSD WS+R+      E  VEGT++VQ
Sbjct  275  PRARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSARNLVSDDYEPEVEGTLSVQ  334

Query  323  PLVRTLSGFDEYFTSLSPDSSEARRNPWFQEFWEKQFGCHLPNNHINDTIVESGPECDDS  382
            P    + GF+EYF SL+ ++++  RNPWF EFWE  F C  P +  +        +C   
Sbjct  335  PQANPVRGFEEYFLSLTVENNQ--RNPWFVEFWEDHFQCRYPGS-TSTPYNNYTKQCTTK  391

Query  383  LRID-ASSGYRQQAFLHFVRDSVYAFAYALHNMHREYCGGVPGLCGRMQHIEGDELRNFL  441
             R+   ++ +  Q  L FV D+V AFAYAL +MHR+ CGG P LC  M+  +G +L  +L
Sbjct  392  ERLSRQNTDFEDQ--LQFVSDAVMAFAYALRDMHRDLCGGGPSLCEAMKPTKGADLLKYL  449

Query  442  NNVTFKDEADNTFRFVNGGDGTPRYSVVNFQRFPDSDTYGWKIVGNYSLSDYGQYHLHMD  501
              V F+  + + FRF   GDG  RY++++F++   +  Y W  VG Y+    G+  L+M 
Sbjct  450  RKVEFEGLSGDEFRFDGNGDGPARYNIIHFKQ-SQAGQYHWVKVGEYT---EGELRLNMT  505

Query  502  ESILRFRSDEADFPASSCTEPCQRHQVQVREGDDTCCWHCRSCGQYQYRR--NNSHCVDC  559
            E  ++F+      P S C+ PC   Q +     ++CCWHC +C  YQ R   + +HC  C
Sbjct  506  E--VKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLC  563

Query  560  PMGFTPTDNHDQCIPLPEVFVDYQNSWAIGAMAFAGLGIMVTVFVALIFWIHNGTPIIKA  619
             +G  P  +   C P+PE+++  +++WAIGAMAF+  GI+VT+FV  +F  HN TPI++A
Sbjct  564  KLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRA  623

Query  620  AGRELSYLLLLGIFMSFGVTFVVVARPTNFSCGLSRFFLGFCYTLTYAAIVTKTNRIARI  679
            +GRELSY+LL GIFM +GVTF +V +PTN  C + RF +GFC+T+ YAA++TKTNRIARI
Sbjct  624  SGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARI  683

Query  680  FNHKSTTPQKTKYTSPKSQMIIVGLLTSVEVVINVCWLLYDPPVA-SVMASRSLRIRICE  738
            F     + ++  + SPKSQ++I   L SV+++IN  W++  P  A     +R   + +C+
Sbjct  684  FKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCD  743

Query  739  GVENYSYLVLHYRMPCISTSILLSIFLSIQVGLLYPFVLIGFCTIYAIKTRKCPGGFNET  798
               + SY+                      +   YP  LI  CT+YA+ TRK P  FNE+
Sbjct  744  SYIDASYM----------------------IAFSYPIFLIVICTVYAVLTRKIPEAFNES  781

Query  799  -----------------------------------------SALVQLGCLFFPKIYIVLL  817
                                                     SA V + CLF PK+YI+L+
Sbjct  782  KHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILI  841

Query  818  KPEKNTKEVVMA-----QHRSSYVTPPS  840
            +PE+N ++ +M       HR++   P S
Sbjct  842  RPERNVRQSMMPPRYGNMHRTAGTGPSS  869


>A0A0B4KF15_DROME unnamed protein product
Length=1472

 Score = 628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/868 (38%), Positives = 491/868 (57%), Gaps = 101/868 (12%)

Query  28    ITGDLMLGALFPIHKRGQGAQMACDGLQTDDGIQPLEAMLYTLDRINRNEDLLPGIHLGV  87
             + GD++LG L  +H R     + C  +    GIQ LEAML+T+DRINR E LLP I LG 
Sbjct  391   VEGDVILGGLMMVHSREDS--ITCGPIMPQGGIQALEAMLFTIDRINR-EQLLPNITLGA  447

Query  88    LAFDTCDSVSYALEQSLDFVKGFISHINEFHNREFRCNDGSAPSFRGGAFDSVVGVIGGQ  147
                D CD  SY LE ++DF+KG IS+I++    E+ CN              + GV+G  
Sbjct  448   HILDDCDKDSYGLEMAVDFIKGSISNIDD---AEYHCNKTQVRKV-------ISGVVGAA  497

Query  148   SSSVSIQVATLLRLFKVPQISYLSTSASLSNRERFPYFFRTVPSDINQAQAILEILRRFN  207
             SS  SIQVA LLRLF++PQ+SY STS  LSN++RF YF RT+PSD  Q +A++EI++R  
Sbjct  498   SSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMG  557

Query  208   WSYVAVVYSDSEYGVHGFESLRDLAANYSVCFTVPQRIIRDQFTAED--YDQVIAKIEEK  265
             WSYV+++Y +S YG+  FE L +L A +++C  + +++++D   AED  YD ++ K+  K
Sbjct  558   WSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTK  617

Query  266   SLVRVVVVYAEKATTQLLMRAAGRRGVKGRFVWVGSDAWSSRD---SGQEETVEGTIAVQ  322
                R  +++      + +MRA  R    G F W+GSD WS+R+      E  VEGT++VQ
Sbjct  618   PRARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSARNLVSDDYEPEVEGTLSVQ  677

Query  323   PLVRTLSGFDEYFTSLSPDSSEARRNPWFQEFWEKQFGCHLPNNHINDTIVESGPECDDS  382
             P    + GF+EYF SL+ ++++  RNPWF EFWE  F C  P +  +        +C   
Sbjct  678   PQANPVRGFEEYFLSLTVENNQ--RNPWFVEFWEDHFQCRYPGS-TSTPYNNYTKQCTTK  734

Query  383   LRID-ASSGYRQQAFLHFVRDSVYAFAYALHNMHREYCGGVPGLCGRMQHIEGDELRNFL  441
              R+   ++ +  Q  L FV D+V AFAYAL +MHR+ CGG P LC  M+  +G +L  +L
Sbjct  735   ERLSRQNTDFEDQ--LQFVSDAVMAFAYALRDMHRDLCGGGPSLCEAMKPTKGADLLKYL  792

Query  442   NNVTFKDEADNTFRFVNGGDGTPRYSVVNFQRFPDSDTYGWKIVGNYSLSDYGQYHLHMD  501
               V F+  + + FRF   GDG  RY++++F++   +  Y W  VG Y+    G+  L+M 
Sbjct  793   RKVEFEGLSGDEFRFDGNGDGPARYNIIHFKQ-SQAGQYHWVKVGEYT---EGELRLNMT  848

Query  502   ESILRFRSDEADFPASSCTEPCQRHQVQVREGDDTCCWHCRSCGQYQYRR--NNSHCVDC  559
             E  ++F+      P S C+ PC   Q +     ++CCWHC +C  YQ R   + +HC  C
Sbjct  849   E--VKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLC  906

Query  560   PMGFTPTDNHDQCIPLPEVFVDYQNSWAIGAMAFAGLGIMVTVFVALIFWIHNGTPIIKA  619
              +G  P  +   C P+PE+++  +++WAIGAMAF+  GI+VT+FV  +F  HN TPI++A
Sbjct  907   KLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRA  966

Query  620   AGRELSYLLLLGIFMSFGVTFVVVARPTNFSCGLSRFFLGFCYTLTYAAIVTKTNRIARI  679
             +GRELSY+LL GIFM +GVTF +V +PTN  C + RF +GFC+T+ YAA++TKTNRIARI
Sbjct  967   SGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARI  1026

Query  680   FNHKSTTPQKTKYTSPKSQMIIVGLLTSVEVVINVCWLLYDPPVA-SVMASRSLRIRICE  738
             F     + ++  + SPKSQ++I   L SV+++IN  W++  P  A     +R   + +C+
Sbjct  1027  FKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCD  1086

Query  739   GVENYSYLVLHYRMPCISTSILLSIFLSIQVGLLYPFVLIGFCTIYAIKTRKCPGGFNET  798
                + SY+                      +   YP  LI  CT+YA+ TRK P  FNE+
Sbjct  1087  SYIDASYM----------------------IAFSYPIFLIVICTVYAVLTRKIPEAFNES  1124

Query  799   -----------------------------------------SALVQLGCLFFPKIYIVLL  817
                                                      SA V + CLF PK+YI+L+
Sbjct  1125  KHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILI  1184

Query  818   KPEKNTKEVVMA-----QHRSSYVTPPS  840
             +PE+N ++ +M       HR++   P S
Sbjct  1185  RPERNVRQSMMPPRYGNMHRTAGTGPSS  1212


 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 3/90 (3%)

Query  28   ITGDLMLGALFPIHKRGQGAQMACDGLQTDDGIQPLEAMLYTLDRINRNEDLLPGIHLGV  87
            + GD++LG L  +H R     + C  +    GIQ LEAMLYTLD++N+ + LLP + LG 
Sbjct  71   LEGDVILGGLMMVHSREDS--ITCGPIMPQGGIQALEAMLYTLDQVNKQQ-LLPNVTLGA  127

Query  88   LAFDTCDSVSYALEQSLDFVKGFISHINEF  117
               D CD  +Y LE ++DF+K  I   +E+
Sbjct  128  HLLDDCDKDTYGLEMAVDFIKAHIQINSEY  157


>B7YZT0_DROME unnamed protein product
Length=1415

 Score = 627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/868 (38%), Positives = 491/868 (57%), Gaps = 101/868 (12%)

Query  28    ITGDLMLGALFPIHKRGQGAQMACDGLQTDDGIQPLEAMLYTLDRINRNEDLLPGIHLGV  87
             + GD++LG L  +H R     + C  +    GIQ LEAML+T+DRINR E LLP I LG 
Sbjct  391   VEGDVILGGLMMVHSREDS--ITCGPIMPQGGIQALEAMLFTIDRINR-EQLLPNITLGA  447

Query  88    LAFDTCDSVSYALEQSLDFVKGFISHINEFHNREFRCNDGSAPSFRGGAFDSVVGVIGGQ  147
                D CD  SY LE ++DF+KG IS+I++    E+ CN              + GV+G  
Sbjct  448   HILDDCDKDSYGLEMAVDFIKGSISNIDD---AEYHCNKTQVRKV-------ISGVVGAA  497

Query  148   SSSVSIQVATLLRLFKVPQISYLSTSASLSNRERFPYFFRTVPSDINQAQAILEILRRFN  207
             SS  SIQVA LLRLF++PQ+SY STS  LSN++RF YF RT+PSD  Q +A++EI++R  
Sbjct  498   SSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMG  557

Query  208   WSYVAVVYSDSEYGVHGFESLRDLAANYSVCFTVPQRIIRDQFTAED--YDQVIAKIEEK  265
             WSYV+++Y +S YG+  FE L +L A +++C  + +++++D   AED  YD ++ K+  K
Sbjct  558   WSYVSIIYEESNYGIKAFEELEELLARHNICIAIKEKLVKDSGVAEDIAYDNIVQKLLTK  617

Query  266   SLVRVVVVYAEKATTQLLMRAAGRRGVKGRFVWVGSDAWSSRD---SGQEETVEGTIAVQ  322
                R  +++      + +MRA  R    G F W+GSD WS+R+      E  VEGT++VQ
Sbjct  618   PRARGAIIFGSDQEVRQVMRAVRRANATGSFSWIGSDGWSARNLVSDDYEPEVEGTLSVQ  677

Query  323   PLVRTLSGFDEYFTSLSPDSSEARRNPWFQEFWEKQFGCHLPNNHINDTIVESGPECDDS  382
             P    + GF+EYF SL+ ++++  RNPWF EFWE  F C  P +  +        +C   
Sbjct  678   PQANPVRGFEEYFLSLTVENNQ--RNPWFVEFWEDHFQCRYPGS-TSTPYNNYTKQCTTK  734

Query  383   LRID-ASSGYRQQAFLHFVRDSVYAFAYALHNMHREYCGGVPGLCGRMQHIEGDELRNFL  441
              R+   ++ +  Q  L FV D+V AFAYAL +MHR+ CGG P LC  M+  +G +L  +L
Sbjct  735   ERLSRQNTDFEDQ--LQFVSDAVMAFAYALRDMHRDLCGGGPSLCEAMKPTKGADLLKYL  792

Query  442   NNVTFKDEADNTFRFVNGGDGTPRYSVVNFQRFPDSDTYGWKIVGNYSLSDYGQYHLHMD  501
               V F+  + + FRF   GDG  RY++++F++   +  Y W  VG Y+    G+  L+M 
Sbjct  793   RKVEFEGLSGDEFRFDGNGDGPARYNIIHFKQ-SQAGQYHWVKVGEYT---EGELRLNMT  848

Query  502   ESILRFRSDEADFPASSCTEPCQRHQVQVREGDDTCCWHCRSCGQYQYRR--NNSHCVDC  559
             E  ++F+      P S C+ PC   Q +     ++CCWHC +C  YQ R   + +HC  C
Sbjct  849   E--VKFKRLSPKPPESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPDDETHCKLC  906

Query  560   PMGFTPTDNHDQCIPLPEVFVDYQNSWAIGAMAFAGLGIMVTVFVALIFWIHNGTPIIKA  619
              +G  P  +   C P+PE+++  +++WAIGAMAF+  GI+VT+FV  +F  HN TPI++A
Sbjct  907   KLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSATGILVTLFVMGVFVRHNDTPIVRA  966

Query  620   AGRELSYLLLLGIFMSFGVTFVVVARPTNFSCGLSRFFLGFCYTLTYAAIVTKTNRIARI  679
             +GRELSY+LL GIFM +GVTF +V +PTN  C + RF +GFC+T+ YAA++TKTNRIARI
Sbjct  967   SGRELSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARI  1026

Query  680   FNHKSTTPQKTKYTSPKSQMIIVGLLTSVEVVINVCWLLYDPPVA-SVMASRSLRIRICE  738
             F     + ++  + SPKSQ++I   L SV+++IN  W++  P  A     +R   + +C+
Sbjct  1027  FKAGKQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCD  1086

Query  739   GVENYSYLVLHYRMPCISTSILLSIFLSIQVGLLYPFVLIGFCTIYAIKTRKCPGGFNET  798
                + SY+                      +   YP  LI  CT+YA+ TRK P  FNE+
Sbjct  1087  SYIDASYM----------------------IAFSYPIFLIVICTVYAVLTRKIPEAFNES  1124

Query  799   -----------------------------------------SALVQLGCLFFPKIYIVLL  817
                                                      SA V + CLF PK+YI+L+
Sbjct  1125  KHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSASVTIACLFSPKLYIILI  1184

Query  818   KPEKNTKEVVMA-----QHRSSYVTPPS  840
             +PE+N ++ +M       HR++   P S
Sbjct  1185  RPERNVRQSMMPPRYGNMHRTAGTGPSS  1212


 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 3/90 (3%)

Query  28   ITGDLMLGALFPIHKRGQGAQMACDGLQTDDGIQPLEAMLYTLDRINRNEDLLPGIHLGV  87
            + GD++LG L  +H R     + C  +    GIQ LEAMLYTLD++N+ + LLP + LG 
Sbjct  71   LEGDVILGGLMMVHSREDS--ITCGPIMPQGGIQALEAMLYTLDQVNKQQ-LLPNVTLGA  127

Query  88   LAFDTCDSVSYALEQSLDFVKGFISHINEF  117
               D CD  +Y LE ++DF+K  I   +E+
Sbjct  128  HLLDDCDKDTYGLEMAVDFIKAHIQINSEY  157



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000095-PA

Length=848
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z087_DROME  unnamed protein product                                 477     1e-149
Q9VW85_DROME  unnamed protein product                                 477     1e-148
M9PG56_DROME  unnamed protein product                                 441     6e-142


>B7Z087_DROME unnamed protein product
Length=1480

 Score = 477 bits (1227),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 287/675 (43%), Positives = 385/675 (57%), Gaps = 63/675 (9%)

Query  11    FPTQDTKMDALVEQLNTYSKNGIPKLKDLLAFETDEETEEELY--SLEDDWRQLVHNWAS  68
             F  ++ +   L E LN+Y+KNG+P+  D ++F+  +      Y   +   WR  V N  S
Sbjct  777   FGIKNPQQSQLCELLNSYAKNGVPQRPDSMSFDHPDLVNSLAYLQYMHKSWRDFV-NSDS  835

Query  69    LSERVIQQQTAIWELVDTEAAYIRTLKVIQDLFLMCLCNLQAAGILTEVDTYRLFANISD  128
             +SE  ++ QTAIWELV TE  YI  L+ + DLFL CL  +Q  G+L +VD  RLF+N+  
Sbjct  836   MSESEVKIQTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRA  895

Query  129   IYGANRFFWQNHLLPTMHKSRDSGEPLNPTLMAEGFIKFSEIFHPYTKYCADQSQCQQYC  188
             +  AN  FW   L P +  S  + EPL      EGF+ F+ IF PY  YCA+QS CQ YC
Sbjct  896   VCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYC  955

Query  189   KEKHHENEFFKAYLAWCETQKDCNRLRLMDILVKPMQRLTKYSLLLKAIQKHTEDPEARK  248
             KE +H N  F +YLAWCE+QK CNRLRL DI+V+PMQRLTKYSLLL AI+KH  D E  +
Sbjct  956   KELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIE  1015

Query  249   RLEEMIQSVGSFVASVNATLRQRQEQERLRGIIARIEAYDVVETKDDEVDKMLRQHCN-F  307
              ++ M+ SV +FV SVN  L  RQE ERL+G++ RIE+YDVV+T ++ +DKM++Q+   F
Sbjct  1016  AIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMF  1075

Query  308   DLTCPMPGCIESQRRHLLVESDLKMKDHTTSKMDVHCFLFTDMLLVCKIVAKKG-EKVKV  366
             DL  PM GC     RHL +E D K KD+   K DVHCFL TD+LLVCK +AK+G   +KV
Sbjct  1076  DLCAPMRGCPAYHVRHLFMEGDHKFKDN-LGKSDVHCFLLTDLLLVCKTIAKRGLGALKV  1134

Query  367   IRQPYVVDRLVVHELKDSGGMALLYLNEYGTATTAFTLHSSEPKLVKSWMDQIRKAQSLY  426
             IRQPY+ D+L+V +L  +  +  +YLNE+  ATTAFTL  +E    K+W D + +A+++Y
Sbjct  1135  IRQPYLTDQLIV-QLAPNNTLNCVYLNEFQVATTAFTLQCTE---AKNWYDALWRAKTIY  1190

Query  427   REAKVAAMSDVPLGPGPGSPSPFDLEEEEDMDLPTSALLVARSHRGSSRGSHVSSLVHSH  486
             +  K             G    F             +L V +S   SS  SHVSS  +SH
Sbjct  1191  QRLKRGGGGGGSGSGTVGGGDSFRFGGSATSGGTADSLGVRKSPMNSSICSHVSSANNSH  1250

Query  487   SGSMDMNEASSGSLSQGRGVSLENDLRGSSVSSDEGST--TDGHAANASTAAGSSAVAGS  544
             SGS++ N++        R +S++ + + +SVSSDEGS+  T  H  N     G   +   
Sbjct  1251  SGSVEWNDS--------RNISVDFE-KTNSVSSDEGSSIMTGNHGVNLK---GKQQLI--  1296

Query  545   LPTPGVAGSGASSVKPRALSMEGSRLVQPPSPRPERRSFLSKSPTPNTLSVQLPYSSGQS  604
                     SG    K   +   GS+                   + NTLSVQ     GQS
Sbjct  1297  --------SGLHKTKMGIIGQMGSK-------------------SANTLSVQPMNHLGQS  1329

Query  605   MPNLSVDSGGVHSTLTVPSPKA-------LSPSHRGISYPPPSPRS--LRRSCALS-SQR  654
             +PNL++     ++TL VP           LSPSHRGISYPPPSP    LRR  A S S +
Sbjct  1330  LPNLNMHHSHTNNTLLVPGSTTSHSGNMLLSPSHRGISYPPPSPTRVPLRRGMAFSTSTK  1389

Query  655   NPPLIKTRHVGSTTS  669
             NPPL KTR++ S  S
Sbjct  1390  NPPLRKTRNITSQNS  1404


>Q9VW85_DROME unnamed protein product
Length=1661

 Score = 477 bits (1228),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 287/677 (42%), Positives = 386/677 (57%), Gaps = 63/677 (9%)

Query  9     AYFPTQDTKMDALVEQLNTYSKNGIPKLKDLLAFETDEETEEELY--SLEDDWRQLVHNW  66
             + F  ++ +   L E LN+Y+KNG+P+  D ++F+  +      Y   +   WR  V N 
Sbjct  956   SIFGIKNPQQSQLCELLNSYAKNGVPQRPDSMSFDHPDLVNSLAYLQYMHKSWRDFV-NS  1014

Query  67    ASLSERVIQQQTAIWELVDTEAAYIRTLKVIQDLFLMCLCNLQAAGILTEVDTYRLFANI  126
              S+SE  ++ QTAIWELV TE  YI  L+ + DLFL CL  +Q  G+L +VD  RLF+N+
Sbjct  1015  DSMSESEVKIQTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNV  1074

Query  127   SDIYGANRFFWQNHLLPTMHKSRDSGEPLNPTLMAEGFIKFSEIFHPYTKYCADQSQCQQ  186
               +  AN  FW   L P +  S  + EPL      EGF+ F+ IF PY  YCA+QS CQ 
Sbjct  1075  RAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQF  1134

Query  187   YCKEKHHENEFFKAYLAWCETQKDCNRLRLMDILVKPMQRLTKYSLLLKAIQKHTEDPEA  246
             YCKE +H N  F +YLAWCE+QK CNRLRL DI+V+PMQRLTKYSLLL AI+KH  D E 
Sbjct  1135  YCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEE  1194

Query  247   RKRLEEMIQSVGSFVASVNATLRQRQEQERLRGIIARIEAYDVVETKDDEVDKMLRQHCN  306
              + ++ M+ SV +FV SVN  L  RQE ERL+G++ RIE+YDVV+T ++ +DKM++Q+  
Sbjct  1195  IEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQ  1254

Query  307   -FDLTCPMPGCIESQRRHLLVESDLKMKDHTTSKMDVHCFLFTDMLLVCKIVAKKG-EKV  364
              FDL  PM GC     RHL +E D K KD+   K DVHCFL TD+LLVCK +AK+G   +
Sbjct  1255  MFDLCAPMRGCPAYHVRHLFMEGDHKFKDN-LGKSDVHCFLLTDLLLVCKTIAKRGLGAL  1313

Query  365   KVIRQPYVVDRLVVHELKDSGGMALLYLNEYGTATTAFTLHSSEPKLVKSWMDQIRKAQS  424
             KVIRQPY+ D+L+V +L  +  +  +YLNE+  ATTAFTL  +E    K+W D + +A++
Sbjct  1314  KVIRQPYLTDQLIV-QLAPNNTLNCVYLNEFQVATTAFTLQCTE---AKNWYDALWRAKT  1369

Query  425   LYREAKVAAMSDVPLGPGPGSPSPFDLEEEEDMDLPTSALLVARSHRGSSRGSHVSSLVH  484
             +Y+  K             G    F             +L V +S   SS  SHVSS  +
Sbjct  1370  IYQRLKRGGGGGGSGSGTVGGGDSFRFGGSATSGGTADSLGVRKSPMNSSICSHVSSANN  1429

Query  485   SHSGSMDMNEASSGSLSQGRGVSLENDLRGSSVSSDEGST--TDGHAANASTAAGSSAVA  542
             SHSGS++ N++        R +S++ + + +SVSSDEGS+  T  H  N     G   + 
Sbjct  1430  SHSGSVEWNDS--------RNISVDFE-KTNSVSSDEGSSIMTGNHGVN---LKGKQQLI  1477

Query  543   GSLPTPGVAGSGASSVKPRALSMEGSRLVQPPSPRPERRSFLSKSPTPNTLSVQLPYSSG  602
                       SG    K   +   GS+                   + NTLSVQ     G
Sbjct  1478  ----------SGLHKTKMGIIGQMGSK-------------------SANTLSVQPMNHLG  1508

Query  603   QSMPNLSVDSGGVHSTLTVPSPKA-------LSPSHRGISYPPPSPRS--LRRSCALS-S  652
             QS+PNL++     ++TL VP           LSPSHRGISYPPPSP    LRR  A S S
Sbjct  1509  QSLPNLNMHHSHTNNTLLVPGSTTSHSGNMLLSPSHRGISYPPPSPTRVPLRRGMAFSTS  1568

Query  653   QRNPPLIKTRHVGSTTS  669
              +NPPL KTR++ S  S
Sbjct  1569  TKNPPLRKTRNITSQNS  1585


>M9PG56_DROME unnamed protein product
Length=848

 Score = 441 bits (1134),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 272/666 (41%), Positives = 369/666 (55%), Gaps = 80/666 (12%)

Query  11   FPTQDTKMDALVEQLNTYSKNGIPKLKDLLAFETDEETEEELY--SLEDDWRQLVHNWAS  68
            F  ++ +   L E LN+Y+KNG+P+  D ++F+  +      Y   +   WR  V N  S
Sbjct  180  FGIKNPQQSQLCELLNSYAKNGVPQRPDSMSFDHPDLVNSLAYLQYMHKSWRDFV-NSDS  238

Query  69   LSERVIQQQTAIWELVDTEAAYIRTLKVIQDLFLMCLCNLQAAGILTEVDTYRLFANISD  128
            +SE  ++ QTAIWELV TE  YI  L+ + DLFL CL  +Q  G+L +VD  RLF+N+  
Sbjct  239  MSESEVKIQTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRA  298

Query  129  IYGANRFFWQNHLLPTMHKSRDSGEPLNPTLMAEGFIKFSEIFHPYTKYCADQSQCQQYC  188
            +  AN  FW   L P +  S  + EPL      EGF+ F+ IF PY  YCA+QS CQ YC
Sbjct  299  VCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYC  358

Query  189  KEKHHENEFFKAYLAWCETQKDCNRLRLMDILVKPMQRLTKYSLLLKAIQKHTEDPEARK  248
            KE +H N  F +YLAWCE+QK CNRLRL DI+V+PMQRLTKYSLLL AI+KH  D E  +
Sbjct  359  KELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIE  418

Query  249  RLEEMIQSVGSFVASVNATLRQRQEQERLRGIIARIEAYDVVETKDDEVDKMLRQHCN-F  307
             ++ M+ SV +FV SVN  L  RQE ERL+G++ RIE+YDVV+T ++ +DKM++Q+   F
Sbjct  419  AIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMF  478

Query  308  DLTCPMPGCIESQRRHLLVESDLKMKDHTTSKMDVHCFLFTDMLLVCKIVAKKG-EKVKV  366
            DL  PM GC     RHL +E D K KD+   K DVHCFL TD+LLVCK +AK+G   +KV
Sbjct  479  DLCAPMRGCPAYHVRHLFMEGDHKFKDN-LGKSDVHCFLLTDLLLVCKTIAKRGLGALKV  537

Query  367  IRQPYVVDRLVVHELKDSGGMALLYLNEYGTATTAFTLHSSEPKLVKSWMDQIRKAQSLY  426
            IRQPY+ D+L+V +L  +  +  +YLNE+  ATTAFTL  +E    K+W D + +A+++Y
Sbjct  538  IRQPYLTDQLIV-QLAPNNTLNCVYLNEFQVATTAFTLQCTE---AKNWYDALWRAKTIY  593

Query  427  REAKVAAMSDVPLGPGPGSPSPFDLEEEEDMDLPTSALLVARSHRGSSRGSHVSSLVHSH  486
            +  K             G    F             +L V +S   SS  SHVSS  +SH
Sbjct  594  QRLKRGGGGGGSGSGTVGGGDSFRFGGSATSGGTADSLGVRKSPMNSSICSHVSSANNSH  653

Query  487  SGSMDMNEASSGSLSQGRGVSLENDLRGSSVSSDEGST--TDGHAANASTAAGSSAVAGS  544
            SGS++ N++        R +S++ + + +SVSSDEGS+  T  H  N     G   +   
Sbjct  654  SGSVEWNDS--------RNISVDFE-KTNSVSSDEGSSIMTGNHGVNLK---GKQQLI--  699

Query  545  LPTPGVAGSGASSVKPRALSMEGSRLVQPPSPRPERRSFLSKSPTPNTLSVQLPYSSGQS  604
                    SG    K   +   GS+                   + NTLSVQ     GQS
Sbjct  700  --------SGLHKTKMGIIGQMGSK-------------------SANTLSVQPMNHLGQS  732

Query  605  MPNLSVDSGGVHSTLTVPSPKALSPSHRGISYPPPSPRSLRRSCALS-SQRNPPLIKTRH  663
            +PNL+     +H + TVP                     LRR  A S S +NPPL KTR+
Sbjct  733  LPNLN-----MHHSHTVP---------------------LRRGMAFSTSTKNPPLRKTRN  766

Query  664  VGSTTS  669
            + S  S
Sbjct  767  ITSQNS  772



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000096-PA

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

COPB2_DROME  unnamed protein product                                  36.6    0.064
WEK_DROME  unnamed protein product                                    35.0    0.15 
Q9GPN7_DROME  unnamed protein product                                 33.9    0.45 


>COPB2_DROME unnamed protein product
Length=914

 Score = 36.6 bits (83),  Expect = 0.064, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 6/78 (8%)

Query  227  LEQGLQQQHAGENVSQETYTHQADVADATQDMQLYKMC---GSDGEGMVFLATAETDTQG  283
            LE  L+     EN   + ++  ADVA +  +M L K C    +D  G++ L+TA  D Q 
Sbjct  656  LEIALKLARESEN--SQKWSQLADVASSKNNMSLVKECMQKANDLSGLLLLSTASGDAQL  713

Query  284  MQFVAADGDIAEGMQYVA  301
            ++ V A G  A+G   +A
Sbjct  714  LEVVGAAGS-AQGHHNLA  730


>WEK_DROME unnamed protein product
Length=470

 Score = 35.0 bits (79),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 42/103 (41%), Gaps = 12/103 (12%)

Query  399  APESDEFGLLLDEEEMVMPVPTFQEENDPLATTSASVLD---NLVSEHSGDGTDLGRLES  455
            A ESD+   +LDE+E V P P  ++   P  +     +D   N+ S    D     + + 
Sbjct  193  ATESDDEEAILDEDEAVSPPPLKRKRGRPKGSGKQKNVDDSDNVTSREPDDNAKSKQDDK  252

Query  456  VAAALKTPR---------FPCDNCLVVFRDKAALERHQENDHG  489
             +    +P          +PC  C   F    AL RH+ + HG
Sbjct  253  TSELSMSPHGSQSSNFVDYPCKICNETFMSFMALRRHKHDMHG  295


>Q9GPN7_DROME unnamed protein product
Length=4350

 Score = 33.9 bits (76),  Expect = 0.45, Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query  236   AGENVSQETYTHQADVADATQDMQ-LYKMCGSDGEGMVFLATA-----ETDTQGMQFVAA  289
             AG    Q T T   +  + T+D++ LY+  G DG GM F+ TA     E+  + +  + +
Sbjct  2693  AGYKFFQMTLTRSYNTGNLTEDLKFLYRTAGLDGNGMTFIFTANEIKEESFLEFINNILS  2752

Query  290   DGDIA  294
              G+IA
Sbjct  2753  SGEIA  2757



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000097-PA

Length=128
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V444_DROME  unnamed protein product                                 70.1    2e-16
Q8IHQ2_PLAF7  unnamed protein product                                 51.2    2e-08
Q8ST61_DROME  unnamed protein product                                 45.1    1e-06


>Q9V444_DROME unnamed protein product
Length=128

 Score = 70.1 bits (170),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 60/90 (67%), Gaps = 0/90 (0%)

Query  6   ETLEDLNLPNSVIARLIKDSIPSGVIVSKDARVAICRAASIFIMYATASACNQATKHNRK  65
           E +EDLNLPN+VI RLIK+++P    VSK+AR AI RAAS+F ++ T+S+   A K N K
Sbjct  3   ERIEDLNLPNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHK  62

Query  66  VISGQDVIDAMDAMEFGEFKAVLVEFLENF  95
            I+ +D++  +  ++F  F   L + LE +
Sbjct  63  TITAKDILQTLTELDFESFVPSLTQDLEVY  92


>Q8IHQ2_PLAF7 unnamed protein product
Length=1301

 Score = 51.2 bits (121),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/113 (27%), Positives = 62/113 (55%), Gaps = 4/113 (4%)

Query  5     SETLEDLNLPNSVIARLIKDSIPSGVIVSKDARVAICRAASIFIMYATASACNQATKHNR  64
             SETL    LP + I+R++K  +P    V+K+++  I    + FI + T+ A ++ T+  R
Sbjct  1130  SETL----LPIANISRIMKRILPGSAKVAKESKDIIRECVTEFIQFLTSEASDRCTREKR  1185

Query  65    KVISGQDVIDAMDAMEFGEFKAVLVEFLENFHKKQQEKKETAAKKRKVRNSAK  117
             K I+G+D++ +M+ + F ++   L E+L  + + ++        ++K  N  K
Sbjct  1186  KTINGEDILYSMEKLGFNDYIEPLTEYLNKWKQLKELNNSNNYHEKKFDNIKK  1238


>Q8ST61_DROME unnamed protein product
Length=156

 Score = 45.1 bits (105),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 0/96 (0%)

Query  2    AGVSETLEDLNLPNSVIARLIKDSIPSGVIVSKDARVAICRAASIFIMYATASACNQATK  61
             G+    +D  LP   I +++K  +P    ++KDAR  I    S FI + ++ A  ++  
Sbjct  32   GGIMLREQDRFLPICNIIKIMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVA  91

Query  62   HNRKVISGQDVIDAMDAMEFGEFKAVLVEFLENFHK  97
             NRK ++G D++ A   + F  +   L  +L+ + +
Sbjct  92   ENRKTVNGDDLLVAFSNLGFDNYVEPLSIYLQKYRE  127



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


Query= CAQU000098-PA

Length=1374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAR_DROME  unnamed protein product                                    1999    0.0  
G5EDC5_CAEEL  unnamed protein product                                 872     0.0  
G5EE54_CAEEL  unnamed protein product                                 871     0.0  


>LAR_DROME unnamed protein product
Length=2029

 Score = 1999 bits (5179),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/1373 (69%), Positives = 1117/1373 (81%), Gaps = 66/1373 (5%)

Query  1     MNSTTIHVQWKPPVEKDRNGIIRGYQIHVQEVSEEGGNLLNNPLHYNVPNGNVEELNVSG  60
             +NST+IHV WKPP+EKDRNGIIRGY IH QE+ +EG   LN P  ++V   +  E NV+G
Sbjct  720   LNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKFDV--VDTLEFNVTG  777

Query  61    LQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSKVSLELEWSRP  120
             LQPDT+Y++QVAALTRKGDG RS+ + VKTPGGVP RP+++ K+++ +  VS+ELEW RP
Sbjct  778   LQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERP  837

Query  121   TQTFGELAAYRLRWGPRTPSGDQ-LQELVLEGGKVQHHKLDQLERGLEYEFRVAGGNSVG  179
              QT+GEL  YRLRWG +    DQ L+E +L G ++   + D LERG+EYEFRVAG N +G
Sbjct  838   AQTYGELRGYRLRWGVK----DQALKEEMLSGPQMTKKRFDNLERGVEYEFRVAGSNHIG  893

Query  180   FGQEAVKFFQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFHKRL  239
              GQE VK FQTPEG P GPPS ++ +FQT DV+ +TW PP  + RNG +T Y V FHK++
Sbjct  894   IGQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKI  953

Query  240   DHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTEREI  299
             DH      N T         KAVF+NLEENTEY+ +VRAYT+QG GP+ + +   TER++
Sbjct  954   DHGLGSERNMT-------LRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDM  1006

Query  300   VRAPMNVRAMATSDSSVEVWWETVPSRGKVIGYQIFYTMTAVEDMDEWQQKAVPITESAD  359
              RAPM+++A ATS+ + E+WWE V SRGK++GY+IFYTMTAVED+D+WQ K V +TESAD
Sbjct  1007  GRAPMSLQAEATSEQTAEIWWEPVTSRGKLLGYKIFYTMTAVEDLDDWQTKTVGLTESAD  1066

Query  360   LINLEKNAQYAIAVAARTKSGLGRLSERVTAKVKPEDVPLNLRAHDVSTHSMTLSWGPPL  419
             L+NLEK AQYA+A+AAR K+GLGRLSE+VT ++KPEDVPLNLRAHDVSTHSMTLSW PP+
Sbjct  1067  LVNLEKFAQYAVAIAARFKNGLGRLSEKVTVRIKPEDVPLNLRAHDVSTHSMTLSWSPPI  1126

Query  420   RLNPVNYKISFDAVKEFVDSQGITQTQMITPRTILLAPDSQSHTINELSPFTTYNVNVSA  479
             RL PVNYKISFDA+K FVDSQG +QTQ++  R I+L    ++HTINELSPFTTYNVNVSA
Sbjct  1127  RLTPVNYKISFDAMKVFVDSQGFSQTQIVPKREIILKHYVKTHTINELSPFTTYNVNVSA  1186

Query  480   IPTDHSYRPPAKISVTTQMAAPQPMVKPDFFGVQNAEEIVVFLPQASEEYGPISHYYLIV  539
             IP+D+SYRPP KI+VTTQMAAPQPMVKPDF+GV N EEI+V LPQASEEYGPISHYYL+V
Sbjct  1187  IPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGEEILVILPQASEEYGPISHYYLVV  1246

Query  540   VPEDKRTLHKNPDQFLTDDLIANKNGNNKQEDENTPYIAAKFLQRNIPYTFPLGDSKTFE  599
             VPEDK  LHK PDQFLTDDL+    G NK E  N PYIAAKF QR+IP+TF LG    + 
Sbjct  1247  VPEDKSNLHKIPDQFLTDDLLP---GRNKPERPNAPYIAAKFPQRSIPFTFHLGSGDDYH  1303

Query  600   GFENRRLEKGKKYRIFVRAVVDTPQKHLYTSSPFSEQLSLDMREIPPGQLPHRPNPYVPV  659
              F NR+LE+ K+YRIFVRAVVDTPQKHLYTSSPFSE LSLDMRE PPG+ PHRP+P  P 
Sbjct  1304  NFTNRKLEREKRYRIFVRAVVDTPQKHLYTSSPFSEFLSLDMREAPPGERPHRPDPNWPA  1363

Query  660   ESADVAVDRNAEDPGMLWVLGPVVAAVMVTCCLVFFILVIRRRRQMPKTPEQASVTKPLM  719
             E  +V+V+RN ++P +LWV+ P++ +  +    +  + V++RRRQ  KTP+QA+VT+PLM
Sbjct  1364  E-PEVSVNRNKDEPEILWVVLPLMVSTFIVSTALIVLCVVKRRRQPCKTPDQAAVTRPLM  1422

Query  720   APGEYGGVGGAGGGGLGGLGAGGLGGLGGLGGGGVGGTGTLGGGGTASAAAFHPASDPVE  779
             A                                       LG G T S        DPV+
Sbjct  1423  A-------------------------------------ADLGAGPTPS--------DPVD  1437

Query  780   MRRLNFQTPGMMSHPPIPVADLSNHIDRLKSSDNLLFSQEYESIEPGQQFTWDNSNLDVN  839
             MRRLNFQTPGM+SHPPIP+++ +NHI+RLKS+DN  FSQEYESIEPGQQFTWDNSNL+ N
Sbjct  1438  MRRLNFQTPGMISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHN  1497

Query  840   KSKNRYANVIAYDHSRVVLQAVEGLPGSDYINANFCDGYRKHNAYVATQGPLPDTFADFW  899
             KSKNRYANV AYDHSRV L AVEG+ GSDYINAN+CDGYRKHNAYVATQGPL +TF DFW
Sbjct  1498  KSKNRYANVTAYDHSRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFW  1557

Query  900   RMCWELRSATVVMMTRLEERARIKCDQYWPSRGTETYGPVSVTLTDIQDLATYCIRTFQL  959
             RMCWEL++AT+VMMTRLEER RIKCDQYWP+RGTETYG + VT+T+ Q+LATY IRTFQL
Sbjct  1558  RMCWELKTATIVMMTRLEERTRIKCDQYWPTRGTETYGQIFVTITETQELATYSIRTFQL  1617

Query  960   QRLGHPERREVRQFQFTAWPDHGVPDHPAPFLMFLRRVKNVNPMEAGPMVVHCSAGVGRT  1019
              R G  +RRE++Q QFTAWPDHGVPDHPAPFL FLRR + + P E+GP++VHCSAGVGRT
Sbjct  1618  CRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRT  1677

Query  1020  GCFIVIDSMLERLKHEKTVDIYGHVTCLRAQRNYMVQTEDQYIFIHDALLEAVICGHTEI  1079
             GC+IVIDSMLER+KHEK +DIYGHVTCLRAQRNYMVQTEDQYIFIHDA+LEA+ICG TE+
Sbjct  1678  GCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEV  1737

Query  1080  PARNLHNHIQKLMQTELGENITGMELEFKVFMRLANIKADSTRFVSANLPCNKFKNRLVN  1139
             PARNLH H+QKL+ TE GE I+GME+EFK   +L+N+K DS++FV+ANLPCNK KNRLV+
Sbjct  1738  PARNLHTHLQKLLITEPGETISGMEVEFK---KLSNVKMDSSKFVTANLPCNKHKNRLVH  1794

Query  1140  ILPFESARVCISPLRGVEGSDYINASFIDGYRYRNAYIATQGPLAETTEDFWRMLWEHNS  1199
             ILP+ES+RV ++P+ G+EGSDY+NASFIDGYRYR+AYIA QGP+ +  EDFWRMLWEHNS
Sbjct  1795  ILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNS  1854

Query  1200  TIVVMLTKLKELGREKCHQYWPSERSARYACYVVEPIAEYNMPQYILREFKVTDARDGQS  1259
             TIVVMLTKLKE+GREKC QYWP ERS RY  YVV+PIAEYNMPQY LREFKVTDARDG S
Sbjct  1855  TIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSS  1914

Query  1260  RTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITL  1319
             RTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGR+GVFITL
Sbjct  1915  RTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITL  1974

Query  1320  SIVLERMQYEGVVDVFQTVRILRTQRPAMVQTEDQYQFCYRAALEYLGSFDHY  1372
             SIVLERMQYEGV+DVFQTVRILR+QRPAMVQTEDQY FCYRAALEYLGSFD+Y
Sbjct  1975  SIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSFDNY  2027


 Score = 128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 111/409 (27%), Positives = 186/409 (45%), Gaps = 33/409 (8%)

Query  1    MNSTTIHVQWKPPVEKDRNGIIRGYQIHVQEVSEEGGNLLNNPLHYNVPNGNVEELNVSG  60
            ++S+T+ + W+PP  +  NG + GY+++    S +     N+ +       N E   VS 
Sbjct  428  LSSSTMVITWEPP--ETPNGQVTGYKVYYTTNSNQPEASWNSQM-----VDNSELTTVSE  480

Query  61   LQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSKVSLELEWSRP  120
            L P   Y V+V A T  G G  S+PV VK   GVPS+PS N++      + ++ L+W++P
Sbjct  481  LTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPS-NFRATDI-GETAVTLQWTKP  538

Query  121  TQTFGELAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRVAGGNSVGF  180
            T +   +  Y L W     +    + +       + + LD L     Y   +A  +  G 
Sbjct  539  THSSENIVHYELYWNDTYANQAHHKRI----SNSEAYTLDGLYPDTLYYIWLAARSQRGE  594

Query  181  GQEAVKF-FQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLF---H  236
            G        +T + VP  PP  ++    ++  ++++W PPPV+  NG++  Y+V F    
Sbjct  595  GATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVG  654

Query  237  KRLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTE  296
            +  D A     N TS          V   L+  TEY + V A T  G GP    +  RT+
Sbjct  655  REDDEATTMTLNMTSI---------VLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQ  705

Query  297  REIVRAPMNVRAMATSDSSVEVWWETVPSR---GKVIGYQIFYTMTAVED---MDEWQQK  350
             ++   P +V+A   + +S+ V W+    +   G + GY I       E    ++E  + 
Sbjct  706  EDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKF  765

Query  351  AVPITESADLINLEKNAQYAIAVAARTKSGLGRLSERVTAKVKPEDVPL  399
             V  T   ++  L+ + +Y+I VAA T+ G G  S  +  K  P  VP+
Sbjct  766  DVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT-PGGVPV  813


 Score = 110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 108/429 (25%), Positives = 191/429 (45%), Gaps = 28/429 (7%)

Query  1    MNSTTIHVQWKPPVEKDRNGIIRGYQIHVQEVSEEGGNLLNNPLHYNVPNGNVEELNVSG  60
            +  T + +QW  P     N  I  Y+++  +         N   H  + N   E   + G
Sbjct  526  IGETAVTLQWTKPTHSSEN--IVHYELYWND------TYANQAHHKRISNS--EAYTLDG  575

Query  61   LQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSKVSLELEWSRP  120
            L PDT Y + +AA +++G+G+ + P+ V+T   VP  P  N   + T S  ++ L W  P
Sbjct  576  LYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAIAT-SSTTISLSWLPP  634

Query  121  --TQTFGELAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRVAGGNSV  178
               ++ G +  Y++ +       D+   + L    +    LD+L+R  EY+  V  G SV
Sbjct  635  PVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSI---VLDELKRWTEYKIWVLAGTSV  691

Query  179  GFGQEAVK-FFQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFHK  237
            G G  +     +T E VP G P +V      +  + ++WKPP    RNG +  Y +   +
Sbjct  692  GDGPRSHPIILRTQEDVP-GDPQDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQE  750

Query  238  RLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTER  297
              D       N         TL+   + L+ +T+Y +QV A TR+G G     +  +T  
Sbjct  751  LRDEGKG-FLNEPFKFDVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPG  809

Query  298  EI-VRAPMNVRAMATSD-SSVEVWWET-VPSRGKVIGYQIFYTMTAVEDMD-EWQQKAVP  353
             + VR  ++++ M      S+E+ WE    + G++ GY++ +    V+D   + +  + P
Sbjct  810  GVPVRPTVSLKIMEREPIVSIELEWERPAQTYGELRGYRLRW---GVKDQALKEEMLSGP  866

Query  354  ITESADLINLEKNAQYAIAVAARTKSGLGRLSERV--TAKVKPEDVPLNLRAHDVSTHSM  411
                    NLE+  +Y   VA     G+G+ + ++  T +  P   P N+     +   +
Sbjct  867  QMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVKIFQTPEGTPGGPPSNITIRFQTPDVL  926

Query  412  TLSWGPPLR  420
             ++W PP R
Sbjct  927  CVTWDPPTR  935


 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 126/559 (23%), Positives = 228/559 (41%), Gaps = 69/559 (12%)

Query  58   VSGLQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSKVSLELEW  117
            V  L P T Y   V A+   G G  S+P    T          N +V +T S  ++ + W
Sbjct  379  VRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQV-RTLSSSTMVITW  437

Query  118  SRPTQTFGELAAYRLRWGPRT--PSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRVAGG  175
              P    G++  Y++ +   +  P      ++V      +   + +L     Y  RV   
Sbjct  438  EPPETPNGQVTGYKVYYTTNSNQPEASWNSQMV---DNSELTTVSELTPHAIYTVRVQAY  494

Query  176  NSVGFGQEAVKF-FQTPEGVPSGPPSEVSYQFQTADV----VAITWKPPPVDMRNGQLTN  230
             S+G G  +     +  +GVPS P +     F+  D+    V + W  P     N  + +
Sbjct  495  TSMGAGPMSTPVQVKAQQGVPSQPSN-----FRATDIGETAVTLQWTKPTHSSEN--IVH  547

Query  231  YQVLFHKRLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEH  290
            Y++ ++   D  A Q ++   +     TL  ++     +T Y + + A +++G G     
Sbjct  548  YELYWN---DTYANQAHHKRISNSEAYTLDGLYP----DTLYYIWLAARSQRGEGATTPP  600

Query  291  VQFRTEREIVRA-PMNVRAMATSDSSVEVWWETVP---SRGKVIGYQIFYTMTAVEDMDE  346
            +  RT++ +  A P N+ A+ATS +++ + W   P   S G++I Y++F+     ED DE
Sbjct  601  IPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGRED-DE  659

Query  347  WQQKAVPITESADLINLEKNAQYAIAVAARTKSGLGRLSERVTAKVKPEDV---PLNLRA  403
                 + +T S  L  L++  +Y I V A T  G G  S  +  + + EDV   P +++A
Sbjct  660  ATTMTLNMT-SIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQ-EDVPGDPQDVKA  717

Query  404  HDVSTHSMTLSWGPPLRLNPVNYKISFDAVKEFVDSQGITQTQMITPRTILLAP------  457
              +++ S+ +SW PPL  +       +    + +  +G         +  L  P      
Sbjct  718  TPLNSTSIHVSWKPPLEKDRNGIIRGYHIHAQELRDEG---------KGFLNEPFKFDVV  768

Query  458  DSQSHTINELSPFTTYNVNVSAIPTDHSYRPPAKISVTTQMAAP-QPMVKPDFFGVQNAE  516
            D+    +  L P T Y++ V+A+         A I V T    P +P V       +   
Sbjct  769  DTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIV  828

Query  517  EIVVFLPQASEEYGPISHYYLIVVPEDKRTLHKNPDQFLTDDLIANKNGNNKQEDENTPY  576
             I +   + ++ YG +  Y         R      DQ L +++++      K+ D     
Sbjct  829  SIELEWERPAQTYGELRGY---------RLRWGVKDQALKEEMLSGPQMTKKRFDN----  875

Query  577  IAAKFLQRNIPYTFPLGDS  595
                 L+R + Y F +  S
Sbjct  876  -----LERGVEYEFRVAGS  889


>G5EDC5_CAEEL unnamed protein product
Length=2227

 Score = 872 bits (2253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/1458 (37%), Positives = 786/1458 (54%), Gaps = 125/1458 (9%)

Query  2     NSTTIHVQWKPPVEKDRNGIIRGYQIHV------QEVSEEGGNLLNNPLHYNVPNGNVEE  55
             ++T++ + W  P     NG + GY +++      + V E+G    +      + + +   
Sbjct  809   SATSVKLTWDAPAAA--NGALLGYYVYLDRMVNGEPVVEKG----SKKRIVMIRDSSKRY  862

Query  56    LNVSGLQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSK-VSLE  114
               +  L P+T Y+ ++ A  R GDG  S   ++ T G  P  P +    L  D   V   
Sbjct  863   FELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRDEPPVVAR  922

Query  115   LEWSRPTQTFGE--LAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRV  172
             +EW  P     E  +  Y L    +      ++   ++G  +    +  L  G+ Y+  +
Sbjct  923   IEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVDGTDLST-TISGLWMGVVYDVLL  981

Query  173   AGGNSVGFGQEAVKFFQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQ  232
             A  N  G  Q A +   TP G P G P +V Y+     +V ++W+PP  + RNG +T+Y+
Sbjct  982   AAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIV-VSWRPPSEEKRNGNITSYK  1040

Query  233   VLFHKRLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQ  292
              +    +D A A  Y      P PST      N+     Y+ +V A T +G GPY   + 
Sbjct  1041  AILSA-MD-ATADRYE--QPVPAPSTSSTFEVNVRR--AYLFKVAAATMKGIGPYSPVLT  1094

Query  293   FRTE-REIVRAPMNVRAMATSDSSVEVWWETVPSRGKVIGYQIFYTMTAVEDMDEWQQKA  351
                +   +V  P NVR  ATS+S+  V W+    +      +  +      D ++W+Q  
Sbjct  1095  INPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLP  1154

Query  352   VPITES------ADLINLEKNAQYAIAVAARTKSGLGRLSE--RVTAKVKPEDVPLNLRA  403
             V   +       A + +L  +  YA  V A   +  G  S+   V   V P  +  NLR 
Sbjct  1155  VVSIDKENPKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSDPPTVLESVTPTYMVQNLRV  1214

Query  404   HDVSTHSMTLSW---GPPLRLNPVNYKISFDAVKEFVDSQGITQTQMITPRTILLAPDSQ  460
                +++S+ L+W   GP      V + ++    K++V+ + + +  M TP       +  
Sbjct  1215  LWKTSNSVQLTWEYNGP----RNVGFYVNHTGRKDYVNHE-LQEKTMSTPGFGQDVDEKH  1269

Query  461   SHTI-NELSPFTTYNVNV---SAIPTDHSYRPPAKISVTTQMAAPQPMVKP--DFFGVQN  514
                +   L P   Y ++V   +  P    Y P   +++T     P   V    D  G Q 
Sbjct  1270  REYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQP  1329

Query  515   AEEIVVFLPQASEEYGPISHYYLIVVPED-------------------------KRTLHK  549
              ++++   P A+EEYGPISHY++I+VP +                          R+L  
Sbjct  1330  GQQMIRLTP-ATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSV  1388

Query  550   NPDQFLTDDLIANKNGNNKQEDENTP-------------YIAAKF--------LQRNIPY  588
             +P + L     A++ G++ Q     P             Y+ A+          + N P 
Sbjct  1389  SPSKKLKRK--ASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRVKQQYRNNQP-  1445

Query  589   TFPLGDSKTFEGFENRRLEKGKKYRIFVRAVV--DTPQKHLYTS-SPFSEQLSLDMREIP  645
              F +GDS+ ++GF N  LE    YR+ +RA    D   K  +   +P SE+LS   R   
Sbjct  1446  -FIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDSFEQRAPMSEKLS---RMYS  1501

Query  646   PGQLPHRPNPYVPVESADVAVDRNAEDPGMLWVLGPVVAAVMVTCCLVFFILVIR-RRRQ  704
                L     P+  ++SA     R A      WV   +   V+ +   +     +R  ++ 
Sbjct  1502  DSVLTE---PFT-IKSA----LRGASQKSSPWVGACIAFLVLFSIVGMLICWWLRCNKKS  1553

Query  705   MPKTPEQASVTKPLMAPGEYGGVGGAGGGGLGGLGAGGLGGLGGL-------GGGGVGGT  757
               + P   S+TK  +      G GG  G     L      G   +       G   +  +
Sbjct  1554  AGRHPRHGSITKVALTGNIMNGGGGIPGETSKLLSTSNEYGRQIMNPYEQMNGNHHMESS  1613

Query  758   GTLGGGGTASAAAFHPASDPVEMRRL--NFQTPGMMSHPPIPVADLSNHIDRLKSSDNLL  815
               L    T+ + +   A  PV +  L  N      +SHP +P+A+L+NHI+RL+ ++N  
Sbjct  1614  MDLYPLPTSHSRSNGYAPVPVAIPSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAG  1673

Query  816   FSQEYESIEPGQQFTWDNSNLDVNKSKNRYANVIAYDHSRVVLQAVEGLPGSDYINANFC  875
             F  E+ESIE GQ FTW++S+ D+NK KNRYANV AYDHSRVVL  VEG PG DYINAN+ 
Sbjct  1674  FQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV  1733

Query  876   DGYRKHNAYVATQGPLPDTFADFWRMCWELRSATVVMMTRLEERARIKCDQYWPSRGTET  935
             DGY K  +Y+ATQGPLP+TF+DFWRM WE +S T+VM+T LEER+R+KCDQYWPSRGT T
Sbjct  1734  DGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTAT  1793

Query  936   YGPVSVTLTDIQDLATYCIRTFQLQRLGHPERREVRQFQFTAWPDHGVPDHPAPFLMFLR  995
             YG + VTL +   LA Y +RT +L+ +G PE RE++  Q+TAWPDHGVPDHP PFL+FL+
Sbjct  1794  YGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLK  1853

Query  996   RVKNVNPMEAGPMVVHCSAGVGRTGCFIVIDSMLERLKHEKTVDIYGHVTCLRAQRNYMV  1055
             RVK +NP +AGP++ HCSAG+GRTG FIVID MLERL+++ TVDIYG VT LRAQR+YMV
Sbjct  1854  RVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMV  1913

Query  1056  QTEDQYIFIHDALLEAVICGHTEIPARNLHNHIQKLMQTELGENITGMELEFKVFMRLAN  1115
             QTE+QYIFIHDA+L+AV  G TE+PA  LH H+  L Q    + ++G+++EF+    L  
Sbjct  1914  QTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPS-ADQLSGIDMEFR---HLTT  1969

Query  1116  IKADSTRFVSANLPCNKFKNRLVNILPFESARVCISPLRGVEGSDYINASFIDGYRYRNA  1175
             +K  S R   ANLP N+ KNR+++ +P++S RV +  L G +GSDYINAS+IDGY+ R A
Sbjct  1970  LKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGA  2029

Query  1176  YIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLKELGREKCHQYWPSERSARYACYVVEP  1235
             YIATQ P  ET  DFWR +WEHNS I+ ML +  E G+E+C  YWP E   +    VVEP
Sbjct  2030  YIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEP  2089

Query  1236  IAEYNMPQYILREFKVTDARDGQSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQ  1295
             +AEY+M  Y LREF+++D    + RTVRQF F++WP+ G P + + F+DF+ QVH T  Q
Sbjct  2090  MAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQ  2149

Query  1296  FGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVVDVFQTVRILRTQRPAMVQTEDQY  1355
             FG  GPITVHC +G GRT VFI LSI+L+RM+ E VVDVF TV++LRT+R  M+Q  +QY
Sbjct  2150  FGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQY  2209

Query  1356  QFCYRAALEYLGSFDHYA  1373
              F Y AA EYL ++D+++
Sbjct  2210  HFLYLAAYEYLAAYDNFS  2227


 Score = 110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 114/426 (27%), Positives = 199/426 (47%), Gaps = 48/426 (11%)

Query  1    MNSTTIHVQWKPPVEKDRNGIIRGYQIHVQEVSEEGGNLLNNPL-HYNVPNGNVEEL--N  57
            +N  +I V+W P  +   NG+I GY+++         +L+  P+  +   +   +E    
Sbjct  495  LNRDSILVKWGPCEQP--NGLITGYKVYYT------NDLVTTPIREWKQHDAKSDEFMTT  546

Query  58   VSGLQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSKVSLELEW  117
            ++GL+PD+RY V+V A   +GD   S+ V V T  G+P +P +   V   DS+  ++L W
Sbjct  547  INGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPM-LTVKALDSR-RMQLTW  604

Query  118  SRPTQTFGELAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRVAGGNS  177
             +P  +   +  Y +R+     + D  +EL L     + H +  L     Y FRVA  + 
Sbjct  605  DKPLYS-SPVVGYTVRYN----TSDGEKELTLTSPH-EKHVVTGLHPDKYYYFRVAAYSD  658

Query  178  VGFGQEAVKFF-QTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFH  236
             G G+       +T   +P   P+ VS    ++  V I WK P     NG LT Y++ + 
Sbjct  659  RGQGEFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYF  718

Query  237  KRLDHAAA--------QNYNTTST--------KPTPSTLKAVFSNLEENTEYVVQVRAYT  280
            +  D   A        ++ + +S+         P+ +T   V S+L   + Y + V A T
Sbjct  719  RLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDAT-SYVLSDLLPYSSYEITVAAST  777

Query  281  RQGPGPYGEHVQFRTEREIVRAPMNVRAMATSDSSVEVWWET-VPSRGKVIGYQIFYT-M  338
              G GP       +T  ++  AP N  A  TS +SV++ W+    + G ++GY ++   M
Sbjct  778  MDGYGPESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRM  837

Query  339  TAVEDMDE--WQQKAVPITESA----DLINLEKNAQYAIAVAARTKSGLGRLSER---VT  389
               E + E   +++ V I +S+    +L +L+ N +Y+  + A  ++G G  SER   +T
Sbjct  838  VNGEPVVEKGSKKRIVMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIIT  897

Query  390  AKVKPE  395
              + PE
Sbjct  898  QGIPPE  903


 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 127/536 (24%), Positives = 207/536 (39%), Gaps = 77/536 (14%)

Query  8    VQWKPPVEKDR-NGIIRGYQIHVQEVSEEGGNLLNNPLHYNVPNGNVEELNVSGLQPDTR  66
            + WKPP   +  N  +  Y++   E     G  +       + N     L + GL     
Sbjct  404  ITWKPPKYNEAINKYVVNYRLKYSEGRSSRGKTMET-----LENS----LVIDGLVAFQT  454

Query  67   YAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDS--KVSLELEWSRPTQTF  124
            Y   V +    G G  S PV  +T    PS+P+      Q  S  + S+ ++W    Q  
Sbjct  455  YEFTVRSAGPVGVGLESLPVEAQTK---PSKPATAPVSPQARSLNRDSILVKWGPCEQPN  511

Query  125  GELAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQ-------LERGLEYEFRVAGGNS  177
            G +  Y++ +       + L    +   K    K D+       LE    Y  RV   NS
Sbjct  512  GLITGYKVYYT------NDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNS  565

Query  178  VGFGQ-EAVKFFQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFH  236
             G      +    T +G+P  PP  ++ +   +  + +TW  P   + +  +  Y V ++
Sbjct  566  EGDSPLSTLVTVATRQGIPGQPPM-LTVKALDSRRMQLTWDKP---LYSSPVVGYTVRYN  621

Query  237  KRLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTE  296
                  +      T T P     K V + L  +  Y  +V AY+ +G G + E +  +T 
Sbjct  622  -----TSDGEKELTLTSPHE---KHVVTGLHPDKYYYFRVAAYSDRGQGEFTEPMISKTI  673

Query  297  REI-VRAPMNVRAMATSDSSVEVWW---ETVPSRGKVIGYQIFY------------TMTA  340
              I + +P  V A ATS  SVE+ W   E     G +  Y+I Y            ++  
Sbjct  674  ASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEY  733

Query  341  VEDMDE----WQQKAVPITESAD---LINLEKNAQYAIAVAARTKSGLGRLSERVTAKVK  393
             EDMD+      + +V +   A    L +L   + Y I VAA T  G G  S     K  
Sbjct  734  DEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGPESSIRVVKTL  793

Query  394  PEDVP---LNLRAHDVSTHSMTLSWGPPLRLNP--VNYKISFDAVKEFVDSQGITQTQMI  448
             EDVP    N  A   S  S+ L+W  P   N   + Y +  D     V+ + + +    
Sbjct  794  -EDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLD---RMVNGEPVVEKG--  847

Query  449  TPRTILLAPDSQSH--TINELSPFTTYNVNVSAIPTDHSYRPPAKISVTTQMAAPQ  502
            + + I++  DS      ++ L P T Y+  ++A   +       + S+ TQ   P+
Sbjct  848  SKKRIVMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPE  903


 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 123/290 (42%), Gaps = 30/290 (10%)

Query  198  PPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFHKRLDHAAAQNYNTTSTKPTPS  257
            PP  +     T++ V ITWKPP     N  +  Y V +  RL ++  ++    + +   +
Sbjct  388  PPVNIVVSSVTSESVVITWKPPKY---NEAINKYVVNY--RLKYSEGRSSRGKTMETLEN  442

Query  258  TLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTE-REIVRAPMNVRAMATSDSSV  316
            +L  V   L     Y   VR+    G G     V+ +T+  +   AP++ +A + +  S+
Sbjct  443  SL--VIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSI  500

Query  317  EVWWETVPS-RGKVIGYQIFYTMTAVED-MDEWQQKAVPITESADLIN-LEKNAQYAIAV  373
             V W       G + GY+++YT   V   + EW+Q      E    IN LE +++Y + V
Sbjct  501  LVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRV  560

Query  374  AARTKSGLGRLSERVTAKVK---PEDVPLNLRAHDVSTHSMTLSWGPPLRLNP-VNYKIS  429
             A+   G   LS  VT   +   P   P+ L    + +  M L+W  PL  +P V Y + 
Sbjct  561  IAQNSEGDSPLSTLVTVATRQGIPGQPPM-LTVKALDSRRMQLTWDKPLYSSPVVGYTVR  619

Query  430  FDAVKEFVDSQGITQTQMITPRTILLAPDSQSHTINELSPFTTYNVNVSA  479
            ++       S G  +  + +P         + H +  L P   Y   V+A
Sbjct  620  YNT------SDGEKELTLTSPH--------EKHVVTGLHPDKYYYFRVAA  655


>G5EE54_CAEEL unnamed protein product
Length=1985

 Score = 871 bits (2251),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/1458 (37%), Positives = 786/1458 (54%), Gaps = 125/1458 (9%)

Query  2     NSTTIHVQWKPPVEKDRNGIIRGYQIHV------QEVSEEGGNLLNNPLHYNVPNGNVEE  55
             ++T++ + W  P     NG + GY +++      + V E+G    +      + + +   
Sbjct  567   SATSVKLTWDAPAAA--NGALLGYYVYLDRMVNGEPVVEKG----SKKRIVMIRDSSKRY  620

Query  56    LNVSGLQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSK-VSLE  114
               +  L P+T Y+ ++ A  R GDG  S   ++ T G  P  P +    L  D   V   
Sbjct  621   FELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPEAPEIVSVSLDRDEPPVVAR  680

Query  115   LEWSRPTQTFGE--LAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRV  172
             +EW  P     E  +  Y L    +      ++   ++G  +    +  L  G+ Y+  +
Sbjct  681   IEWKMPKMKPNETPIEKYNLWLRAQGYPDSYVKAKTVDGTDLST-TISGLWMGVVYDVLL  739

Query  173   AGGNSVGFGQEAVKFFQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQ  232
             A  N  G  Q A +   TP G P G P +V Y+     +V ++W+PP  + RNG +T+Y+
Sbjct  740   AAENREGRSQNATETIATPVGSPDGEPIDVQYEVMKGKIV-VSWRPPSEEKRNGNITSYK  798

Query  233   VLFHKRLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQ  292
              +    +D A A  Y      P PST      N+     Y+ +V A T +G GPY   + 
Sbjct  799   AILSA-MD-ATADRYE--QPVPAPSTSSTFEVNVRR--AYLFKVAAATMKGIGPYSPVLT  852

Query  293   FRTE-REIVRAPMNVRAMATSDSSVEVWWETVPSRGKVIGYQIFYTMTAVEDMDEWQQKA  351
                +   +V  P NVR  ATS+S+  V W+    +      +  +      D ++W+Q  
Sbjct  853   INPDPAALVGPPTNVRVEATSNSTAVVQWDFESQKADSFVVKYMHEPGNRMDTEKWKQLP  912

Query  352   VPITES------ADLINLEKNAQYAIAVAARTKSGLGRLSE--RVTAKVKPEDVPLNLRA  403
             V   +       A + +L  +  YA  V A   +  G  S+   V   V P  +  NLR 
Sbjct  913   VVSIDKENPKRFAVVSDLNAHKPYAFCVLAVKNNRQGPCSDPPTVLESVTPTYMVQNLRV  972

Query  404   HDVSTHSMTLSW---GPPLRLNPVNYKISFDAVKEFVDSQGITQTQMITPRTILLAPDSQ  460
                +++S+ L+W   GP      V + ++    K++V+ + + +  M TP       +  
Sbjct  973   LWKTSNSVQLTWEYNGP----RNVGFYVNHTGRKDYVNHE-LQEKTMSTPGFGQDVDEKH  1027

Query  461   SHTI-NELSPFTTYNVNV---SAIPTDHSYRPPAKISVTTQMAAPQPMVKP--DFFGVQN  514
                +   L P   Y ++V   +  P    Y P   +++T     P   V    D  G Q 
Sbjct  1028  REYLWTNLRPHMMYTIHVGVRTLPPGARKYWPQEVVTITDPTGPPFVDVPKLVDSSGTQP  1087

Query  515   AEEIVVFLPQASEEYGPISHYYLIVVPED-------------------------KRTLHK  549
              ++++   P A+EEYGPISHY++I+VP +                          R+L  
Sbjct  1088  GQQMIRLTP-ATEEYGPISHYWIILVPANYSTEDVVNLDPIELEKATAEKRAQLARSLSV  1146

Query  550   NPDQFLTDDLIANKNGNNKQEDENTP-------------YIAAKF--------LQRNIPY  588
             +P + L     A++ G++ Q     P             Y+ A+          + N P 
Sbjct  1147  SPSKKLKRK--ASEVGDDSQSASYHPKEKRARRATVPGAYVTARLSADRVKQQYRNNQP-  1203

Query  589   TFPLGDSKTFEGFENRRLEKGKKYRIFVRAVV--DTPQKHLYTS-SPFSEQLSLDMREIP  645
              F +GDS+ ++GF N  LE    YR+ +RA    D   K  +   +P SE+LS   R   
Sbjct  1204  -FIVGDSQLYDGFTNYPLEHNLHYRLMMRAFAKNDVRTKDSFEQRAPMSEKLS---RMYS  1259

Query  646   PGQLPHRPNPYVPVESADVAVDRNAEDPGMLWVLGPVVAAVMVTCCLVFFILVIR-RRRQ  704
                L     P+  ++SA     R A      WV   +   V+ +   +     +R  ++ 
Sbjct  1260  DSVLTE---PFT-IKSA----LRGASQKSSPWVGACIAFLVLFSIVGMLICWWLRCNKKS  1311

Query  705   MPKTPEQASVTKPLMAPGEYGGVGGAGGGGLGGLGAGGLGGLGGL-------GGGGVGGT  757
               + P   S+TK  +      G GG  G     L      G   +       G   +  +
Sbjct  1312  AGRHPRHGSITKVALTGNIMNGGGGIPGETSKLLSTSNEYGRQIMNPYEQMNGNHHMESS  1371

Query  758   GTLGGGGTASAAAFHPASDPVEMRRL--NFQTPGMMSHPPIPVADLSNHIDRLKSSDNLL  815
               L    T+ + +   A  PV +  L  N      +SHP +P+A+L+NHI+RL+ ++N  
Sbjct  1372  MDLYPLPTSHSRSNGYAPVPVAIPSLPNNGNNMTTVSHPAVPIAELANHIERLRMNNNAG  1431

Query  816   FSQEYESIEPGQQFTWDNSNLDVNKSKNRYANVIAYDHSRVVLQAVEGLPGSDYINANFC  875
             F  E+ESIE GQ FTW++S+ D+NK KNRYANV AYDHSRVVL  VEG PG DYINAN+ 
Sbjct  1432  FQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYV  1491

Query  876   DGYRKHNAYVATQGPLPDTFADFWRMCWELRSATVVMMTRLEERARIKCDQYWPSRGTET  935
             DGY K  +Y+ATQGPLP+TF+DFWRM WE +S T+VM+T LEER+R+KCDQYWPSRGT T
Sbjct  1492  DGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTAT  1551

Query  936   YGPVSVTLTDIQDLATYCIRTFQLQRLGHPERREVRQFQFTAWPDHGVPDHPAPFLMFLR  995
             YG + VTL +   LA Y +RT +L+ +G PE RE++  Q+TAWPDHGVPDHP PFL+FL+
Sbjct  1552  YGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLK  1611

Query  996   RVKNVNPMEAGPMVVHCSAGVGRTGCFIVIDSMLERLKHEKTVDIYGHVTCLRAQRNYMV  1055
             RVK +NP +AGP++ HCSAG+GRTG FIVID MLERL+++ TVDIYG VT LRAQR+YMV
Sbjct  1612  RVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMV  1671

Query  1056  QTEDQYIFIHDALLEAVICGHTEIPARNLHNHIQKLMQTELGENITGMELEFKVFMRLAN  1115
             QTE+QYIFIHDA+L+AV  G TE+PA  LH H+  L Q    + ++G+++EF+    L  
Sbjct  1672  QTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPS-ADQLSGIDMEFR---HLTT  1727

Query  1116  IKADSTRFVSANLPCNKFKNRLVNILPFESARVCISPLRGVEGSDYINASFIDGYRYRNA  1175
             +K  S R   ANLP N+ KNR+++ +P++S RV +  L G +GSDYINAS+IDGY+ R A
Sbjct  1728  LKWTSNRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGA  1787

Query  1176  YIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLKELGREKCHQYWPSERSARYACYVVEP  1235
             YIATQ P  ET  DFWR +WEHNS I+ ML +  E G+E+C  YWP E   +    VVEP
Sbjct  1788  YIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEP  1847

Query  1236  IAEYNMPQYILREFKVTDARDGQSRTVRQFQFIDWPEQGVPKSGEGFIDFIGQVHKTKEQ  1295
             +AEY+M  Y LREF+++D    + RTVRQF F++WP+ G P + + F+DF+ QVH T  Q
Sbjct  1848  MAEYDMKHYHLREFRISDINTREVRTVRQFHFMEWPDVGKPHTADHFLDFVTQVHNTYAQ  1907

Query  1296  FGQDGPITVHCSAGVGRTGVFITLSIVLERMQYEGVVDVFQTVRILRTQRPAMVQTEDQY  1355
             FG  GPITVHC +G GRT VFI LSI+L+RM+ E VVDVF TV++LRT+R  M+Q  +QY
Sbjct  1908  FGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQY  1967

Query  1356  QFCYRAALEYLGSFDHYA  1373
              F Y AA EYL ++D+++
Sbjct  1968  HFLYLAAYEYLAAYDNFS  1985


 Score = 110 bits (275),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 114/426 (27%), Positives = 199/426 (47%), Gaps = 48/426 (11%)

Query  1    MNSTTIHVQWKPPVEKDRNGIIRGYQIHVQEVSEEGGNLLNNPL-HYNVPNGNVEEL--N  57
            +N  +I V+W P  +   NG+I GY+++         +L+  P+  +   +   +E    
Sbjct  253  LNRDSILVKWGPCEQP--NGLITGYKVYYT------NDLVTTPIREWKQHDAKSDEFMTT  304

Query  58   VSGLQPDTRYAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDSKVSLELEW  117
            ++GL+PD+RY V+V A   +GD   S+ V V T  G+P +P +   V   DS+  ++L W
Sbjct  305  INGLEPDSRYFVRVIAQNSEGDSPLSTLVTVATRQGIPGQPPM-LTVKALDSR-RMQLTW  362

Query  118  SRPTQTFGELAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQLERGLEYEFRVAGGNS  177
             +P  +   +  Y +R+     + D  +EL L     + H +  L     Y FRVA  + 
Sbjct  363  DKPLYS-SPVVGYTVRYN----TSDGEKELTLTSPH-EKHVVTGLHPDKYYYFRVAAYSD  416

Query  178  VGFGQEAVKFF-QTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFH  236
             G G+       +T   +P   P+ VS    ++  V I WK P     NG LT Y++ + 
Sbjct  417  RGQGEFTEPMISKTIASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYF  476

Query  237  KRLDHAAA--------QNYNTTST--------KPTPSTLKAVFSNLEENTEYVVQVRAYT  280
            +  D   A        ++ + +S+         P+ +T   V S+L   + Y + V A T
Sbjct  477  RLEDSKTANLESVEYDEDMDDSSSFLDRMSVVVPSDAT-SYVLSDLLPYSSYEITVAAST  535

Query  281  RQGPGPYGEHVQFRTEREIVRAPMNVRAMATSDSSVEVWWET-VPSRGKVIGYQIFYT-M  338
              G GP       +T  ++  AP N  A  TS +SV++ W+    + G ++GY ++   M
Sbjct  536  MDGYGPESSIRVVKTLEDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLDRM  595

Query  339  TAVEDMDE--WQQKAVPITESA----DLINLEKNAQYAIAVAARTKSGLGRLSER---VT  389
               E + E   +++ V I +S+    +L +L+ N +Y+  + A  ++G G  SER   +T
Sbjct  596  VNGEPVVEKGSKKRIVMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIIT  655

Query  390  AKVKPE  395
              + PE
Sbjct  656  QGIPPE  661


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 127/536 (24%), Positives = 207/536 (39%), Gaps = 77/536 (14%)

Query  8    VQWKPPVEKDR-NGIIRGYQIHVQEVSEEGGNLLNNPLHYNVPNGNVEELNVSGLQPDTR  66
            + WKPP   +  N  +  Y++   E     G  +       + N     L + GL     
Sbjct  162  ITWKPPKYNEAINKYVVNYRLKYSEGRSSRGKTMET-----LENS----LVIDGLVAFQT  212

Query  67   YAVQVAALTRKGDGSRSSPVNVKTPGGVPSRPSLNYKVLQTDS--KVSLELEWSRPTQTF  124
            Y   V +    G G  S PV  +T    PS+P+      Q  S  + S+ ++W    Q  
Sbjct  213  YEFTVRSAGPVGVGLESLPVEAQTK---PSKPATAPVSPQARSLNRDSILVKWGPCEQPN  269

Query  125  GELAAYRLRWGPRTPSGDQLQELVLEGGKVQHHKLDQ-------LERGLEYEFRVAGGNS  177
            G +  Y++ +       + L    +   K    K D+       LE    Y  RV   NS
Sbjct  270  GLITGYKVYYT------NDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRVIAQNS  323

Query  178  VGFGQ-EAVKFFQTPEGVPSGPPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFH  236
             G      +    T +G+P  PP  ++ +   +  + +TW  P   + +  +  Y V ++
Sbjct  324  EGDSPLSTLVTVATRQGIPGQPPM-LTVKALDSRRMQLTWDKP---LYSSPVVGYTVRYN  379

Query  237  KRLDHAAAQNYNTTSTKPTPSTLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTE  296
                  +      T T P     K V + L  +  Y  +V AY+ +G G + E +  +T 
Sbjct  380  -----TSDGEKELTLTSPHE---KHVVTGLHPDKYYYFRVAAYSDRGQGEFTEPMISKTI  431

Query  297  REI-VRAPMNVRAMATSDSSVEVWW---ETVPSRGKVIGYQIFY------------TMTA  340
              I + +P  V A ATS  SVE+ W   E     G +  Y+I Y            ++  
Sbjct  432  ASIPLSSPTIVSAAATSSKSVEIRWKGPEQKKLNGVLTAYRINYFRLEDSKTANLESVEY  491

Query  341  VEDMDE----WQQKAVPITESAD---LINLEKNAQYAIAVAARTKSGLGRLSERVTAKVK  393
             EDMD+      + +V +   A    L +L   + Y I VAA T  G G  S     K  
Sbjct  492  DEDMDDSSSFLDRMSVVVPSDATSYVLSDLLPYSSYEITVAASTMDGYGPESSIRVVKTL  551

Query  394  PEDVP---LNLRAHDVSTHSMTLSWGPPLRLNP--VNYKISFDAVKEFVDSQGITQTQMI  448
             EDVP    N  A   S  S+ L+W  P   N   + Y +  D     V+ + + +    
Sbjct  552  -EDVPSAPRNFNAELTSATSVKLTWDAPAAANGALLGYYVYLD---RMVNGEPVVEKG--  605

Query  449  TPRTILLAPDSQSH--TINELSPFTTYNVNVSAIPTDHSYRPPAKISVTTQMAAPQ  502
            + + I++  DS      ++ L P T Y+  ++A   +       + S+ TQ   P+
Sbjct  606  SKKRIVMIRDSSKRYFELDSLDPNTEYSFRLNAFNRNGDGEFSERKSIITQGIPPE  661


 Score = 53.9 bits (128),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 123/290 (42%), Gaps = 30/290 (10%)

Query  198  PPSEVSYQFQTADVVAITWKPPPVDMRNGQLTNYQVLFHKRLDHAAAQNYNTTSTKPTPS  257
            PP  +     T++ V ITWKPP     N  +  Y V +  RL ++  ++    + +   +
Sbjct  146  PPVNIVVSSVTSESVVITWKPPKY---NEAINKYVVNY--RLKYSEGRSSRGKTMETLEN  200

Query  258  TLKAVFSNLEENTEYVVQVRAYTRQGPGPYGEHVQFRTE-REIVRAPMNVRAMATSDSSV  316
            +L  V   L     Y   VR+    G G     V+ +T+  +   AP++ +A + +  S+
Sbjct  201  SL--VIDGLVAFQTYEFTVRSAGPVGVGLESLPVEAQTKPSKPATAPVSPQARSLNRDSI  258

Query  317  EVWWETVPS-RGKVIGYQIFYTMTAVED-MDEWQQKAVPITESADLIN-LEKNAQYAIAV  373
             V W       G + GY+++YT   V   + EW+Q      E    IN LE +++Y + V
Sbjct  259  LVKWGPCEQPNGLITGYKVYYTNDLVTTPIREWKQHDAKSDEFMTTINGLEPDSRYFVRV  318

Query  374  AARTKSGLGRLSERVTAKVK---PEDVPLNLRAHDVSTHSMTLSWGPPLRLNP-VNYKIS  429
             A+   G   LS  VT   +   P   P+ L    + +  M L+W  PL  +P V Y + 
Sbjct  319  IAQNSEGDSPLSTLVTVATRQGIPGQPPM-LTVKALDSRRMQLTWDKPLYSSPVVGYTVR  377

Query  430  FDAVKEFVDSQGITQTQMITPRTILLAPDSQSHTINELSPFTTYNVNVSA  479
            ++       S G  +  + +P         + H +  L P   Y   V+A
Sbjct  378  YNT------SDGEKELTLTSPH--------EKHVVTGLHPDKYYYFRVAA  413



Lambda      K        H
   0.318    0.135    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 24426371112


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  12:13 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= CAQU000099-PA

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAR_DROME  unnamed protein product                                    126     5e-31
Q7KSE9_DROME  unnamed protein product                                 62.0    5e-10
A8JR35_DROME  unnamed protein product                                 62.0    5e-10


>LAR_DROME unnamed protein product
Length=2029

 Score = 126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 79/109 (72%), Gaps = 3/109 (3%)

Query  6    ARHTVPGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATIT  65
             +  VPGAPP+N++A A  ST+I + WLPPP E+ NG I YYK+ +VE  R D EA T+T
Sbjct  605  TKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMT  664

Query  66   ISNPDARHFLVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDEDEAG  114
            +   +    ++D+LKRWT+Y++WVLAGTSVGDGP S+P+++ T ED  G
Sbjct  665  L---NMTSIVLDELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPG  710


 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 52/104 (50%), Gaps = 3/104 (3%)

Query  3    TCPARHTVPGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAA  62
            TC    T   + P+NV      S+++++ W PP  E  NG +  YK++Y  +S +  EA+
Sbjct  408  TCTTGETKMESAPRNVQVRTLSSSTMVITWEPP--ETPNGQVTGYKVYYTTNS-NQPEAS  464

Query  63   TITISNPDARHFLVDQLKRWTQYRVWVLAGTSVGDGPASYPVVV  106
              +    ++    V +L     Y V V A TS+G GP S PV V
Sbjct  465  WNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQV  508


 Score = 45.8 bits (107),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 50/102 (49%), Gaps = 5/102 (5%)

Query  10   VPGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAAT---ITI  66
            VPG P Q+V A   +STSI V W PP  + +NG IR Y +H  +  R + +         
Sbjct  708  VPGDP-QDVKATPLNSTSIHVSWKPPLEKDRNGIIRGYHIH-AQELRDEGKGFLNEPFKF  765

Query  67   SNPDARHFLVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTT  108
               D   F V  L+  T+Y + V A T  GDG  S  +VV T
Sbjct  766  DVVDTLEFNVTGLQPDTKYSIQVAALTRKGDGDRSAAIVVKT  807


 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 4/113 (4%)

Query  11    PGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNPD  70
             PG PP N++   +    + V W PP  E +NG I  Y + +        +    +  N  
Sbjct  909   PGGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQF----HKKIDHGLGSERNMT  964

Query  71    ARHFLVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDEDEAGACSSSPDEA  123
              R  +   L+  T+Y   V A T  G GP S  ++V T+ D   A  S   EA
Sbjct  965   LRKAVFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMSLQAEA  1017


 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 51/110 (46%), Gaps = 10/110 (9%)

Query  15   PQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNPDARHF  74
            P +V      +TS+ + W    + +   D++YY + Y      ++  A   IS     ++
Sbjct  325  PTDVQISEVTATSVRLEW----SYKGPEDLQYYVIQY---KPKNANQAFSEISGIITMYY  377

Query  75   LVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDEDEAGACSSSPDEAQ  124
            +V  L  +T+Y  +V+A  ++G GP S P   TT E +     S+P   Q
Sbjct  378  VVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKM---ESAPRNVQ  424


 Score = 35.0 bits (79),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 51/101 (50%), Gaps = 6/101 (6%)

Query  15   PQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNPDARHF  74
            P N  A     T++ ++W  P    +N  I +Y+L++ ++  +  +A    ISN +A  +
Sbjct  518  PSNFRATDIGETAVTLQWTKPTHSSEN--IVHYELYWNDTYAN--QAHHKRISNSEA--Y  571

Query  75   LVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDEDEAGA  115
             +D L   T Y +W+ A +  G+G  + P+ V T +   GA
Sbjct  572  TLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGA  612


>Q7KSE9_DROME unnamed protein product
Length=2087

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 0/102 (0%)

Query  10    VPGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNP  69
             VP A PQNV+  A  S S+ + WL PP +   G I+ YK+ Y          A + I   
Sbjct  1146  VPEAAPQNVNCTALSSQSLKISWLEPPLQFHGGIIQGYKILYRPIVHQIDFPAKLEIKRT  1205

Query  70    DARHFLVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDED  111
                   +  L + + Y + VLA T+ GDG AS+P+   TD+D
Sbjct  1206  SNLETYLHTLHKASNYSIRVLAYTATGDGLASHPLFCQTDDD  1247


 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (42%), Gaps = 13/110 (12%)

Query  11    PGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNPD  70
             P   P NV  +    + ++V W  PP E  NG++  Y    V  S        I++ N  
Sbjct  1038  PTEAPSNVQVQTGGESELIVTWQIPPRESWNGELIGYT---VNCSEEKQNINFISVVNSS  1094

Query  71    ARHFLVD----------QLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDE  110
              +  +V            L+++++Y V + A  S G GP S  +  TT E
Sbjct  1095  LKSTIVSGWATTKATLRGLRKYSRYAVTIRAMNSFGSGPWSAAIFGTTAE  1144


 Score = 34.3 bits (77),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 40/86 (47%), Gaps = 6/86 (7%)

Query  27    SILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITI---SNPDARHFLVDQLKRWT  83
             SIL+ WL P  + +NG I +Y ++  E+ R   +A T  +    N     F    L    
Sbjct  1264  SILISWLTP--KNRNGIISHYTVYSREAGR-KGQAKTHMVRVDENGYPVTFESRSLAENQ  1320

Query  84    QYRVWVLAGTSVGDGPASYPVVVTTD  109
              Y  WV A TSVG+G  +  +   T+
Sbjct  1321  MYEFWVSASTSVGEGEPTSVIAQATN  1346


>A8JR35_DROME unnamed protein product
Length=2007

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 0/102 (0%)

Query  10    VPGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNP  69
             VP A PQNV+  A  S S+ + WL PP +   G I+ YK+ Y          A + I   
Sbjct  1170  VPEAAPQNVNCTALSSQSLKISWLEPPLQFHGGIIQGYKILYRPIVHQIDFPAKLEIKRT  1229

Query  70    DARHFLVDQLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDED  111
                   +  L + + Y + VLA T+ GDG AS+P+   TD+D
Sbjct  1230  SNLETYLHTLHKASNYSIRVLAYTATGDGLASHPLFCQTDDD  1271


 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 46/110 (42%), Gaps = 13/110 (12%)

Query  11    PGAPPQNVSAEAEDSTSILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITISNPD  70
             P   P NV  +    + ++V W  PP E  NG++  Y    V  S        I++ N  
Sbjct  1062  PTEAPSNVQVQTGGESELIVTWQIPPRESWNGELIGYT---VNCSEEKQNINFISVVNSS  1118

Query  71    ARHFLVD----------QLKRWTQYRVWVLAGTSVGDGPASYPVVVTTDE  110
              +  +V            L+++++Y V + A  S G GP S  +  TT E
Sbjct  1119  LKSTIVSGWATTKATLRGLRKYSRYAVTIRAMNSFGSGPWSAAIFGTTAE  1168


 Score = 34.3 bits (77),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 36/75 (48%), Gaps = 6/75 (8%)

Query  27    SILVRWLPPPAEQQNGDIRYYKLHYVESSRSDSEAATITI---SNPDARHFLVDQLKRWT  83
             SIL+ WL P  + +NG I +Y ++  E+ R   +A T  +    N     F    L    
Sbjct  1288  SILISWLTP--KNRNGIISHYTVYSREAGR-KGQAKTHMVRVDENGYPVTFESRSLAENQ  1344

Query  84    QYRVWVLAGTSVGDG  98
              Y  WV A TSVG+G
Sbjct  1345  MYEFWVSASTSVGEG  1359



Lambda      K        H
   0.314    0.135    0.408 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= CAQU000100-PA

Length=331
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LAR_DROME  unnamed protein product                                    455     1e-146
G5EDC5_CAEEL  unnamed protein product                                 180     2e-50 
LAR_CAEEL  unnamed protein product                                    179     3e-50 


>LAR_DROME unnamed protein product
Length=2029

 Score = 455 bits (1171),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 264/322 (82%), Gaps = 10/322 (3%)

Query  3    EVMLGSDLKITCVAVGSPMPLVKWRKGLATDLTPDDAIPIGKNVLTLENVQESANYTCVA  62
            EVMLGS+L ++C+AVGSPMP VKW KG + DLTP++ +PIG+NVL L N+QESANYTC+A
Sbjct  245  EVMLGSNLNLSCIAVGSPMPHVKWMKG-SEDLTPENEMPIGRNVLQLINIQESANYTCIA  303

Query  63   SSKLGMIEAHTFVKVQSLPRPPTNVRISDVTATSVRLAWSYDIGADDISYYVIQYKPKYA  122
            +S LG I++ + VKVQSLP  PT+V+IS+VTATSVRL WSY  G +D+ YYVIQYKPK A
Sbjct  304  ASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYK-GPEDLQYYVIQYKPKNA  362

Query  123  NQEYSEISGIITMYYTVRGLNPYTEYEYYVIAVNKIGRGPPSTPAYITTGETTDPAFGGA  182
            NQ +SEISGIITMYY VR L+PYTEYE+YVIAVN IGRGPPS PA  TTGET        
Sbjct  363  NQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGET--------  414

Query  183  KPGSAPRNVQVRPLSSSTMVIQWDEPETPNGQVVGYKVYYTTNPNLPMALWESQMVDNNQ  242
            K  SAPRNVQVR LSSSTMVI W+ PETPNGQV GYKVYYTTN N P A W SQMVDN++
Sbjct  415  KMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASWNSQMVDNSE  474

Query  243  LTTISDLTPHTIYTIRVQAHTSVGPGPLSAPVQVKTQQGVPSQPMNLRATQIGATSVVLE  302
            LTT+S+LTPH IYT+RVQA+TS+G GP+S PVQVK QQGVPSQP N RAT IG T+V L+
Sbjct  475  LTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQ  534

Query  303  WSRPIHSGDNLMSYELYWNDTF  324
            W++P HS +N++ YELYWNDT+
Sbjct  535  WTKPTHSSENIVHYELYWNDTY  556


 Score = 101 bits (252),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/239 (31%), Positives = 121/239 (51%), Gaps = 16/239 (7%)

Query  78   QSLPRPPTNVRISDVTATSVRLAWSYDI-GADDISYYVIQYKPKYANQ-EYSEISGIITM  135
            Q +P  P+N R +D+  T+V L W+     +++I +Y + +   YANQ  +  IS   + 
Sbjct  512  QGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIVHYELYWNDTYANQAHHKRISN--SE  569

Query  136  YYTVRGLNPYTEYEYYVIAVNKIGRGPPSTPAYITTGETTDPAFGGAKPGSAPRNVQVRP  195
             YT+ GL P T Y  ++ A ++ G G  + P  + T +          PG+ PRN+    
Sbjct  570  AYTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYV--------PGAPPRNITAIA  621

Query  196  LSSSTMVIQWDEP--ETPNGQVVGYKVYYTTNPNLPMALWESQMVDNNQLTTISDLTPHT  253
             SS+T+ + W  P  E  NG+++ YKV++            + M  N     + +L   T
Sbjct  622  TSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEA--TTMTLNMTSIVLDELKRWT  679

Query  254  IYTIRVQAHTSVGPGPLSAPVQVKTQQGVPSQPMNLRATQIGATSVVLEWSRPIHSGDN  312
             Y I V A TSVG GP S P+ ++TQ+ VP  P +++AT + +TS+ + W  P+    N
Sbjct  680  EYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWKPPLEKDRN  738


 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 115/249 (46%), Gaps = 21/249 (8%)

Query  83   PPTNVRISDVTATSVRLAW---SYDIGADDISYYVIQYKPKYANQEYSEISGIITMYYTV  139
            PP N+     ++T++ L+W     +     I YY + +       + +    +      +
Sbjct  613  PPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVL  672

Query  140  RGLNPYTEYEYYVIAVNKIGRGPPSTPAYITTGETTDPAFGGAKPGSAPRNVQVRPLSSS  199
              L  +TEY+ +V+A   +G GP S P  + T E          PG  P++V+  PL+S+
Sbjct  673  DELKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDV--------PGD-PQDVKATPLNST  723

Query  200  TMVIQWDEP--ETPNGQVVGYKVYYTTNPNLPMAL----WESQMVDNNQLTTISDLTPHT  253
            ++ + W  P  +  NG + GY ++     +         ++  +VD  +   ++ L P T
Sbjct  724  SIHVSWKPPLEKDRNGIIRGYHIHAQELRDEGKGFLNEPFKFDVVDTLEFN-VTGLQPDT  782

Query  254  IYTIRVQAHTSVGPGPLSAPVQVKTQQGVPSQP-MNLRATQIG-ATSVVLEWSRPIHSGD  311
             Y+I+V A T  G G  SA + VKT  GVP +P ++L+  +     S+ LEW RP  +  
Sbjct  783  KYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSLKIMEREPIVSIELEWERPAQTYG  842

Query  312  NLMSYELYW  320
             L  Y L W
Sbjct  843  ELRGYRLRW  851


 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 72/271 (27%), Positives = 115/271 (42%), Gaps = 27/271 (10%)

Query  49    LENVQESANYT--CVASSKLGMIEAHTFVKVQSLPR-----PPTNVRISDVTATSVRLAW  101
              +N++    Y      S+ +G+      VK+   P      PP+N+ I   T   + + W
Sbjct  873   FDNLERGVEYEFRVAGSNHIGI--GQETVKIFQTPEGTPGGPPSNITIRFQTPDVLCVTW  930

Query  102   ---SYDIGADDISYYVIQYKPKYANQEYSEISGIITMYYTV-RGLNPYTEYEYYVIAVNK  157
                + +     I+ Y +Q+  K  +   SE +  +T+   V   L   TEY + V A  K
Sbjct  931   DPPTREHRNGIITRYDVQFHKKIDHGLGSERN--MTLRKAVFTNLEENTEYIFRVRAYTK  988

Query  158   IGRGPPSTPAYITTGETTDPAFGGAKPGSAPRNVQVRPLSSSTMVIQWDEPETPNGQVVG  217
              G GP S    + T             G AP ++Q    S  T  I W EP T  G+++G
Sbjct  989   QGAGPFSDKLIVETERDM---------GRAPMSLQAEATSEQTAEIWW-EPVTSRGKLLG  1038

Query  218   YKVYYTTNPNLPMALWESQMVDNNQLTTISDLTPHTIYTIRVQAHTSVGPGPLSAPVQVK  277
             YK++YT      +  W+++ V   +   + +L     Y + + A    G G LS  V V+
Sbjct  1039  YKIFYTMTAVEDLDDWQTKTVGLTESADLVNLEKFAQYAVAIAARFKNGLGRLSEKVTVR  1098

Query  278   TQQGVPSQPMNLRATQIGATSVVLEWSRPIH  308
              +      P+NLRA  +   S+ L WS PI 
Sbjct  1099  IKP--EDVPLNLRAHDVSTHSMTLSWSPPIR  1127


 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 49/179 (27%), Positives = 81/179 (45%), Gaps = 15/179 (8%)

Query  147   EYEYYVIAVNKIGRGPPSTPAYITTGETTDPAFGGAKPGSAPRNVQVRPLSSSTMVIQWD  206
             EYE+ V   N IG G  +   + T   T         PG  P N+ +R  +   + + WD
Sbjct  881   EYEFRVAGSNHIGIGQETVKIFQTPEGT---------PGGPPSNITIRFQTPDVLCVTWD  931

Query  207   EP--ETPNGQVVGYKVYYTTNPNLPMALWESQMVDNNQLTTISDLTPHTIYTIRVQAHTS  264
              P  E  NG +  Y V +    +  +   E  M     + T  +L  +T Y  RV+A+T 
Sbjct  932   PPTREHRNGIITRYDVQFHKKIDHGLGS-ERNMTLRKAVFT--NLEENTEYIFRVRAYTK  988

Query  265   VGPGPLSAPVQVKTQQGVPSQPMNLRATQIGATSVVLEWSRPIHSGDNLMSYELYWNDT  323
              G GP S  + V+T++ +   PM+L+A      +  + W  P+ S   L+ Y++++  T
Sbjct  989   QGAGPFSDKLIVETERDMGRAPMSLQAEATSEQTAEI-WWEPVTSRGKLLGYKIFYTMT  1046


 Score = 55.5 bits (132),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 69/329 (21%), Positives = 139/329 (42%), Gaps = 37/329 (11%)

Query  4    VMLGSDLKITCVAVGSPMPLVKWRKGLATDLTPDDAIPIGKNVLTLENVQES--ANYTCV  61
            + +G  + +TC A+G+P P + W K        +    +    L +EN +E     Y CV
Sbjct  151  IEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKYECV  210

Query  62   ASSKLGMIEA---HTFVKVQSLP----RPPTNVRISDVTATSVRLAWSYDIGADDISYYV  114
            A + +G   +   + +VKV+ +P    RPP        T + V L  + ++    +   +
Sbjct  211  AENSMGTEHSKATNLYVKVRRVPPTFSRPPE-------TISEVMLGSNLNLSCIAVGSPM  263

Query  115  IQYKPKYANQEYSEISGIITMYYTVRGLNPYTEYEYYVIAVNKIGRGPPSTPAYITTGET  174
               K    +++ +  + +      ++ +N      Y  IA + +G+    +   + +  T
Sbjct  264  PHVKWMKGSEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPT  323

Query  175  TDPAFGGAKPGSAPRNVQVRPLSSSTMVIQW--DEPETPNGQVVGYKVYYTTNPNLPMAL  232
                        AP +VQ+  ++++++ ++W    PE     V+ YK       N   A 
Sbjct  324  ------------APTDVQISEVTATSVRLEWSYKGPEDLQYYVIQYK-----PKNANQAF  366

Query  233  WESQMVDNNQLTTISDLTPHTIYTIRVQAHTSVGPGPLSAPVQVKT-QQGVPSQPMNLRA  291
             E   +       +  L+P+T Y   V A  ++G GP SAP    T +  + S P N++ 
Sbjct  367  SEISGII-TMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQV  425

Query  292  TQIGATSVVLEWSRPIHSGDNLMSYELYW  320
              + ++++V+ W  P      +  Y++Y+
Sbjct  426  RTLSSSTMVITWEPPETPNGQVTGYKVYY  454


 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 73/333 (22%), Positives = 119/333 (36%), Gaps = 68/333 (20%)

Query  4    VMLGSDLKITCVAVGSPMPLVKWRK------GLATDLTPDDAIPIGKNVLTLENV---QE  54
            V +G      C A G P P + WRK      G  +  T  +  P G ++L +E V   ++
Sbjct  47   VRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQ-PGGISILRIEPVRAGRD  105

Query  55   SANYTCVASSKLG-MIEAHTFVKVQSLPRPPTNV---------RISDVTATSVRLAWSYD  104
             A Y CVA + +G  + A   + +    + P            R+ +V  T +    +  
Sbjct  106  DAPYECVAENGVGDAVSADATLTIYEGDKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIG  165

Query  105  IGADDISYYVIQYKPKYANQEYSEISGIITMYYTVRGLNPYTEYEYYVIAVNKIGRGPPS  164
                +I +   Q K   +N  YS   G +     +       + +Y  +A N +G     
Sbjct  166  NPTPNIYWIKNQTKVDMSNPRYSLKDGFL----QIENSREEDQGKYECVAENSMGTEHSK  221

Query  165  TPAYITTGETTDPAFGGAKPGSAPRNVQVRPLSSSTMVIQWDEPETPNGQVVGYKVYYTT  224
                        P F              RP            PET +  ++G      +
Sbjct  222  ATNLYVKVRRVPPTFS-------------RP------------PETISEVMLG------S  250

Query  225  NPNLPMALWESQMVDNNQLTTISDLTP--------HTIYTIRVQA---HTSVGPGPLSA-  272
            N NL      S M     +    DLTP        + +  I +Q    +T +    L   
Sbjct  251  NLNLSCIAVGSPMPHVKWMKGSEDLTPENEMPIGRNVLQLINIQESANYTCIAASTLGQI  310

Query  273  -PVQVKTQQGVPSQPMNLRATQIGATSVVLEWS  304
              V V   Q +P+ P +++ +++ ATSV LEWS
Sbjct  311  DSVSVVKVQSLPTAPTDVQISEVTATSVRLEWS  343


 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 18/123 (15%)

Query  49    LENVQESANYTCVASSKL--GMIEAHTFVKVQSLPRP-PTNVRISDVTATSVRLAWS---  102
             L N+++ A Y    +++   G+      V V+  P   P N+R  DV+  S+ L+WS   
Sbjct  1067  LVNLEKFAQYAVAIAARFKNGLGRLSEKVTVRIKPEDVPLNLRAHDVSTHSMTLSWSPPI  1126

Query  103   ------YDIGADDISYYVIQYKPKYANQEYSEISGIITMYY----TVRGLNPYTEYEYYV  152
                   Y I  D +  +V      ++  +      II  +Y    T+  L+P+T Y   V
Sbjct  1127  RLTPVNYKISFDAMKVFVDSQ--GFSQTQIVPKREIILKHYVKTHTINELSPFTTYNVNV  1184

Query  153   IAV  155
              A+
Sbjct  1185  SAI  1187


 Score = 29.3 bits (64),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 49/117 (42%), Gaps = 17/117 (15%)

Query  183   KPGSAPRNVQVRPLSSSTMVIQWDEP--ETPNGQVVGYKVYYTTNPNL--PMALWESQMV  238
             KP   P N++   +S+ +M + W  P   TP    V YK+ +             ++Q+V
Sbjct  1100  KPEDVPLNLRAHDVSTHSMTLSWSPPIRLTP----VNYKISFDAMKVFVDSQGFSQTQIV  1155

Query  239   DNNQLT--------TISDLTPHTIYTIRVQAHTSVGPGPLSAPVQVKTQQGVPSQPM  287
                ++         TI++L+P T Y + V A  S         + V TQ   P QPM
Sbjct  1156  PKREIILKHYVKTHTINELSPFTTYNVNVSAIPSDYSYRPPTKITVTTQMAAP-QPM  1211


>G5EDC5_CAEEL unnamed protein product
Length=2227

 Score = 180 bits (456),  Expect = 2e-50, Method: Compo