BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= NP_001310770.1 uncharacterized LOC107264838 [Cephus cinctus]

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR22B_DROME  unnamed protein product                                  64.7    3e-11
OR2_ANOGA  unnamed protein product                                    58.2    4e-09
OR85E_DROME  unnamed protein product                                  57.8    7e-09


>OR22B_DROME unnamed protein product
Length=397

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 85/374 (23%), Positives = 147/374 (39%), Gaps = 52/374 (14%)

Query  41   PLELSSSRTERIVTITTAVTCCLLMSFVLTIPCCIEMFSSQKDFKSRLEMLGPSSFCVMA  100
            P+ +S    +R  T +          F+ +I   + M+ S   FKS L M+G        
Sbjct  64   PISVSVEYIQRFKTFSAG-------EFLSSIQIGVNMYGSS--FKSYLTMMGYK------  108

Query  101  VIKFFFFVIRGKEIRFCIDSVVTDWRNVDVPEERNIMLRKAKSARFLTTVCALFMYYGGI  160
                     + +E +  +D +  D R V   EER I+ R      F    C +F +   I
Sbjct  109  ---------KRQEAKMSLDEL--DKRCV-CDEERTIVHRHVALGNF----CYIFYH---I  149

Query  161  FYTTYLPLTTAKALSTENVTIRILPYRCNFILFDPYAPLFFDIIYFLQCLSAAFMFTLTS  220
             YT++L    +  LS   +  RI  +R  F   DP    +   I  +     A    L +
Sbjct  150  AYTSFL---ISNFLSF--IMKRIHAWRMYFPYVDPEKQFYISSIAEVILRGWAVFMDLCT  204

Query  221  GVCSLAANFIIHACGQCQIIGL--LLENLVDGRGNTSTTLEKRIAVVIVRHLHLLRFVTR  278
             VC L +  I     +C I  L   L NL    G T     K +A  +  H  +L +V  
Sbjct  205  DVCPLISMVI----ARCHITLLKQRLRNLRSEPGRTEDEYLKELADCVRDHRLILDYVDA  260

Query  279  VEDVLNEVCLVEFL--GCTLNICLLGYYFITGLETADTARFVTFALLFISFTFNIFIFCY  336
            +  V +    V+FL  G  L + ++   F + L T      V   L     +   F FCY
Sbjct  261  LRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLSTG-----VAVVLFMSCVSMQTFPFCY  315

Query  337  IGQLLTNHCHQIGEISYTIDWYRIPGAQARFLILLIAIANRPVTITAGKIVQLSFPCFRD  396
            +  ++ + C ++ +  +  DW          L+  +    +P+ +TAG +  +S     +
Sbjct  316  LCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLN  375

Query  397  VLKAALAYLNMLRK  410
            ++K A   + ++++
Sbjct  376  MVKLAFTVVTIVKQ  389


>OR2_ANOGA unnamed protein product
Length=378

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 76/356 (21%), Positives = 149/356 (42%), Gaps = 30/356 (8%)

Query  68   VLTIPCCIEMFSSQKDFKSRLEMLGPSSFCVM---AVIKFFFFVIRGKEIRFCIDSVVTD  124
            VL +   ++++SS  D     E++    F V+    V++  F VI  ++     + V  +
Sbjct  39   VLNVFQFLKLYSSWGDMS---ELIINGYFTVLYFNLVLRTSFLVINRRKFETFFEGVAAE  95

Query  125  WRNVDVPEE-RNIMLRKAKSARFLTTVCALFMYYGGIFYTTYLPLTTAKALSTENVTIRI  183
            +  ++  ++ R ++ R  +  R L+        +    + TY PL          V  R 
Sbjct  96   YALLEKNDDIRPVLERYTRRGRMLSISNLWLGAFISACFVTY-PLF---------VPGRG  145

Query  184  LPYRCNFILFDPYAPLFFDIIYFLQC---LSAAFM---FTLTSGVCSLAANFIIHACGQC  237
            LPY       D  A   + +++ LQ      A  M   FT     C+L A  ++      
Sbjct  146  LPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACCMYIPFTSFYATCTLFA--LVQIAALK  203

Query  238  QIIGLLLEN--LVDGRGNTSTTLEKRIAVVIVRHLHLLRFVTRVEDVLNEVCLVEFLGCT  295
            Q +G L  +   +   G+++ TL   +   +  H  ++++V  +  ++  +CL+EFL   
Sbjct  204  QRLGRLGRHSGTMASTGHSAGTLFAELKECLKYHKQIIQYVHDLNSLVTHLCLLEFLSFG  263

Query  296  LNICLLGYYFITGLETADTARFVTFALLFISFTFNIFIFCYIGQLLTNHCHQIGEISYTI  355
            + +C L +      + A      ++  + +S    +F F +    +      IG+  Y  
Sbjct  264  MMLCALLFLLSISNQLAQMIMIGSYIFMILS---QMFAFYWHANEVLEQSLGIGDAIYNG  320

Query  356  DWYRIPGAQARFLILLIAIANRPVTITAGKIVQLSFPCFRDVLKAALAYLNMLRKV  411
             W        + LIL+IA A RP+ I  G +  ++   F+ +L  + +Y  +LR+V
Sbjct  321  AWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYFTLLRRV  376


>OR85E_DROME unnamed protein product
Length=467

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 74/146 (51%), Gaps = 4/146 (3%)

Query  269  HLHLLRFVTRVEDVLNEVCLVEFLGCTLNICLLGYYFITGLETADTARFVTFALLFISFT  328
            H  +L     +E++ +  CLV+ L  T  +CLL +  ++G  T +  R V   L ++  T
Sbjct  318  HRFILHCSQELENLFSPYCLVKSLQITFQLCLLVFVGVSG--TREVLRIVN-QLQYLGLT  374

Query  329  -FNIFIFCYIGQLLTNHCHQIGEISYTIDWYRIPGAQARFLILLIAIANRPVTITAGKIV  387
             F + +F Y G+LL+ H  + G+  +   W++      + +++ +  + R V +TAGK  
Sbjct  375  IFELLMFTYCGELLSRHSIRSGDAFWRGAWWKHAHFIRQDILIFLVNSRRAVHVTAGKFY  434

Query  388  QLSFPCFRDVLKAALAYLNMLRKVTT  413
             +     R V+  A ++L +L+K+  
Sbjct  435  VMDVNRLRSVITQAFSFLTLLQKLAA  460



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310771.1 odorant receptor 67c-like [Cephus cinctus]

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR2_ANOGA  unnamed protein product                                    64.3    4e-11
OR45B_DROME  unnamed protein product                                  56.2    2e-08
OR22B_DROME  unnamed protein product                                  53.9    1e-07


>OR2_ANOGA unnamed protein product
Length=378

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 62/320 (19%), Positives = 133/320 (42%), Gaps = 21/320 (7%)

Query  99   VVLKYFFLITRGDTLKMCIDTILGDWSNVQAKEE-RKIMFRNAKIARLFTIICVSFMYCG  157
            +VL+  FL+      +   + +  +++ ++  ++ R ++ R  +  R+ +I   S ++ G
Sbjct  71   LVLRTSFLVINRRKFETFFEGVAAEYALLEKNDDIRPVLERYTRRGRMLSI---SNLWLG  127

Query  158  GIFYSIFLPLITAKSLTNGNNLTIRILPYRCNFIIFDPYRRPIFDIVYVVHCF------C  211
                + F   +T      G     R LPY       D    P + +V+V+  +      C
Sbjct  128  AFISACF---VTYPLFVPG-----RGLPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACC  179

Query  212  SVIMYSITTGICSLAAKFVMHACGQCEIVMSLLENLIDDDKQCSDIVESKLATIIVQHLH  271
              I ++     C+L A   + A  Q    +      +      +  + ++L   +  H  
Sbjct  180  MYIPFTSFYATCTLFALVQIAALKQRLGRLGRHSGTMASTGHSAGTLFAELKECLKYHKQ  239

Query  272  VIRFVTRVEDLLNEVCLVEFLGCTMNMCLVGYYIITGFESADTVRFITFTLLFISFTFNI  331
            +I++V  +  L+  +CL+EFL   M +C + + +    + A  +   ++  + +S    +
Sbjct  240  IIQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLLSISNQLAQMIMIGSYIFMILS---QM  296

Query  332  FVFCYIGQILTNHCHQIGEASYMIDWYRFPGTQARFLILLIGVANRPIRLTAGKMVQFSF  391
            F F +    +      IG+A Y   W  F     + LIL+I  A RP+ +  G +   + 
Sbjct  297  FAFYWHANEVLEQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTL  356

Query  392  PCFCNVIKAAMAYLNIIRTV  411
              F  ++  + +Y  ++R V
Sbjct  357  EMFQKLLNVSYSYFTLLRRV  376


>OR45B_DROME unnamed protein product
Length=396

 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/236 (23%), Positives = 106/236 (45%), Gaps = 18/236 (8%)

Query  184  LPYRCNFIIFDPYRRPIFDIVYVVHCFC---SVIMYSITTGIC---SLAAKFVMHACGQC  237
            +P+R  F  F  +R P F + Y+   +    +V  ++ T G     +L   F++ A    
Sbjct  170  MPFRMLFHDF-AHRMPWFPVFYLYSTWSGQVTVYAFAGTDGFFFGFTLYMAFLLQALRYD  228

Query  238  EIVMSLLENLIDDDKQCSDIVESKLATIIVQHLHVIRFVTRVEDLLNEVCLVEFLGCTM-  296
              +   L+ + D   + S I   +LA I+ +H  + + V     ++     V F+  ++ 
Sbjct  229  --IQDALKPIRDPSLRESKICCQRLADIVDRHNEIEKIVKEFSGIMAAPTFVHFVSASLV  286

Query  297  -NMCLVGYYIITGFESADTVRFITFTLLFISFTFNIFVFCYIGQILTNHCHQIGEASYMI  355
                ++   + +G+   + +R++ +T    S    IF++CY G  ++     +GEA+Y  
Sbjct  287  IATSVIDILLYSGY---NIIRYVVYTFTVSS---AIFLYCYGGTEMSTESLSLGEAAYSS  340

Query  356  DWYRFPGTQARFLILLIGVANRPIRLTAGKMVQFSFPCFCNVIKAAMAYLNIIRTV  411
             WY +     R + L+I  A RPI +        S P F +VIK   + + + +T+
Sbjct  341  AWYTWDRETRRRVFLIILRAQRPITVRVPFFAP-SLPVFTSVIKFTGSIVALAKTI  395


>OR22B_DROME unnamed protein product
Length=397

 Score = 53.9 bits (128),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/238 (21%), Positives = 101/238 (42%), Gaps = 25/238 (11%)

Query  182  RILPYRCNFIIFDPYRRPIFDIVYVVHCFCSVIM--YSITTGICSLAAKFVMHACGQCEI  239
            RI  +R  F   DP ++      + +     VI+  +++   +C+     +     +C I
Sbjct  166  RIHAWRMYFPYVDPEKQ------FYISSIAEVILRGWAVFMDLCTDVCPLISMVIARCHI  219

Query  240  VM--SLLENLIDDDKQCSDIVESKLATIIVQHLHVIRFVTRVEDLLNEVCLVEFLGCTMN  297
             +    L NL  +  +  D    +LA  +  H  ++ +V  +  + +    V+FL     
Sbjct  220  TLLKQRLRNLRSEPGRTEDEYLKELADCVRDHRLILDYVDALRSVFSGTIFVQFL-----  274

Query  298  MCLVGYYIITGFESADTVRFITFT-----LLFIS-FTFNIFVFCYIGQILTNHCHQIGEA  351
              L+G  I+ G    + + F T +     +LF+S  +   F FCY+  ++ + C ++ ++
Sbjct  275  --LIG--IVLGLSMINIMFFSTLSTGVAVVLFMSCVSMQTFPFCYLCNMIMDDCQEMADS  330

Query  352  SYMIDWYRFPGTQARFLILLIGVANRPIRLTAGKMVQFSFPCFCNVIKAAMAYLNIIR  409
             +  DW          L+  +    +PI LTAG +   S     N++K A   + I++
Sbjct  331  LFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGVFPISMQTNLNMVKLAFTVVTIVK  388



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310772.1 odorant receptor 13a-like [Cephus cinctus]

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR49B_DROME  unnamed protein product                                  103     1e-24
OR47A_DROME  unnamed protein product                                  86.3    2e-18
OR67C_DROME  unnamed protein product                                  85.5    5e-18


>OR49B_DROME unnamed protein product
Length=375

 Score = 103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 123/238 (52%), Gaps = 11/238 (5%)

Query  157  YILHSEEKILPFRGYF-FLNHTLSPNYEMIYIFEIIAGSFGGSMIAGVTSFNLVVIMHGA  215
            Y L S E++LPF      LN   SP YEM YIF+++    G  M    TS  + +IM G 
Sbjct  137  YPLSSSERVLPFGSKIPGLNEYESPYYEMWYIFQMLITPMGCCMYIPYTSLIVGLIMFGI  196

Query  216  ARFSLLQKKLESL-------NRNDPDVNKLMVKCIKLHQDAIKFADALEDIINVVALGQF  268
             R   LQ +L  +       +R+  ++ + ++ CI+  Q  I++ D + ++  ++ L + 
Sbjct  197  VRCKALQHRLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMMFLFEL  256

Query  269  VTSTGLVCFAGFQLTSMLEDRGRLMKYSTFLNSAILELFIFSFSGNELIVESEAVGDAAY  328
            +  + L+C   F L  ++    +L+    ++N  + ++    +  NEL  ++ AV  AAY
Sbjct  257  MAFSALLCALLFMLI-IVSGTSQLIIVCMYINMILAQILALYWYANELREQNLAVATAAY  315

Query  329  RSDWAS--SSFTQSLRILMMRATLPSRITAAKFYSMSLESFSAVLSTSFSYFTVLKAV  384
             ++W +      +++  +MMRA  P+ I       ++LE F  +L+T++++FTVLK V
Sbjct  316  ETEWFTFDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTTYTFFTVLKRV  373


>OR47A_DROME unnamed protein product
Length=385

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 86/349 (25%), Positives = 160/349 (46%), Gaps = 32/349 (9%)

Query  60   VTADVIHNWGNMDTATECSLIASAFVLCFLRLMVYTYHQKDMRYVVETMR---SDWADAS  116
            + A V+HNW N+    +  +     +L   +  +  Y ++D + +++  R   S+ A+  
Sbjct  46   ILAAVLHNWKNVLLLADAMVALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQG  105

Query  117  YEEKQVLKEKCDFAFRLAKYFIATVAITIAFFMTVPM----LETYILHSEEKILPFRGYF  172
             E  ++L        R+   F     +  A    +P+    L  ++    E  LPF   F
Sbjct  106  EEYAEILNAANKQDQRMCTLFRTCFLLAWALNSVLPLVRMGLSYWLAGHAEPELPFPCLF  165

Query  173  FLNHTLSPNYEMIYIFEIIAGSFGGSMIAGVT------SF--NLVVIMHGAARFSLLQKK  224
              N  +  NY + +I+   A +  G ++  V+      SF  NL       A++ +++ K
Sbjct  166  PWNIHIIRNYVLSFIWSAFAST--GVVLPAVSLDTIFCSFTSNLCAFFK-IAQYKVVRFK  222

Query  225  LESLNRNDPDVNKLMVKCIKLHQDAIKFADALEDIINVVALGQFVTSTGLVCFAGFQLTS  284
              SL  +   +NK+      L+Q ++   + L      +   QF  S+  +C  G+ L S
Sbjct  223  GGSLKESQATLNKVFA----LYQTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGY-LFS  277

Query  285  MLEDRGRLMKYSTFLNSAILELFIFSFSGNELIVESEAVGDAAYRSDW--------ASSS  336
            +   +   + Y++F+ + I++ +I+ + G  L  ES +   A Y S W        AS+S
Sbjct  278  ITFAQTEGVYYASFIATIIIQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTS  337

Query  337  FTQSLRILMMRATLPSRITAAKFYSMSLESFSAVLSTSFSYFTVLKAVS  385
              +SL I MMRA    RIT   F+  ++E+FS+++ T+ SY T+L++ S
Sbjct  338  ICRSLLISMMRAHRGFRITG-YFFEANMEAFSSIVRTAMSYITMLRSFS  385


>OR67C_DROME unnamed protein product
Length=404

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 104/197 (53%), Gaps = 14/197 (7%)

Query  197  GSMIAGVTSFN-----LVVIMHGAARFSLLQKKLE--SLNRNDPDVN-KLMVKCIKLHQD  248
            G+ +AG+         +VVI      F+ +  +LE    N N+   N + ++  I+ H  
Sbjct  205  GAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDK  264

Query  249  AIKFADALEDIINVVALGQFVTSTGLVCFAGFQLT-SMLEDRGRLMKYSTFLNSAILELF  307
             +K  + + D+ +   L  F+ ++  +CF  FQ+T S +E    ++ Y  FL ++++++F
Sbjct  265  CLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVE---VIIIYCIFLMTSMVQVF  321

Query  308  IFSFSGNELIVESEAVGDAAYRSDW--ASSSFTQSLRILMMRATLPSRITAAKFYSMSLE  365
            +  + G+ LI  S  VGDAAY   W   S S+   L++L+MR+  P+ I    F  +SL 
Sbjct  322  MVCYYGDTLIAASLKVGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLV  381

Query  366  SFSAVLSTSFSYFTVLK  382
            ++  V+S S+ +F +L+
Sbjct  382  TYMKVISMSYQFFALLR  398



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310773.1 odorant receptor 67c-like [Cephus cinctus]

Length=399
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR67C_DROME  unnamed protein product                                  52.4    3e-07
OR67A_DROME  unnamed protein product                                  51.6    6e-07
OR85B_DROME  unnamed protein product                                  48.5    5e-06


>OR67C_DROME unnamed protein product
Length=404

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/222 (20%), Positives = 99/222 (45%), Gaps = 32/222 (14%)

Query  169  STGLFIAGILFETLGGFYTILKKASIDIYLIHVITLLTAQYKYLSLELINIINGKNENIN  228
            + G ++AGI F               D+ L+ VIT +   + Y+S+ L            
Sbjct  203  AHGAYLAGIAF------------LCADLLLVVVITQICMHFNYISMRL------------  238

Query  229  KSDLESLDNERNEKIEKTVQIELKKWIRHREVVMEIGKILKNLLVLNVVYVYLNCIFRFC  288
              D     NE  E IE  + I     IR+ +  +++ + + +L   +++  +L    + C
Sbjct  239  -EDHPCNSNEDKENIEFLIGI-----IRYHDKCLKLCEHVNDLYSFSLLLNFLMASMQIC  292

Query  289  FLGFLLISSSGDYFIQALVCSYTVVCLMQVYVLCFCAQNLLDSSTAMTHDAFYEKWYAYG  348
            F+ F +  S+ +  I  + C + +  ++QV+++C+    L+ +S  +   A+ +KW+   
Sbjct  293  FIAFQVTESTVEVII--IYCIFLMTSMVQVFMVCYYGDTLIAASLKVGDAAYNQKWFQCS  350

Query  349  PSTKRIFSMILISNKMECRLSMCGVVDLTLPTFMAILKNSYS  390
             S   +  ++++ ++    +       ++L T+M ++  SY 
Sbjct  351  KSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQ  392


>OR67A_DROME unnamed protein product
Length=407

 Score = 51.6 bits (122),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 56/234 (24%), Positives = 104/234 (44%), Gaps = 31/234 (13%)

Query  164  PGEPYSTGLFIAGILFETLGGFYTILKKASIDIYLIHVITLLTAQYKYLS-------LEL  216
            P E   + LF      ++  G+       + D+ +  V+  +   Y+ L+       ++ 
Sbjct  186  PWEFRDSWLFYPSYFHQSSAGYTATCGSIAGDLMIFAVVLQVIMHYERLAKVLREFKIQA  245

Query  217  INIINGKNENINKSDLESLDNERNEKIEKTVQIELKKWIRHREVVMEIGKILKNLLVLNV  276
             N  NG  E+I K  L+SL       +   + I     +R  +++ E+  I    L+LN 
Sbjct  246  HNAPNGAKEDIRK--LQSL-------VANHIDI-----LRLTDLMNEVFGIP---LLLN-  287

Query  277  VYVYLNCIFRFCFLGF-LLISSSGDYFIQALVCSYTVVCLMQVYVLCFCAQNLLDSSTAM  335
               ++      C +G  L I+ S +YF + ++  + +  L++VY+LC  +Q L+D+S  +
Sbjct  288  ---FIASALLVCLVGVQLTIALSPEYFCKQML--FLISVLLEVYLLCSFSQRLIDASENV  342

Query  336  THDAFYEKWYAYGPSTKRIFSMILISNKMECRLSMCGVVDLTLPTFMAILKNSY  389
             H A+   W       K+I   I + ++    L    V+DL++PT    L  SY
Sbjct  343  GHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMSY  396


>OR85B_DROME unnamed protein product
Length=390

 Score = 48.5 bits (114),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/229 (20%), Positives = 94/229 (41%), Gaps = 22/229 (10%)

Query  162  YIPGEPYSTGLFIAGILFETLGGFYTILKKASIDIYLIHVITLLTAQYKYLSLELINIIN  221
            YIP +      +   +  +   G+ +   + S D+ L  V T L   + +LS        
Sbjct  171  YIPWKWQDNWSYYPLLFSQNFAGYTSAAGQISTDVLLCAVATQLVMHFDFLS--------  222

Query  222  GKNENINKSDLESLDNERNEKIEKTVQIELKKWIRHREVVMEIGKILKNLLVLNVVYVYL  281
                  N  +   L  +  +     V I     +R+ E ++ +   + ++  + ++  ++
Sbjct  223  ------NSMERHELSGDWKKDSRFLVDI-----VRYHERILRLSDAVNDIFGIPLLLNFM  271

Query  282  NCIFRFCFLGF-LLISSSGDYFIQALVCSYTVVCLMQVYVLCFCAQNLLDSSTAMTHDAF  340
               F  CF+GF + +    D  ++  +  + V  + QVY++C   Q + D+S   +   +
Sbjct  272  VSSFVICFVGFQMTVGVPPDIVVKLFL--FLVSSMSQVYLICHYGQLVADASYGFSVATY  329

Query  341  YEKWYAYGPSTKRIFSMILISNKMECRLSMCGVVDLTLPTFMAILKNSY  389
             +KWY      KR   +I+  ++    L     +D+T  T   +L+ SY
Sbjct  330  NQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISY  378



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310774.1 odorant receptor coreceptor [Cephus cinctus]

Length=480
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ORCO_OOCBI  unnamed protein product                                   756     0.0  
B0FAQ4_APOBA  unnamed protein product                                 748     0.0  
ORCO_HARSA  unnamed protein product                                   736     0.0  


>ORCO_OOCBI unnamed protein product
Length=478

 Score = 756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/480 (78%), Positives = 417/480 (87%), Gaps = 2/480 (0%)

Query  1    MMKFKQQGLVADLMPNIRHMQFSGHFMFNYYNDTGGSTKLFHTIYCSIHLFLILLQFGLC  60
            MMK KQQGLVADL+PNIR M+  GHF+FNYYND   S+K  H +YC ++LF++LLQFGLC
Sbjct  1    MMKMKQQGLVADLLPNIRVMKTFGHFVFNYYND--NSSKYLHKVYCCVNLFMLLLQFGLC  58

Query  61   CVNLTLERADVDDLTANTITVLFFAHSIIKLAYFAVRSKLFYRTLGIWNNPNSHPLFAES  120
             VNL +E ADVDDLTANTIT+LFF HSI+K+ YFA+RSK FYRT  IWNNPNSHPLFAES
Sbjct  59   AVNLIVESADVDDLTANTITLLFFTHSIVKICYFAIRSKYFYRTWAIWNNPNSHPLFAES  118

Query  121  NARYHAIALTKMRRLLAAVGAATILTVCAWTGITFVGDSVKKVTDPVTNETMTVEIPRLM  180
            NARYHAIAL KMR LL  VG  T+L   AWT +TF    ++K+ DPVTNET  +E+P+L+
Sbjct  119  NARYHAIALKKMRLLLFLVGGTTMLAAVAWTVLTFFEHPIRKIVDPVTNETEIIELPQLL  178

Query  181  LRSWYPYDASHGMAHVLTLIYQFYFLLITTMDANSLDVLFCSWLLFACEQLQHLKQIMKP  240
            +RS+YP+DA  G+ HVL L+YQFY++L   +DANSLDVLFCSWLLFACEQLQHLKQIMKP
Sbjct  179  IRSFYPFDAGKGITHVLVLVYQFYWVLFMLIDANSLDVLFCSWLLFACEQLQHLKQIMKP  238

Query  241  LMELSATLDTVVPHTNELFKAGSTDHLRDTQGTQPMAPPPNENMLDMDLRGIYSNRQDFT  300
            LMELSATLDTVVP+++ELFKAGS DHLRD     P  PP ++NMLD+DLR IYSNRQDFT
Sbjct  239  LMELSATLDTVVPNSSELFKAGSADHLRDGDNPPPPPPPQSDNMLDLDLRNIYSNRQDFT  298

Query  301  ATFRTAAGMNFNGGVGPNGLTKKQEMLVRSAIKYWVERHKHIVRLVTAIGDAYGVALLFH  360
            ATFR  AGM FNGGVGPNGLTKKQE LVRSAIKYWVERHKHIVRLVTA+GDAYG ALL H
Sbjct  299  ATFRPTAGMTFNGGVGPNGLTKKQEALVRSAIKYWVERHKHIVRLVTAVGDAYGFALLLH  358

Query  361  MLITTVSLTLLAYQATKVNTVDVYAATVIGYVLYTLGQVFLFCIFGNRLIEESSSVMEAA  420
            ML TT++LTLLAYQATKVN ++VYAA+ IGY+LYT GQVFLFCIFGNRLIEES+SVMEAA
Sbjct  359  MLTTTITLTLLAYQATKVNGINVYAASTIGYILYTFGQVFLFCIFGNRLIEESTSVMEAA  418

Query  421  YSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK  480
            YSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK
Sbjct  419  YSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK  478


>B0FAQ4_APOBA unnamed protein product
Length=474

 Score = 748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/479 (78%), Positives = 417/479 (87%), Gaps = 5/479 (1%)

Query  2    MKFKQQGLVADLMPNIRHMQFSGHFMFNYYNDTGGSTKLFHTIYCSIHLFLILLQFGLCC  61
            MKFK QGLVADL+PNIR MQ  GHFMFNYY++     K  H IYC + L L+LLQ+G+  
Sbjct  1    MKFKHQGLVADLLPNIRVMQGVGHFMFNYYSE---GKKFPHRIYCIVTLLLLLLQYGMMA  57

Query  62   VNLTLERADVDDLTANTITVLFFAHSIIKLAYFAVRSKLFYRTLGIWNNPNSHPLFAESN  121
            VNL +E  DVDDLTANTIT+LFF H I+K+ YF VRSK+FY+TL IWNNPNSHPLFAESN
Sbjct  58   VNLMMESDDVDDLTANTITMLFFLHPIVKMIYFPVRSKIFYKTLAIWNNPNSHPLFAESN  117

Query  122  ARYHAIALTKMRRLLAAVGAATILTVCAWTGITFVGDSVKKVTDPVTNETMTVEIPRLML  181
            AR+HA+A+TKMRRLL  V  ATI +V +WTGITF+ DSVK++TDP TNET  + IPRLM+
Sbjct  118  ARFHALAITKMRRLLFCVAGATIFSVISWTGITFIEDSVKRITDPETNETTIIPIPRLMI  177

Query  182  RSWYPYDASHGMAHVLTLIYQFYFLLITTMDANSLDVLFCSWLLFACEQLQHLKQIMKPL  241
            R++YP++A  G  HV  LIYQFY+L+I+   +NSLDVLFCSWLLFACEQLQHLK IMKPL
Sbjct  178  RTFYPFNAMSGAGHVFALIYQFYYLVISMAVSNSLDVLFCSWLLFACEQLQHLKAIMKPL  237

Query  242  MELSATLDTVVPHTNELFKAGSTDHLRDTQGTQPMAPPPNENMLDMDLRGIYSNRQDFTA  301
            MELSATLDTVVP++ ELFKAGS DHLR++QG QP      +N+LD+DLRGIYSNRQDFTA
Sbjct  238  MELSATLDTVVPNSGELFKAGSADHLRESQGVQPSGN--GDNVLDVDLRGIYSNRQDFTA  295

Query  302  TFRTAAGMNFNGGVGPNGLTKKQEMLVRSAIKYWVERHKHIVRLVTAIGDAYGVALLFHM  361
            TFR  AG  FNGGVGPNGLTKKQEMLVRSAIKYWVERHKH+VRLVTA+GDAYGVALL HM
Sbjct  296  TFRPTAGTTFNGGVGPNGLTKKQEMLVRSAIKYWVERHKHVVRLVTAVGDAYGVALLLHM  355

Query  362  LITTVSLTLLAYQATKVNTVDVYAATVIGYVLYTLGQVFLFCIFGNRLIEESSSVMEAAY  421
            L TT++LTLLAYQATKVN V+VYAATVIGY+LYTLGQVFLFCIFGNRLIEESSSVMEAAY
Sbjct  356  LTTTITLTLLAYQATKVNGVNVYAATVIGYLLYTLGQVFLFCIFGNRLIEESSSVMEAAY  415

Query  422  SCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK  480
            SCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK
Sbjct  416  SCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK  474


>ORCO_HARSA unnamed protein product
Length=479

 Score = 736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/481 (78%), Positives = 422/481 (88%), Gaps = 3/481 (1%)

Query  1    MMKFKQQGLVADLMPNIRHMQFSGHFMFNYYNDTGGSTKLFHTIYCSIHLFLILLQFGLC  60
            MMK KQQGLVADL+PNIR M+F GHF+FNYY+D   S+K  H I+C ++LFL+LLQF LC
Sbjct  1    MMKMKQQGLVADLLPNIRVMKFFGHFVFNYYDD--NSSKYLHKIFCCVNLFLLLLQFALC  58

Query  61   CVNLTLERADVDDLTANTITVLFFAHSIIKLAYFAVRSKLFYRTLGIWNNPNSHPLFAES  120
             VNL +E ADVDDLTANTIT+LFF HSI+K+ YFAVRSK FYRT  IWNNPNSHPLFAES
Sbjct  59   AVNLIIESADVDDLTANTITLLFFTHSIVKIIYFAVRSKYFYRTWAIWNNPNSHPLFAES  118

Query  121  NARYHAIALTKMRRLLAAVGAATILTVCAWTGITFVGDSVKKVTDPVTNETMTVEIPRLM  180
            NARYHAIAL KMR LL  VGA T+L+  AWT +TF    ++K+ DPVTNET  +E+P+L+
Sbjct  119  NARYHAIALKKMRLLLFLVGATTVLSAIAWTVLTFFEHPIRKLVDPVTNETTIIELPQLL  178

Query  181  LRSWYPYDASHGMAHVLTLIYQFYFLLITTMDANSLDVLFCSWLLFACEQLQHLKQIMKP  240
            LRS+YP+DAS G+ HV+ LIYQFY++L   +DANSLDVLFCSWLLFACEQLQHLKQIMKP
Sbjct  179  LRSYYPFDASKGIMHVIVLIYQFYWVLFMLIDANSLDVLFCSWLLFACEQLQHLKQIMKP  238

Query  241  LMELSATLDTVVPHTNELFKAGSTDHLRDTQG-TQPMAPPPNENMLDMDLRGIYSNRQDF  299
            LMELSATLDTVVP+++ELFKAGS +HLR+++    P  PP  ++MLD+DLR IYSNRQDF
Sbjct  239  LMELSATLDTVVPNSSELFKAGSAEHLRESENQPPPPVPPQGDSMLDLDLRNIYSNRQDF  298

Query  300  TATFRTAAGMNFNGGVGPNGLTKKQEMLVRSAIKYWVERHKHIVRLVTAIGDAYGVALLF  359
            TATFR  AGM FNGGVGPNGLTKKQEMLVRSAIKYWVERHKHIVRLVTA+GDAYG ALL 
Sbjct  299  TATFRPTAGMTFNGGVGPNGLTKKQEMLVRSAIKYWVERHKHIVRLVTAVGDAYGFALLL  358

Query  360  HMLITTVSLTLLAYQATKVNTVDVYAATVIGYVLYTLGQVFLFCIFGNRLIEESSSVMEA  419
            HML TT++LTLLAYQATKVN V+VYAA+ IGY++YT GQVFLFCIFGNRLIEES+SVMEA
Sbjct  359  HMLTTTITLTLLAYQATKVNGVNVYAASTIGYIIYTFGQVFLFCIFGNRLIEESTSVMEA  418

Query  420  AYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQL  479
            AYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQL
Sbjct  419  AYSCHWYDGSEEAKTFVQIVCQQCQKAMSISGAKFFTVSLDLFASVLGAVVTYFMVLVQL  478

Query  480  K  480
            K
Sbjct  479  K  479



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310775.1 odorant receptor 13a-like [Cephus cinctus]

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR47A_DROME  unnamed protein product                                  70.9    3e-13
ORCO_AEDAE  unnamed protein product                                   70.1    6e-13
ORCO_DROME  unnamed protein product                                   68.9    1e-12


>OR47A_DROME unnamed protein product
Length=385

 Score = 70.9 bits (172),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 147/327 (45%), Gaps = 32/327 (10%)

Query  73   AMVILKTAMFRRNMQLLLPLLSEVRADKF----SVEEEPG--IAWLYNIMGKLYTRLSVV  126
            A++I    +F+ +M L L    +   DKF    S E E G   A + N   K   R+  +
Sbjct  66   ALLITILGLFKFSMILYLRRDFKRLIDKFRLLMSNEAEQGEEYAEILNAANKQDQRMCTL  125

Query  127  L--IFIVTTMLYAV------PLSQWIVAKSNNLTSTYELPYQMYFGFEINDLRSHVLACL  178
                F++   L +V       LS W+   +       ELP+   F + I+ +R++VL+ +
Sbjct  126  FRTCFLLAWALNSVLPLVRMGLSYWLAGHAEP-----ELPFPCLFPWNIHIIRNYVLSFI  180

Query  179  SLLPMSTVLTIGCTGSDTLLVVLIFYLCRQFVLLSVRIRNVETDPLIHP-TKMKQLIERH  237
                 ST + +     DT+       LC  F +   ++   +   L      + ++   +
Sbjct  181  WSAFASTGVVLPAVSLDTIFCSFTSNLCAFFKIAQYKVVRFKGGSLKESQATLNKVFALY  240

Query  238  ANLIGMATALNKTYSSLLLVQTMGLSFVICIVAFEL-LTMAEVGEETNTLSFIIYSLAVV  296
               + M   LN+ Y  ++  Q    S  +C++ +   +T A+  E     SFI     ++
Sbjct  241  QTSLDMCNDLNQCYQPIICAQFFISSLQLCMLGYLFSITFAQT-EGVYYASFIA---TII  296

Query  297  TLLFSYCFLGECLIHESSSIHNACYFSNWYQ------LPPDLARPIIIPIMRSRKPLHLT  350
               + YC+ GE L  ES+S   A Y S W++          + R ++I +MR+ +   +T
Sbjct  297  IQAYIYCYCGENLKTESASFEWAIYDSPWHESLGAGGASTSICRSLLISMMRAHRGFRIT  356

Query  351  AGQFYVFSLETFTSIMKGSMAYLSVLR  377
             G F+  ++E F+SI++ +M+Y+++LR
Sbjct  357  -GYFFEANMEAFSSIVRTAMSYITMLR  382


>ORCO_AEDAE unnamed protein product
Length=478

 Score = 70.1 bits (170),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 83/154 (54%), Gaps = 4/154 (3%)

Query  228  TKMKQLIERHANLIGMATALNKTYSSLLLVQTMGLSFVICIVAFELLTMAEVGEETNT-L  286
            + +K  +ERH +++ + +A+ +TY + LL+  +  +  + ++A++   +  +     T +
Sbjct  328  SAIKYWVERHKHVVRLVSAIGETYGAALLLHMLTSTIKLTLLAYQATKIDALNVYGLTVI  387

Query  287  SFIIYSLAVVTLLFSYCFLGECLIHESSSIHNACYFSNWYQLPPDLARPIIIPIMRSRKP  346
             +++Y+LA V   F +C  G  LI ESSS+  A Y  +WY    +    + I   + +K 
Sbjct  388  GYLVYALAQV---FLFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKA  444

Query  347  LHLTAGQFYVFSLETFTSIMKGSMAYLSVLREIK  380
            + ++  +F+  SL+ F S++   + Y  VL ++K
Sbjct  445  MTISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK  478


>ORCO_DROME unnamed protein product
Length=486

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/154 (26%), Positives = 80/154 (52%), Gaps = 4/154 (3%)

Query  228  TKMKQLIERHANLIGMATALNKTYSSLLLVQTMGLSFVICIVAFELLTMAEVGEETNTL-  286
            + +K  +ERH +++ +  A+  TY + LL+  +  +  + ++A++   +  V     T+ 
Sbjct  336  SAIKYWVERHKHVVRLVAAIGDTYGAALLLHMLTSTIKLTLLAYQATKINGVNVYAFTVV  395

Query  287  SFIIYSLAVVTLLFSYCFLGECLIHESSSIHNACYFSNWYQLPPDLARPIIIPIMRSRKP  346
             ++ Y+LA V   F +C  G  LI ESSS+  A Y  +WY    +    + I   + +K 
Sbjct  396  GYLGYALAQV---FHFCIFGNRLIEESSSVMEAAYSCHWYDGSEEAKTFVQIVCQQCQKA  452

Query  347  LHLTAGQFYVFSLETFTSIMKGSMAYLSVLREIK  380
            + ++  +F+  SL+ F S++   + Y  VL ++K
Sbjct  453  MSISGAKFFTVSLDLFASVLGAVVTYFMVLVQLK  486



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310776.1 putative odorant receptor 71a [Cephus cinctus]

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR2_ANOGA  unnamed protein product                                    73.6    4e-14
OR94B_DROME  unnamed protein product                                  63.5    7e-11
OR43A_DROME  unnamed protein product                                  62.4    1e-10


>OR2_ANOGA unnamed protein product
Length=378

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/318 (22%), Positives = 138/318 (43%), Gaps = 21/318 (7%)

Query  75   VIYLHAAGKVGIMRLHRHKFSRLLHGV--ERVQTTASGELLRYHKEYTRVGYV----AYW  128
            V+Y +   +   + ++R KF     GV  E      + ++    + YTR G +      W
Sbjct  66   VLYFNLVLRTSFLVINRRKFETFFEGVAAEYALLEKNDDIRPVLERYTRRGRMLSISNLW  125

Query  129  IYTISVFIITLDYIVQPLWKKSQFLPTGAWYPFDYKKSTFFYTLAYFQQIICITFSGCAS  188
            +       I+  ++  PL+   + LP G   P     +T  Y + +  Q+  +TF  C  
Sbjct  126  LGAF----ISACFVTYPLFVPGRGLPYGVTIPGVDVLATPTYQVVFVLQVY-LTFPACCM  180

Query  189  TTEIT--FGVFIFFACARLKVLQRKFQQLSDNSNG------NEKILRRRICNYVQQHCDI  240
                T  +     FA  ++  L+++  +L  +S        +   L   +   ++ H  I
Sbjct  181  YIPFTSFYATCTLFALVQIAALKQRLGRLGRHSGTMASTGHSAGTLFAELKECLKYHKQI  240

Query  241  LRYINDVNETYTFIILVLFLSILLTVCCTSFLIINVTEHSLDSIFINSLLMVASAVQLLF  300
            ++Y++D+N   T + L+ FLS  + +C   FL+ +++      I I S + +  +    F
Sbjct  241  IQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLL-SISNQLAQMIMIGSYIFMILSQMFAF  299

Query  301  YYLPGHILIEEAKTIAESVYYSGWESLSINCRKLLLQIMVYSASPINLRNGKMGLLILEN  360
            Y+    +L E++  I +++Y   W       RK L+ I+  +  P+ ++ G +  + LE 
Sbjct  300  YWHANEVL-EQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEM  358

Query  361  YTTFLTTAASYLTSLRSI  378
            +   L  + SY T LR +
Sbjct  359  FQKLLNVSYSYFTLLRRV  376


>OR94B_DROME unnamed protein product
Length=383

 Score = 63.5 bits (153),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 67/318 (21%), Positives = 139/318 (44%), Gaps = 19/318 (6%)

Query  51   IQALVYAIIQANNPQEIIETLSTQVIYLHAAGKVGIMRLHRHKFSRLLHGVER---VQTT  107
            I  + Y  I +++ +E  + L   +  L    K+  +   RH+ + L+H ++        
Sbjct  54   IALMWYEAITSSDFEEAGQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLR  113

Query  108  ASGELLRYHKEYTRVGYVAYWIYTISVFIITLDYIVQPLWKKSQFLPTGAWYPFDYK-KS  166
             S E+  + +       + YW    S+F+  + YI    +++   LP G + PF+++ + 
Sbjct  114  NSEEIKFWQQNQRNFKRIFYWYIWGSLFVAVMGYI-SVFFQEDYELPFGYYVPFEWRTRE  172

Query  167  TFFYTLAYFQQIICITFSGCASTTEITFGVFIFFACARL-KVLQRKFQQLSDNSNGNEKI  225
             +FY   Y   ++ +T    ++    T G +  F  A L ++L  + + L + +    + 
Sbjct  173  RYFYAWGY--NVVAMTLCCLSNILLDTLGCYFMFHIASLFRLLGMRLEALKNAAEEKARP  230

Query  226  LRRRICNYVQQHCDILRYINDVNETYTFIILVLFLSILLTVCCTSFLIINVTEHSLDSIF  285
              RRI    Q H  + R   +     +  +L   +     +C +++ ++++       +F
Sbjct  231  ELRRI---FQLHTKVRRLTRECEVLVSPYVLSQVVFSAFIICFSAYRLVHMGFKQRPGLF  287

Query  286  INSLLMVASAVQLLFYYLP---GHILIEEAKTIAESVYYSGWESLSINCRKLLLQIMVYS  342
            + ++  VA  +  +F  LP   G+ L   A  +  SV+ + W   S+  RKLL   M + 
Sbjct  288  VTTVQFVAVMIVQIF--LPCYYGNELTFHANALTNSVFGTNWLEYSVGTRKLLNCYMEFL  345

Query  343  ASPINLRNG---KMGLLI  357
              P+ +R G   ++GL I
Sbjct  346  KRPVKVRAGVFFEIGLPI  363


>OR43A_DROME unnamed protein product
Length=376

 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/247 (22%), Positives = 105/247 (43%), Gaps = 4/247 (2%)

Query  135  FIITLDYIVQPLWKKSQFLPTGAWYPFDYKKSTFFYTLAYFQQIICITFSGCASTTEIT-  193
            F+  +  +V PL+++ +  P G   P     S+  Y + Y  Q+             ++ 
Sbjct  132  FLDIVGALVSPLFREERAHPFGLALPGVSMTSSPVYEVIYLAQLPTPLLLSMMYMPFVSL  191

Query  194  FGVFIFFACARLKVLQRKFQQLSDNSNGNEKILRRRICNYVQQHCDILRYINDVNETYTF  253
            F     F  A L++L  +  Q+       E+  +R + + +  H  ++RY+  +N+    
Sbjct  192  FAGLAIFGKAMLQILVHRLGQIGGEEQSEEERFQR-LASCIAYHTQVMRYVWQLNKLVAN  250

Query  254  IILVLFLSILLTVCCTSFLIINVTEHSLDSIFINSLLMVASAVQLLFYYLPGHILIEEAK  313
            I+ V  + I  ++ C+    +N+       I I   ++    V   +Y     I +E  +
Sbjct  251  IVAVEAI-IFGSIICSLLFCLNIITSPTQVISIVMYILTMLYVLFTYYNRANEICLENNR  309

Query  314  TIAESVYYSGWESLSINCRKLLLQIMVYSASPINLRNGKMGLLILENYTTFLTTAASYLT  373
             +AE+VY   W       RK LL  ++ +  P+ +R G +  + L  + + L  + SY T
Sbjct  310  -VAEAVYNVPWYEAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFT  368

Query  374  SLRSIVG  380
             LR + G
Sbjct  369  MLRGVTG  375



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310777.1 odorant receptor 13a-like [Cephus cinctus]

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR82A_DROME  unnamed protein product                                  73.6    5e-14
OR9A_DROME  unnamed protein product                                   67.8    4e-12
OR67C_DROME  unnamed protein product                                  67.4    4e-12


>OR82A_DROME unnamed protein product
Length=385

 Score = 73.6 bits (179),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 83/337 (25%), Positives = 151/337 (45%), Gaps = 19/337 (6%)

Query  79   SDTGFVIAVLSGTLTATLSMSKGLTILTSHREVRELLLRLSGFWEKS---IER-PENVDV  134
            +D   V A LS   T  L++ K  T L + ++  E++ R     E+S   I R  E +D 
Sbjct  56   NDMEKVTACLSVVFTNMLTVIKISTFLANRKDFWEMIHRFRKMHEQSASHIPRYREGLDY  115

Query  135  MVQMANRASYLSKCYAATVVIMCSSYCMNPYVSVITQFLFTKTANNSYNFTATTFPTVYP  194
            + +    AS+L + Y  +  +    + + P V +        T +          P  +P
Sbjct  116  VAEANKLASFLGRAYCVSCGLTGLYFMLGPIVKIGVCRWHGTTCDKEL-----PMPMKFP  170

Query  195  FDLSYFPKYVVWILFEQAVCLLMTLHWIACDTLFPMCATHLAIQFQILRRDLER----TT  250
            F+    P Y V  L+   V +++  +  A D LF   A +L   FQ L+R +E     ++
Sbjct  171  FNDLESPGYEVCFLYTVLVTVVVVAYASAVDGLFISFAINLRAHFQTLQRQIENWEFPSS  230

Query  251  EVD---ELREIVKKQIILFQSCDILENIFSPIIFLTIIMTSTIMCACIFQFEKTLSCGVY  307
            E D    L+ IV+  ++L      L +I++P +    ++TS  +   I+Q    +     
Sbjct  231  EPDTQIRLKSIVEYHVLLLSLSRKLRSIYTPTVMGQFVITSLQVGVIIYQLVTNMDS--V  288

Query  308  LEIIKYVTHMMSLFVEILIYCGFSNVLSDQTELLYHAAYNSEWTDRSKKYKSIIYFLILR  367
            ++++ Y +   S+ +++ IYC    ++  ++  +  A   S W   S K ++ +  +IL+
Sbjct  289  MDLLLYASFFGSIMLQLFIYCYGGEIIKAESLQVDTAVRLSNWHLASPKTRTSLSLIILQ  348

Query  368  SQKPFQCTAYHFFPVGLVQITTILTTAVSYFTLLKTV  404
            SQK     A  FF   L     I  TA+S  TL+K++
Sbjct  349  SQKEVLIRA-GFFVASLANFVGICRTALSLITLIKSI  384


>OR9A_DROME unnamed protein product
Length=392

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 82/351 (23%), Positives = 146/351 (42%), Gaps = 46/351 (13%)

Query  75   VSLGSDTGFVIAVLSGTLTATLSMSKGLTILTSHREVRELLLRLSGFWEKSIERPENVDV  134
            VSL SDT      L  T  + L++ K L      +E   L+  +     K IE   +   
Sbjct  69   VSLLSDT------LGSTFASMLTLVKFLLFCYHRKEFVGLIYHIRAILAKEIEVWPDARE  122

Query  135  MVQMANRASYL-----SKCYAATVVIMCSSYCMNPYVSVITQFLFTKTANNSYNFTATTF  189
            ++++ N++  +     ++C+    +       + P+V +I   +     +          
Sbjct  123  IIEVENQSDQMLSLTYTRCFGLAGIFAA----LKPFVGIILSSIRGDEIHLELPHNG---  175

Query  190  PTVYPFDLS----YFPKYVVWILFEQAVCLLMTLHWIACDTLFPMCATHLAIQFQILRRD  245
              VYP+DL     Y P Y+ W +      + M L     D+L      ++   F+I +  
Sbjct  176  --VYPYDLQVVMFYVPTYL-WNVMASYSAVTMAL---CVDSLLFFFTYNVCAIFKIAKHR  229

Query  246  LERTTEV---DELREIVKKQIILF-----QSCDILENIFSPIIFLTIIMTSTIMCACIFQ  297
            +     V   +EL  +V  Q++L      Q  D + + + P+IFL   +++  +C   FQ
Sbjct  230  MIHLPAVGGKEELEGLV--QVLLLHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQ  287

Query  298  FEKTLSCGVYLEIIKYVTHMMSLFVEILIY--CGFSNVLSDQTELLYHAAYNSEWTDRSK  355
                      L  I +V    SL + + IY  CG  N+ S   +   +  Y + WTD S 
Sbjct  288  VADLFPNPQSLYFIAFVG---SLLIALFIYSKCG-ENIKSASLDF-GNGLYETNWTDFSP  342

Query  356  KYKSIIYFLILRSQKPFQCTAYHFFPVGLVQITTILTTAVSYFTLLKTVTS  406
              K  +    +R+Q+P Q   Y FF   +   +TI+ +AVSY  +L++  +
Sbjct  343  PTKRALLIAAMRAQRPCQMKGY-FFEASMATFSTIVRSAVSYIMMLRSFNA  392


>OR67C_DROME unnamed protein product
Length=404

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 80/368 (22%), Positives = 154/368 (42%), Gaps = 50/368 (14%)

Query  52   VLLVLTISTCGFFIIILEFRSVAVSLGSDTGFVIAVLSGTLTATLSMSKGLTILTSHREV  111
            + L + ++ C  F ++ +F+  A+  G  T  +I +L             L  +      
Sbjct  76   IRLAIAVAPCIGFSLVADFKQAAMIRGKKT--LIMLLDD-----------LENMHPKTLA  122

Query  112  RELLLRLSGFWEKSIERPENVDVMVQMANRASYLSKCYAATVVIMCSSYCMNPYVSVITQ  171
            +++  +L  F EK+++R  N+   +           C A T     +++   P +    +
Sbjct  123  KQMEYKLPDF-EKTMKRVINIFTFL-----------CLAYT-----TTFSFYPAIKASVK  165

Query  172  FLFTKTANNSYNFTATTFPTVYPFDLSYFPKYVVWILFEQAV--CLLMTLHWIACDTLFP  229
            F F        NF    F   +PFD +     + WI++        L  + ++  D L  
Sbjct  166  FNFLGYDTFDRNFG---FLIWFPFDATR-NNLIYWIMYWDIAHGAYLAGIAFLCADLLLV  221

Query  230  MCATHLAIQFQILRRDLER--------TTEVDELREIVKKQIILFQSCDILENIFSPIIF  281
            +  T + + F  +   LE            ++ L  I++      + C+ + +++S  + 
Sbjct  222  VVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSFSLL  281

Query  282  LTIIMTSTIMCACIFQF-EKTLSCGVYLEIIKYVTHMMSLFVEILIYCGFSNVLSDQTEL  340
            L  +M S  +C   FQ  E T+       II Y   +M+  V++ + C + + L   +  
Sbjct  282  LNFLMASMQICFIAFQVTESTVEV-----IIIYCIFLMTSMVQVFMVCYYGDTLIAASLK  336

Query  341  LYHAAYNSEWTDRSKKYKSIIYFLILRSQKPFQCTAYHFFPVGLVQITTILTTAVSYFTL  400
            +  AAYN +W   SK Y +++  LI+RSQKP       F P+ LV    +++ +  +F L
Sbjct  337  VGDAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFAL  396

Query  401  LKTVTSES  408
            L+T  S +
Sbjct  397  LRTTYSNN  404



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310778.1 odorant receptor 13a-like [Cephus cinctus]

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR49B_DROME  unnamed protein product                                  95.1    2e-21
OR2_ANOGA  unnamed protein product                                    86.7    2e-18
OR83A_DROME  unnamed protein product                                  84.3    2e-17


>OR49B_DROME unnamed protein product
Length=375

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 121/249 (49%), Gaps = 19/249 (8%)

Query  155  NTTERTLPF-RVVFDLPLTVTPYYEISYVIEVIGAFSVGLCS-VAFASYLFYTCTFVSGH  212
            +++ER LPF   +  L    +PYYE+ Y+ +++    +G C  + + S +     F    
Sbjct  140  SSSERVLPFGSKIPGLNEYESPYYEMWYIFQMLIT-PMGCCMYIPYTSLIVGLIMFGIVR  198

Query  213  FKILQRELENVCEVELKILITKSSYSDNDAKLAYEKFKKCIVQHELLIGYLGKLESLFSY  272
             K LQ  L  V          K  Y D D +   E+   CI   + +I Y+  +  L + 
Sbjct  199  CKALQHRLRQVA--------LKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTM  250

Query  273  IFLMLVLCIVIILCFSGFQFILGDGTSKLHRQILSAEYIVTTLVETGLFAFSCNEIFEAS  332
            +FL  ++    +LC   F  I+  GTS+L   I+   YI   L +     +  NE+ E +
Sbjct  251  MFLFELMAFSALLCALLFMLIIVSGTSQL---IIVCMYINMILAQILALYWYANELREQN  307

Query  333  AAIGEAAYRCKWYKLPCDENGRALRQGMTIMVMRSYKPCSLTVGKFCPMNLQVFSSVLST  392
             A+  AAY  +W+          LR+ +  M+MR+ +P ++ +G   P+ L++F ++L+T
Sbjct  308  LAVATAAYETEWFTFDV-----PLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNT  362

Query  393  SLSYFTVLR  401
            + ++FTVL+
Sbjct  363  TYTFFTVLK  371


>OR2_ANOGA unnamed protein product
Length=378

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 121/245 (49%), Gaps = 16/245 (7%)

Query  159  RTLPFRV-VFDLPLTVTPYYEISYVIEVIGAFSVGLCSVAFASYLFYTCT-FVSGHFKIL  216
            R LP+ V +  + +  TP Y++ +V++V   F      + F S+ + TCT F       L
Sbjct  144  RGLPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACCMYIPFTSF-YATCTLFALVQIAAL  202

Query  217  QRELENVCEVELKILITKSSYSDNDAKLAYEKFKKCIVQHELLIGYLGKLESLFSYIFLM  276
            ++ L  +      +  T  S     A   + + K+C+  H+ +I Y+  L SL +++ L+
Sbjct  203  KQRLGRLGRHSGTMASTGHS-----AGTLFAELKECLKYHKQIIQYVHDLNSLVTHLCLL  257

Query  277  LVLCIVIILCFSGFQFILGDGTSKLHRQILSAEYIVTTLVETGLFAFSCNEIFEASAAIG  336
              L   ++LC     F+L   +++L + I+   YI   L +   F +  NE+ E S  IG
Sbjct  258  EFLSFGMMLC--ALLFLLSI-SNQLAQMIMIGSYIFMILSQMFAFYWHANEVLEQSLGIG  314

Query  337  EAAYRCKWYKLPCDENGRALRQGMTIMVMRSYKPCSLTVGKFCPMNLQVFSSVLSTSLSY  396
            +A Y   W      +    +R+ + +++ R+ +P  + VG   PM L++F  +L+ S SY
Sbjct  315  DAIYNGAW-----PDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSY  369

Query  397  FTVLR  401
            FT+LR
Sbjct  370  FTLLR  374


>OR83A_DROME unnamed protein product
Length=453

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 70/343 (20%), Positives = 138/343 (40%), Gaps = 51/343 (15%)

Query  111  NELDKAILDKCDSTSAIGMCVLSV----------LATIVAIHYLTGPYWDAVGTNTTERT  160
            N +   I D+ ++ SA+G   +++          + T V   Y+   +W A+     +R+
Sbjct  116  NTILSNINDEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYCCYIGTIFWLALPIAYRDRS  175

Query  161  LPFRVVFDLPLTVTPYYEISYVIEVIGAFSVGLCSVAFASYLFYTCTFVSGHFKILQREL  220
            LP    +    T    YE+ ++++ +G   V     + +      C  +SG + +L   L
Sbjct  176  LPLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSGLHMVLCVLISGQYDVLFCSL  235

Query  221  ENVCE----------VELKILITKSSYSD-NDAKLAYE----------------------  247
            +NV             EL  L  + S +D    + AY                       
Sbjct  236  KNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSA  295

Query  248  ---KFKKCIVQHELLIGYLGKLESLFSYIFLMLVLCIVIILCFSGFQFILGDGTSKLHRQ  304
                F +CI  H  ++  L K+ES +S I+ + +  +  ++C   F        +   R 
Sbjct  296  FRLSFVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRM  355

Query  305  ILSAEYIVTTLVETGLFAFSCNEIFEASAAIGEAAYRCKWYKLPCDENGRALRQGMTIMV  364
            +   +Y++  L E  +  +  + +F+ S   GEA +R  W +     + + +R      +
Sbjct  356  VSLGQYLLLVLYELFIICYFADIVFQNSQRCGEALWRSPWQR-----HLKDVRSDYMFFM  410

Query  365  MRSYKPCSLTVGKFCPMNLQVFSSVLSTSLSYFTVLRSMNESE  407
            + S +   LT GK   +N+  F   ++T+ S+ T+L+ M+  E
Sbjct  411  LNSRRQFQLTAGKISNLNVDRFRGTITTAFSFLTLLQKMDARE  453



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310779.1 odorant receptor Or1-like [Cephus cinctus]

Length=378
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR1_ANOGA  unnamed protein product                                    103     2e-24
OR46A_DROME  unnamed protein product                                  92.8    1e-20
OR2_ANOGA  unnamed protein product                                    90.9    5e-20


>OR1_ANOGA unnamed protein product
Length=417

 Score = 103 bits (257),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 89/397 (22%), Positives = 177/397 (45%), Gaps = 37/397 (9%)

Query  12   KFWGLWRPSDYLSWMKILYNIYS-LLIVVIMYSFMLFEFIDVFINIKSIDDFTMNSFMLV  70
            K+ GLW P D     +  Y  Y   L ++ ++ + L + +  F ++K I+D     F+L+
Sbjct  27   KYLGLWPPEDTDQATRNRYIAYGWALRIMFLHLYALTQAL-YFKDVKDINDIANALFVLM  85

Query  71   TFTNACWRVAKILAGRGKILKVINLLTSDYCVAVDKREVE----IKEGYDGIARWNTLRY  126
            T     +++ K      +I   +  L    C     ++ E    + +   G+  W  +  
Sbjct  86   TQVTLIYKLEKFNYNIARIQACLRKLN---CTLYHPKQREEFSPVLQSMSGVF-WLMIFL  141

Query  127  VILVQITVALMLIVPLSNESRKRILPFRSWLPYDLS-SLKLFWLSYVHQCIAIMAAAYIN  185
            + +   T+ + ++ P  +  R+  LP  +W P D   S  ++ + +++Q I I+ +A  N
Sbjct  142  MFVAIFTIIMWVMSPAFDNERR--LPVPAWFPVDYHHSDIVYGVLFLYQTIGIVMSATYN  199

Query  186  VATDSFISGLMIQICSQLDILKYRLIKLPR------------------LYNINHRDEFLS  227
             +TD+  SGLM+ I  Q+  L   + KL                       I+H  +   
Sbjct  200  FSTDTMFSGLMLHINGQIVRLGSMVKKLGHDVPPERQLVATDAEWKEMRKRIDHHSKVYG  259

Query  228  SL----THCVLHHEHIFKFASAVESVSNPITIVQFCASAVALCSSVYQLSKHSVDSAKFM  283
            ++    T CVL H+ I  F   V+ +       Q CAS + +C ++ Q +   V  A  +
Sbjct  260  TMYAKVTECVLFHKDILSFGDEVQDIFQGSIFAQVCASVIIICMTLLQATGDDVTMADLL  319

Query  284  PLILYLLCMLFQLFFYCWYGNEVILKSMEVRDAVYEMDWILLDNNNKKALLMMMKRSERS  343
                YLL M  Q+F +C+ GNE+   + +  + V   ++   D    +A++  ++ + + 
Sbjct  320  GCGFYLLVMTSQVFIFCYVGNEISYTTDKFTEFVGFSNYFKFDKRTSQAMIFFLQMTLKD  379

Query  344  IQIKSGYF--IALSVEPYIKILKASFTAYNALQQISN  378
            + IK G    + L++  +++I+K S++    LQ + +
Sbjct  380  VHIKVGSVLKVTLNLHTFLQIMKLSYSYLAVLQSMES  416


>OR46A_DROME unnamed protein product
Length=381

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 4/200 (2%)

Query  151  LPFRSWLPY-DLSSLKLFWLSYVHQCIAIMAAAYINVATDSFISGLMIQICSQLDILKYR  209
            LP +++ P  + +    +WL Y +QC+A+  +   N+  DS  S L I +  QLDIL  R
Sbjct  153  LPLKTYNPLGENTGSPAYWLLYCYQCLALSVSCITNIGFDSLCSSLFIFLKCQLDILAVR  212

Query  210  LIKLPRLYNINHRDEFLSSLTHCVLHHEHIFKFASAVESV-SNPITIVQFCASAVALCSS  268
            L K+ RL   +        L   + +H  I + +  VE +   PI++  FC S + L ++
Sbjct  213  LDKIGRLITTSG-GTVEQQLKENIRYHMTIVELSKTVERLLCKPISVQIFC-SVLVLTAN  270

Query  269  VYQLSKHSVDSAKFMPLILYLLCMLFQLFFYCWYGNEVILKSMEVRDAVYEMDWILLDNN  328
             Y ++  S +  +    + Y  CML Q+F  C+Y  EV  +S+++   +Y+  W+  D  
Sbjct  271  FYAIAVLSDERLELFKYVTYQACMLIQIFILCYYAGEVTQRSLDLPHELYKTSWVDWDYR  330

Query  329  NKKALLMMMKRSERSIQIKS  348
            +++  L+ M+R   +++I++
Sbjct  331  SRRIALLFMQRLHSTLRIRT  350


>OR2_ANOGA unnamed protein product
Length=378

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 72/340 (21%), Positives = 162/340 (48%), Gaps = 10/340 (3%)

Query  46   LFEFIDVFINIKSIDDFTMNSFMLVTFTNACWRVAKILAGRGKILKVINLLTSDYCVAVD  105
            +F+F+ ++ +   + +  +N +  V + N   R + ++  R K       + ++Y +   
Sbjct  42   VFQFLKLYSSWGDMSELIINGYFTVLYFNLVLRTSFLVINRRKFETFFEGVAAEYALLEK  101

Query  106  KREVE-IKEGYDGIARWNTLRYVILVQITVALMLIVPLSNESRKRILPFRSWLP-YDLSS  163
              ++  + E Y    R  ++  + L     A  +  PL    R   LP+   +P  D+ +
Sbjct  102  NDDIRPVLERYTRRGRMLSISNLWLGAFISACFVTYPLFVPGRG--LPYGVTIPGVDVLA  159

Query  164  LKLFWLSYVHQCIAIMAAAYINVATDSFISGLMIQICSQLDILKYRLIKLPR----LYNI  219
               + + +V Q      A  + +   SF +   +    Q+  LK RL +L R    + + 
Sbjct  160  TPTYQVVFVLQVYLTFPACCMYIPFTSFYATCTLFALVQIAALKQRLGRLGRHSGTMAST  219

Query  220  NHR-DEFLSSLTHCVLHHEHIFKFASAVESVSNPITIVQFCASAVALCSSVYQLSKHSVD  278
             H      + L  C+ +H+ I ++   + S+   + +++F +  + LC+ ++ LS  S  
Sbjct  220  GHSAGTLFAELKECLKYHKQIIQYVHDLNSLVTHLCLLEFLSFGMMLCALLFLLSI-SNQ  278

Query  279  SAKFMPLILYLLCMLFQLFFYCWYGNEVILKSMEVRDAVYEMDWILLDNNNKKALLMMMK  338
             A+ + +  Y+  +L Q+F + W+ NEV+ +S+ + DA+Y   W   +   +K L++++ 
Sbjct  279  LAQMIMIGSYIFMILSQMFAFYWHANEVLEQSLGIGDAIYNGAWPDFEEPIRKRLILIIA  338

Query  339  RSERSIQIKSGYFIALSVEPYIKILKASFTAYNALQQISN  378
            R++R + IK G    +++E + K+L  S++ +  L+++ N
Sbjct  339  RAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYFTLLRRVYN  378



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= NP_001310780.1 odorant receptor Or2-like [Cephus cinctus]

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR2_ANOGA  unnamed protein product                                    86.7    2e-18
OR49B_DROME  unnamed protein product                                  84.0    1e-17
OR43A_DROME  unnamed protein product                                  76.3    5e-15


>OR2_ANOGA unnamed protein product
Length=378

 Score = 86.7 bits (213),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/246 (26%), Positives = 123/246 (50%), Gaps = 14/246 (6%)

Query  159  RTLPFRV-VFDFPITVTPLYQILYFIEVIGTISIGICSVAFASYLFYTCIFVSGFFKILQ  217
            R LP+ V +    +  TP YQ+++ ++V  T       + F S+     +F       L+
Sbjct  144  RGLPYGVTIPGVDVLATPTYQVVFVLQVYLTFPACCMYIPFTSFYATCTLFALVQIAALK  203

Query  218  RELENVCEVELESVNTKSSYNNNDTMLAYKKLKKCVIQHQLLIWYLGKLEGLFSYILLML  277
            + L  +      S    S+ ++  T+ A  +LK+C+  H+ +I Y+  L  L +++ L+ 
Sbjct  204  QRLGRLGR---HSGTMASTGHSAGTLFA--ELKECLKYHKQIIQYVHDLNSLVTHLCLLE  258

Query  278  VLCAVIILCFAGFQIILGDGTTKLHRQILSVEFIMAALAETVLFAFSCNEILTASAAIGE  337
             L   ++LC   F + + +   +L + I+   +I   L++   F +  NE+L  S  IG+
Sbjct  259  FLSFGMMLCALLFLLSISN---QLAQMIMIGSYIFMILSQMFAFYWHANEVLEQSLGIGD  315

Query  338  AAYRCKWYKLPCDEYGRALRQGMTIMVMRSYKPCSLTVGKFCPMTLEVFTSILSTSLSYF  397
            A Y   W      ++   +R+ + +++ R+ +P  + VG   PMTLE+F  +L+ S SYF
Sbjct  316  AIYNGAW-----PDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLNVSYSYF  370

Query  398  TVLRSM  403
            T+LR +
Sbjct  371  TLLRRV  376


>OR49B_DROME unnamed protein product
Length=375

 Score = 84.0 bits (206),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 147/308 (48%), Gaps = 26/308 (8%)

Query  97   LHKFTEDTYWNKDYNELDKAILDKCDTTSAIGMSILALTSAILAFHYLTGPYLDNLGTNT  156
            + K TE  Y   + N  D  I +  D  + +G     +    L F  LT         ++
Sbjct  87   IQKLTEAYYDLLNLN--DSYISEILDQVNKVGK---LMARGNLFFGMLTSMGFGLYPLSS  141

Query  157  TERTLPF-RVVFDFPITVTPLYQILYFIEVIGTISIGICSVAFASYLFYTCIFVS-GFFK  214
            +ER LPF   +       +P Y++ Y  +++ T  +G C      Y+ YT + V    F 
Sbjct  142  SERVLPFGSKIPGLNEYESPYYEMWYIFQMLIT-PMGCCM-----YIPYTSLIVGLIMFG  195

Query  215  ILQ-RELENVCEVELESVNTKSSYNNNDTMLAYKKLKKCVIQHQLLIWYLGKLEGLFSYI  273
            I++ + L++     L  V  K  Y + D     +++  C+   Q +I Y+  +  L + +
Sbjct  196  IVRCKALQH----RLRQVALKHPYGDRDPRELREEIIACIRYQQSIIEYMDHINELTTMM  251

Query  274  LLMLVLCAVIILCFAGFQIILGDGTTKLHRQILSVEFIMAALAETVLFAFSCNEILTASA  333
             L  ++    +LC   F +I+  GT++L   I+   +I   LA+ +   +  NE+   + 
Sbjct  252  FLFELMAFSALLCALLFMLIIVSGTSQL---IIVCMYINMILAQILALYWYANELREQNL  308

Query  334  AIGEAAYRCKWYKLPCDEYGRALRQGMTIMVMRSYKPCSLTVGKFCPMTLEVFTSILSTS  393
            A+  AAY  +W+      +   LR+ +  M+MR+ +P ++ +G   P+TLE+F ++L+T+
Sbjct  309  AVATAAYETEWFT-----FDVPLRKNILFMMMRAQRPAAILLGNIRPITLELFQNLLNTT  363

Query  394  LSYFTVLR  401
             ++FTVL+
Sbjct  364  YTFFTVLK  371


>OR43A_DROME unnamed protein product
Length=376

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 77/294 (26%), Positives = 133/294 (45%), Gaps = 35/294 (12%)

Query  122  DTTSAIGMSILALT---SAILAFHYLTGPYLDNLGTNTT-----ERTLPFRVVFD-FPIT  172
            D+T   G  IL      +  LA   L+  +LD +G   +     ER  PF +      +T
Sbjct  103  DSTDEWGRGILRRAEREARNLAILNLSASFLDIVGALVSPLFREERAHPFGLALPGVSMT  162

Query  173  VTPLYQILYFIEVIGTISIGICSVAFASYLFYTCIFVSGFFKILQRELENVCEVELESVN  232
             +P+Y+++Y  ++   + + +  + F S      IF     +IL   L  +   E +S  
Sbjct  163  SSPVYEVIYLAQLPTPLLLSMMYMPFVSLFAGLAIFGKAMLQILVHRLGQIGGEE-QSEE  221

Query  233  TKSSYNNNDTMLAYKKLKKCVIQHQLLIWYLGKLEGLFSYILLMLVLCAVIILCFAGFQI  292
             +           +++L  C+  H  ++ Y+ +L  L + I+ +  +    I+C   F +
Sbjct  222  ER-----------FQRLASCIAYHTQVMRYVWQLNKLVANIVAVEAIIFGSIICSLLFCL  270

Query  293  ILGDGTTKLHRQILS-VEFIMAALAETVLFAF--SCNEILTASAAIGEAAYRCKWYKLPC  349
             +    T    Q++S V +I+  L   VLF +    NEI   +  + EA Y   WY    
Sbjct  271  NIITSPT----QVISIVMYILTML--YVLFTYYNRANEICLENNRVAEAVYNVPWY----  320

Query  350  DEYGRALRQGMTIMVMRSYKPCSLTVGKFCPMTLEVFTSILSTSLSYFTVLRSM  403
             E G   R+ + I +M++  P  + VG   PMTL +F S+L+ S SYFT+LR +
Sbjct  321  -EAGTRFRKTLLIFLMQTQHPMEIRVGNVYPMTLAMFQSLLNASYSYFTMLRGV  373



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584661.1 uncharacterized protein LOC107275202 isoform X1
[Cephus cinctus]

Length=983
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYX_DROME  unnamed protein product                                    47.0    7e-05
FEM1_CAEEL  unnamed protein product                                   37.7    0.047
Q7PLP4_DROME  unnamed protein product                                 33.9    0.81 


>PYX_DROME unnamed protein product
Length=956

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 122/288 (42%), Gaps = 54/288 (19%)

Query  56   IQNYIFDWNAIPEVFSNKENERRKLREINRNIEKETQTYKTILKLLTRGANPNYPTAPYP  115
            I   + D+ A P    N+ + R+++  ++      +++ + IL LL R A+ N       
Sbjct  148  IAKVLLDFGADP----NRWDARKEVTSLH--CAASSKSVECILLLLRRKASINIGIEKRS  201

Query  116  VLIMAIFSKSTNLVQQLLLYGADPNVTLSKQEYSLAPLHILAVIEPSFDNSIIAKSLIHA  175
             L  AI   + + V+ LL YGADPN   + Q Y+  PLH  +     F   +  + L+  
Sbjct  202  ALHYAIDVNAVDCVEILLKYGADPN---TPQVYTETPLHTASA--AGFAKCV--QLLLSH  254

Query  176  NADV------------NLRTDSTYRPDVKARVSESRSTEFLDDSQGFTALHLLALRSDYK  223
            NADV            +L  ++ Y  +    + E R+     ++   T LHL  L     
Sbjct  255  NADVRSQFGEGKVTALHLAAENDY-VECARLLLEHRAEVDCRNASHQTPLHLACLSQSIG  313

Query  224  TDKNQFLTQLVCALLCNGSNKSYQFYQGHSALSLAIVEE--NIDAMKLLLQTGQ-INVNE  280
            T         V  L+  G+N +  +  G +AL  AIV++  ++D    LL+ G  +N  +
Sbjct  314  T---------VDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKAGADVNKAD  364

Query  281  QLGY---------DVGSCMLMM------VSCRLQEKLSA-SFIEKSIP  312
              GY         +  SC+         ++ R   ++SA SFI +  P
Sbjct  365  NYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGRVSALSFIVRRTP  412


>FEM1_CAEEL unnamed protein product
Length=656

 Score = 37.7 bits (86),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 48/187 (26%), Positives = 81/187 (43%), Gaps = 28/187 (15%)

Query  114  YPVLIMAIFSKSTNLVQQLLLYGADPNV----TLSKQEYSLAPLHILAVIEPSFDNSIIA  169
            YP L++A  +   N+V+ LL  GADP+V        +     P    A      +   I 
Sbjct  50   YP-LVIAARNGHANVVEYLLEIGADPSVRGVVEFDNENIQGTPPLWAASAAGHIE---IV  105

Query  170  KSLIH-ANADVNLRTDSTYRP----------DVKARVSESRSTEFLDDSQGFTALHLLAL  218
            K LI  ANADVN  T++   P          D+   + E  +   + +  G T L + + 
Sbjct  106  KLLIEKANADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIASY  165

Query  219  RSDYKTDKNQFLTQLVCALLCNGSNKSYQFYQGHSALSLAIVEENIDAMKLLLQTGQINV  278
            R+            +V  LL  G + + +  +G++AL  A    N++ +K+LL+ G + +
Sbjct  166  RNK---------VGIVEELLKTGIDVNKKTERGNTALHDAAESGNVEVVKILLKHGSVLM  216

Query  279  NEQLGYD  285
             +  G D
Sbjct  217  KDIQGVD  223


>Q7PLP4_DROME unnamed protein product
Length=1111

 Score = 33.9 bits (76),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 20/157 (13%)

Query  165  NSIIAKSLIH---ANAD-VNLRTDSTYRPDVKARVSESRSTEFLDDSQGF----------  210
            N+ IAKSL+    AN + VN+   S  +  +K    ++ S  FL D              
Sbjct  257  NAKIAKSLVDNGMANINAVNMEGFSLLKSALKN--GDAFSANFLLDQNCLLDLPSKPSSD  314

Query  211  TALHLLALRSDYKTDKNQFLTQLVCALLCNGSNKSYQFYQGHSALSLAIVEENIDAMKLL  270
            TALH++    +Y  D    + ++V  +L    N + Q  +G + L +AI   N++ +KLL
Sbjct  315  TALHIIC---NYGPDNTPEIMEVVKKILQRQLNINIQNIKGETPLHIAIARRNVEMVKLL  371

Query  271  LQTGQINVNEQLGYDVGSCMLMMVSCRLQEKLSASFI  307
            L+   I++N +  YD    + + +S    E L AS +
Sbjct  372  LKVPNIDINLR-TYDEKCALELSLSMGDHEFLIASIL  407



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584664.1 ATP synthase subunit O, mitochondrial [Cephus
cinctus]

Length=209
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATPO_DROME  unnamed protein product                                   246     2e-83
P91283_CAEEL  unnamed protein product                                 180     2e-57
Q7JNG1_CAEEL  unnamed protein product                                 179     7e-57


>ATPO_DROME unnamed protein product
Length=209

 Score = 246 bits (629),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/205 (60%), Positives = 155/205 (76%), Gaps = 1/205 (0%)

Query  4    SRINIIARSFSSSAAVQQMVKPPVQVFGLEGRYATALFSAASKQKSLDVVEKDLIKFQGL  63
            +++ +++R+ SS+AA Q  VKPPVQVFGLEGRYATAL+SAASK   LD VEKDL   Q  
Sbjct  5    NKLALLSRTLSSAAA-QATVKPPVQVFGLEGRYATALYSAASKLSQLDQVEKDLTALQAT  63

Query  64   LKTDAKLAEFVKDPSIKRKSKVEAFKGIGGAANLNPATTNLLALLAENGRLGKINQVINA  123
            +++D KL E+V  P I +K    A K         PAT NLL LLA+NGRL K++ VINA
Sbjct  64   IRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINA  123

Query  124  FKVIMAANRGEVVCEVITAKPLDADSKSKLEGALKSFLSKGQTLLLTTKVDPSIIGGMVV  183
            +K IMAA+RGEVVCEV+TAKPLDA    +LEGALKSFL   ++L +T++VDPSIIGG++V
Sbjct  124  YKTIMAAHRGEVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIV  183

Query  184  SIGDKYVDMSISSKVKKYSELISAA  208
            SIGDKYVDMSI++KVK Y+++I  A
Sbjct  184  SIGDKYVDMSIATKVKLYTDVIQTA  208


>P91283_CAEEL unnamed protein product
Length=207

 Score = 180 bits (456),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 132/204 (65%), Gaps = 2/204 (1%)

Query  8    IIARSFSSSAAVQ--QMVKPPVQVFGLEGRYATALFSAASKQKSLDVVEKDLIKFQGLLK  65
            ++ R FS+SAA+   Q+VK P+QV G+EGRYA AL+SA  KQ  LD +  DL   + + K
Sbjct  4    LMKRGFSTSAALAKAQLVKTPIQVHGVEGRYAAALYSAGHKQNKLDQISTDLNNVRSVYK  63

Query  66   TDAKLAEFVKDPSIKRKSKVEAFKGIGGAANLNPATTNLLALLAENGRLGKINQVINAFK  125
             + K  EFV DP++K   K  A + I     L   T N L LLAENGRL K+  V+++F+
Sbjct  64   DNKKFQEFVLDPTLKANKKKTAIEAISTKLGLTKETGNFLGLLAENGRLNKLESVVSSFE  123

Query  126  VIMAANRGEVVCEVITAKPLDADSKSKLEGALKSFLSKGQTLLLTTKVDPSIIGGMVVSI  185
             IM A+RGE+  +V +A+ L + ++  L  AL      GQ L +T  V PSI+GG+VV+I
Sbjct  124  SIMRAHRGELFVQVTSAEELSSSNQKALSDALSKIGKSGQKLTVTYAVKPSILGGLVVTI  183

Query  186  GDKYVDMSISSKVKKYSELISAAV  209
            GDKYVD+SI+S+VKKY + ++ A+
Sbjct  184  GDKYVDLSIASRVKKYKDALATAI  207


>Q7JNG1_CAEEL unnamed protein product
Length=228

 Score = 179 bits (455),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/204 (46%), Positives = 132/204 (65%), Gaps = 2/204 (1%)

Query  8    IIARSFSSSAAVQ--QMVKPPVQVFGLEGRYATALFSAASKQKSLDVVEKDLIKFQGLLK  65
            ++ R FS+SAA+   Q+VK P+QV G+EGRYA AL+SA  KQ  LD +  DL   + + K
Sbjct  25   LMKRGFSTSAALAKAQLVKTPIQVHGVEGRYAAALYSAGHKQNKLDQISTDLNNVRSVYK  84

Query  66   TDAKLAEFVKDPSIKRKSKVEAFKGIGGAANLNPATTNLLALLAENGRLGKINQVINAFK  125
             + K  EFV DP++K   K  A + I     L   T N L LLAENGRL K+  V+++F+
Sbjct  85   DNKKFQEFVLDPTLKANKKKTAIEAISTKLGLTKETGNFLGLLAENGRLNKLESVVSSFE  144

Query  126  VIMAANRGEVVCEVITAKPLDADSKSKLEGALKSFLSKGQTLLLTTKVDPSIIGGMVVSI  185
             IM A+RGE+  +V +A+ L + ++  L  AL      GQ L +T  V PSI+GG+VV+I
Sbjct  145  SIMRAHRGELFVQVTSAEELSSSNQKALSDALSKIGKSGQKLTVTYAVKPSILGGLVVTI  204

Query  186  GDKYVDMSISSKVKKYSELISAAV  209
            GDKYVD+SI+S+VKKY + ++ A+
Sbjct  205  GDKYVDLSIASRVKKYKDALATAI  228



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584665.1 AP-3 complex subunit sigma-2 [Cephus cinctus]

Length=191
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W1E8_DROME  unnamed protein product                                 363     5e-130
Q57TU5_TRYB2  unnamed protein product                                 158     2e-49 
Q9VDC3_DROME  unnamed protein product                                 114     9e-33 


>Q9W1E8_DROME unnamed protein product
Length=191

 Score = 363 bits (931),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 172/191 (90%), Positives = 184/191 (96%), Gaps = 0/191 (0%)

Query  1    MIKAILVFNNHGKPRLSKFYQYFNEDMQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSD  60
            MIKAILVFNNHGKPRLSKFYQYF+E +QQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSD
Sbjct  1    MIKAILVFNNHGKPRLSKFYQYFDESLQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSD  60

Query  61   YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHYIL  120
            YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFH D VH+IL
Sbjct  61   YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHADAVHHIL  120

Query  121  NELVMGGMVLETNMTEILTRIEDQNKLEKQEAGITAAPARAVSAVKNMNIPQQIKDMKLP  180
            +ELVMGGMVL+TNM +I+ RIE+QNK+ KQEAGI+AAPARAVSAVK+MNIPQQIKD+KLP
Sbjct  121  SELVMGGMVLQTNMNDIMARIEEQNKIVKQEAGISAAPARAVSAVKSMNIPQQIKDIKLP  180

Query  181  DLPQAIKDLKF  191
            DLPQAIKD KF
Sbjct  181  DLPQAIKDFKF  191


>Q57TU5_TRYB2 unnamed protein product
Length=164

 Score = 158 bits (399),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 110/160 (69%), Gaps = 1/160 (1%)

Query  1    MIKAILVFNNHGKPRLSKFYQY-FNEDMQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGS  59
            MIKA+++ N  GK RL   Y+      +QQ++++    L+S+R  ++CNF++        
Sbjct  1    MIKAVIIINMVGKIRLLNVYEKEIPLSVQQELVQRVHSLISRRGADLCNFVDNFREWPTP  60

Query  60   DYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHYI  119
            D +++YRHYATL FVF VDSSES+L ILDLIQVFVE LD+ FENVCELDLIFH DKV  +
Sbjct  61   DTRVVYRHYATLCFVFVVDSSESQLAILDLIQVFVEVLDRTFENVCELDLIFHSDKVQLL  120

Query  120  LNELVMGGMVLETNMTEILTRIEDQNKLEKQEAGITAAPA  159
            L E+VMGGMVLET+  E+L  + D  +L   + G+ ++ +
Sbjct  121  LMEMVMGGMVLETSREEVLRAVCDMQRLGNTKTGMGSSSS  160


>Q9VDC3_DROME unnamed protein product
Length=142

 Score = 114 bits (286),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 97/148 (66%), Gaps = 6/148 (4%)

Query  1    MIKAILVFNNHGKPRLSKFYQYFNEDMQQQIIKETFQLVSKRDDNVCNFLEGGSLIGGSD  60
            MI+ IL+ N  GK RL+K+Y  F++D +Q++I+E   +V+ RD    NF+E        +
Sbjct  1    MIRFILIQNRAGKTRLAKWYMNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEF------RN  54

Query  61   YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKVHYIL  120
            +K++YR YA LYF  CVD +++ L  L+ I  FVE L++ F NVCELDL+F+  KV+ ++
Sbjct  55   FKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYSVV  114

Query  121  NELVMGGMVLETNMTEILTRIEDQNKLE  148
            +E+ + G + ET+ T++L ++   N LE
Sbjct  115  DEMFLAGEIRETSQTKVLKQLLTLNSLE  142



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584668.1 D-aminoacyl-tRNA deacylase 1 [Cephus cinctus]

Length=158
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DTD_DROME  unnamed protein product                                    173     4e-56
DTD1_LEIMA  unnamed protein product                                   156     2e-49
Q38AP4_TRYB2  unnamed protein product                                 122     2e-36


>DTD_DROME unnamed protein product
Length=158

 Score = 173 bits (438),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 111/154 (72%), Gaps = 1/154 (1%)

Query  1    MKAVIQRVTKASVSVDGKIISSIENGLCILIGIKRDDTLADMEYIVRKILNMKVFEGQNG  60
            M+AVIQRV  A V+V  +++SSI  GLC+L+GIK  DT  D+EY+VRKIL +++FE + G
Sbjct  1    MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKILALRLFE-EEG  59

Query  61   RKWCANVMEKEYEVLCVSQFTLYHVMKGNKLDFHKAMPAQDSEPFYMNFLAELGKKYKPE  120
            ++W  +V +   E+LCVSQFTLYH +KGNK DF  AM  ++++  Y  FL  LG+ Y   
Sbjct  60   KRWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEEAQELYNQFLDRLGQSYDST  119

Query  121  LIKDGKFGAMMQVHIQNDGPVTLEIESPIKTAND  154
             IKDGKFGA MQVHI+NDGPVT+ +ESP +   D
Sbjct  120  KIKDGKFGAYMQVHIENDGPVTINLESPEQKDTD  153


>DTD1_LEIMA unnamed protein product
Length=152

 Score = 156 bits (394),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 101/148 (68%), Gaps = 1/148 (1%)

Query  1    MKAVIQRVTKASVSVDGKIISSIENGLCILIGIKRDDTLADMEYIVRKILNMKVFEGQNG  60
            MKAVIQRV   SV+ +G+++ SI+ GL +L+GI RDDT  D EYI+RKIL ++V+  ++G
Sbjct  1    MKAVIQRVLSGSVTSEGEVVGSIQKGLAVLVGIARDDTADDTEYILRKILGVRVWSNEDG  60

Query  61   RK-WCANVMEKEYEVLCVSQFTLYHVMKGNKLDFHKAMPAQDSEPFYMNFLAELGKKYKP  119
             K WC NV E + EVL +SQFTL HVMKGNK DFH AMP +D+   +     +L  +Y P
Sbjct  61   SKMWCRNVKEIDGEVLLISQFTLMHVMKGNKPDFHNAMPPEDALKVFNALRDKLRCEYAP  120

Query  120  ELIKDGKFGAMMQVHIQNDGPVTLEIES  147
              I  G F   M +H+ NDGPVTL ++S
Sbjct  121  HKIATGNFQHYMNIHLSNDGPVTLILDS  148


>Q38AP4_TRYB2 unnamed protein product
Length=151

 Score = 122 bits (307),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 96/148 (65%), Gaps = 1/148 (1%)

Query  1    MKAVIQRVTKASVSVDGKIISSIENGLCILIGIKRDDTLADMEYIVRKILNMKVFEGQNG  60
            M+ V+QRV + +V+V  +++ S+  G+  L+GI  +D ++D++YI  K+L+++++  ++G
Sbjct  1    MRVVVQRVLEGAVTVGEEVVGSVGRGIVALVGIHHEDDMSDVDYIAHKLLSLRIWRSEDG  60

Query  61   RK-WCANVMEKEYEVLCVSQFTLYHVMKGNKLDFHKAMPAQDSEPFYMNFLAELGKKYKP  119
            +K W  NV + +  +L VSQFTL HV+KGNK DFH AM  + +   + N    L + Y  
Sbjct  61   QKTWDRNVKQVDGGILLVSQFTLMHVLKGNKPDFHLAMKPERASELFNNLREALCRDYAA  120

Query  120  ELIKDGKFGAMMQVHIQNDGPVTLEIES  147
              I  G+F + M +++ NDGPVTL ++S
Sbjct  121  HKISTGRFQSYMNINMTNDGPVTLVLDS  148



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584671.1 heat shock factor-binding protein 1 [Cephus cinctus]

Length=84
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3B7_CAEEL  unnamed protein product                                 64.3    2e-15
Q556J3_DICDI  unnamed protein product                                 54.3    5e-11
Q8IIF8_PLAF7  unnamed protein product                                 41.6    4e-06


>Q9U3B7_CAEEL unnamed protein product
Length=80

 Score = 64.3 bits (155),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)

Query  26  NMQELTQYVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
           NM +LT  +Q +LQ  QD+FQ +SDQII RID+M  RIDDLEKNI DL+    VE
Sbjct  20  NMNDLTSLIQGVLQQTQDRFQHMSDQIIRRIDDMTTRIDDLEKNINDLLQSNQVE  74


>Q556J3_DICDI unnamed protein product
Length=102

 Score = 54.3 bits (129),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)

Query  33  YVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLM  74
            VQ LL+ MQ +F+ +S+ I+ RIDEMG RID+L+K+I+DLM
Sbjct  32  VVQNLLEQMQSRFEKVSESILTRIDEMGQRIDELDKSISDLM  73


>Q8IIF8_PLAF7 unnamed protein product
Length=113

 Score = 41.6 bits (96),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 36/58 (62%), Gaps = 0/58 (0%)

Query  23   DPKNMQELTQYVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
            +PK  +EL  YV+ +L  ++ K Q++SD ++ ++D M   +D+LE  + +  TQ  ++
Sbjct  56   EPKAGEELEIYVENMLNELKTKMQSLSDNLLNKVDNMEKYLDELENTMMNYTTQNNLQ  113



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584672.1 heat shock factor-binding protein 1 [Cephus cinctus]

Length=84
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3B7_CAEEL  unnamed protein product                                 64.3    2e-15
Q556J3_DICDI  unnamed protein product                                 54.3    5e-11
Q8IIF8_PLAF7  unnamed protein product                                 41.6    4e-06


>Q9U3B7_CAEEL unnamed protein product
Length=80

 Score = 64.3 bits (155),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)

Query  26  NMQELTQYVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
           NM +LT  +Q +LQ  QD+FQ +SDQII RID+M  RIDDLEKNI DL+    VE
Sbjct  20  NMNDLTSLIQGVLQQTQDRFQHMSDQIIRRIDDMTTRIDDLEKNINDLLQSNQVE  74


>Q556J3_DICDI unnamed protein product
Length=102

 Score = 54.3 bits (129),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)

Query  33  YVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLM  74
            VQ LL+ MQ +F+ +S+ I+ RIDEMG RID+L+K+I+DLM
Sbjct  32  VVQNLLEQMQSRFEKVSESILTRIDEMGQRIDELDKSISDLM  73


>Q8IIF8_PLAF7 unnamed protein product
Length=113

 Score = 41.6 bits (96),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 36/58 (62%), Gaps = 0/58 (0%)

Query  23   DPKNMQELTQYVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
            +PK  +EL  YV+ +L  ++ K Q++SD ++ ++D M   +D+LE  + +  TQ  ++
Sbjct  56   EPKAGEELEIYVENMLNELKTKMQSLSDNLLNKVDNMEKYLDELENTMMNYTTQNNLQ  113



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584673.1 heat shock factor-binding protein 1 [Cephus cinctus]

Length=84
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3B7_CAEEL  unnamed protein product                                 64.3    2e-15
Q556J3_DICDI  unnamed protein product                                 54.3    5e-11
Q8IIF8_PLAF7  unnamed protein product                                 41.6    4e-06


>Q9U3B7_CAEEL unnamed protein product
Length=80

 Score = 64.3 bits (155),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)

Query  26  NMQELTQYVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
           NM +LT  +Q +LQ  QD+FQ +SDQII RID+M  RIDDLEKNI DL+    VE
Sbjct  20  NMNDLTSLIQGVLQQTQDRFQHMSDQIIRRIDDMTTRIDDLEKNINDLLQSNQVE  74


>Q556J3_DICDI unnamed protein product
Length=102

 Score = 54.3 bits (129),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)

Query  33  YVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLM  74
            VQ LL+ MQ +F+ +S+ I+ RIDEMG RID+L+K+I+DLM
Sbjct  32  VVQNLLEQMQSRFEKVSESILTRIDEMGQRIDELDKSISDLM  73


>Q8IIF8_PLAF7 unnamed protein product
Length=113

 Score = 41.6 bits (96),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 36/58 (62%), Gaps = 0/58 (0%)

Query  23   DPKNMQELTQYVQTLLQNMQDKFQTISDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
            +PK  +EL  YV+ +L  ++ K Q++SD ++ ++D M   +D+LE  + +  TQ  ++
Sbjct  56   EPKAGEELEIYVENMLNELKTKMQSLSDNLLNKVDNMEKYLDELENTMMNYTTQNNLQ  113



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584674.1 vacuolar protein sorting-associated protein 13
isoform X1 [Cephus cinctus]

Length=3281
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS13_DROME  unnamed protein product                                  2214    0.0  
VP13C_DICDI  unnamed protein product                                  214     1e-54
VP13F_DICDI  unnamed protein product                                  144     1e-33


>VPS13_DROME unnamed protein product
Length=3321

 Score = 2214 bits (5736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1297/3435 (38%), Positives = 1955/3435 (57%), Gaps = 291/3435 (8%)

Query  1     MVFESIVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYG  60
             MVFE++VA++LNKVLG+YIENLD  QLK+ +WGGDVVL++L I+E+ALD LDLP++L YG
Sbjct  1     MVFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYG  60

Query  61    RLGKLILKIPFKDIWNGQIDAIIEELFILIVPTSQAKYDAEKEAKAQLAAKRAELARVEK  120
              LGKL+LKIP+K++++  +   IE+L++L+ P +  +Y+AEKEAK ++  K+A L  +E 
Sbjct  61    YLGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEA  120

Query  121   NKQLADIKSQEKLDDSMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSVGFTLNSF  180
              ++      Q K D    EKL A+++ N+ V+I  +H+R+ED  +    PFS G +L+  
Sbjct  121   ARKKELEMDQPKADAGFAEKLTAQIVNNLQVQITNVHLRYEDTTT-TGSPFSFGISLHEL  179

Query  181   ALQSCTDTWTTDGNLKDMYAIQQ---IYKLCTMDGFAVYLNTDIMQFSKEPQISYLHLFS  237
              L      +TTD + +  Y  QQ   ++K+  +   + YLN    Q     +      F 
Sbjct  180   EL------YTTDCDWEKCYMAQQASQVFKIANLSCLSAYLNCG-GQLYANNKSDLSQQFK  232

Query  238   EGIATLDYIPKKYHYLLGPINVKAKLKLNPKPETDGSNYSIPKVWLDLEMQMLRIGLTKC  297
               IA  +  P  Y+Y+LGPI+  AKLKLN  PE D   +  PK+ L LEM+ L +GLT  
Sbjct  233   TNIACKETKPN-YNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNT  291

Query  298   QYQTLMQMGEGLDQAQKAAPYRKYRPDLTSYRGHYKEWWRFAYTCIMEETVRRLRRNWNW  357
             Q+  LM++G+ +++ Q   PYRKYRP    Y+GH ++WW FA T I+EE VR+ R +W W
Sbjct  292   QFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTW  351

Query  358   VNMKEHRDTCRVYAKAYQTKLTTKKVAQDIDKCITDCETKLDIFNLVIIRQQIEMEVERL  417
              ++K HR+ C  YA+ Y+ +  +KK +  + +     ET+LD+FNL++IRQ++ +E+ + 
Sbjct  352   GHIKTHRERCNTYAQKYKEQCLSKKPSAVLTETCRLLETELDVFNLLLIRQRVNIEIAKQ  411

Query  418   AEKEKDLKAKRGWFGFLWGTPPAEDAEELNSAAAIMRKFEEAMTPQEKEKLYRAIDYQEN  477
              E   + K+         G    +D     ++  ++ KFE AMT +EKEK+YRAI YQEN
Sbjct  412   REAVPEQKSGWFSGWGWGGGAKKDDQ---TTSQKLVEKFEAAMTSEEKEKMYRAIGYQEN  468

Query  478   SAPAHYPETYVMIDTKFFLHGLQIVISDTEMSH----------PEVLNLELQGVRVGFKS  527
             + P   PE+Y  I   F L  L++ +   E +           P ++ L           
Sbjct  469   AKPTDLPESYEAIRMNFKLIALEVGLYKDERNSSAATKDFHELPSLVLLNFSMATALITQ  528

Query  528   RPSANAILATASVNDMKLFGVKQEEKVPSLFNSDDGSSDSELFAVSYEKNPLDKLCGDRV  587
             RP+A AI   A + ++K+ G+ + +  P L  S   + +  L  V +E NPLDKLC  RV
Sbjct  529   RPAAEAISIIAGMREIKVTGLTRNDYTPLLVESKI-TDEFNLLEVFFETNPLDKLCDQRV  587

Query  588   IVQSKSVHIVYDAQTIIELVKLFKVQNSSTLSQLQAAAAVQLEGLKEMSALGLEYAIQKH  647
              V ++ + I YDA TI+ L+  F+     TLS+ + AA+ ++   KE SA G++Y I K 
Sbjct  588   KVVARPLQITYDAPTILALINAFQTPGDVTLSKFEDAASTKISNFKERSATGMQYMIDKK  647

Query  648   SALDIQVDLQASQLIVPCGGFYNEKE-SLFVLNLGSLKMRTLEKPKDDKATTNVKELISM  706
             + LD+ + L  + L+VP  G Y+    SL V+++G + + +  +P+  + +  ++ L S 
Sbjct  648   AVLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQVHLSS--QPR--RESNKLQHLFSA  703

Query  707   GKSDEDILTHLRHSSYDKFVLEITNFQALVSFADEDWRSALISDSINSMVLLRPTTLEVQ  766
             G+  ++IL  +  ++YD+F + + + Q LV  A E W++AL   +   M +LRP +L+V 
Sbjct  704   GEDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVT  763

Query  767   FHKCLIMDDPLLPKMRLIGQLPSVVLNVTDTRLLEALKIAQSIPFPEEEENNDLQKSSLS  826
                C++ +DP LP +++   LP++++NV++ R+  A+K+A SIP PE++E       + S
Sbjct  764   AALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEPASRLTQTNS  823

Query  827   KSVSQLSLF--KELTAISTSADKKEESSGP----VKQTIDLEAKFVMKEFTVTVSKQS-D  879
             +S   +S F  KE+  I  SA     S  P    + Q   L+  F + E    + + S  
Sbjct  824   RSSMSISNFINKEVKKIGPSASGSSASKDPLLDEIIQYTSLDVNFSLGEINFVLFQSSRK  883

Query  880   LEISP------------------------------------FLRVEVLQLEAEMLQRTFD  903
              E SP                                     L +++ +LEA  + +T++
Sbjct  884   CETSPDVSIEFLTPDGDVLPSQLTENIQEPIEELPPTPPQQILSIDIRRLEAHFVSKTYE  943

Query  904   QEVTLRLGGVQIKQ----NHKSDEIFMINTPMATGSEEYLIVIQYKNVNKRSPEFVTRHG  959
                T++LG + ++Q    +   D + +I TP    S  YL  +     +K SPEF T++ 
Sbjct  944   SVATVKLGDINLRQYDCQDSDMDVLDVIYTPKQENSSNYLFTVSCTIADKSSPEFSTKYN  1003

Query  960   SVVKLLQLEFTTLDILLHQEALINALKFISSIQDKI------TASNDALNEKAQGKVTRV  1013
             S  +L+   F  L I+LHQE L   ++ +++ Q  +      T   D +     G   + 
Sbjct  1004  STEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLDLVLSSTRPRDRMGSIGGGDGIKR  1063

Query  1014  SHMATIHEDGTSTFIKEHIQRQKANLSTSRRKKKVVECIDLKVNAKFGSISIKMASDFRD  1073
             + +  I ED       + ++R+K       R+  VVE + ++V A    + + +    R 
Sbjct  1064  T-LNVILEDTEEIMTTDQMKRRKKT-----RRTHVVETVKVRVIANLDQVGLVLTGRKRP  1117

Query  1074  ISAFFIEGIAAGFIMKASYSQANATLASINIKDLNTSSAYKNIISVEGTESLQVQAVIYN  1133
             I+   ++   +  I+K+SY++ N  L  I + DLN  + +KNI+S+ G ++   Q VIYN
Sbjct  1118  IAEMNVKKFVSSLIIKSSYTEVNIGLKDIQVLDLNPYTIHKNILSIVGKDAFNCQIVIYN  1177

Query  1134  LE-PWEVDKNNMSIKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQQAIKEASAAAAEAAKT  1192
              E   + + ++M I V +GC +++FLN FV GVMNFLNNF AAQ  I +A AAAAE+A+ 
Sbjct  1178  KEETQDYNSDDMKITVDIGCMKIIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQ  1237

Query  1193  NIKDVQEHATRIELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKLEVTNDAGES  1252
                D  E ATR++L++ +KAP++ VP+ S+  + L++D+G L + N   ++ V  +    
Sbjct  1238  KAMDAYETATRMKLNIRIKAPIIIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEEE-RL  1296

Query  1253  PIVDEMKIDLQNIKLSRVRLNKDNFVLENEV----------LLLQPVSFTLLIKRNLSTA  1302
              ++DE+K+ + ++K+S++ L   N    +EV           ++ P+S TL I RNLS  
Sbjct  1297  AVIDEIKLQICDVKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLSITRNLSYT  1356

Query  1303  WFTSIPDIDMSGRLNLIELLLSQEDYAMVMKVLEGNLGETIEDPNP----PKVVDLRDRR  1358
             W+  +P++++SGRL  IEL L  +DYA+VM VL  NL E +E+  P    P+   +R  R
Sbjct  1357  WYRDVPELNLSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEFPPSEEAPQEAQVRPER  1416

Query  1359  PITEDLEKSRTRKSEMGTIQET-EASDFQEQKNVHTAMKFEFIMDSFVINLFMGGSKTLQ  1417
                        R S  G +  T + S  +E+  +H ++KF F  D  VINL  G      
Sbjct  1417  -----------RNSRAGRLSRTVQVSPIREK--IHESIKFNFQFDGVVINLMEGEGA---  1460

Query  1418  SQASPLHLPENGLAKFSLSHFALKGRMFADGLLATSILLMNCTWDDTRQNRQGSLMTIME  1477
                        GLA+F +   ++KG    +G L+TS++L N   DD R N +  +   + 
Sbjct  1461  -----------GLARFGIYFLSVKGTKLDNGTLSTSVVLCNIQMDDMRSNSKSQIRQYLS  1509

Query  1478  R--ITEPSAENLSSEDEAPSGRS-MVDVTIRKGPNDIFVDVRVFSFSIIISLDYLMKIKD  1534
             R    +P  +     D   + R+ MVDVT     +D F +VRV  F +I+ +D+L+K+  
Sbjct  1510  RKDWVQPKLDTDEIIDACYNERNFMVDVTAIIKEDDTFAEVRVRGFDLIVCIDFLLKLTT  1569

Query  1535  FFNVAPTATDQPISQHSQKGITEAVPKKKMAQTSSPVAAM-----------------ITI  1577
             F  + P    +         ++E     K +  SS + A                  + +
Sbjct  1570  FLTLPPEENPRESVYIKPAPVSETARDTKHSIRSSAILAAQELVPVESSSHEVPNRKMNL  1629

Query  1578  NLHVEKPDIILLEDMDDINSNCIVLNTELLLKLRLVGEHQVITGSIKDLSLSTGVYNPAK  1637
              LH+++PDIIL+E+++D+N++CI+ N ++ L  R + + Q++ G I  L +    + P +
Sbjct  1630  ILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMYMCAFLPER  1689

Query  1638  RSDSIYQVLKPCSISLAGSTPEEKGLHVDVCCTDIHLSVSPGVIEILNRVVQTVTKKEEE  1697
             R  + + +L PC ISL GSTPEE+G+H+ +  +DI ++VSP  IE+LN+ + +V+     
Sbjct  1690  REMTRHYILHPCVISLQGSTPEEEGMHISLKLSDIIINVSPATIELLNKAMLSVSSGTMT  1749

Query  1698  SDEIVKREPNYEGLWIITPFYENNYWFLKTEVAVEAFEDLSLSDDEDTTVYKPELAILSA  1757
                I +   NY  LW    F+   YWF K E  V+A E    S   D    K E  ++  
Sbjct  1750  KCAIAEESRNYSNLWHQHHFHSRTYWFTKVEQGVDALEAEQRSVSTDNEKQKTEKCVIEI  1809

Query  1758  PTILLTLEAGVGNKTLPMLLLHLGFQSNVNDWSSKTMSVEATMTVVMAYYNSCLALWEPL  1817
             P+I L +E+GVG  T P++ L     +  N+W S++++   ++T+ M YYN  LA WEP+
Sbjct  1810  PSITLVIESGVGYYTKPLISLDTRITAVFNNW-SRSLTAHGSLTLNMNYYNQALAEWEPI  1868

Query  1818  IEPMEGI-QDGRRISTPWEIKTKVQFNDLSLGSKGASAVSPSSEIEPEEIQQSTKMSIDV  1876
             IE  E I ++G R  TPWE+K ++          G   V   SE+E +  QQ+  M+I  
Sbjct  1869  IELNEVIGRNGVREYTPWELKFEM----------GMEKV--QSELEDDAEQQAMHMNIH-  1915

Query  1877  LSSENLEITVTKTCLDVLKQLGNAFSNAMEASSKGHSQKMAPYILKNETGLTMTLDLEHS  1936
              S+E LEIT++KTCL +L +L  AFS A++ +       +APY+L+N+TG  + L+L   
Sbjct  1916  -SAETLEITLSKTCLGLLSELAEAFSQAIDQNGLTKPDIVAPYVLENDTGFDVNLNLRKG  1974

Query  1937  CFKV--VDDGMSVTSQQSKGSYSEVILESGATVQLAPKILKK-----------NTEILEQ  1983
              F +  V  G +     S       +L    + ++ P ++K             T+ L  
Sbjct  1975  IFTLHEVHRGGTPVGANS------TLLMVAQSEEVDPSVIKTCTISTGGRAYLQTKDLST  2028

Query  1984  LKAEIVKDSADSKFTVSFKGIPNKLEIPVLRADKRFFSLKYRKEGSEEWGIISDVTVEEG  2043
             L  E   DS D    V+   I  ++ +PV ++D RFF+L  R    E WGIIS+V  E G
Sbjct  2029  LSEE---DSEDYTLYVTIGDINKEIALPVSKSDTRFFNL-MRSTSHEPWGIISEVKQEYG  2084

Query  2044  STIVILRSVLQVHNHFSEPVSVYYM----TKRGNEVECVGTVGPDERLNLPLDAVYAPIN  2099
             +T V +  V+ VHNHF+  +++Y      T +  E   VG V P E  ++PL A+YA   
Sbjct  2085  TTKVNIHGVVSVHNHFTTGLNIYRRNPAPTAQCFEDIFVGRVRPGEVFHVPLHAIYAESK  2144

Query  2100  IYWLFFSVNGYMVSIEPFVWKDLQKTVSMTKVLKCEARSKQENTEPFYIKAVGEIEQVYF  2159
                LFFS+ GY  S++   W      ++ +  L C+  +     EP  + A     +VYF
Sbjct  2145  D--LFFSMRGYRRSVQGISWASNPSDLNYSHQLHCDPTN---TFEPLIMNARRSKSEVYF  2199

Query  2160  ENTSRHTMASTIYNIHLYPSVYFKNFLPINIIICLPGCA---------------------  2198
             ENT+++T+ S  Y IHL P +Y +N LPINI + + GC+                     
Sbjct  2200  ENTNKYTLLSAFYTIHLRPPLYLRNSLPINIQVSVAGCSVRKEDGLDAQSSQRFVDRGYR  2259

Query  2199  -------EEKLLPASKTLQIPTI------DPGKSSIVIKLPQYLEKDWSCKGEILANPPE  2245
                     EK + +   L +PT+         KS +V++L QYLEKDWSC  EI     +
Sbjct  2260  KEDFLDYGEKPVNSGDVLHLPTVRLASKGKESKSFLVVRLVQYLEKDWSCATEIWDYTDD  2319

Query  2246  FAVWSFESFDSAQKVVMDLGMHTSFKHGSIIMALYCPFWMLNKTGLMLSYKKSSKAGKEH  2305
                W+F S+DS  KV MDL + T  +HGS+++ L+ PFWM+NKTG+ML+YK  + +    
Sbjct  2320  VITWTFSSYDSEMKVDMDLYVKTENRHGSLMLTLFSPFWMINKTGMMLTYKSETTS----  2375

Query  2306  SSPIKKLVSNIKPHRSHGRNRKKKGHSSGEDHLNVLYHPETFKGPILFSFSSKAFFGKKK  2365
                                             + VLYHP  + GPILF+F  K FF KKK
Sbjct  2376  --------------------------------VEVLYHPPEYSGPILFTFRDKLFFDKKK  2403

Query  2366  AMIRVEDGEWSDKFSIDVAGSKGVVSCKYNGMTYKIGVHNQLTYNSLTKQITFTPYYVLI  2425
             A IR+++G+WS+K  +DVAGS G V C  N   Y +GVHN LT NSLTKQITF P+Y++ 
Sbjct  2404  ASIRIDNGQWSEKIPLDVAGSVGEVICFANNQKYPVGVHNHLTQNSLTKQITFIPFYIVC  2463

Query  2426  NNADFLMECQEADRPADPLFKVPPGECTALWPRSEHEQKTLKVKVADYPEKTAPFIFTDM  2485
             N   F +E QE  RPADP   + P E   LWPR++  +  L V+V    + T  F FT++
Sbjct  2464  NKCHFDIELQEQSRPADPWLHLEPNEMEPLWPRND-TKNNLVVRVDG--KITPAFDFTEV  2520

Query  2486  HTTLLKL-DNKYGGINVDIQINEGGTYISLSEYTPGSAPALIINHTPQTIHLWEKGSMNV  2544
               TLLKL D+KYGGINVD+Q  EGG YI+ ++Y P  AP L+INHT + I   EKG+ N 
Sbjct  2521  ICTLLKLEDSKYGGINVDVQTTEGGVYITFTDYKPADAPGLLINHTGKQIVYHEKGTKNE  2580

Query  2545  RSVQSFNQMLYTWENPSGPRKIVWEDNNKREIENDLRKNSLGTFQLPETDEEIYFVSFLD  2604
               + + + ++Y W++P+GP+ +V+  N +   E DL+++ +G   + +   ++ +VSFLD
Sbjct  2581  HILNAKSTIMYAWDDPTGPKMLVFGTNKE---ETDLKRDGIGEVIMQDGG-KVLWVSFLD  2636

Query  2605  GIQRVLLFTNNLKIAEDCELAGDLESTEQEITLSIHGIGISLVNNITRTELLYMCIASSG  2664
             G+QRVLLFT N  IA   E    L+S  Q I L IHGIG+S++NN T  ++LY+ + SSG
Sbjct  2637  GLQRVLLFTENESIANRTESTASLQSITQSIDLRIHGIGLSVINNETGLDILYLGVTSSG  2696

Query  2665  IIWEARK--GNRWRALNTREVDLIEEGYQRYMREIQIAKDPTYRIILEPKLEIDYLNMEM  2722
             IIWE++K   NR++ L   E  L+E  YQ+Y+    +    TY+  L+ K  ID+  M +
Sbjct  2697  IIWESKKVTKNRFKELTINENALLEIEYQKYLVHKSVNDVQTYK--LDNKFPIDFDLMIL  2754

Query  2723  LRPHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAPVPPPKSV  2782
              +   + +RR+F   +W+  ++S  Q QLH K+NR+Q+DNQ  + +FPV+LAP+PPPKSV
Sbjct  2755  KKTVERNLRRSFYPAIWLSRKSSPFQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSV  2814

Query  2783  AQTSVMKPFAELSMVKRLLEHSTVQQFRYFKILIQEFHVKVDIGFINGLTGFFETNEVND  2842
             A T+ +KPF E SMV+R++ +STV+QF+Y +ILIQEF  KVD+ F+  +   F   EV+D
Sbjct  2815  ASTTSLKPFIECSMVQRIMPNSTVRQFKYARILIQEFLFKVDLNFLTAIAEMF-AKEVSD  2873

Query  2843  IEESELFQTDMKLVHEPLIYHVNQVRTAEQKNFFDLLHFSPLKIHISFSMAGGGSGPSTL  2902
                ++ F+ D++ +  PL     +    EQK+F+D LH  PLKIH+SFSMA  GS    L
Sbjct  2874  EAAAKQFRQDVESIELPLSAFFEEHSLEEQKSFYDNLHLGPLKIHVSFSMA--GSDTKAL  2931

Query  2903  PPFLNVLLQGIGVTLTDINDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLV  2962
             P FL  L+QG+GVTLTD+ND+VF+LA+FER+Y F + KQLI+E TSHYTGQA+KQLYVLV
Sbjct  2932  PGFLGSLVQGVGVTLTDVNDVVFRLAFFEREYQFFSQKQLINEITSHYTGQALKQLYVLV  2991

Query  2963  LGLDVIGDPYGLVVGTVKGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGA  3022
             LGLDV+G+PYGLVVG  KG+EDLFYEPFQGAIQGPGEFAEGL+LGV+S+ GHTVGG AGA
Sbjct  2992  LGLDVLGNPYGLVVGLKKGVEDLFYEPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGA  3051

Query  3023  VSKITGAMGKGIAALTFDKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVM  3082
             VSKITGAMGKG+AALTFD+DYQ+KR++ +  +P N  E LARS KGLVMGFVDGVTGVV 
Sbjct  3052  VSKITGAMGKGLAALTFDEDYQKKRRQGIQNKPKNFHEGLARSSKGLVMGFVDGVTGVVT  3111

Query  3083  KPISGGKEEGVEGFFKGVGKGMMGLVTRPTAGVIDFASGSLGAVRRATDMGEEVKRTRPP  3142
             KP++G ++ GVEGFFKG+GKG +GLV RPTAGV+DFASGS  AV+RA D  E+VKR RPP
Sbjct  3112  KPVTGARDNGVEGFFKGLGKGAIGLVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPP  3171

Query  3143  RFLQPDSLVRPYVRYEAEGNKILCEVEKGKYANTD--IYFYHIFINKDGLLLTDKRIAFI  3200
             RF   D ++RPY   EA GNKI+ E +KGK+A TD  I+   I    + L++T+ R+ ++
Sbjct  3172  RFQHYDFVLRPYCLMEATGNKIMKETDKGKFATTDNFIHCEEIIQKSEYLVVTNYRVMYV  3231

Query  3201  QHSDLFGGWKVDWAYTWPEISSNPRIVDKGVQINIKDNAKKKKLTNFFGNTDLIKIILIP  3260
             Q +++FG W   W+Y W EISS      +GVQ  +K +  KK L  F       K++L+ 
Sbjct  3232  QRNEMFGVWTSLWSYLWNEISSVAATA-RGVQFTVKTDG-KKVLGLFSSKESPRKLVLVA  3289

Query  3261  DYNERQLLCRKIQEQ  3275
             D  +R  L   I+ Q
Sbjct  3290  DERKRDALVDIIESQ  3304


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 214 bits (544),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 244/519 (47%), Gaps = 68/519 (13%)

Query  2725  PHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAPV--------  2776
             P R+ I      GL ++ + S     +  KV+ LQID+Q     FPV L           
Sbjct  3252  PTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDLQIDDQRYSTNFPVFLCQSKKINHSIN  3311

Query  2777  -------PPPKSVA----------------QTSVMKPFAELSMVKRLLEHSTVQQFRYFK  2813
                      P+S                  Q   +KPF + S   R L++S +  FRYF 
Sbjct  3312  QQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQKLKPFLQFSAT-RTLKYSNIMFFRYFS  3370

Query  2814  ILIQEFHVKVDIGFINGLTGFFETNEVNDIEESELFQTDMKLVHEPLIYHVNQVRTAEQK  2873
             ILIQEF + +D   I     F   N +N + E   F     +  E ++   N        
Sbjct  3371  ILIQEFDINLDEASILNALSFININ-LNSLNEH--FTLHPTITQEEILETKNASNIENHM  3427

Query  2874  NFFDLLHFSPLKIHISF----------SMAGGGS------GPSTLPPFLNVLLQGIGVTL  2917
              +F++LH +P+K+++SF          ++ G  S      G  +  PFLN+    I    
Sbjct  3428  VYFEMLHINPVKMNLSFISCKSPKETQAILGARSLAELLIGFKSNSPFLNIERAPI----  3483

Query  2918  TDINDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVG  2977
                     K   F  ++ F++ +Q+I E + H++ Q + Q + +    D IG+P  L   
Sbjct  3484  --------KFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFGSFDFIGNPIRLAES  3535

Query  2978  TVKGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAAL  3037
                G +D F+EP  G ++ P +FA GL  G  S++ ++V G A + SKITG + KG+  L
Sbjct  3536  LGSGFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADSTSKITGTISKGLVQL  3595

Query  3038  TFDKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGG-KEEGVEGF  3096
             + D  Y ++RQE   ++P  ++E L    +    G + G+TG++ +P  G  +E+  EGF
Sbjct  3596  SLDDSYIKERQESNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDEPYKGATQEKSWEGF  3655

Query  3097  FKGVGKGMMGLVTRPTAGVIDFASGSLGAVRRATDMGE---EVKRTRPPRFLQPDSLVRP  3153
             FKG+GKG++G+  +PT GV D  S +   ++ +T + +   ++KR R PR+   +  +  
Sbjct  3656  FKGIGKGVLGVAVKPTVGVFDLVSKTSEGIKNSTTVAKSLSQIKRRRIPRYFPREGTLST  3715

Query  3154  YVRYEAEGNKILCEVEKGKYANTDIYFYHIFINKDGLLL  3192
             Y ++++ G+ IL   + G     D Y +H  +N   L+L
Sbjct  3716  YNQFKSIGSFILYS-KIGPPPTHDWYVFHTILNYKDLIL  3753


 Score = 123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 203/447 (45%), Gaps = 64/447 (14%)

Query  6    IVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYGRLGKL  65
            I A +L K LG+Y+++L+   +KLS   G+ VL+DL IK++ L      + ++   + KL
Sbjct  5    IAASVLTKYLGDYVDDLNKDNIKLSFLSGEAVLQDLKIKKTVLQSFLPNVIVKQAIIKKL  64

Query  66   ILKIPFKDIWNGQIDAIIEELFILIVPTS--------QAKYDAEKEAKAQ----LAAKRA  113
             L +P+KD+        IE +++L   TS        + K+  EK+AK      L   + 
Sbjct  65   SLHVPWKDLKGKPAIIKIEGIYVL-AETSVEFDEQYYKKKFQDEKQAKLHIQEVLRLNKQ  123

Query  114  ELARVEKNKQLADIKSQEKLDDSMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSV  173
            +L    ++       S E   ++   KLL  ++ N+ + I  +H+RFED V+ ++  FS 
Sbjct  124  QLKNPHQSTTTTTTTSDE--SNTFGSKLLQTVVDNLQLYIDSVHIRFEDSVNRRS--FSF  179

Query  174  GFTLNSFALQSCTDTWTTDGNLKDMYAIQQIYKLCTMDGFAVYLNTDIMQFSKEPQISYL  233
            G TLNS   +S   TW     +K+   I  I+KL  ++  ++Y N      S  P++ Y 
Sbjct  180  GVTLNSLVAESTDQTWNPTF-IKNESTI--IHKLINLNQLSIYWN------SNSPKLKYT  230

Query  234  HL--FSEGIAT-------------------------------LDYIPKKYHYLLGPINVK  260
            ++   S+ + +                               L    +K  Y++ PI+ K
Sbjct  231  NIDDLSQKLKSMIKKEDSGKQQQQQQQQQGEEQDDEIEEDYFLSTESRKQQYIIDPISAK  290

Query  261  AKLKLNPKPETDGSNYSIPKVWLDLEMQMLRIGLTKCQYQTLMQMGEGLDQAQKAAPYRK  320
             K+ +N   ++   +  IPK  L+ E     I L+  QY+ +  + E     +K+  +R 
Sbjct  291  LKVVIN---KSIIPSEVIPKYNLNFEFDKTDISLSDYQYKDITGILESFKLFEKSIEFRS  347

Query  321  YRPDLTSYRGHYKEWWRFAYTCIMEETVRRLRRNWNWVNMKEHRDTCRVYAKAYQTKLTT  380
             RP  T+ +   ++WW +A  C++++ V + R   +W  +KE     R Y + ++ KL  
Sbjct  348  ARPINTTIKQSPRKWWNYAIQCVLQK-VHQKRYTQSWSYIKEFLSDKRDYIELFK-KLKK  405

Query  381  KKVAQDIDKCITDCETKLDIFNLVIIR  407
            K + Q     +   E KL    ++  R
Sbjct  406  KTIHQTEQTRLDSLEWKLPFDQILFFR  432


 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 67/134 (50%), Gaps = 13/134 (10%)

Query  1140  DKNNMSIKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQQAIKEASAAAAEAAKTNIKDVQE  1199
             D N+  +K+ +   R +FL  F   +  FLNN    ++ +K +  +AA         + +
Sbjct  1395  DNNSQMLKINLSSIRFIFLKRFTEELRLFLNNVNMMREYLKSSIYSAATV-------ISQ  1447

Query  1200  HATRIELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKL------EVTNDAGESP  1253
             + + +   + ++ P + +P++S S+   ++D+G + I N  +K+      E+     E  
Sbjct  1448  NRSTLFYEIEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEKIIPTSTGEIDMILMEPV  1507

Query  1254  IVDEMKIDLQNIKL  1267
             I++ + I+ QNIKL
Sbjct  1508  IIENIIIEAQNIKL  1521


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/235 (23%), Positives = 101/235 (43%), Gaps = 52/235 (22%)

Query  2272  HGSIIMALYCPFWMLNKTGLMLSYKKS------SKAGKEHSSPIKKL--VSNIKPHRSHG  2323
             +GS  + LYC +W++N+TGL L ++          AG+  +  I+ +   +++KP  S  
Sbjct  2696  NGSRFVTLYCEYWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHESTSMKPTDSRN  2755

Query  2324  RNRKKKGHSSGEDHLNVLYHPETFKGPILFSFSSKAFFGKKKAMIRVEDGEWSDKFSI--  2381
                K+  H S                P +F++S  +  G K ++ ++ D  WS  FS+  
Sbjct  2756  WYTKEWNHPS---------------QPFMFAYSDNSIVGGKFSL-KIYDSNWSSPFSLIS  2799

Query  2382  --------------------DVAGSKGVVSCKYNGMT-YKIGVHNQLTYNS---LTKQIT  2417
                                 ++    G ++ +    T Y + V + L  NS    TK +T
Sbjct  2800  SQSSSNSNIEISEDRTDEEKEIKNVIGTITKRQPLKTNYNLSV-SILPSNSKFWRTKVVT  2858

Query  2418  FTPYYVLINNADFLMECQEADRPADPLFKVPPGECTALWPRSEHEQKTLKVKVAD  2472
             F+P Y+++N+  F +  Q+ D  ++    +        +P S HE K +++ + D
Sbjct  2859  FSPMYLMVNSTRFRILYQQFDCDSNTQSIIQDQSLPFQFPSSRHE-KLIRIGILD  2912


>VP13F_DICDI unnamed protein product
Length=4246

 Score = 144 bits (364),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/476 (22%), Positives = 217/476 (46%), Gaps = 66/476 (14%)

Query  2718  LNMEMLRPHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAP--  2775
             +++ ++  H K +      GL ++++    +  ++  ++  ++DNQL    +PV++    
Sbjct  3665  ISVSLIDGHPKELMYITLRGLQLRFKQYSTEQNINLSIHSFKVDNQLYHTPYPVMIQSYN  3724

Query  2776  ---VPPPKSVAQTSVMKPFAELSMVKRLLEHSTVQQFRYFKILIQEFHVKVDIGFINGLT  2832
                + P K     S+++         + L    ++  +     IQ F V++D   +  L 
Sbjct  3725  SNNLKPTKHSFNVSLIR---SGQYQPKELHQVGIEYIKELNFDIQPFDVEIDETILFHLY  3781

Query  2833  GFFET----------------------NEVNDIEESELFQTDMKLVHE--------PLIY  2862
              F ++                      N +++ +E E  + D K++          P+ +
Sbjct  3782  NFIKSIKLPNNQNNNNNQNNNNQNNDFNNIDEYDEKE--KNDGKIIKSIKLPYSNLPIPH  3839

Query  2863  HVNQVRTAEQKNFFDLLHFSPLKIHISFSMAGGGSGPSTLP---PFLNVLLQGIGVTLTD  2919
              ++  R      + ++L+   + + IS+ ++     P + P   P+ +V       T+ +
Sbjct  3840  SIDSKRL-----YIEVLNLPLVDVTISYCLS-----PHSRPLIGPWASVF-----STIAN  3884

Query  2920  INDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVGTV  2979
             I+     L  ++ ++ F+T   L     SHY  +  K    ++L  DV G P  LV    
Sbjct  3885  IDKASLHLGSWKLEHQFVTANALALSLFSHYKWEVSK----ILLYSDVFGAPLSLVENIT  3940

Query  2980  KGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAALTF  3039
             +GI D  YE  +G +  P  F +GL+ G +S++ +++ G+  + SK+T  +G  IA  + 
Sbjct  3941  RGINDFIYESKEG-LNNPENFGKGLVKGTKSLVSNSIYGIFNSASKLTNTVGSAIAPFSM  3999

Query  3040  DKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGGKEEGVEGFFKG  3099
             D++Y  +R      QP +  + ++        G   G++G+  +P+   +++G  G  KG
Sbjct  4000  DENYLAQRDRH--TQPKHAIDGVSNGIGRFTQGLAHGLSGLFDQPVKEFQDQGFSGLVKG  4057

Query  3100  VGKGMMGLVTRPTAGVIDFASGSLGAVRRA-TDMGEEVKRTRPPRFLQPDSLVRPY  3154
              GKG++G V +PT G ID  + +   +R +  D      R+RPPRF+ PD++++P+
Sbjct  4058  FGKGILGTVVKPTVGAIDMINAATQGIRNSYLDPASSKSRSRPPRFIGPDAIIKPF  4113


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 88/153 (58%), Gaps = 6/153 (4%)

Query  2    VFESIVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYGR  61
            +FESIV+ LL + L EYI+ L+   L +S+W G+V L++L +K  AL+  +LP  ++ G 
Sbjct  1    MFESIVSNLLTRYLKEYIKALNTDNLNISIWSGNVSLENLELKSRALEKFNLPFTIKEGF  60

Query  62   LGKLILKIPFKDIWNGQIDAIIEELFILIVPTSQAKYDAEKEAKAQLAAKRA----ELAR  117
            LGKL LKIP+ ++    +  +I++L+I   P S   ++ E E        +     E  +
Sbjct  61   LGKLSLKIPWNNLKTEPVIVVIDQLYITASPKSTTVWNEEDEDLLLQKKLKKLKIYEALK  120

Query  118  VEKNKQLADIKSQEKLDDSMI--EKLLARMIKN  148
             EK K+   +K + ++ +++I  ++L  + IKN
Sbjct  121  EEKRKKQQQLKEKREIRNNLIKEKRLQKKQIKN  153


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 68/302 (23%), Positives = 123/302 (41%), Gaps = 45/302 (15%)

Query  136  SMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSVGFTLNSFALQSCTDTWTTDGNL  195
            S  EKL  +++ N+ + I  +H+RFED V+    P+  G TL     QS  + W     +
Sbjct  297  SFAEKLRNKIVDNLQIMIYNVHIRFEDSVTNPTTPYCFGVTLEHLLAQSSNEEWKPSF-I  355

Query  196  KDMYAIQQIYKLCTMDGFAVYLNTDIMQFSKEPQISYLHL--FSEGIATL----------  243
               + +  ++KL T+   ++Y + D    + +P ++Y  +  F   +  L          
Sbjct  356  HTPHTL--VHKLITLQNLSIYWDAD----NDKPDLNYKSISEFKSLMTKLIPKKSSPSTT  409

Query  244  -------------DYIPKKYHYLLGPINVKAKLKLNPKPETDGSNYSIPKVWLDLEMQML  290
                           I  +++YLL P+    KL +N   ++   N  IP    + E   +
Sbjct  410  TTTPPISPPPKETQLIKPQHNYLLHPVCGSLKLLIN---KSIIPNKYIPLYTANFEFDEI  466

Query  291  RIGLTKCQYQTLMQMGEGLDQAQKAAPYRKYRPDLTSYRGHY----KEWWRFAYTCIMEE  346
             + L   QY  ++ + +     +K   YRK++   T   G      K+ W FA  CI+ +
Sbjct  467  NLELESKQYSGILALVDWFTTQKKGERYRKFK---TKESGGVLKTAKDRWEFAGKCILAD  523

Query  347  TVRRLRRNWNWVNMKEHRDTCRVYAKAYQTKLTTKKVAQDIDKC-ITDCETKLDIFNLVI  405
               ++R+ W      + R     Y   Y+ K   KK   D++   +   E +    +LV 
Sbjct  524  VRDKIRK-WTPQFFDKRRKDRLDYIHLYKLK-KRKKTLSDLNTTKLNSLEKEYSFEDLVY  581

Query  406  IR  407
             R
Sbjct  582  FR  583


 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 89/162 (55%), Gaps = 11/162 (7%)

Query  562   DGSSDSE---------LFAVSYEKNPLDKLCGDRVIVQSKSVHIVYDAQTIIELVKLFKV  612
             DGS D E         LF+++ ++NPL+      + +++  + +VY+   +  +++ F  
Sbjct  1002  DGSGDYENNTNDEKQPLFSMTLQQNPLNSESDFSIFIEALPLEVVYNKSMMDAILEFFGN  1061

Query  613   QNSSTLSQLQAAAAVQLEGLKEMSALGLEYAIQKHSALDIQVDLQASQLIVPCGGFYNEK  672
               S TL +++ AA  Q++  K+ + L +++ ++ H ++D+ +++ A  +++P   F    
Sbjct  1062  APSDTLKEIEEAARNQIKIFKDKTTLRIQHELENHKSIDLDININAPHVLIP-ESFTIPS  1120

Query  673   ESLFVLNLGSLKMRTLEKPKDDKATTNVKELISMGKSDEDIL  714
               + VL+LGS  ++++   KDD  +  + E+ S+ K+D  I+
Sbjct  1121  APILVLDLGSFSVQSVVTHKDDTLSEEI-EISSILKNDFSII  1161


 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 98/212 (46%), Gaps = 23/212 (11%)

Query  1146  IKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQ--QAIKEASAAAAEAAKTNIKDVQEHATR  1203
             I V M   +++ + + +  ++++   F   Q  Q + +++  A E   T   + Q+   R
Sbjct  1847  IGVRMSSVKLIVVRSLIDRIIDYFEEFAPNQIDQILADSAKGAVEIMSTRRINQQK---R  1903

Query  1204  IELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKLEVTNDAGESPIVDEMKIDLQ  1263
             I   V++  P +  P N  S + ++ D+G++++ N  K     ++ G++ I+   ++   
Sbjct  1904  ILFEVDVNTPRIIFPKNHYSPYVIIADLGHISVFNKYKSNLTNSNGGDNTILSSEQV---  1960

Query  1264  NIKLSRVRLNKDNF----VLENEVLLLQPVSFTLLIKRNLSTAWFTSI--------PDID  1311
              +  S V  +   F    VLE+ +   +P+S  + +  N+ +    S+        P   
Sbjct  1961  FVYASSVNFHACKFQNGKVLESTI---EPISNKINVHVNIESFLNPSLLEEDQLDEPKQK  2017

Query  1312  MSGRLNLIELLLSQEDYAMVMKVLEGNLGETI  1343
             + G ++ I L +S + Y++ + +++  +  TI
Sbjct  2018  VDGEISPINLKISDQQYSLTIAIIKSLIEPTI  2049


 Score = 40.0 bits (92),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 34/149 (23%), Positives = 73/149 (49%), Gaps = 24/149 (16%)

Query  870   FTVT-VSKQSDLEISPFLRVEVLQLEAEMLQRTFDQEVTLRLGGVQIK---QNHKSDEI-  924
             F+VT VS Q   +  PF+R+ +  + A++L+RTFD  + L L  + I+   Q+ K++   
Sbjct  1473  FSVTTVSLQVVEDDKPFIRMILSDISAQVLKRTFDTSIKLSLAKLSIEDLYQDFKNESFK  1532

Query  925   FMINTPMATGS---------------EEYLIVIQYKNVNKRSPEFVTRHGSVVKLLQLEF  969
             ++ N+ +                   EE+LI I   +V + SP++      + + + + F
Sbjct  1533  YLANSSIDNNQQPLQSELENSSGIEREEHLISISISSVQRNSPQY----SGISQQIDVSF  1588

Query  970   TTLDILLHQEALINALKFISSIQDKITAS  998
              TL + ++++ +I  +  +  ++  I  +
Sbjct  1589  NTLFVNINKKLVIKIMNLVDFVEKTIVET  1617


 Score = 37.0 bits (84),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 33/201 (16%)

Query  1755  LSAPTILLTLEAGVGNKTLPMLLLHLGFQSNVNDWSSKTMSVEAT-------MTVVMAYY  1807
               +P++ LT+    GNK   ++           D   + +SVE         M +   Y+
Sbjct  2522  FQSPSVELTVINDYGNKYCGII-----------DLKIRDISVEVAQNRVLFAMFIAANYF  2570

Query  1808  NSCLALWEPLIEPMEGIQDGRRISTPWEIKTKVQFNDLSLGSKGASAVSPSSEI--EPEE  1865
             N   ++WEP+IE   G + G   S   EI TK Q  ++ + S G   ++ +  +      
Sbjct  2571  NVSKSVWEPMIEEW-GCKFGIETS---EIGTKDQSKNIVISSSGKLNLNITKSLFDTFTT  2626

Query  1866  IQQSTKMSIDVLSSENLEITVTKTCLDVLKQLGNAFSNAMEASSKGHSQKMAPYILKNET  1925
             I    ++++D+  +++     T++  D+  + G   +N +    K  SQ   P++LKN+T
Sbjct  2627  IYPLIEIAMDISKADS-----TQSAYDLGYKTG--VNNNLLQHYK--SQNYHPFLLKNQT  2677

Query  1926  GLTMTLDLEHSCFKVVDDGMS  1946
             GL +   +   C     D  S
Sbjct  2678  GLEIQYQISIICASSFGDTQS  2698


 Score = 33.9 bits (76),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 12/69 (17%)

Query  722   YDKFVLEITNFQALVSFADEDWRSALISDSINSMVLLRPTTLEVQFHKCLIMDDPLLPKM  781
             YD F L++ N Q  ++   E            S+ L+    +  + +KC+I    LL K+
Sbjct  1274  YDLFELKLNNIQFYIASQGE------------SLQLVEKFDINFKIYKCIIKSQTLLSKL  1321

Query  782   RLIGQLPSV  790
             +L G LPS+
Sbjct  1322  KLFGGLPSL  1330



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


Query= XP_015584675.1 vacuolar protein sorting-associated protein 13
isoform X2 [Cephus cinctus]

Length=3259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS13_DROME  unnamed protein product                                  2224    0.0  
VP13C_DICDI  unnamed protein product                                  214     9e-55
VP13F_DICDI  unnamed protein product                                  144     9e-34


>VPS13_DROME unnamed protein product
Length=3321

 Score = 2224 bits (5762),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1297/3413 (38%), Positives = 1955/3413 (57%), Gaps = 269/3413 (8%)

Query  1     MVFESIVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYG  60
             MVFE++VA++LNKVLG+YIENLD  QLK+ +WGGDVVL++L I+E+ALD LDLP++L YG
Sbjct  1     MVFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYG  60

Query  61    RLGKLILKIPFKDIWNGQIDAIIEELFILIVPTSQAKYDAEKEAKAQLAAKRAELARVEK  120
              LGKL+LKIP+K++++  +   IE+L++L+ P +  +Y+AEKEAK ++  K+A L  +E 
Sbjct  61    YLGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEA  120

Query  121   NKQLADIKSQEKLDDSMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSVGFTLNSF  180
              ++      Q K D    EKL A+++ N+ V+I  +H+R+ED  +    PFS G +L+  
Sbjct  121   ARKKELEMDQPKADAGFAEKLTAQIVNNLQVQITNVHLRYEDTTT-TGSPFSFGISLHEL  179

Query  181   ALQSCTDTWTTDGNLKDMYAIQQ---IYKLCTMDGFAVYLNTDIMQFSKEPQISYLHLFS  237
              L      +TTD + +  Y  QQ   ++K+  +   + YLN    Q     +      F 
Sbjct  180   EL------YTTDCDWEKCYMAQQASQVFKIANLSCLSAYLNCG-GQLYANNKSDLSQQFK  232

Query  238   EGIATLDYIPKKYHYLLGPINVKAKLKLNPKPETDGSNYSIPKVWLDLEMQMLRIGLTKC  297
               IA  +  P  Y+Y+LGPI+  AKLKLN  PE D   +  PK+ L LEM+ L +GLT  
Sbjct  233   TNIACKETKPN-YNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNT  291

Query  298   QYQTLMQMGEGLDQAQKAAPYRKYRPDLTSYRGHYKEWWRFAYTCIMEETVRRLRRNWNW  357
             Q+  LM++G+ +++ Q   PYRKYRP    Y+GH ++WW FA T I+EE VR+ R +W W
Sbjct  292   QFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTW  351

Query  358   VNMKEHRDTCRVYAKAYQTKLTTKKVAQDIDKCITDCETKLDIFNLVIIRQQIEMEVERL  417
              ++K HR+ C  YA+ Y+ +  +KK +  + +     ET+LD+FNL++IRQ++ +E+ + 
Sbjct  352   GHIKTHRERCNTYAQKYKEQCLSKKPSAVLTETCRLLETELDVFNLLLIRQRVNIEIAKQ  411

Query  418   AEKEKDLKAKRGWFGFLWGTPPAEDAEELNSAAAIMRKFEEAMTPQEKEKLYRAIDYQEN  477
              E   + K+         G    +D     ++  ++ KFE AMT +EKEK+YRAI YQEN
Sbjct  412   REAVPEQKSGWFSGWGWGGGAKKDDQ---TTSQKLVEKFEAAMTSEEKEKMYRAIGYQEN  468

Query  478   SAPAHYPETYVMIDTKFFLHGLQIVISDTEMSH----------PEVLNLELQGVRVGFKS  527
             + P   PE+Y  I   F L  L++ +   E +           P ++ L           
Sbjct  469   AKPTDLPESYEAIRMNFKLIALEVGLYKDERNSSAATKDFHELPSLVLLNFSMATALITQ  528

Query  528   RPSANAILATASVNDMKLFGVKQEEKVPSLFNSDDGSSDSELFAVSYEKNPLDKLCGDRV  587
             RP+A AI   A + ++K+ G+ + +  P L  S   + +  L  V +E NPLDKLC  RV
Sbjct  529   RPAAEAISIIAGMREIKVTGLTRNDYTPLLVESKI-TDEFNLLEVFFETNPLDKLCDQRV  587

Query  588   IVQSKSVHIVYDAQTIIELVKLFKVQNSSTLSQLQAAAAVQLEGLKEMSALGLEYAIQKH  647
              V ++ + I YDA TI+ L+  F+     TLS+ + AA+ ++   KE SA G++Y I K 
Sbjct  588   KVVARPLQITYDAPTILALINAFQTPGDVTLSKFEDAASTKISNFKERSATGMQYMIDKK  647

Query  648   SALDIQVDLQASQLIVPCGGFYNEKE-SLFVLNLGSLKMRTLEKPKDDKATTNVKELISM  706
             + LD+ + L  + L+VP  G Y+    SL V+++G + + +  +P+  + +  ++ L S 
Sbjct  648   AVLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQVHLSS--QPR--RESNKLQHLFSA  703

Query  707   GKSDEDILTHLRHSSYDKFVLEITNFQALVSFADEDWRSALISDSINSMVLLRPTTLEVQ  766
             G+  ++IL  +  ++YD+F + + + Q LV  A E W++AL   +   M +LRP +L+V 
Sbjct  704   GEDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVT  763

Query  767   FHKCLIMDDPLLPKMRLIGQLPSVVLNVTDTRLLEALKIAQSIPFPEEEENNDLQKSSLS  826
                C++ +DP LP +++   LP++++NV++ R+  A+K+A SIP PE++E       + S
Sbjct  764   AALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEPASRLTQTNS  823

Query  827   KSVSQLSLF--KELTAISTSADKKEESSGP----VKQTIDLEAKFVMKEFTVTVSKQS-D  879
             +S   +S F  KE+  I  SA     S  P    + Q   L+  F + E    + + S  
Sbjct  824   RSSMSISNFINKEVKKIGPSASGSSASKDPLLDEIIQYTSLDVNFSLGEINFVLFQSSRK  883

Query  880   LEISP------------------------------------FLRVEVLQLEAEMLQRTFD  903
              E SP                                     L +++ +LEA  + +T++
Sbjct  884   CETSPDVSIEFLTPDGDVLPSQLTENIQEPIEELPPTPPQQILSIDIRRLEAHFVSKTYE  943

Query  904   QEVTLRLGGVQIKQ----NHKSDEIFMINTPMATGSEEYLIVIQYKNVNKRSPEFVTRHG  959
                T++LG + ++Q    +   D + +I TP    S  YL  +     +K SPEF T++ 
Sbjct  944   SVATVKLGDINLRQYDCQDSDMDVLDVIYTPKQENSSNYLFTVSCTIADKSSPEFSTKYN  1003

Query  960   SVVKLLQLEFTTLDILLHQEALINALKFISSIQDKI------TASNDALNEKAQGKVTRV  1013
             S  +L+   F  L I+LHQE L   ++ +++ Q  +      T   D +     G   + 
Sbjct  1004  STEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLDLVLSSTRPRDRMGSIGGGDGIKR  1063

Query  1014  SHMATIHEDGTSTFIKEHIQRQKANLSTSRRKKKVVECIDLKVNAKFGSISIKMASDFRD  1073
             + +  I ED       + ++R+K       R+  VVE + ++V A    + + +    R 
Sbjct  1064  T-LNVILEDTEEIMTTDQMKRRKKT-----RRTHVVETVKVRVIANLDQVGLVLTGRKRP  1117

Query  1074  ISAFFIEGIAAGFIMKASYSQANATLASINIKDLNTSSAYKNIISVEGTESLQVQAVIYN  1133
             I+   ++   +  I+K+SY++ N  L  I + DLN  + +KNI+S+ G ++   Q VIYN
Sbjct  1118  IAEMNVKKFVSSLIIKSSYTEVNIGLKDIQVLDLNPYTIHKNILSIVGKDAFNCQIVIYN  1177

Query  1134  LE-PWEVDKNNMSIKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQQAIKEASAAAAEAAKT  1192
              E   + + ++M I V +GC +++FLN FV GVMNFLNNF AAQ  I +A AAAAE+A+ 
Sbjct  1178  KEETQDYNSDDMKITVDIGCMKIIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQ  1237

Query  1193  NIKDVQEHATRIELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKLEVTNDAGES  1252
                D  E ATR++L++ +KAP++ VP+ S+  + L++D+G L + N   ++ V  +    
Sbjct  1238  KAMDAYETATRMKLNIRIKAPIIIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEEE-RL  1296

Query  1253  PIVDEMKIDLQNIKLSRVRLNKDNFVLENEV----------LLLQPVSFTLLIKRNLSTA  1302
              ++DE+K+ + ++K+S++ L   N    +EV           ++ P+S TL I RNLS  
Sbjct  1297  AVIDEIKLQICDVKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLSITRNLSYT  1356

Query  1303  WFTSIPDIDMSGRLNLIELLLSQEDYAMVMKVLEGNLGETIEDPNP----PKVVDLRDRR  1358
             W+  +P++++SGRL  IEL L  +DYA+VM VL  NL E +E+  P    P+   +R  R
Sbjct  1357  WYRDVPELNLSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEFPPSEEAPQEAQVRPER  1416

Query  1359  PITEDLEKSRTRKSEMGTIQET-EASDFQEQKNVHTAMKFEFIMDSFVINLFMGGSKTLQ  1417
                        R S  G +  T + S  +E+  +H ++KF F  D  VINL  G      
Sbjct  1417  -----------RNSRAGRLSRTVQVSPIREK--IHESIKFNFQFDGVVINLMEGEGA---  1460

Query  1418  SQASPLHLPENGLAKFSLSHFALKGRMFADGLLATSILLMNCTWDDTRQNRQGSLMTIME  1477
                        GLA+F +   ++KG    +G L+TS++L N   DD R N +  +   + 
Sbjct  1461  -----------GLARFGIYFLSVKGTKLDNGTLSTSVVLCNIQMDDMRSNSKSQIRQYLS  1509

Query  1478  R--ITEPSAENLSSEDEAPSGRS-MVDVTIRKGPNDIFVDVRVFSFSIIISLDYLMKIKD  1534
             R    +P  +     D   + R+ MVDVT     +D F +VRV  F +I+ +D+L+K+  
Sbjct  1510  RKDWVQPKLDTDEIIDACYNERNFMVDVTAIIKEDDTFAEVRVRGFDLIVCIDFLLKLTT  1569

Query  1535  FFNVAPTATDQPISQHSQKGITEAVPKKKMAQTSSPVAAM-----------------ITI  1577
             F  + P    +         ++E     K +  SS + A                  + +
Sbjct  1570  FLTLPPEENPRESVYIKPAPVSETARDTKHSIRSSAILAAQELVPVESSSHEVPNRKMNL  1629

Query  1578  NLHVEKPDIILLEDMDDINSNCIVLNTELLLKLRLVGEHQVITGSIKDLSLSTGVYNPAK  1637
              LH+++PDIIL+E+++D+N++CI+ N ++ L  R + + Q++ G I  L +    + P +
Sbjct  1630  ILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMYMCAFLPER  1689

Query  1638  RSDSIYQVLKPCSISLAGSTPEEKGLHVDVCCTDIHLSVSPGVIEILNRVVQTVTKKEEE  1697
             R  + + +L PC ISL GSTPEE+G+H+ +  +DI ++VSP  IE+LN+ + +V+     
Sbjct  1690  REMTRHYILHPCVISLQGSTPEEEGMHISLKLSDIIINVSPATIELLNKAMLSVSSGTMT  1749

Query  1698  SDEIVKREPNYEGLWIITPFYENNYWFLKTEVAVEAFEDLSLSDDEDTTVYKPELAILSA  1757
                I +   NY  LW    F+   YWF K E  V+A E    S   D    K E  ++  
Sbjct  1750  KCAIAEESRNYSNLWHQHHFHSRTYWFTKVEQGVDALEAEQRSVSTDNEKQKTEKCVIEI  1809

Query  1758  PTILLTLEAGVGNKTLPMLLLHLGFQSNVNDWSSKTMSVEATMTVVMAYYNSCLALWEPL  1817
             P+I L +E+GVG  T P++ L     +  N+W S++++   ++T+ M YYN  LA WEP+
Sbjct  1810  PSITLVIESGVGYYTKPLISLDTRITAVFNNW-SRSLTAHGSLTLNMNYYNQALAEWEPI  1868

Query  1818  IEPMEGI-QDGRRISTPWEIKTKVQFNDLSLGSKGASAVSPSSEIEPEEIQQSTKMSIDV  1876
             IE  E I ++G R  TPWE+K ++          G   V   SE+E +  QQ+  M+I  
Sbjct  1869  IELNEVIGRNGVREYTPWELKFEM----------GMEKV--QSELEDDAEQQAMHMNIH-  1915

Query  1877  LSSENLEITVTKTCLDVLKQLGNAFSNAMEASSKGHSQKMAPYILKNETGLTMTLDLEHS  1936
              S+E LEIT++KTCL +L +L  AFS A++ +       +APY+L+N+TG  + L+L   
Sbjct  1916  -SAETLEITLSKTCLGLLSELAEAFSQAIDQNGLTKPDIVAPYVLENDTGFDVNLNLRKG  1974

Query  1937  CFKV--VDDGMSVTSQQSKGSYSEVILESGATVQLAPKILKK-----------NTEILEQ  1983
              F +  V  G +     S       +L    + ++ P ++K             T+ L  
Sbjct  1975  IFTLHEVHRGGTPVGANS------TLLMVAQSEEVDPSVIKTCTISTGGRAYLQTKDLST  2028

Query  1984  LKAEIVKDSADSKFTVSFKGIPNKLEIPVLRADKRFFSLKYRKEGSEEWGIISDVTVEEG  2043
             L  E   DS D    V+   I  ++ +PV ++D RFF+L  R    E WGIIS+V  E G
Sbjct  2029  LSEE---DSEDYTLYVTIGDINKEIALPVSKSDTRFFNL-MRSTSHEPWGIISEVKQEYG  2084

Query  2044  STIVILRSVLQVHNHFSEPVSVYYM----TKRGNEVECVGTVGPDERLNLPLDAVYAPIN  2099
             +T V +  V+ VHNHF+  +++Y      T +  E   VG V P E  ++PL A+YA   
Sbjct  2085  TTKVNIHGVVSVHNHFTTGLNIYRRNPAPTAQCFEDIFVGRVRPGEVFHVPLHAIYAESK  2144

Query  2100  IYWLFFSVNGYMVSIEPFVWKDLQKTVSMTKVLKCEARSKQENTEPFYIKAVGEIEQVYF  2159
                LFFS+ GY  S++   W      ++ +  L C+  +     EP  + A     +VYF
Sbjct  2145  D--LFFSMRGYRRSVQGISWASNPSDLNYSHQLHCDPTN---TFEPLIMNARRSKSEVYF  2199

Query  2160  ENTSRHTMASTIYNIHLYPSVYFKNFLPINIIICLPGCA---------------------  2198
             ENT+++T+ S  Y IHL P +Y +N LPINI + + GC+                     
Sbjct  2200  ENTNKYTLLSAFYTIHLRPPLYLRNSLPINIQVSVAGCSVRKEDGLDAQSSQRFVDRGYR  2259

Query  2199  -------EEKLLPASKTLQIPTI------DPGKSSIVIKLPQYLEKDWSCKGEILANPPE  2245
                     EK + +   L +PT+         KS +V++L QYLEKDWSC  EI     +
Sbjct  2260  KEDFLDYGEKPVNSGDVLHLPTVRLASKGKESKSFLVVRLVQYLEKDWSCATEIWDYTDD  2319

Query  2246  FAVWSFESFDSAQKVVMDLGMHTSFKHGSIIMALYCPFWMLNKTGLMLSYKKSSKAGKEH  2305
                W+F S+DS  KV MDL + T  +HGS+++ L+ PFWM+NKTG+ML+YK  + +    
Sbjct  2320  VITWTFSSYDSEMKVDMDLYVKTENRHGSLMLTLFSPFWMINKTGMMLTYKSETTS----  2375

Query  2306  SSPIKSGEDHLNVLYHPETFKGPILFSFSSKAFFGKKKAMIRVEDGEWSDKFSIDVAGSK  2365
                       + VLYHP  + GPILF+F  K FF KKKA IR+++G+WS+K  +DVAGS 
Sbjct  2376  ----------VEVLYHPPEYSGPILFTFRDKLFFDKKKASIRIDNGQWSEKIPLDVAGSV  2425

Query  2366  GVVSCKYNGMTYKIGVHNQLTYNSLTKQITFTPYYVLINNADFLMECQEADRPADPLFKV  2425
             G V C  N   Y +GVHN LT NSLTKQITF P+Y++ N   F +E QE  RPADP   +
Sbjct  2426  GEVICFANNQKYPVGVHNHLTQNSLTKQITFIPFYIVCNKCHFDIELQEQSRPADPWLHL  2485

Query  2426  PPGECTALWPRSEHEQKTLKVKVADYPEKTAPFIFTDMHTTLLKL-DNKYGGINVDIQIN  2484
              P E   LWPR++  +  L V+V    + T  F FT++  TLLKL D+KYGGINVD+Q  
Sbjct  2486  EPNEMEPLWPRND-TKNNLVVRVDG--KITPAFDFTEVICTLLKLEDSKYGGINVDVQTT  2542

Query  2485  EGGTYISLSEYTPGSAPALIINHTPQTIHLWEKGSMNVRSVQSFNQMLYTWENPSGPRKI  2544
             EGG YI+ ++Y P  AP L+INHT + I   EKG+ N   + + + ++Y W++P+GP+ +
Sbjct  2543  EGGVYITFTDYKPADAPGLLINHTGKQIVYHEKGTKNEHILNAKSTIMYAWDDPTGPKML  2602

Query  2545  VWEDNNKREIENDLRKNSLGTFQLPETDEEIYFVSFLDGIQRVLLFTNNLKIAEDCELAG  2604
             V+  N +   E DL+++ +G   + +   ++ +VSFLDG+QRVLLFT N  IA   E   
Sbjct  2603  VFGTNKE---ETDLKRDGIGEVIMQDGG-KVLWVSFLDGLQRVLLFTENESIANRTESTA  2658

Query  2605  DLESTEQEITLSIHGIGISLVNNITRTELLYMCIASSGIIWEARK--GNRWRALNTREVD  2662
              L+S  Q I L IHGIG+S++NN T  ++LY+ + SSGIIWE++K   NR++ L   E  
Sbjct  2659  SLQSITQSIDLRIHGIGLSVINNETGLDILYLGVTSSGIIWESKKVTKNRFKELTINENA  2718

Query  2663  LIEEGYQRYMREIQIAKDPTYRIILEPKLEIDYLNMEMLRPHRKYIRRTFQTGLWVQYRT  2722
             L+E  YQ+Y+    +    TY+  L+ K  ID+  M + +   + +RR+F   +W+  ++
Sbjct  2719  LLEIEYQKYLVHKSVNDVQTYK--LDNKFPIDFDLMILKKTVERNLRRSFYPAIWLSRKS  2776

Query  2723  SIHQVQLHAKVNRLQIDNQLSEHVFPVILAPVPPPKSVAQTSVMKPFAELSMVKRLLEHS  2782
             S  Q QLH K+NR+Q+DNQ  + +FPV+LAP+PPPKSVA T+ +KPF E SMV+R++ +S
Sbjct  2777  SPFQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNS  2836

Query  2783  TVQQFRYFKILIQEFHVKVDIGFINGLTGFFETNEVNDIEESELFQTDMKLVHEPLIYHV  2842
             TV+QF+Y +ILIQEF  KVD+ F+  +   F   EV+D   ++ F+ D++ +  PL    
Sbjct  2837  TVRQFKYARILIQEFLFKVDLNFLTAIAEMF-AKEVSDEAAAKQFRQDVESIELPLSAFF  2895

Query  2843  NQVRTAEQKNFFDLLHFSPLKIHISFSMAGGGSGPSTLPPFLNVLLQGIGVTLTDINDIV  2902
              +    EQK+F+D LH  PLKIH+SFSMA  GS    LP FL  L+QG+GVTLTD+ND+V
Sbjct  2896  EEHSLEEQKSFYDNLHLGPLKIHVSFSMA--GSDTKALPGFLGSLVQGVGVTLTDVNDVV  2953

Query  2903  FKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVGTVKGIED  2962
             F+LA+FER+Y F + KQLI+E TSHYTGQA+KQLYVLVLGLDV+G+PYGLVVG  KG+ED
Sbjct  2954  FRLAFFEREYQFFSQKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVED  3013

Query  2963  LFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAALTFDKDYQ  3022
             LFYEPFQGAIQGPGEFAEGL+LGV+S+ GHTVGG AGAVSKITGAMGKG+AALTFD+DYQ
Sbjct  3014  LFYEPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQ  3073

Query  3023  RKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGGKEEGVEGFFKGVGKGM  3082
             +KR++ +  +P N  E LARS KGLVMGFVDGVTGVV KP++G ++ GVEGFFKG+GKG 
Sbjct  3074  KKRRQGIQNKPKNFHEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGA  3133

Query  3083  MGLVTRPTAGVIDFASGSLGAVRRATDMGEEVKRTRPPRFLQPDSLVRPYVRYEAEGNKI  3142
             +GLV RPTAGV+DFASGS  AV+RA D  E+VKR RPPRF   D ++RPY   EA GNKI
Sbjct  3134  IGLVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATGNKI  3193

Query  3143  LCEVEKGKYANTD--IYFYHIFINKDGLLLTDKRIAFIQHSDLFGGWKVDWAYTWPEISS  3200
             + E +KGK+A TD  I+   I    + L++T+ R+ ++Q +++FG W   W+Y W EISS
Sbjct  3194  MKETDKGKFATTDNFIHCEEIIQKSEYLVVTNYRVMYVQRNEMFGVWTSLWSYLWNEISS  3253

Query  3201  NPRIVDKGVQINIKDNAKKKKLTNFFGNTDLIKIILIPDYNERQLLCRKIQEQ  3253
                   +GVQ  +K +  KK L  F       K++L+ D  +R  L   I+ Q
Sbjct  3254  VAATA-RGVQFTVKTDG-KKVLGLFSSKESPRKLVLVADERKRDALVDIIESQ  3304


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 214 bits (544),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 244/519 (47%), Gaps = 68/519 (13%)

Query  2703  PHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAPV--------  2754
             P R+ I      GL ++ + S     +  KV+ LQID+Q     FPV L           
Sbjct  3252  PTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDLQIDDQRYSTNFPVFLCQSKKINHSIN  3311

Query  2755  -------PPPKSVA----------------QTSVMKPFAELSMVKRLLEHSTVQQFRYFK  2791
                      P+S                  Q   +KPF + S   R L++S +  FRYF 
Sbjct  3312  QQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQKLKPFLQFSAT-RTLKYSNIMFFRYFS  3370

Query  2792  ILIQEFHVKVDIGFINGLTGFFETNEVNDIEESELFQTDMKLVHEPLIYHVNQVRTAEQK  2851
             ILIQEF + +D   I     F   N +N + E   F     +  E ++   N        
Sbjct  3371  ILIQEFDINLDEASILNALSFININ-LNSLNEH--FTLHPTITQEEILETKNASNIENHM  3427

Query  2852  NFFDLLHFSPLKIHISF----------SMAGGGS------GPSTLPPFLNVLLQGIGVTL  2895
              +F++LH +P+K+++SF          ++ G  S      G  +  PFLN+    I    
Sbjct  3428  VYFEMLHINPVKMNLSFISCKSPKETQAILGARSLAELLIGFKSNSPFLNIERAPI----  3483

Query  2896  TDINDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVG  2955
                     K   F  ++ F++ +Q+I E + H++ Q + Q + +    D IG+P  L   
Sbjct  3484  --------KFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFGSFDFIGNPIRLAES  3535

Query  2956  TVKGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAAL  3015
                G +D F+EP  G ++ P +FA GL  G  S++ ++V G A + SKITG + KG+  L
Sbjct  3536  LGSGFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADSTSKITGTISKGLVQL  3595

Query  3016  TFDKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGG-KEEGVEGF  3074
             + D  Y ++RQE   ++P  ++E L    +    G + G+TG++ +P  G  +E+  EGF
Sbjct  3596  SLDDSYIKERQESNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDEPYKGATQEKSWEGF  3655

Query  3075  FKGVGKGMMGLVTRPTAGVIDFASGSLGAVRRATDMGE---EVKRTRPPRFLQPDSLVRP  3131
             FKG+GKG++G+  +PT GV D  S +   ++ +T + +   ++KR R PR+   +  +  
Sbjct  3656  FKGIGKGVLGVAVKPTVGVFDLVSKTSEGIKNSTTVAKSLSQIKRRRIPRYFPREGTLST  3715

Query  3132  YVRYEAEGNKILCEVEKGKYANTDIYFYHIFINKDGLLL  3170
             Y ++++ G+ IL   + G     D Y +H  +N   L+L
Sbjct  3716  YNQFKSIGSFILYS-KIGPPPTHDWYVFHTILNYKDLIL  3753


 Score = 123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 203/447 (45%), Gaps = 64/447 (14%)

Query  6    IVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYGRLGKL  65
            I A +L K LG+Y+++L+   +KLS   G+ VL+DL IK++ L      + ++   + KL
Sbjct  5    IAASVLTKYLGDYVDDLNKDNIKLSFLSGEAVLQDLKIKKTVLQSFLPNVIVKQAIIKKL  64

Query  66   ILKIPFKDIWNGQIDAIIEELFILIVPTS--------QAKYDAEKEAKAQ----LAAKRA  113
             L +P+KD+        IE +++L   TS        + K+  EK+AK      L   + 
Sbjct  65   SLHVPWKDLKGKPAIIKIEGIYVL-AETSVEFDEQYYKKKFQDEKQAKLHIQEVLRLNKQ  123

Query  114  ELARVEKNKQLADIKSQEKLDDSMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSV  173
            +L    ++       S E   ++   KLL  ++ N+ + I  +H+RFED V+ ++  FS 
Sbjct  124  QLKNPHQSTTTTTTTSDE--SNTFGSKLLQTVVDNLQLYIDSVHIRFEDSVNRRS--FSF  179

Query  174  GFTLNSFALQSCTDTWTTDGNLKDMYAIQQIYKLCTMDGFAVYLNTDIMQFSKEPQISYL  233
            G TLNS   +S   TW     +K+   I  I+KL  ++  ++Y N      S  P++ Y 
Sbjct  180  GVTLNSLVAESTDQTWNPTF-IKNESTI--IHKLINLNQLSIYWN------SNSPKLKYT  230

Query  234  HL--FSEGIAT-------------------------------LDYIPKKYHYLLGPINVK  260
            ++   S+ + +                               L    +K  Y++ PI+ K
Sbjct  231  NIDDLSQKLKSMIKKEDSGKQQQQQQQQQGEEQDDEIEEDYFLSTESRKQQYIIDPISAK  290

Query  261  AKLKLNPKPETDGSNYSIPKVWLDLEMQMLRIGLTKCQYQTLMQMGEGLDQAQKAAPYRK  320
             K+ +N   ++   +  IPK  L+ E     I L+  QY+ +  + E     +K+  +R 
Sbjct  291  LKVVIN---KSIIPSEVIPKYNLNFEFDKTDISLSDYQYKDITGILESFKLFEKSIEFRS  347

Query  321  YRPDLTSYRGHYKEWWRFAYTCIMEETVRRLRRNWNWVNMKEHRDTCRVYAKAYQTKLTT  380
             RP  T+ +   ++WW +A  C++++ V + R   +W  +KE     R Y + ++ KL  
Sbjct  348  ARPINTTIKQSPRKWWNYAIQCVLQK-VHQKRYTQSWSYIKEFLSDKRDYIELFK-KLKK  405

Query  381  KKVAQDIDKCITDCETKLDIFNLVIIR  407
            K + Q     +   E KL    ++  R
Sbjct  406  KTIHQTEQTRLDSLEWKLPFDQILFFR  432


 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 67/134 (50%), Gaps = 13/134 (10%)

Query  1140  DKNNMSIKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQQAIKEASAAAAEAAKTNIKDVQE  1199
             D N+  +K+ +   R +FL  F   +  FLNN    ++ +K +  +AA         + +
Sbjct  1395  DNNSQMLKINLSSIRFIFLKRFTEELRLFLNNVNMMREYLKSSIYSAATV-------ISQ  1447

Query  1200  HATRIELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKL------EVTNDAGESP  1253
             + + +   + ++ P + +P++S S+   ++D+G + I N  +K+      E+     E  
Sbjct  1448  NRSTLFYEIEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEKIIPTSTGEIDMILMEPV  1507

Query  1254  IVDEMKIDLQNIKL  1267
             I++ + I+ QNIKL
Sbjct  1508  IIENIIIEAQNIKL  1521


 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/223 (23%), Positives = 94/223 (42%), Gaps = 50/223 (22%)

Query  2272  HGSIIMALYCPFWMLNKTGLMLSYKKS------SKAGKE--------HSS----PIKSGE  2313
             +GS  + LYC +W++N+TGL L ++          AG+         H S    P  S  
Sbjct  2696  NGSRFVTLYCEYWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHESTSMKPTDSRN  2755

Query  2314  DHLNVLYHPETFKGPILFSFSSKAFFGKKKAMIRVEDGEWSDKFSI--------------  2359
              +     HP     P +F++S  +  G K ++ ++ D  WS  FS+              
Sbjct  2756  WYTKEWNHPSQ---PFMFAYSDNSIVGGKFSL-KIYDSNWSSPFSLISSQSSSNSNIEIS  2811

Query  2360  --------DVAGSKGVVSCKYNGMT-YKIGVHNQLTYNS---LTKQITFTPYYVLINNAD  2407
                     ++    G ++ +    T Y + V + L  NS    TK +TF+P Y+++N+  
Sbjct  2812  EDRTDEEKEIKNVIGTITKRQPLKTNYNLSV-SILPSNSKFWRTKVVTFSPMYLMVNSTR  2870

Query  2408  FLMECQEADRPADPLFKVPPGECTALWPRSEHEQKTLKVKVAD  2450
             F +  Q+ D  ++    +        +P S HE K +++ + D
Sbjct  2871  FRILYQQFDCDSNTQSIIQDQSLPFQFPSSRHE-KLIRIGILD  2912


>VP13F_DICDI unnamed protein product
Length=4246

 Score = 144 bits (364),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 105/476 (22%), Positives = 217/476 (46%), Gaps = 66/476 (14%)

Query  2696  LNMEMLRPHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAP--  2753
             +++ ++  H K +      GL ++++    +  ++  ++  ++DNQL    +PV++    
Sbjct  3665  ISVSLIDGHPKELMYITLRGLQLRFKQYSTEQNINLSIHSFKVDNQLYHTPYPVMIQSYN  3724

Query  2754  ---VPPPKSVAQTSVMKPFAELSMVKRLLEHSTVQQFRYFKILIQEFHVKVDIGFINGLT  2810
                + P K     S+++         + L    ++  +     IQ F V++D   +  L 
Sbjct  3725  SNNLKPTKHSFNVSLIR---SGQYQPKELHQVGIEYIKELNFDIQPFDVEIDETILFHLY  3781

Query  2811  GFFET----------------------NEVNDIEESELFQTDMKLVHE--------PLIY  2840
              F ++                      N +++ +E E  + D K++          P+ +
Sbjct  3782  NFIKSIKLPNNQNNNNNQNNNNQNNDFNNIDEYDEKE--KNDGKIIKSIKLPYSNLPIPH  3839

Query  2841  HVNQVRTAEQKNFFDLLHFSPLKIHISFSMAGGGSGPSTLP---PFLNVLLQGIGVTLTD  2897
              ++  R      + ++L+   + + IS+ ++     P + P   P+ +V       T+ +
Sbjct  3840  SIDSKRL-----YIEVLNLPLVDVTISYCLS-----PHSRPLIGPWASVF-----STIAN  3884

Query  2898  INDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVGTV  2957
             I+     L  ++ ++ F+T   L     SHY  +  K    ++L  DV G P  LV    
Sbjct  3885  IDKASLHLGSWKLEHQFVTANALALSLFSHYKWEVSK----ILLYSDVFGAPLSLVENIT  3940

Query  2958  KGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAALTF  3017
             +GI D  YE  +G +  P  F +GL+ G +S++ +++ G+  + SK+T  +G  IA  + 
Sbjct  3941  RGINDFIYESKEG-LNNPENFGKGLVKGTKSLVSNSIYGIFNSASKLTNTVGSAIAPFSM  3999

Query  3018  DKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGGKEEGVEGFFKG  3077
             D++Y  +R      QP +  + ++        G   G++G+  +P+   +++G  G  KG
Sbjct  4000  DENYLAQRDRH--TQPKHAIDGVSNGIGRFTQGLAHGLSGLFDQPVKEFQDQGFSGLVKG  4057

Query  3078  VGKGMMGLVTRPTAGVIDFASGSLGAVRRA-TDMGEEVKRTRPPRFLQPDSLVRPY  3132
              GKG++G V +PT G ID  + +   +R +  D      R+RPPRF+ PD++++P+
Sbjct  4058  FGKGILGTVVKPTVGAIDMINAATQGIRNSYLDPASSKSRSRPPRFIGPDAIIKPF  4113


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 88/153 (58%), Gaps = 6/153 (4%)

Query  2    VFESIVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYGR  61
            +FESIV+ LL + L EYI+ L+   L +S+W G+V L++L +K  AL+  +LP  ++ G 
Sbjct  1    MFESIVSNLLTRYLKEYIKALNTDNLNISIWSGNVSLENLELKSRALEKFNLPFTIKEGF  60

Query  62   LGKLILKIPFKDIWNGQIDAIIEELFILIVPTSQAKYDAEKEAKAQLAAKRA----ELAR  117
            LGKL LKIP+ ++    +  +I++L+I   P S   ++ E E        +     E  +
Sbjct  61   LGKLSLKIPWNNLKTEPVIVVIDQLYITASPKSTTVWNEEDEDLLLQKKLKKLKIYEALK  120

Query  118  VEKNKQLADIKSQEKLDDSMI--EKLLARMIKN  148
             EK K+   +K + ++ +++I  ++L  + IKN
Sbjct  121  EEKRKKQQQLKEKREIRNNLIKEKRLQKKQIKN  153


 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 68/302 (23%), Positives = 123/302 (41%), Gaps = 45/302 (15%)

Query  136  SMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSVGFTLNSFALQSCTDTWTTDGNL  195
            S  EKL  +++ N+ + I  +H+RFED V+    P+  G TL     QS  + W     +
Sbjct  297  SFAEKLRNKIVDNLQIMIYNVHIRFEDSVTNPTTPYCFGVTLEHLLAQSSNEEWKPSF-I  355

Query  196  KDMYAIQQIYKLCTMDGFAVYLNTDIMQFSKEPQISYLHL--FSEGIATL----------  243
               + +  ++KL T+   ++Y + D    + +P ++Y  +  F   +  L          
Sbjct  356  HTPHTL--VHKLITLQNLSIYWDAD----NDKPDLNYKSISEFKSLMTKLIPKKSSPSTT  409

Query  244  -------------DYIPKKYHYLLGPINVKAKLKLNPKPETDGSNYSIPKVWLDLEMQML  290
                           I  +++YLL P+    KL +N   ++   N  IP    + E   +
Sbjct  410  TTTPPISPPPKETQLIKPQHNYLLHPVCGSLKLLIN---KSIIPNKYIPLYTANFEFDEI  466

Query  291  RIGLTKCQYQTLMQMGEGLDQAQKAAPYRKYRPDLTSYRGHY----KEWWRFAYTCIMEE  346
             + L   QY  ++ + +     +K   YRK++   T   G      K+ W FA  CI+ +
Sbjct  467  NLELESKQYSGILALVDWFTTQKKGERYRKFK---TKESGGVLKTAKDRWEFAGKCILAD  523

Query  347  TVRRLRRNWNWVNMKEHRDTCRVYAKAYQTKLTTKKVAQDIDKC-ITDCETKLDIFNLVI  405
               ++R+ W      + R     Y   Y+ K   KK   D++   +   E +    +LV 
Sbjct  524  VRDKIRK-WTPQFFDKRRKDRLDYIHLYKLK-KRKKTLSDLNTTKLNSLEKEYSFEDLVY  581

Query  406  IR  407
             R
Sbjct  582  FR  583


 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 89/162 (55%), Gaps = 11/162 (7%)

Query  562   DGSSDSE---------LFAVSYEKNPLDKLCGDRVIVQSKSVHIVYDAQTIIELVKLFKV  612
             DGS D E         LF+++ ++NPL+      + +++  + +VY+   +  +++ F  
Sbjct  1002  DGSGDYENNTNDEKQPLFSMTLQQNPLNSESDFSIFIEALPLEVVYNKSMMDAILEFFGN  1061

Query  613   QNSSTLSQLQAAAAVQLEGLKEMSALGLEYAIQKHSALDIQVDLQASQLIVPCGGFYNEK  672
               S TL +++ AA  Q++  K+ + L +++ ++ H ++D+ +++ A  +++P   F    
Sbjct  1062  APSDTLKEIEEAARNQIKIFKDKTTLRIQHELENHKSIDLDININAPHVLIP-ESFTIPS  1120

Query  673   ESLFVLNLGSLKMRTLEKPKDDKATTNVKELISMGKSDEDIL  714
               + VL+LGS  ++++   KDD  +  + E+ S+ K+D  I+
Sbjct  1121  APILVLDLGSFSVQSVVTHKDDTLSEEI-EISSILKNDFSII  1161


 Score = 44.3 bits (103),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 98/212 (46%), Gaps = 23/212 (11%)

Query  1146  IKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQ--QAIKEASAAAAEAAKTNIKDVQEHATR  1203
             I V M   +++ + + +  ++++   F   Q  Q + +++  A E   T   + Q+   R
Sbjct  1847  IGVRMSSVKLIVVRSLIDRIIDYFEEFAPNQIDQILADSAKGAVEIMSTRRINQQK---R  1903

Query  1204  IELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKLEVTNDAGESPIVDEMKIDLQ  1263
             I   V++  P +  P N  S + ++ D+G++++ N  K     ++ G++ I+   ++   
Sbjct  1904  ILFEVDVNTPRIIFPKNHYSPYVIIADLGHISVFNKYKSNLTNSNGGDNTILSSEQV---  1960

Query  1264  NIKLSRVRLNKDNF----VLENEVLLLQPVSFTLLIKRNLSTAWFTSI--------PDID  1311
              +  S V  +   F    VLE+ +   +P+S  + +  N+ +    S+        P   
Sbjct  1961  FVYASSVNFHACKFQNGKVLESTI---EPISNKINVHVNIESFLNPSLLEEDQLDEPKQK  2017

Query  1312  MSGRLNLIELLLSQEDYAMVMKVLEGNLGETI  1343
             + G ++ I L +S + Y++ + +++  +  TI
Sbjct  2018  VDGEISPINLKISDQQYSLTIAIIKSLIEPTI  2049


 Score = 40.0 bits (92),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 34/149 (23%), Positives = 73/149 (49%), Gaps = 24/149 (16%)

Query  870   FTVT-VSKQSDLEISPFLRVEVLQLEAEMLQRTFDQEVTLRLGGVQIK---QNHKSDEI-  924
             F+VT VS Q   +  PF+R+ +  + A++L+RTFD  + L L  + I+   Q+ K++   
Sbjct  1473  FSVTTVSLQVVEDDKPFIRMILSDISAQVLKRTFDTSIKLSLAKLSIEDLYQDFKNESFK  1532

Query  925   FMINTPMATGS---------------EEYLIVIQYKNVNKRSPEFVTRHGSVVKLLQLEF  969
             ++ N+ +                   EE+LI I   +V + SP++      + + + + F
Sbjct  1533  YLANSSIDNNQQPLQSELENSSGIEREEHLISISISSVQRNSPQY----SGISQQIDVSF  1588

Query  970   TTLDILLHQEALINALKFISSIQDKITAS  998
              TL + ++++ +I  +  +  ++  I  +
Sbjct  1589  NTLFVNINKKLVIKIMNLVDFVEKTIVET  1617


 Score = 37.4 bits (85),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 33/201 (16%)

Query  1755  LSAPTILLTLEAGVGNKTLPMLLLHLGFQSNVNDWSSKTMSVEAT-------MTVVMAYY  1807
               +P++ LT+    GNK   ++           D   + +SVE         M +   Y+
Sbjct  2522  FQSPSVELTVINDYGNKYCGII-----------DLKIRDISVEVAQNRVLFAMFIAANYF  2570

Query  1808  NSCLALWEPLIEPMEGIQDGRRISTPWEIKTKVQFNDLSLGSKGASAVSPSSEI--EPEE  1865
             N   ++WEP+IE   G + G   S   EI TK Q  ++ + S G   ++ +  +      
Sbjct  2571  NVSKSVWEPMIEEW-GCKFGIETS---EIGTKDQSKNIVISSSGKLNLNITKSLFDTFTT  2626

Query  1866  IQQSTKMSIDVLSSENLEITVTKTCLDVLKQLGNAFSNAMEASSKGHSQKMAPYILKNET  1925
             I    ++++D+  +++     T++  D+  + G   +N +    K  SQ   P++LKN+T
Sbjct  2627  IYPLIEIAMDISKADS-----TQSAYDLGYKTG--VNNNLLQHYK--SQNYHPFLLKNQT  2677

Query  1926  GLTMTLDLEHSCFKVVDDGMS  1946
             GL +   +   C     D  S
Sbjct  2678  GLEIQYQISIICASSFGDTQS  2698


 Score = 33.9 bits (76),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 12/69 (17%)

Query  722   YDKFVLEITNFQALVSFADEDWRSALISDSINSMVLLRPTTLEVQFHKCLIMDDPLLPKM  781
             YD F L++ N Q  ++   E            S+ L+    +  + +KC+I    LL K+
Sbjct  1274  YDLFELKLNNIQFYIASQGE------------SLQLVEKFDINFKIYKCIIKSQTLLSKL  1321

Query  782   RLIGQLPSV  790
             +L G LPS+
Sbjct  1322  KLFGGLPSL  1330



Lambda      K        H
   0.332    0.144    0.451 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4477352264


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584677.1 vacuolar protein sorting-associated protein 13
isoform X3 [Cephus cinctus]

Length=3245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS13_DROME  unnamed protein product                                  2233    0.0  
VP13C_DICDI  unnamed protein product                                  214     1e-54
VP13F_DICDI  unnamed protein product                                  144     1e-33


>VPS13_DROME unnamed protein product
Length=3321

 Score = 2233 bits (5786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1298/3399 (38%), Positives = 1954/3399 (57%), Gaps = 255/3399 (8%)

Query  1     MVFESIVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYG  60
             MVFE++VA++LNKVLG+YIENLD  QLK+ +WGGDVVL++L I+E+ALD LDLP++L YG
Sbjct  1     MVFEAVVADVLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYG  60

Query  61    RLGKLILKIPFKDIWNGQIDAIIEELFILIVPTSQAKYDAEKEAKAQLAAKRAELARVEK  120
              LGKL+LKIP+K++++  +   IE+L++L+ P +  +Y+AEKEAK ++  K+A L  +E 
Sbjct  61    YLGKLVLKIPWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEA  120

Query  121   NKQLADIKSQEKLDDSMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSVGFTLNSF  180
              ++      Q K D    EKL A+++ N+ V+I  +H+R+ED  +    PFS G +L+  
Sbjct  121   ARKKELEMDQPKADAGFAEKLTAQIVNNLQVQITNVHLRYEDTTT-TGSPFSFGISLHEL  179

Query  181   ALQSCTDTWTTDGNLKDMYAIQQ---IYKLCTMDGFAVYLNTDIMQFSKEPQISYLHLFS  237
              L      +TTD + +  Y  QQ   ++K+  +   + YLN    Q     +      F 
Sbjct  180   EL------YTTDCDWEKCYMAQQASQVFKIANLSCLSAYLNCG-GQLYANNKSDLSQQFK  232

Query  238   EGIATLDYIPKKYHYLLGPINVKAKLKLNPKPETDGSNYSIPKVWLDLEMQMLRIGLTKC  297
               IA  +  P  Y+Y+LGPI+  AKLKLN  PE D   +  PK+ L LEM+ L +GLT  
Sbjct  233   TNIACKETKPN-YNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNT  291

Query  298   QYQTLMQMGEGLDQAQKAAPYRKYRPDLTSYRGHYKEWWRFAYTCIMEETVRRLRRNWNW  357
             Q+  LM++G+ +++ Q   PYRKYRP    Y+GH ++WW FA T I+EE VR+ R +W W
Sbjct  292   QFDNLMKLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAITSILEEEVRKPRESWTW  351

Query  358   VNMKEHRDTCRVYAKAYQTKLTTKKVAQDIDKCITDCETKLDIFNLVIIRQQIEMEVERL  417
              ++K HR+ C  YA+ Y+ +  +KK +  + +     ET+LD+FNL++IRQ++ +E+ + 
Sbjct  352   GHIKTHRERCNTYAQKYKEQCLSKKPSAVLTETCRLLETELDVFNLLLIRQRVNIEIAKQ  411

Query  418   AEKEKDLKAKRGWFGFLWGTPPAEDAEELNSAAAIMRKFEEAMTPQEKEKLYRAIDYQEN  477
              E   + K+         G    +D     ++  ++ KFE AMT +EKEK+YRAI YQEN
Sbjct  412   REAVPEQKSGWFSGWGWGGGAKKDDQ---TTSQKLVEKFEAAMTSEEKEKMYRAIGYQEN  468

Query  478   SAPAHYPETYVMIDTKFFLHGLQIVISDTEMSH----------PEVLNLELQGVRVGFKS  527
             + P   PE+Y  I   F L  L++ +   E +           P ++ L           
Sbjct  469   AKPTDLPESYEAIRMNFKLIALEVGLYKDERNSSAATKDFHELPSLVLLNFSMATALITQ  528

Query  528   RPSANAILATASVNDMKLFGVKQEEKVPSLFNSDDGSSDSELFAVSYEKNPLDKLCGDRV  587
             RP+A AI   A + ++K+ G+ + +  P L  S   + +  L  V +E NPLDKLC  RV
Sbjct  529   RPAAEAISIIAGMREIKVTGLTRNDYTPLLVESKI-TDEFNLLEVFFETNPLDKLCDQRV  587

Query  588   IVQSKSVHIVYDAQTIIELVKLFKVQNSSTLSQLQAAAAVQLEGLKEMSALGLEYAIQKH  647
              V ++ + I YDA TI+ L+  F+     TLS+ + AA+ ++   KE SA G++Y I K 
Sbjct  588   KVVARPLQITYDAPTILALINAFQTPGDVTLSKFEDAASTKISNFKERSATGMQYMIDKK  647

Query  648   SALDIQVDLQASQLIVPCGGFYNEKE-SLFVLNLGSLKMRTLEKPKDDKATTNVKELISM  706
             + LD+ + L  + L+VP  G Y+    SL V+++G + + +  +P+  + +  ++ L S 
Sbjct  648   AVLDVDILLMPNILVVPHKGVYDAGNVSLLVVSMGQVHLSS--QPR--RESNKLQHLFSA  703

Query  707   GKSDEDILTHLRHSSYDKFVLEITNFQALVSFADEDWRSALISDSINSMVLLRPTTLEVQ  766
             G+  ++IL  +  ++YD+F + + + Q LV  A E W++AL   +   M +LRP +L+V 
Sbjct  704   GEDKDEILKTVMENAYDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVT  763

Query  767   FHKCLIMDDPLLPKMRLIGQLPSVVLNVTDTRLLEALKIAQSIPFPEEEENNDLQKSSLS  826
                C++ +DP LP +++   LP++++NV++ R+  A+K+A SIP PE++E       + S
Sbjct  764   AALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEPASRLTQTNS  823

Query  827   KSVSQLSLF--KELTAISTSADKKEESSGP----VKQTIDLEAKFVMKEFTVTVSKQS-D  879
             +S   +S F  KE+  I  SA     S  P    + Q   L+  F + E    + + S  
Sbjct  824   RSSMSISNFINKEVKKIGPSASGSSASKDPLLDEIIQYTSLDVNFSLGEINFVLFQSSRK  883

Query  880   LEISP------------------------------------FLRVEVLQLEAEMLQRTFD  903
              E SP                                     L +++ +LEA  + +T++
Sbjct  884   CETSPDVSIEFLTPDGDVLPSQLTENIQEPIEELPPTPPQQILSIDIRRLEAHFVSKTYE  943

Query  904   QEVTLRLGGVQIKQ----NHKSDEIFMINTPMATGSEEYLIVIQYKNVNKRSPEFVTRHG  959
                T++LG + ++Q    +   D + +I TP    S  YL  +     +K SPEF T++ 
Sbjct  944   SVATVKLGDINLRQYDCQDSDMDVLDVIYTPKQENSSNYLFTVSCTIADKSSPEFSTKYN  1003

Query  960   SVVKLLQLEFTTLDILLHQEALINALKFISSIQDKI------TASNDALNEKAQGKVTRV  1013
             S  +L+   F  L I+LHQE L   ++ +++ Q  +      T   D +     G   + 
Sbjct  1004  STEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLDLVLSSTRPRDRMGSIGGGDGIKR  1063

Query  1014  SHMATIHEDGTSTFIKEHIQRQKANLSTSRRKKKVVECIDLKVNAKFGSISIKMASDFRD  1073
             + +  I ED       + ++R+K       R+  VVE + ++V A    + + +    R 
Sbjct  1064  T-LNVILEDTEEIMTTDQMKRRKKT-----RRTHVVETVKVRVIANLDQVGLVLTGRKRP  1117

Query  1074  ISAFFIEGIAAGFIMKASYSQANATLASINIKDLNTSSAYKNIISVEGTESLQVQAVIYN  1133
             I+   ++   +  I+K+SY++ N  L  I + DLN  + +KNI+S+ G ++   Q VIYN
Sbjct  1118  IAEMNVKKFVSSLIIKSSYTEVNIGLKDIQVLDLNPYTIHKNILSIVGKDAFNCQIVIYN  1177

Query  1134  LE-PWEVDKNNMSIKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQQAIKEASAAAAEAAKT  1192
              E   + + ++M I V +GC +++FLN FV GVMNFLNNF AAQ  I +A AAAAE+A+ 
Sbjct  1178  KEETQDYNSDDMKITVDIGCMKIIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQ  1237

Query  1193  NIKDVQEHATRIELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKLEVTNDAGES  1252
                D  E ATR++L++ +KAP++ VP+ S+  + L++D+G L + N   ++ V  +    
Sbjct  1238  KAMDAYETATRMKLNIRIKAPIIIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEEE-RL  1296

Query  1253  PIVDEMKIDLQNIKLSRVRLNKDNFVLENEV----------LLLQPVSFTLLIKRNLSTA  1302
              ++DE+K+ + ++K+S++ L   N    +EV           ++ P+S TL I RNLS  
Sbjct  1297  AVIDEIKLQICDVKISKIVLLDGNESTVDEVDAEVGFLSKFNMMNPMSCTLSITRNLSYT  1356

Query  1303  WFTSIPDIDMSGRLNLIELLLSQEDYAMVMKVLEGNLGETIEDPNP----PKVVDLRDRR  1358
             W+  +P++++SGRL  IEL L  +DYA+VM VL  NL E +E+  P    P+   +R  R
Sbjct  1357  WYRDVPELNLSGRLKSIELTLFADDYALVMLVLNRNLNEGLEEFPPSEEAPQEAQVRPER  1416

Query  1359  PITEDLEKSRTRKSEMGTIQET-EASDFQEQKNVHTAMKFEFIMDSFVINLFMGGSKTLQ  1417
                        R S  G +  T + S  +E+  +H ++KF F  D  VINL  G      
Sbjct  1417  -----------RNSRAGRLSRTVQVSPIREK--IHESIKFNFQFDGVVINLMEGEGA---  1460

Query  1418  SQASPLHLPENGLAKFSLSHFALKGRMFADGLLATSILLMNCTWDDTRQNRQGSLMTIME  1477
                        GLA+F +   ++KG    +G L+TS++L N   DD R N +  +   + 
Sbjct  1461  -----------GLARFGIYFLSVKGTKLDNGTLSTSVVLCNIQMDDMRSNSKSQIRQYLS  1509

Query  1478  R--ITEPSAENLSSEDEAPSGRS-MVDVTIRKGPNDIFVDVRVFSFSIIISLDYLMKIKD  1534
             R    +P  +     D   + R+ MVDVT     +D F +VRV  F +I+ +D+L+K+  
Sbjct  1510  RKDWVQPKLDTDEIIDACYNERNFMVDVTAIIKEDDTFAEVRVRGFDLIVCIDFLLKLTT  1569

Query  1535  FFNVAPTATDQPISQHSQKGITEAVPKKKMAQTSSPVAAM-----------------ITI  1577
             F  + P    +         ++E     K +  SS + A                  + +
Sbjct  1570  FLTLPPEENPRESVYIKPAPVSETARDTKHSIRSSAILAAQELVPVESSSHEVPNRKMNL  1629

Query  1578  NLHVEKPDIILLEDMDDINSNCIVLNTELLLKLRLVGEHQVITGSIKDLSLSTGVYNPAK  1637
              LH+++PDIIL+E+++D+N++CI+ N ++ L  R + + Q++ G I  L +    + P +
Sbjct  1630  ILHIDEPDIILVENLEDLNTSCIIFNAQVHLNYRSINDKQIVNGQIDALKMYMCAFLPER  1689

Query  1638  RSDSIYQVLKPCSISLAGSTPEEKGLHVDVCCTDIHLSVSPGVIEILNRVVQTVTKKEEE  1697
             R  + + +L PC ISL GSTPEE+G+H+ +  +DI ++VSP  IE+LN+ + +V+     
Sbjct  1690  REMTRHYILHPCVISLQGSTPEEEGMHISLKLSDIIINVSPATIELLNKAMLSVSSGTMT  1749

Query  1698  SDEIVKREPNYEGLWIITPFYENNYWFLKTEVAVEAFEDLSLSDDEDTTVYKPELAILSA  1757
                I +   NY  LW    F+   YWF K E  V+A E    S   D    K E  ++  
Sbjct  1750  KCAIAEESRNYSNLWHQHHFHSRTYWFTKVEQGVDALEAEQRSVSTDNEKQKTEKCVIEI  1809

Query  1758  PTILLTLEAGVGNKTLPMLLLHLGFQSNVNDWSSKTMSVEATMTVVMAYYNSCLALWEPL  1817
             P+I L +E+GVG  T P++ L     +  N+W S++++   ++T+ M YYN  LA WEP+
Sbjct  1810  PSITLVIESGVGYYTKPLISLDTRITAVFNNW-SRSLTAHGSLTLNMNYYNQALAEWEPI  1868

Query  1818  IEPMEGI-QDGRRISTPWEIKTKVQFNDLSLGSKGASAVSPSSEIEPEEIQQSTKMSIDV  1876
             IE  E I ++G R  TPWE+K ++          G   V   SE+E +  QQ+  M+I  
Sbjct  1869  IELNEVIGRNGVREYTPWELKFEM----------GMEKV--QSELEDDAEQQAMHMNIH-  1915

Query  1877  LSSENLEITVTKTCLDVLKQLGNAFSNAMEASSKGHSQKMAPYILKNETGLTMTLDLEHS  1936
              S+E LEIT++KTCL +L +L  AFS A++ +       +APY+L+N+TG  + L+L   
Sbjct  1916  -SAETLEITLSKTCLGLLSELAEAFSQAIDQNGLTKPDIVAPYVLENDTGFDVNLNLRKG  1974

Query  1937  CFKV--VDDGMSVTSQQSKGSYSEVILESGATVQLAPKILKK-----------NTEILEQ  1983
              F +  V  G +     S       +L    + ++ P ++K             T+ L  
Sbjct  1975  IFTLHEVHRGGTPVGANS------TLLMVAQSEEVDPSVIKTCTISTGGRAYLQTKDLST  2028

Query  1984  LKAEIVKDSADSKFTVSFKGIPNKLEIPVLRADKRFFSLKYRKEGSEEWGIISDVTVEEG  2043
             L  E   DS D    V+   I  ++ +PV ++D RFF+L  R    E WGIIS+V  E G
Sbjct  2029  LSEE---DSEDYTLYVTIGDINKEIALPVSKSDTRFFNL-MRSTSHEPWGIISEVKQEYG  2084

Query  2044  STIVILRSVLQVHNHFSEPVSVYYM----TKRGNEVECVGTVGPDERLNLPLDAVYAPIN  2099
             +T V +  V+ VHNHF+  +++Y      T +  E   VG V P E  ++PL A+YA   
Sbjct  2085  TTKVNIHGVVSVHNHFTTGLNIYRRNPAPTAQCFEDIFVGRVRPGEVFHVPLHAIYAESK  2144

Query  2100  IYWLFFSVNGYMVSIEPFVWKDLQKTVSMTKVLKCEARSKQENTEPFYIKAVGEIEQVYF  2159
                LFFS+ GY  S++   W      ++ +  L C+  +     EP  + A     +VYF
Sbjct  2145  D--LFFSMRGYRRSVQGISWASNPSDLNYSHQLHCDPTN---TFEPLIMNARRSKSEVYF  2199

Query  2160  ENTSRHTMASTIYNIHLYPSVYFKNFLPINIIICLPGCA---------------------  2198
             ENT+++T+ S  Y IHL P +Y +N LPINI + + GC+                     
Sbjct  2200  ENTNKYTLLSAFYTIHLRPPLYLRNSLPINIQVSVAGCSVRKEDGLDAQSSQRFVDRGYR  2259

Query  2199  -------EEKLLPASKTLQIPTI------DPGKSSIVIKLPQYLEKDWSCKGEILANPPE  2245
                     EK + +   L +PT+         KS +V++L QYLEKDWSC  EI     +
Sbjct  2260  KEDFLDYGEKPVNSGDVLHLPTVRLASKGKESKSFLVVRLVQYLEKDWSCATEIWDYTDD  2319

Query  2246  FAVWSFESFDSAQKVVMDLGMHTSFKHGSIIMALYCPFWMLNKTGLMLSYKSGEDHLNVL  2305
                W+F S+DS  KV MDL + T  +HGS+++ L+ PFWM+NKTG+ML+YKS    + VL
Sbjct  2320  VITWTFSSYDSEMKVDMDLYVKTENRHGSLMLTLFSPFWMINKTGMMLTYKSETTSVEVL  2379

Query  2306  YHPETFKGPILFSFSSKAFFGKKKAMIRVEDGEWSDKFSIDVAGSKGVVSCKYNGMTYKI  2365
             YHP  + GPILF+F  K FF KKKA IR+++G+WS+K  +DVAGS G V C  N   Y +
Sbjct  2380  YHPPEYSGPILFTFRDKLFFDKKKASIRIDNGQWSEKIPLDVAGSVGEVICFANNQKYPV  2439

Query  2366  GVHNQLTYNSLTKQITFTPYYVLINNADFLMECQEADRPADPLFKVPPGECTALWPRSEH  2425
             GVHN LT NSLTKQITF P+Y++ N   F +E QE  RPADP   + P E   LWPR++ 
Sbjct  2440  GVHNHLTQNSLTKQITFIPFYIVCNKCHFDIELQEQSRPADPWLHLEPNEMEPLWPRND-  2498

Query  2426  EQKTLKVKVADYPEKTAPFIFTDMHTTLLKL-DNKYGGINVDIQINEGGTYISLSEYTPG  2484
              +  L V+V    + T  F FT++  TLLKL D+KYGGINVD+Q  EGG YI+ ++Y P 
Sbjct  2499  TKNNLVVRVDG--KITPAFDFTEVICTLLKLEDSKYGGINVDVQTTEGGVYITFTDYKPA  2556

Query  2485  SAPALIINHTPQTIHLWEKGSMNVRSVQSFNQMLYTWENPSGPRKIVWEDNNKREIENDL  2544
              AP L+INHT + I   EKG+ N   + + + ++Y W++P+GP+ +V+  N +   E DL
Sbjct  2557  DAPGLLINHTGKQIVYHEKGTKNEHILNAKSTIMYAWDDPTGPKMLVFGTNKE---ETDL  2613

Query  2545  RKNSLGTFQLPETDEEIYFVSFLDGIQRVLLFTNNLKIAEDCELAGDLESTEQEITLSIH  2604
             +++ +G   + +   ++ +VSFLDG+QRVLLFT N  IA   E    L+S  Q I L IH
Sbjct  2614  KRDGIGEVIMQDGG-KVLWVSFLDGLQRVLLFTENESIANRTESTASLQSITQSIDLRIH  2672

Query  2605  GIGISLVNNITRTELLYMCIASSGIIWEARK--GNRWRALNTREVDLIEEGYQRYMREIQ  2662
             GIG+S++NN T  ++LY+ + SSGIIWE++K   NR++ L   E  L+E  YQ+Y+    
Sbjct  2673  GIGLSVINNETGLDILYLGVTSSGIIWESKKVTKNRFKELTINENALLEIEYQKYLVHKS  2732

Query  2663  IAKDPTYRIILEPKLEIDYLNMEMLRPHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRL  2722
             +    TY+  L+ K  ID+  M + +   + +RR+F   +W+  ++S  Q QLH K+NR+
Sbjct  2733  VNDVQTYK--LDNKFPIDFDLMILKKTVERNLRRSFYPAIWLSRKSSPFQSQLHVKINRI  2790

Query  2723  QIDNQLSEHVFPVILAPVPPPKSVAQTSVMKPFAELSMVKRLLEHSTVQQFRYFKILIQE  2782
             Q+DNQ  + +FPV+LAP+PPPKSVA T+ +KPF E SMV+R++ +STV+QF+Y +ILIQE
Sbjct  2791  QVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNSTVRQFKYARILIQE  2850

Query  2783  FHVKVDIGFINGLTGFFETNEVNDIEESELFQTDMKLVHEPLIYHVNQVRTAEQKNFFDL  2842
             F  KVD+ F+  +   F   EV+D   ++ F+ D++ +  PL     +    EQK+F+D 
Sbjct  2851  FLFKVDLNFLTAIAEMF-AKEVSDEAAAKQFRQDVESIELPLSAFFEEHSLEEQKSFYDN  2909

Query  2843  LHFSPLKIHISFSMAGGGSGPSTLPPFLNVLLQGIGVTLTDINDIVFKLAYFERDYIFMT  2902
             LH  PLKIH+SFSMA  GS    LP FL  L+QG+GVTLTD+ND+VF+LA+FER+Y F +
Sbjct  2910  LHLGPLKIHVSFSMA--GSDTKALPGFLGSLVQGVGVTLTDVNDVVFRLAFFEREYQFFS  2967

Query  2903  HKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVGTVKGIEDLFYEPFQGAIQGPG  2962
              KQLI+E TSHYTGQA+KQLYVLVLGLDV+G+PYGLVVG  KG+EDLFYEPFQGAIQGPG
Sbjct  2968  QKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVEDLFYEPFQGAIQGPG  3027

Query  2963  EFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAALTFDKDYQRKRQEQLNKQPANL  3022
             EFAEGL+LGV+S+ GHTVGG AGAVSKITGAMGKG+AALTFD+DYQ+KR++ +  +P N 
Sbjct  3028  EFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKRRQGIQNKPKNF  3087

Query  3023  QESLARSGKGLVMGFVDGVTGVVMKPISGGKEEGVEGFFKGVGKGMMGLVTRPTAGVIDF  3082
              E LARS KGLVMGFVDGVTGVV KP++G ++ GVEGFFKG+GKG +GLV RPTAGV+DF
Sbjct  3088  HEGLARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIGLVARPTAGVVDF  3147

Query  3083  ASGSLGAVRRATDMGEEVKRTRPPRFLQPDSLVRPYVRYEAEGNKILCEVEKGKYANTD-  3141
             ASGS  AV+RA D  E+VKR RPPRF   D ++RPY   EA GNKI+ E +KGK+A TD 
Sbjct  3148  ASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATGNKIMKETDKGKFATTDN  3207

Query  3142  -IYFYHIFINKDGLLLTDKRIAFIQHSDLFGGWKVDWAYTWPEISSNPRIVDKGVQINIK  3200
              I+   I    + L++T+ R+ ++Q +++FG W   W+Y W EISS      +GVQ  +K
Sbjct  3208  FIHCEEIIQKSEYLVVTNYRVMYVQRNEMFGVWTSLWSYLWNEISSVAATA-RGVQFTVK  3266

Query  3201  DNAKKKKLTNFFGNTDLIKIILIPDYNERQLLCRKIQEQ  3239
              +  KK L  F       K++L+ D  +R  L   I+ Q
Sbjct  3267  TDG-KKVLGLFSSKESPRKLVLVADERKRDALVDIIESQ  3304


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 214 bits (544),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 244/519 (47%), Gaps = 68/519 (13%)

Query  2689  PHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAPV--------  2740
             P R+ I      GL ++ + S     +  KV+ LQID+Q     FPV L           
Sbjct  3252  PTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDLQIDDQRYSTNFPVFLCQSKKINHSIN  3311

Query  2741  -------PPPKSVA----------------QTSVMKPFAELSMVKRLLEHSTVQQFRYFK  2777
                      P+S                  Q   +KPF + S   R L++S +  FRYF 
Sbjct  3312  QQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQKLKPFLQFSAT-RTLKYSNIMFFRYFS  3370

Query  2778  ILIQEFHVKVDIGFINGLTGFFETNEVNDIEESELFQTDMKLVHEPLIYHVNQVRTAEQK  2837
             ILIQEF + +D   I     F   N +N + E   F     +  E ++   N        
Sbjct  3371  ILIQEFDINLDEASILNALSFININ-LNSLNEH--FTLHPTITQEEILETKNASNIENHM  3427

Query  2838  NFFDLLHFSPLKIHISF----------SMAGGGS------GPSTLPPFLNVLLQGIGVTL  2881
              +F++LH +P+K+++SF          ++ G  S      G  +  PFLN+    I    
Sbjct  3428  VYFEMLHINPVKMNLSFISCKSPKETQAILGARSLAELLIGFKSNSPFLNIERAPI----  3483

Query  2882  TDINDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVG  2941
                     K   F  ++ F++ +Q+I E + H++ Q + Q + +    D IG+P  L   
Sbjct  3484  --------KFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFGSFDFIGNPIRLAES  3535

Query  2942  TVKGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAAL  3001
                G +D F+EP  G ++ P +FA GL  G  S++ ++V G A + SKITG + KG+  L
Sbjct  3536  LGSGFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADSTSKITGTISKGLVQL  3595

Query  3002  TFDKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGG-KEEGVEGF  3060
             + D  Y ++RQE   ++P  ++E L    +    G + G+TG++ +P  G  +E+  EGF
Sbjct  3596  SLDDSYIKERQESNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDEPYKGATQEKSWEGF  3655

Query  3061  FKGVGKGMMGLVTRPTAGVIDFASGSLGAVRRATDMGE---EVKRTRPPRFLQPDSLVRP  3117
             FKG+GKG++G+  +PT GV D  S +   ++ +T + +   ++KR R PR+   +  +  
Sbjct  3656  FKGIGKGVLGVAVKPTVGVFDLVSKTSEGIKNSTTVAKSLSQIKRRRIPRYFPREGTLST  3715

Query  3118  YVRYEAEGNKILCEVEKGKYANTDIYFYHIFINKDGLLL  3156
             Y ++++ G+ IL   + G     D Y +H  +N   L+L
Sbjct  3716  YNQFKSIGSFILYS-KIGPPPTHDWYVFHTILNYKDLIL  3753


 Score = 123 bits (308),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 113/447 (25%), Positives = 203/447 (45%), Gaps = 64/447 (14%)

Query  6    IVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYGRLGKL  65
            I A +L K LG+Y+++L+   +KLS   G+ VL+DL IK++ L      + ++   + KL
Sbjct  5    IAASVLTKYLGDYVDDLNKDNIKLSFLSGEAVLQDLKIKKTVLQSFLPNVIVKQAIIKKL  64

Query  66   ILKIPFKDIWNGQIDAIIEELFILIVPTS--------QAKYDAEKEAKAQ----LAAKRA  113
             L +P+KD+        IE +++L   TS        + K+  EK+AK      L   + 
Sbjct  65   SLHVPWKDLKGKPAIIKIEGIYVL-AETSVEFDEQYYKKKFQDEKQAKLHIQEVLRLNKQ  123

Query  114  ELARVEKNKQLADIKSQEKLDDSMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSV  173
            +L    ++       S E   ++   KLL  ++ N+ + I  +H+RFED V+ ++  FS 
Sbjct  124  QLKNPHQSTTTTTTTSDE--SNTFGSKLLQTVVDNLQLYIDSVHIRFEDSVNRRS--FSF  179

Query  174  GFTLNSFALQSCTDTWTTDGNLKDMYAIQQIYKLCTMDGFAVYLNTDIMQFSKEPQISYL  233
            G TLNS   +S   TW     +K+   I  I+KL  ++  ++Y N      S  P++ Y 
Sbjct  180  GVTLNSLVAESTDQTWNPTF-IKNESTI--IHKLINLNQLSIYWN------SNSPKLKYT  230

Query  234  HL--FSEGIAT-------------------------------LDYIPKKYHYLLGPINVK  260
            ++   S+ + +                               L    +K  Y++ PI+ K
Sbjct  231  NIDDLSQKLKSMIKKEDSGKQQQQQQQQQGEEQDDEIEEDYFLSTESRKQQYIIDPISAK  290

Query  261  AKLKLNPKPETDGSNYSIPKVWLDLEMQMLRIGLTKCQYQTLMQMGEGLDQAQKAAPYRK  320
             K+ +N   ++   +  IPK  L+ E     I L+  QY+ +  + E     +K+  +R 
Sbjct  291  LKVVIN---KSIIPSEVIPKYNLNFEFDKTDISLSDYQYKDITGILESFKLFEKSIEFRS  347

Query  321  YRPDLTSYRGHYKEWWRFAYTCIMEETVRRLRRNWNWVNMKEHRDTCRVYAKAYQTKLTT  380
             RP  T+ +   ++WW +A  C++++ V + R   +W  +KE     R Y + ++ KL  
Sbjct  348  ARPINTTIKQSPRKWWNYAIQCVLQK-VHQKRYTQSWSYIKEFLSDKRDYIELFK-KLKK  405

Query  381  KKVAQDIDKCITDCETKLDIFNLVIIR  407
            K + Q     +   E KL    ++  R
Sbjct  406  KTIHQTEQTRLDSLEWKLPFDQILFFR  432


 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 67/134 (50%), Gaps = 13/134 (10%)

Query  1140  DKNNMSIKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQQAIKEASAAAAEAAKTNIKDVQE  1199
             D N+  +K+ +   R +FL  F   +  FLNN    ++ +K +  +AA         + +
Sbjct  1395  DNNSQMLKINLSSIRFIFLKRFTEELRLFLNNVNMMREYLKSSIYSAATV-------ISQ  1447

Query  1200  HATRIELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKL------EVTNDAGESP  1253
             + + +   + ++ P + +P++S S+   ++D+G + I N  +K+      E+     E  
Sbjct  1448  NRSTLFYEIEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEKIIPTSTGEIDMILMEPV  1507

Query  1254  IVDEMKIDLQNIKL  1267
             I++ + I+ QNIKL
Sbjct  1508  IIENIIIEAQNIKL  1521


 Score = 42.7 bits (99),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 46/220 (21%), Positives = 92/220 (42%), Gaps = 58/220 (26%)

Query  2272  HGSIIMALYCPFWMLNKTGLMLSYK----------SGE---DHLNVLYHPETFK------  2312
             +GS  + LYC +W++N+TGL L ++          +G+     +  ++   + K      
Sbjct  2696  NGSRFVTLYCEYWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHESTSMKPTDSRN  2755

Query  2313  ----------GPILFSFSSKAFFGKKKAMIRVEDGEWSDKFSI-----------------  2345
                        P +F++S  +  G K ++ ++ D  WS  FS+                 
Sbjct  2756  WYTKEWNHPSQPFMFAYSDNSIVGGKFSL-KIYDSNWSSPFSLISSQSSSNSNIEISEDR  2814

Query  2346  -----DVAGSKGVVSCKYNGMT-YKIGVHNQLTYNS---LTKQITFTPYYVLINNADFLM  2396
                  ++    G ++ +    T Y + V + L  NS    TK +TF+P Y+++N+  F +
Sbjct  2815  TDEEKEIKNVIGTITKRQPLKTNYNLSV-SILPSNSKFWRTKVVTFSPMYLMVNSTRFRI  2873

Query  2397  ECQEADRPADPLFKVPPGECTALWPRSEHEQKTLKVKVAD  2436
               Q+ D  ++    +        +P S HE K +++ + D
Sbjct  2874  LYQQFDCDSNTQSIIQDQSLPFQFPSSRHE-KLIRIGILD  2912


>VP13F_DICDI unnamed protein product
Length=4246

 Score = 144 bits (364),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/476 (22%), Positives = 217/476 (46%), Gaps = 66/476 (14%)

Query  2682  LNMEMLRPHRKYIRRTFQTGLWVQYRTSIHQVQLHAKVNRLQIDNQLSEHVFPVILAP--  2739
             +++ ++  H K +      GL ++++    +  ++  ++  ++DNQL    +PV++    
Sbjct  3665  ISVSLIDGHPKELMYITLRGLQLRFKQYSTEQNINLSIHSFKVDNQLYHTPYPVMIQSYN  3724

Query  2740  ---VPPPKSVAQTSVMKPFAELSMVKRLLEHSTVQQFRYFKILIQEFHVKVDIGFINGLT  2796
                + P K     S+++         + L    ++  +     IQ F V++D   +  L 
Sbjct  3725  SNNLKPTKHSFNVSLIR---SGQYQPKELHQVGIEYIKELNFDIQPFDVEIDETILFHLY  3781

Query  2797  GFFET----------------------NEVNDIEESELFQTDMKLVHE--------PLIY  2826
              F ++                      N +++ +E E  + D K++          P+ +
Sbjct  3782  NFIKSIKLPNNQNNNNNQNNNNQNNDFNNIDEYDEKE--KNDGKIIKSIKLPYSNLPIPH  3839

Query  2827  HVNQVRTAEQKNFFDLLHFSPLKIHISFSMAGGGSGPSTLP---PFLNVLLQGIGVTLTD  2883
              ++  R      + ++L+   + + IS+ ++     P + P   P+ +V       T+ +
Sbjct  3840  SIDSKRL-----YIEVLNLPLVDVTISYCLS-----PHSRPLIGPWASVF-----STIAN  3884

Query  2884  INDIVFKLAYFERDYIFMTHKQLISEATSHYTGQAIKQLYVLVLGLDVIGDPYGLVVGTV  2943
             I+     L  ++ ++ F+T   L     SHY  +  K    ++L  DV G P  LV    
Sbjct  3885  IDKASLHLGSWKLEHQFVTANALALSLFSHYKWEVSK----ILLYSDVFGAPLSLVENIT  3940

Query  2944  KGIEDLFYEPFQGAIQGPGEFAEGLILGVRSMLGHTVGGMAGAVSKITGAMGKGIAALTF  3003
             +GI D  YE  +G +  P  F +GL+ G +S++ +++ G+  + SK+T  +G  IA  + 
Sbjct  3941  RGINDFIYESKEG-LNNPENFGKGLVKGTKSLVSNSIYGIFNSASKLTNTVGSAIAPFSM  3999

Query  3004  DKDYQRKRQEQLNKQPANLQESLARSGKGLVMGFVDGVTGVVMKPISGGKEEGVEGFFKG  3063
             D++Y  +R      QP +  + ++        G   G++G+  +P+   +++G  G  KG
Sbjct  4000  DENYLAQRDRH--TQPKHAIDGVSNGIGRFTQGLAHGLSGLFDQPVKEFQDQGFSGLVKG  4057

Query  3064  VGKGMMGLVTRPTAGVIDFASGSLGAVRRA-TDMGEEVKRTRPPRFLQPDSLVRPY  3118
              GKG++G V +PT G ID  + +   +R +  D      R+RPPRF+ PD++++P+
Sbjct  4058  FGKGILGTVVKPTVGAIDMINAATQGIRNSYLDPASSKSRSRPPRFIGPDAIIKPF  4113


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 88/153 (58%), Gaps = 6/153 (4%)

Query  2    VFESIVAELLNKVLGEYIENLDCTQLKLSLWGGDVVLKDLLIKESALDVLDLPLKLEYGR  61
            +FESIV+ LL + L EYI+ L+   L +S+W G+V L++L +K  AL+  +LP  ++ G 
Sbjct  1    MFESIVSNLLTRYLKEYIKALNTDNLNISIWSGNVSLENLELKSRALEKFNLPFTIKEGF  60

Query  62   LGKLILKIPFKDIWNGQIDAIIEELFILIVPTSQAKYDAEKEAKAQLAAKRA----ELAR  117
            LGKL LKIP+ ++    +  +I++L+I   P S   ++ E E        +     E  +
Sbjct  61   LGKLSLKIPWNNLKTEPVIVVIDQLYITASPKSTTVWNEEDEDLLLQKKLKKLKIYEALK  120

Query  118  VEKNKQLADIKSQEKLDDSMI--EKLLARMIKN  148
             EK K+   +K + ++ +++I  ++L  + IKN
Sbjct  121  EEKRKKQQQLKEKREIRNNLIKEKRLQKKQIKN  153


 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 68/302 (23%), Positives = 123/302 (41%), Gaps = 45/302 (15%)

Query  136  SMIEKLLARMIKNIHVEIKKIHVRFEDHVSFKNHPFSVGFTLNSFALQSCTDTWTTDGNL  195
            S  EKL  +++ N+ + I  +H+RFED V+    P+  G TL     QS  + W     +
Sbjct  297  SFAEKLRNKIVDNLQIMIYNVHIRFEDSVTNPTTPYCFGVTLEHLLAQSSNEEWKPSF-I  355

Query  196  KDMYAIQQIYKLCTMDGFAVYLNTDIMQFSKEPQISYLHL--FSEGIATL----------  243
               + +  ++KL T+   ++Y + D    + +P ++Y  +  F   +  L          
Sbjct  356  HTPHTL--VHKLITLQNLSIYWDAD----NDKPDLNYKSISEFKSLMTKLIPKKSSPSTT  409

Query  244  -------------DYIPKKYHYLLGPINVKAKLKLNPKPETDGSNYSIPKVWLDLEMQML  290
                           I  +++YLL P+    KL +N   ++   N  IP    + E   +
Sbjct  410  TTTPPISPPPKETQLIKPQHNYLLHPVCGSLKLLIN---KSIIPNKYIPLYTANFEFDEI  466

Query  291  RIGLTKCQYQTLMQMGEGLDQAQKAAPYRKYRPDLTSYRGHY----KEWWRFAYTCIMEE  346
             + L   QY  ++ + +     +K   YRK++   T   G      K+ W FA  CI+ +
Sbjct  467  NLELESKQYSGILALVDWFTTQKKGERYRKFK---TKESGGVLKTAKDRWEFAGKCILAD  523

Query  347  TVRRLRRNWNWVNMKEHRDTCRVYAKAYQTKLTTKKVAQDIDKC-ITDCETKLDIFNLVI  405
               ++R+ W      + R     Y   Y+ K   KK   D++   +   E +    +LV 
Sbjct  524  VRDKIRK-WTPQFFDKRRKDRLDYIHLYKLK-KRKKTLSDLNTTKLNSLEKEYSFEDLVY  581

Query  406  IR  407
             R
Sbjct  582  FR  583


 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 89/162 (55%), Gaps = 11/162 (7%)

Query  562   DGSSDSE---------LFAVSYEKNPLDKLCGDRVIVQSKSVHIVYDAQTIIELVKLFKV  612
             DGS D E         LF+++ ++NPL+      + +++  + +VY+   +  +++ F  
Sbjct  1002  DGSGDYENNTNDEKQPLFSMTLQQNPLNSESDFSIFIEALPLEVVYNKSMMDAILEFFGN  1061

Query  613   QNSSTLSQLQAAAAVQLEGLKEMSALGLEYAIQKHSALDIQVDLQASQLIVPCGGFYNEK  672
               S TL +++ AA  Q++  K+ + L +++ ++ H ++D+ +++ A  +++P   F    
Sbjct  1062  APSDTLKEIEEAARNQIKIFKDKTTLRIQHELENHKSIDLDININAPHVLIP-ESFTIPS  1120

Query  673   ESLFVLNLGSLKMRTLEKPKDDKATTNVKELISMGKSDEDIL  714
               + VL+LGS  ++++   KDD  +  + E+ S+ K+D  I+
Sbjct  1121  APILVLDLGSFSVQSVVTHKDDTLSEEI-EISSILKNDFSII  1161


 Score = 44.7 bits (104),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 41/212 (19%), Positives = 98/212 (46%), Gaps = 23/212 (11%)

Query  1146  IKVVMGCHRVVFLNAFVTGVMNFLNNFQAAQ--QAIKEASAAAAEAAKTNIKDVQEHATR  1203
             I V M   +++ + + +  ++++   F   Q  Q + +++  A E   T   + Q+   R
Sbjct  1847  IGVRMSSVKLIVVRSLIDRIIDYFEEFAPNQIDQILADSAKGAVEIMSTRRINQQK---R  1903

Query  1204  IELSVNLKAPVVYVPMNSKSDHCLMMDMGNLTICNTLKKLEVTNDAGESPIVDEMKIDLQ  1263
             I   V++  P +  P N  S + ++ D+G++++ N  K     ++ G++ I+   ++   
Sbjct  1904  ILFEVDVNTPRIIFPKNHYSPYVIIADLGHISVFNKYKSNLTNSNGGDNTILSSEQV---  1960

Query  1264  NIKLSRVRLNKDNF----VLENEVLLLQPVSFTLLIKRNLSTAWFTSI--------PDID  1311
              +  S V  +   F    VLE+ +   +P+S  + +  N+ +    S+        P   
Sbjct  1961  FVYASSVNFHACKFQNGKVLESTI---EPISNKINVHVNIESFLNPSLLEEDQLDEPKQK  2017

Query  1312  MSGRLNLIELLLSQEDYAMVMKVLEGNLGETI  1343
             + G ++ I L +S + Y++ + +++  +  TI
Sbjct  2018  VDGEISPINLKISDQQYSLTIAIIKSLIEPTI  2049


 Score = 40.0 bits (92),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 34/149 (23%), Positives = 73/149 (49%), Gaps = 24/149 (16%)

Query  870   FTVT-VSKQSDLEISPFLRVEVLQLEAEMLQRTFDQEVTLRLGGVQIK---QNHKSDEI-  924
             F+VT VS Q   +  PF+R+ +  + A++L+RTFD  + L L  + I+   Q+ K++   
Sbjct  1473  FSVTTVSLQVVEDDKPFIRMILSDISAQVLKRTFDTSIKLSLAKLSIEDLYQDFKNESFK  1532

Query  925   FMINTPMATGS---------------EEYLIVIQYKNVNKRSPEFVTRHGSVVKLLQLEF  969
             ++ N+ +                   EE+LI I   +V + SP++      + + + + F
Sbjct  1533  YLANSSIDNNQQPLQSELENSSGIEREEHLISISISSVQRNSPQY----SGISQQIDVSF  1588

Query  970   TTLDILLHQEALINALKFISSIQDKITAS  998
              TL + ++++ +I  +  +  ++  I  +
Sbjct  1589  NTLFVNINKKLVIKIMNLVDFVEKTIVET  1617


 Score = 37.0 bits (84),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 33/201 (16%)

Query  1755  LSAPTILLTLEAGVGNKTLPMLLLHLGFQSNVNDWSSKTMSVEAT-------MTVVMAYY  1807
               +P++ LT+    GNK   ++           D   + +SVE         M +   Y+
Sbjct  2522  FQSPSVELTVINDYGNKYCGII-----------DLKIRDISVEVAQNRVLFAMFIAANYF  2570

Query  1808  NSCLALWEPLIEPMEGIQDGRRISTPWEIKTKVQFNDLSLGSKGASAVSPSSEI--EPEE  1865
             N   ++WEP+IE   G + G   S   EI TK Q  ++ + S G   ++ +  +      
Sbjct  2571  NVSKSVWEPMIEEW-GCKFGIETS---EIGTKDQSKNIVISSSGKLNLNITKSLFDTFTT  2626

Query  1866  IQQSTKMSIDVLSSENLEITVTKTCLDVLKQLGNAFSNAMEASSKGHSQKMAPYILKNET  1925
             I    ++++D+  +++     T++  D+  + G   +N +    K  SQ   P++LKN+T
Sbjct  2627  IYPLIEIAMDISKADS-----TQSAYDLGYKTG--VNNNLLQHYK--SQNYHPFLLKNQT  2677

Query  1926  GLTMTLDLEHSCFKVVDDGMS  1946
             GL +   +   C     D  S
Sbjct  2678  GLEIQYQISIICASSFGDTQS  2698


 Score = 33.5 bits (75),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 33/69 (48%), Gaps = 12/69 (17%)

Query  722   YDKFVLEITNFQALVSFADEDWRSALISDSINSMVLLRPTTLEVQFHKCLIMDDPLLPKM  781
             YD F L++ N Q  ++   E            S+ L+    +  + +KC+I    LL K+
Sbjct  1274  YDLFELKLNNIQFYIASQGE------------SLQLVEKFDINFKIYKCIIKSQTLLSKL  1321

Query  782   RLIGQLPSV  790
             +L G LPS+
Sbjct  1322  KLFGGLPSL  1330



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584678.1 serine/threonine-protein kinase 11-interacting
protein isoform X1 [Cephus cinctus]

Length=1263
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q380Y7_TRYB2  unnamed protein product                                 53.1    2e-06
Q9VL65_DROME  unnamed protein product                                 51.6    4e-06
Q7JPR9_DROME  unnamed protein product                                 45.4    3e-04


>Q380Y7_TRYB2 unnamed protein product
Length=1004

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 84/166 (51%), Gaps = 16/166 (10%)

Query  170  SLQHLALPYNALARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLEAV  229
            + ++L L  N L   D  + +   L+ LDLS N I +   L   P L+++ L  NK+E  
Sbjct  39   ATEYLYLRENELTDFDIDITME-HLRVLDLSINEIGSVDFLRKTPYLRHLYLSGNKIEH-  96

Query  230  PIFNKASFQTLQILILKNNYIDNLNGLHGLECLTELDLSYNCLT--EHSVLWPLETMSAL  287
             +   ++F +L+ L L +N I++  GL  L  L  L L++N ++  +H   +P     +L
Sbjct  97   -LHGISNFSSLETLCLSDNAINSFEGLEKLPNLRVLSLNFNKISSFKHYGKFP-----SL  150

Query  288  LWVALDGNPLSYHPRHRILTIRRLHPSLSDRKFV-LDNLPFSKSER  332
              + L GNPL+  P +R + I     ++++   V +D  P +  ER
Sbjct  151  HTLNLVGNPLTEVPSYRSMAI-----AINNSNLVSIDGHPVTAEER  191


 Score = 38.1 bits (87),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 6/83 (7%)

Query  168  WASLQHLALPYNALARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLE  227
            ++SL+ L L  NA+   +  LE  P L+ L L+ N IS+       PSL  +NL  N L 
Sbjct  103  FSSLETLCLSDNAINSFE-GLEKLPNLRVLSLNFNKISSFKHYGKFPSLHTLNLVGNPLT  161

Query  228  AVPIFNKASFQTLQILILKNNYI  250
             VP     S++++ I I  +N +
Sbjct  162  EVP-----SYRSMAIAINNSNLV  179


>Q9VL65_DROME unnamed protein product
Length=566

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (44%), Gaps = 26/230 (11%)

Query  133  IRGQLESVVCAGGRGVGSIGRLLAACG----GDAGVG--------FVWASLQHLALPYNA  180
            +RG LE + C      G I R +        G  G           V+  +  + L +  
Sbjct  22   LRGFLEEINCPEP---GIIDRQMIETAYLEEGKKGEARRLHQLEPVVYDRITTMRLEFKN  78

Query  181  LARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLEAVPIFNKASFQTL  240
            + R+D  L + P L  L L+ N I     L  L +LK++NL FN +    I N      L
Sbjct  79   ILRID-HLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYI--TRIENLEKLVKL  135

Query  241  QILILKNNYIDNLNGLHGLECLTELDLSYNCLTEHSVLWPLETMSALLWVALDGNPLSYH  300
            + L L +N I  +  +H L+ L  L +  N +     +  L  +S+L  + L+GNP++  
Sbjct  136  EKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQ  195

Query  301  PRHRI-LTIRRLHPSLSDRKFVLDNLPFSKSERQLVSQNRMFAIRSVRSV  349
            P   + L +  + P L+  ++V     F K+E +  +Q R +  R +R +
Sbjct  196  PDFPLSLYVIAILPQLNYYEYV-----FIKTETREEAQKRFY--RELREI  238


>Q7JPR9_DROME unnamed protein product
Length=1385

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 110/257 (43%), Gaps = 40/257 (16%)

Query  61   DLECSFQVCNSSKI--DIFRDLKFLHDFVQKTIGL-KVTHNSNDAKVSIDIRKFRHL---  114
            DL+CS ++ ++S++   +FR L+ L +       L +V  N+ +  +S+           
Sbjct  68   DLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAV  127

Query  115  ----KYLELH-------KVCIELVRGIQGIRGQLESVVCAGG------------RGVGSI  151
                K LELH       K   EL  G   IR   E V C+              R    +
Sbjct  128  WGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFL  187

Query  152  GRLLAACGGDA-----GVGFVWASLQHLALPYNALARLDKSLELAPW--LQTLDLSHNLI  204
            G     C G A     G     + LQ L + +N L  L  +   +    LQTL L HN I
Sbjct  188  GFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNI  247

Query  205  ST--ATELNCLPSLKNINLGFNKLEAVPIFNKASFQTLQILILKNNYIDNL--NGLHGLE  260
            ST     L  L SL+ +N+ +N L ++P    A  + L+ L L+ N +  L    LH LE
Sbjct  248  STLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLE  307

Query  261  CLTELDLSYNCLTEHSV  277
             L  LDLS N LT+H V
Sbjct  308  QLLVLDLSGNQLTDHHV  324



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584679.1 serine/threonine-protein kinase 11-interacting
protein isoform X3 [Cephus cinctus]

Length=1237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q380Y7_TRYB2  unnamed protein product                                 53.1    2e-06
Q9VL65_DROME  unnamed protein product                                 51.2    4e-06
Q7JPR9_DROME  unnamed protein product                                 45.8    3e-04


>Q380Y7_TRYB2 unnamed protein product
Length=1004

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 84/166 (51%), Gaps = 16/166 (10%)

Query  170  SLQHLALPYNALARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLEAV  229
            + ++L L  N L   D  + +   L+ LDLS N I +   L   P L+++ L  NK+E  
Sbjct  39   ATEYLYLRENELTDFDIDITME-HLRVLDLSINEIGSVDFLRKTPYLRHLYLSGNKIEH-  96

Query  230  PIFNKASFQTLQILILKNNYIDNLNGLHGLECLTELDLSYNCLT--EHSVLWPLETMSAL  287
             +   ++F +L+ L L +N I++  GL  L  L  L L++N ++  +H   +P     +L
Sbjct  97   -LHGISNFSSLETLCLSDNAINSFEGLEKLPNLRVLSLNFNKISSFKHYGKFP-----SL  150

Query  288  LWVALDGNPLSYHPRHRILTIRRLHPSLSDRKFV-LDNLPFSKSER  332
              + L GNPL+  P +R + I     ++++   V +D  P +  ER
Sbjct  151  HTLNLVGNPLTEVPSYRSMAI-----AINNSNLVSIDGHPVTAEER  191


 Score = 38.5 bits (88),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 6/83 (7%)

Query  168  WASLQHLALPYNALARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLE  227
            ++SL+ L L  NA+   +  LE  P L+ L L+ N IS+       PSL  +NL  N L 
Sbjct  103  FSSLETLCLSDNAINSFE-GLEKLPNLRVLSLNFNKISSFKHYGKFPSLHTLNLVGNPLT  161

Query  228  AVPIFNKASFQTLQILILKNNYI  250
             VP     S++++ I I  +N +
Sbjct  162  EVP-----SYRSMAIAINNSNLV  179


>Q9VL65_DROME unnamed protein product
Length=566

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (44%), Gaps = 26/230 (11%)

Query  133  IRGQLESVVCAGGRGVGSIGRLLAACG----GDAGVG--------FVWASLQHLALPYNA  180
            +RG LE + C      G I R +        G  G           V+  +  + L +  
Sbjct  22   LRGFLEEINCPEP---GIIDRQMIETAYLEEGKKGEARRLHQLEPVVYDRITTMRLEFKN  78

Query  181  LARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLEAVPIFNKASFQTL  240
            + R+D  L + P L  L L+ N I     L  L +LK++NL FN +    I N      L
Sbjct  79   ILRID-HLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYI--TRIENLEKLVKL  135

Query  241  QILILKNNYIDNLNGLHGLECLTELDLSYNCLTEHSVLWPLETMSALLWVALDGNPLSYH  300
            + L L +N I  +  +H L+ L  L +  N +     +  L  +S+L  + L+GNP++  
Sbjct  136  EKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQ  195

Query  301  PRHRI-LTIRRLHPSLSDRKFVLDNLPFSKSERQLVSQNRMFAIRSVRSV  349
            P   + L +  + P L+  ++V     F K+E +  +Q R +  R +R +
Sbjct  196  PDFPLSLYVIAILPQLNYYEYV-----FIKTETREEAQKRFY--RELREI  238


>Q7JPR9_DROME unnamed protein product
Length=1385

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 110/257 (43%), Gaps = 40/257 (16%)

Query  61   DLECSFQVCNSSKI--DIFRDLKFLHDFVQKTIGL-KVTHNSNDAKVSIDIRKFRHL---  114
            DL+CS ++ ++S++   +FR L+ L +       L +V  N+ +  +S+           
Sbjct  68   DLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAV  127

Query  115  ----KYLELH-------KVCIELVRGIQGIRGQLESVVCAGG------------RGVGSI  151
                K LELH       K   EL  G   IR   E V C+              R    +
Sbjct  128  WGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFL  187

Query  152  GRLLAACGGDA-----GVGFVWASLQHLALPYNALARLDKSLELAPW--LQTLDLSHNLI  204
            G     C G A     G     + LQ L + +N L  L  +   +    LQTL L HN I
Sbjct  188  GFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNI  247

Query  205  ST--ATELNCLPSLKNINLGFNKLEAVPIFNKASFQTLQILILKNNYIDNL--NGLHGLE  260
            ST     L  L SL+ +N+ +N L ++P    A  + L+ L L+ N +  L    LH LE
Sbjct  248  STLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLE  307

Query  261  CLTELDLSYNCLTEHSV  277
             L  LDLS N LT+H V
Sbjct  308  QLLVLDLSGNQLTDHHV  324



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584680.1 serine/threonine-protein kinase 11-interacting
protein isoform X4 [Cephus cinctus]

Length=1150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q380Y7_TRYB2  unnamed protein product                                 52.4    2e-06
Q9VL65_DROME  unnamed protein product                                 51.6    3e-06
Q7JPR9_DROME  unnamed protein product                                 46.2    2e-04


>Q380Y7_TRYB2 unnamed protein product
Length=1004

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/166 (29%), Positives = 84/166 (51%), Gaps = 16/166 (10%)

Query  170  SLQHLALPYNALARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLEAV  229
            + ++L L  N L   D  + +   L+ LDLS N I +   L   P L+++ L  NK+E  
Sbjct  39   ATEYLYLRENELTDFDIDITME-HLRVLDLSINEIGSVDFLRKTPYLRHLYLSGNKIEH-  96

Query  230  PIFNKASFQTLQILILKNNYIDNLNGLHGLECLTELDLSYNCLT--EHSVLWPLETMSAL  287
             +   ++F +L+ L L +N I++  GL  L  L  L L++N ++  +H   +P     +L
Sbjct  97   -LHGISNFSSLETLCLSDNAINSFEGLEKLPNLRVLSLNFNKISSFKHYGKFP-----SL  150

Query  288  LWVALDGNPLSYHPRHRILTIRRLHPSLSDRKFV-LDNLPFSKSER  332
              + L GNPL+  P +R + I     ++++   V +D  P +  ER
Sbjct  151  HTLNLVGNPLTEVPSYRSMAI-----AINNSNLVSIDGHPVTAEER  191


 Score = 38.1 bits (87),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 43/83 (52%), Gaps = 6/83 (7%)

Query  168  WASLQHLALPYNALARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLE  227
            ++SL+ L L  NA+   +  LE  P L+ L L+ N IS+       PSL  +NL  N L 
Sbjct  103  FSSLETLCLSDNAINSFE-GLEKLPNLRVLSLNFNKISSFKHYGKFPSLHTLNLVGNPLT  161

Query  228  AVPIFNKASFQTLQILILKNNYI  250
             VP     S++++ I I  +N +
Sbjct  162  EVP-----SYRSMAIAINNSNLV  179


>Q9VL65_DROME unnamed protein product
Length=566

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 101/230 (44%), Gaps = 26/230 (11%)

Query  133  IRGQLESVVCAGGRGVGSIGRLLAACG----GDAGVG--------FVWASLQHLALPYNA  180
            +RG LE + C      G I R +        G  G           V+  +  + L +  
Sbjct  22   LRGFLEEINCPEP---GIIDRQMIETAYLEEGKKGEARRLHQLEPVVYDRITTMRLEFKN  78

Query  181  LARLDKSLELAPWLQTLDLSHNLISTATELNCLPSLKNINLGFNKLEAVPIFNKASFQTL  240
            + R+D  L + P L  L L+ N I     L  L +LK++NL FN +    I N      L
Sbjct  79   ILRID-HLWMMPNLTKLCLNCNKIEVIEHLEMLTALKDLNLSFNYI--TRIENLEKLVKL  135

Query  241  QILILKNNYIDNLNGLHGLECLTELDLSYNCLTEHSVLWPLETMSALLWVALDGNPLSYH  300
            + L L +N I  +  +H L+ L  L +  N +     +  L  +S+L  + L+GNP++  
Sbjct  136  EKLSLFSNRIRKIENIHTLQNLVILSIGNNLIDTVEGIERLRFVSSLKVLNLEGNPIAKQ  195

Query  301  PRHRI-LTIRRLHPSLSDRKFVLDNLPFSKSERQLVSQNRMFAIRSVRSV  349
            P   + L +  + P L+  ++V     F K+E +  +Q R +  R +R +
Sbjct  196  PDFPLSLYVIAILPQLNYYEYV-----FIKTETREEAQKRFY--RELREI  238


>Q7JPR9_DROME unnamed protein product
Length=1385

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 110/257 (43%), Gaps = 40/257 (16%)

Query  61   DLECSFQVCNSSKI--DIFRDLKFLHDFVQKTIGL-KVTHNSNDAKVSIDIRKFRHL---  114
            DL+CS ++ ++S++   +FR L+ L +       L +V  N+ +  +S+           
Sbjct  68   DLQCSQELLHASELAPGLFRQLQKLSELRIDACKLQRVPPNAFEGLMSLKRLTLESHNAV  127

Query  115  ----KYLELH-------KVCIELVRGIQGIRGQLESVVCAGG------------RGVGSI  151
                K LELH       K   EL  G   IR   E V C+              R    +
Sbjct  128  WGPGKTLELHGQSFQGLKELSELHLGDNNIRQLPEGVWCSMPSLQLLNLTQNRIRSAEFL  187

Query  152  GRLLAACGGDA-----GVGFVWASLQHLALPYNALARLDKSLELAPW--LQTLDLSHNLI  204
            G     C G A     G     + LQ L + +N L  L  +   +    LQTL L HN I
Sbjct  188  GFSEKLCAGSALSNANGAVSGGSELQTLDVSFNELRSLPDAWGASRLRRLQTLSLQHNNI  247

Query  205  ST--ATELNCLPSLKNINLGFNKLEAVPIFNKASFQTLQILILKNNYIDNL--NGLHGLE  260
            ST     L  L SL+ +N+ +N L ++P    A  + L+ L L+ N +  L    LH LE
Sbjct  248  STLAPNALAGLSSLRVLNISYNHLVSLPSEAFAGNKELRELHLQGNDLYELPKGLLHRLE  307

Query  261  CLTELDLSYNCLTEHSV  277
             L  LDLS N LT+H V
Sbjct  308  QLLVLDLSGNQLTDHHV  324


 Score = 35.8 bits (81),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query  174  LALPYNALARL-DKSLELAPWLQTLDLSHNLISTATELNCLP--SLKNINLGFNKLEAVP  230
            L L  NAL R+  K+ +   +LQ LD+ +N I    E   LP  +L  +NL  N+L  + 
Sbjct  338  LNLSNNALTRIGSKTFKELYFLQILDMRNNSIGHIEEGAFLPLYNLHTLNLAENRLHTLD  397

Query  231  --IFNKASFQTLQILILKNNYIDNLNGLHGLEC--LTELDLSYNCLTE  274
              IFN      L  L L NN +  +       C  L ELDLS N LTE
Sbjct  398  NRIFN--GLYVLTKLTLNNNLVSIVESQAFRNCSDLKELDLSSNQLTE  443



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584681.1 glutamate dehydrogenase, mitochondrial [Cephus
cinctus]

Length=615
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHE3_DROME  unnamed protein product                                   647     0.0   
Q9VCN3_DROME  unnamed protein product                                 552     0.0   
DHE3_DICDI  unnamed protein product                                   420     3e-141


>DHE3_DROME unnamed protein product
Length=562

 Score = 647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/529 (57%), Positives = 397/529 (75%), Gaps = 19/529 (4%)

Query  104  YIILHQMPEHLVGIEKIDDPNFFEMVEYHYHRAVMIMEKSFLKDLQKYHDLSEEGRTRRV  163
            Y   HQ+P+ L  +    DP FF+MVEY +HR   I E+S + D++    L+ + + ++V
Sbjct  36   YATEHQIPDRLKDVPTAKDPRFFDMVEYFFHRGCQIAEESLVDDMKG--KLTRDEKKQKV  93

Query  164  KGIIKVMSVCQNTIEVTFPIRRDNGEYEIITGYRAHHNTHRLPCKGGMRFGPDVTRDEVR  223
            KGI+ +M  C + IE+ FP+RRD G YE+ITGYRA H+TH+ P KGG+RF  DV+RDEV+
Sbjct  94   KGILMLMQPCDHIIEIAFPLRRDAGNYEMITGYRAQHSTHKTPTKGGIRFSLDVSRDEVK  153

Query  224  ALASLMTFKCACCNVPFGGAKAGVVIDPKKYSAQELQKITRRFTLELVKKNMIGPAIDVP  283
            AL++LMTFKCAC +VPFGGAKAG+ I+PK+YS  EL+KITRRFTLEL KK  IGP +DVP
Sbjct  154  ALSALMTFKCACVDVPFGGAKAGLKINPKEYSEHELEKITRRFTLELAKKGFIGPGVDVP  213

Query  284  APDVNTGPREMSWMADTYSKTLGLNDINSHAVVTGKPINQGGVQGRSEATGRGIYHAVDN  343
            APD+ TG REMSW+ADTY+KT+G  DIN+HA VTGKPINQGG+ GR  ATGRG++H ++N
Sbjct  214  APDMGTGEREMSWIADTYAKTIGHLDINAHACVTGKPINQGGIHGRVSATGRGVFHGLEN  273

Query  344  FLSEEKWMSHVGLSTGFPNKTFIVQGFGNVGRFAAVYFTKAGAKCIGVIEREVSLYNENG  403
            F++E  +MS +G + G+  KTFIVQGFGNVG     Y T+AGA CIGVIE + +LYN  G
Sbjct  274  FINEANYMSQIGTTPGWGGKTFIVQGFGNVGLHTTRYLTRAGATCIGVIEHDGTLYNPEG  333

Query  404  INPEALIKYFNNKKTVKGFDGADEYNGENLMYEKCDIFVPAAAEKLVKGKDAKKIQAKII  463
            I+P+ L  Y N   T+ G+  A  Y GENLM+EKCDIF+PAA EK++  ++A +IQAKII
Sbjct  334  IDPKLLEDYKNEHGTIVGYQNAKPYEGENLMFEKCDIFIPAAVEKVITSENANRIQAKII  393

Query  464  AEGANGPCTPEADKIFLEKNVLVIPDLYMSGGGVTVSYFEWIKNISHVSFGRLHFKYERE  523
            AE ANGP TP ADKI +++N+LVIPDLY++ GGVTVS+FEW+KN++HVS+GRL FKYERE
Sbjct  394  AEAANGPTTPAADKILIDRNILVIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERE  453

Query  524  SNYHLLDSVEQSLKDKIDG-----------------VKIKPTDAFERRISAATERDIVNS  566
            SNYHLL SV+QS++  I+                  + + P+++F++RIS A+E+DIV+S
Sbjct  454  SNYHLLASVQQSIERIINDESVQESLERRFGRVGGRIPVTPSESFQKRISGASEKDIVHS  513

Query  567  SLDSSMETAAYRIMETANKYDLCLDIRLAAYCYAVEKIFRTYEEAGLAF  615
             LD +ME +A  IM+TA KY+L LD+R AAY  ++EKIF TY +AGLAF
Sbjct  514  GLDYTMERSARAIMKTAMKYNLGLDLRTAAYVNSIEKIFTTYRDAGLAF  562


>Q9VCN3_DROME unnamed protein product
Length=535

 Score = 552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/509 (52%), Positives = 359/509 (71%), Gaps = 3/509 (1%)

Query  108  HQMPEHLVGIEKIDDPNFFEMVEYHYHRAVMIMEKSFLKDLQKYHDLSEEGRTRRVKGII  167
            HQ+PE L  +E   DP F EMV Y+YH+A   ME + LK+++KY  +  E R  RV  I+
Sbjct  26   HQVPEKLKKVETDKDPEFSEMVLYYYHKAAQTMEPALLKEMEKYPHMKPEERQARVTAIL  85

Query  168  KVMSVCQNTIEVTFPIRRDNGEYEIITGYRAHHNTHRLPCKGGMRFGPDVTRDEVRALAS  227
             ++     ++EV FPI R NG YEII+GYR+HH  HRLP KGG+R+  DV   EV+ALA+
Sbjct  86   NLLGSVSTSVEVNFPIVRKNGTYEIISGYRSHHVRHRLPLKGGIRYALDVNESEVKALAA  145

Query  228  LMTFKCACCNVPFGGAKAGVVIDPKKYSAQELQKITRRFTLELVKKNMIGPAIDVPAPDV  287
            +MTFKCAC NVP+GG+K G+ IDPKKY+  ELQ ITRR+T+EL+K+NMIGP IDVPAPDV
Sbjct  146  IMTFKCACVNVPYGGSKGGICIDPKKYTVDELQTITRRYTMELLKRNMIGPGIDVPAPDV  205

Query  288  NTGPREMSWMADTYSKTLGLNDINSHAVVTGKPINQGGVQGRSEATGRGIYHAVDNFLSE  347
            NTGPREMSW+ D Y KT G  DINS A+VTGKP++ GG+ GR  ATGRG++ A D FL +
Sbjct  206  NTGPREMSWIVDQYQKTFGYKDINSSAIVTGKPVHNGGINGRHSATGRGVWKAGDLFLKD  265

Query  348  EKWMSHVGLSTGFPNKTFIVQGFGNVGRFAAVYFTKAGAKCIGVIEREVSLYNENGINPE  407
            ++WM  +   TG+ +KT IVQGFGNVG FAA Y  +AGAK IG+ E +VSL N++GI+  
Sbjct  266  KEWMDLLKWKTGWKDKTVIVQGFGNVGSFAAKYVHEAGAKVIGIKEFDVSLVNKDGIDIN  325

Query  408  ALIKYFNNKKTVKGFDGADEYNGENLMYEKCDIFVPAAAEKLVKGKDAKKIQAKIIAEGA  467
             L +Y   KKT+KG+  A E + E+L+  + DI +P A +K++   +AK I+AK+I EGA
Sbjct  326  DLFEYTEEKKTIKGYPKAQE-SKEDLLVAETDILMPCATQKVITTDNAKDIKAKLILEGA  384

Query  468  NGPCTPEADKIFLEKNVLVIPDLYMSGGGVTVSYFEWIKNISHVSFGRLHFKYERESNYH  527
            NGP TP  +KI L+K VL++PDLY + GGVTVSYFE++KNI+HVS+G+++ K   E    
Sbjct  385  NGPTTPSGEKILLDKGVLLVPDLYCNAGGVTVSYFEYLKNINHVSYGKMNSKSTSELIIE  444

Query  528  LLDSVEQSLKDKIDGV--KIKPTDAFERRISAATERDIVNSSLDSSMETAAYRIMETANK  585
            L++S+ +SL +  D     I P    +R     TE DIV+S+L + ME+AA  I E A+K
Sbjct  445  LMNSINESLHECPDSQLPNICPNKKLKRIQQCTTEADIVDSALQTVMESAARGIKEMAHK  504

Query  586  YDLCLDIRLAAYCYAVEKIFRTYEEAGLA  614
            ++LC D+R AAY ++  KIF+  E +G++
Sbjct  505  FELCNDLRRAAYVWSSFKIFQAMESSGIS  533


>DHE3_DICDI unnamed protein product
Length=502

 Score = 420 bits (1079),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 223/478 (47%), Positives = 302/478 (63%), Gaps = 15/478 (3%)

Query  141  EKSFLKDLQKYHDLSEEGRTRRVKGIIKVMSVCQNTIEVTFPIRRDNGEYEIITGYRAHH  200
            E  FL+  + + D +  G T    G++  M  C   + V FPI+ ++G+ +II GYRA H
Sbjct  36   EPRFLECFKTFFDKAA-GLTNLKPGVLNNMKECNVALRVEFPIKNEHGDVDIIAGYRAQH  94

Query  201  NTHRLPCKGGMRFGPDVTRDEVRALASLMTFKCACCNVPFGGAKAGVVIDPKKYSAQELQ  260
            + HRLPCKGG+RF  +V   EV ALASLMT+KCA  +VPFGGAK GV IDPKKY+  + +
Sbjct  95   SHHRLPCKGGIRFSEEVDLQEVMALASLMTYKCAVVDVPFGGAKGGVRIDPKKYTVAQRE  154

Query  261  KITRRFTLELVKKNMIGPAIDVPAPDVNTGPREMSWMADTYSKTLGLNDINSHAVVTGKP  320
            KITR +TL L +KN IGP +DVPAPD+ TG +EM+W+ DTY +    ND++S A VTGKP
Sbjct  155  KITRAYTLLLCQKNFIGPGVDVPAPDMGTGEQEMAWIRDTY-QAFNTNDVDSMACVTGKP  213

Query  321  INQGGVQGRSEATGRGIYHAVDNFLSEEKWMSHVGLSTGFPNKTFIVQGFGNVGRFAAVY  380
            I+ GG++GR+EATG G+++ +  FLS E+ +   GL+ G   K+ ++QGFGNVG FAA +
Sbjct  214  ISSGGIRGRTEATGLGVFYGIREFLSYEEVLKKTGLTPGIKGKSIVIQGFGNVGYFAAKF  273

Query  381  FTKAGAKCIGVIEREVSLYNENGINPEALIKYFNNKKTVKGFDGADE-YNGENLMYEKCD  439
            F +AGAK I V E   ++YN +G+N +AL KY     T   F GA    +    +   CD
Sbjct  274  FEQAGAKVIAVAEHNGAVYNADGLNIDALNKYKLQHGTFIDFPGATNIVDSVKALEIPCD  333

Query  440  IFVPAAAEKLVKGKDAKKIQAKIIAEGANGPCTPEADKIFLEKNVLVIPDLYMSGGGVTV  499
            I +PAA EK +   +   IQAK+I E ANGP TP AD+I L +  ++IPDL ++ GGVTV
Sbjct  334  ILIPAALEKQIHIGNVADIQAKLIGEAANGPMTPRADQILLNRGHVIIPDLLLNAGGVTV  393

Query  500  SYFEWIKNISHVSFGRLHFKYERESNYHLLDSVEQSLKDKIDGVKIKPTDAFERR--ISA  557
            SYFEW+KN+SHV FGRL+ K+E  S   LL+ VE ++  K+           ER   I  
Sbjct  394  SYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFVESTVNKKLSEA--------ERSLIIHG  445

Query  558  ATERDIVNSSLDSSMETAAYRIMETANKYDLCLDIRLAAYCYAVEKIFRTYEEAGLAF  615
            A E DIV S L+ +M+ A     +TAN+ +   D R AA   A+ KI   YE +G  F
Sbjct  446  ADEIDIVRSGLEDTMQNACAETRKTANEKN--TDYRSAALYNAIMKIKAVYESSGNVF  501



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584682.1 glutamate dehydrogenase, mitochondrial isoform X1
[Cephus cinctus]

Length=560
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHE3_DROME  unnamed protein product                                   989     0.0   
Q9VCN3_DROME  unnamed protein product                                 498     4e-172
DHE3_DICDI  unnamed protein product                                   450     1e-153


>DHE3_DROME unnamed protein product
Length=562

 Score = 989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/567 (84%), Positives = 521/567 (92%), Gaps = 12/567 (2%)

Query  1    MFHLKTLAKSSAALKQGVDVQGALARAVPAAI--QARNFA-DHQIPDRLKDVPTAPNPKF  57
            M+HLK+LA+  A  +Q +     LA+A+P A+   +R +A +HQIPDRLKDVPTA +P+F
Sbjct  1    MYHLKSLARQGARRQQEL---ATLAKALPTAVMQSSRGYATEHQIPDRLKDVPTAKDPRF  57

Query  58   FDMVEYFFHRACQIVEDKLVEDIGKGSKLSVEDRKKKVKGILMLMQPCDHILETSFPLRR  117
            FDMVEYFFHR CQI E+ LV+D+ KG KL+ +++K+KVKGILMLMQPCDHI+E +FPLRR
Sbjct  58   FDMVEYFFHRGCQIAEESLVDDM-KG-KLTRDEKKQKVKGILMLMQPCDHIIEIAFPLRR  115

Query  118  DSGDYEMITGYRAQHSTHRTPCKGGIRFSMDVCRDEVKALSALMTFKCACVDVPFGGAKA  177
            D+G+YEMITGYRAQHSTH+TP KGGIRFS+DV RDEVKALSALMTFKCACVDVPFGGAKA
Sbjct  116  DAGNYEMITGYRAQHSTHKTPTKGGIRFSLDVSRDEVKALSALMTFKCACVDVPFGGAKA  175

Query  178  GIKINPKAYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTI  237
            G+KINPK YSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTI
Sbjct  176  GLKINPKEYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTI  235

Query  238  GHLDINSHACVTGKPINQGGIHGRISATGRGVFHGLENFINEANYMSMIGTTPGWGGKTF  297
            GHLDIN+HACVTGKPINQGGIHGR+SATGRGVFHGLENFINEANYMS IGTTPGWGGKTF
Sbjct  236  GHLDINAHACVTGKPINQGGIHGRVSATGRGVFHGLENFINEANYMSQIGTTPGWGGKTF  295

Query  298  IVQGFGNVGLHSMRYLHRAGAVCIGVIEHDGSIFNPEGIDPKQLEDYRIETGSIVGFPGA  357
            IVQGFGNVGLH+ RYL RAGA CIGVIEHDG+++NPEGIDPK LEDY+ E G+IVG+  A
Sbjct  296  IVQGFGNVGLHTTRYLTRAGATCIGVIEHDGTLYNPEGIDPKLLEDYKNEHGTIVGYQNA  355

Query  358  KPYEGENLMYEPCDIFIPAAIEKVITKDNAGRIQAKIVAEAANGPTTPAADQILIERNIL  417
            KPYEGENLM+E CDIFIPAA+EKVIT +NA RIQAKI+AEAANGPTTPAAD+ILI+RNIL
Sbjct  356  KPYEGENLMFEKCDIFIPAAVEKVITSENANRIQAKIIAEAANGPTTPAADKILIDRNIL  415

Query  418  VIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLESVQQSLER----ESV  473
            VIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLL SVQQS+ER    ESV
Sbjct  416  VIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLASVQQSIERIINDESV  475

Query  474  QESLERRFGRVGGRIPVTPSEAFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKFNL  533
            QESLERRFGRVGGRIPVTPSE+FQKRISGASEKDIVHSGLDYTMERSARAIMKTAMK+NL
Sbjct  476  QESLERRFGRVGGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKYNL  535

Query  534  GLDLRTAAYANSIEKIFTTYSEAGLAF  560
            GLDLRTAAY NSIEKIFTTY +AGLAF
Sbjct  536  GLDLRTAAYVNSIEKIFTTYRDAGLAF  562


>Q9VCN3_DROME unnamed protein product
Length=535

 Score = 498 bits (1281),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 248/527 (47%), Positives = 348/527 (66%), Gaps = 12/527 (2%)

Query  33   QARNFADHQIPDRLKDVPTAPNPKFFDMVEYFFHRACQIVEDKLVEDIGKGSKLSVEDRK  92
            Q    + HQ+P++LK V T  +P+F +MV Y++H+A Q +E  L++++ K   +  E+R+
Sbjct  19   QVLKRSAHQVPEKLKKVETDKDPEFSEMVLYYYHKAAQTMEPALLKEMEKYPHMKPEERQ  78

Query  93   KKVKGILMLMQPCDHILETSFPLRRDSGDYEMITGYRAQHSTHRTPCKGGIRFSMDVCRD  152
             +V  IL L+      +E +FP+ R +G YE+I+GYR+ H  HR P KGGIR+++DV   
Sbjct  79   ARVTAILNLLGSVSTSVEVNFPIVRKNGTYEIISGYRSHHVRHRLPLKGGIRYALDVNES  138

Query  153  EVKALSALMTFKCACVDVPFGGAKAGIKINPKAYSEHELEKITRRFTLELAKKGFIGPGV  212
            EVKAL+A+MTFKCACV+VP+GG+K GI I+PK Y+  EL+ ITRR+T+EL K+  IGPG+
Sbjct  139  EVKALAAIMTFKCACVNVPYGGSKGGICIDPKKYTVDELQTITRRYTMELLKRNMIGPGI  198

Query  213  DVPAPDMGTGEREMSWIADTYAKTIGHLDINSHACVTGKPINQGGIHGRISATGRGVFHG  272
            DVPAPD+ TG REMSWI D Y KT G+ DINS A VTGKP++ GGI+GR SATGRGV+  
Sbjct  199  DVPAPDVNTGPREMSWIVDQYQKTFGYKDINSSAIVTGKPVHNGGINGRHSATGRGVWKA  258

Query  273  LENFINEANYMSMIGTTPGWGGKTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEHDGSIFN  332
             + F+ +  +M ++    GW  KT IVQGFGNVG  + +Y+H AGA  IG+ E D S+ N
Sbjct  259  GDLFLKDKEWMDLLKWKTGWKDKTVIVQGFGNVGSFAAKYVHEAGAKVIGIKEFDVSLVN  318

Query  333  PEGIDPKQLEDYRIETGSIVGFPGAKPYEGENLMYEPCDIFIPAAIEKVITKDNAGRIQA  392
             +GID   L +Y  E  +I G+P A+  + E+L+    DI +P A +KVIT DNA  I+A
Sbjct  319  KDGIDINDLFEYTEEKKTIKGYPKAQESK-EDLLVAETDILMPCATQKVITTDNAKDIKA  377

Query  393  KIVAEAANGPTTPAADQILIERNILVIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKY  452
            K++ E ANGPTTP+ ++IL+++ +L++PDLY NAGGVTVS+FE+LKN+NHVSYG++  K 
Sbjct  378  KLILEGANGPTTPSGEKILLDKGVLLVPDLYCNAGGVTVSYFEYLKNINHVSYGKMNSKS  437

Query  453  ERESNYHLLESVQQSLERESVQESLERRFGRVGGRIPVTPSEAFQKRISGASEKDIVHSG  512
              E    L+ S+ +SL  E     L            + P++  ++     +E DIV S 
Sbjct  438  TSELIIELMNSINESL-HECPDSQLPN----------ICPNKKLKRIQQCTTEADIVDSA  486

Query  513  LDYTMERSARAIMKTAMKFNLGLDLRTAAYANSIEKIFTTYSEAGLA  559
            L   ME +AR I + A KF L  DLR AAY  S  KIF     +G++
Sbjct  487  LQTVMESAARGIKEMAHKFELCNDLRRAAYVWSSFKIFQAMESSGIS  533


>DHE3_DICDI unnamed protein product
Length=502

 Score = 450 bits (1157),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 235/507 (46%), Positives = 315/507 (62%), Gaps = 43/507 (8%)

Query  55   PKFFDMVEYFFHRACQIVEDKLVEDIGKGSKLSVEDRKKKVKGILMLMQPCDHILETSFP  114
            P+F +  + FF +A  +   K                     G+L  M+ C+  L   FP
Sbjct  37   PRFLECFKTFFDKAAGLTNLK--------------------PGVLNNMKECNVALRVEFP  76

Query  115  LRRDSGDYEMITGYRAQHSTHRTPCKGGIRFSMDVCRDEVKALSALMTFKCACVDVPFGG  174
            ++ + GD ++I GYRAQHS HR PCKGGIRFS +V   EV AL++LMT+KCA VDVPFGG
Sbjct  77   IKNEHGDVDIIAGYRAQHSHHRLPCKGGIRFSEEVDLQEVMALASLMTYKCAVVDVPFGG  136

Query  175  AKAGIKINPKAYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYA  234
            AK G++I+PK Y+  + EKITR +TL L +K FIGPGVDVPAPDMGTGE+EM+WI DTY 
Sbjct  137  AKGGVRIDPKKYTVAQREKITRAYTLLLCQKNFIGPGVDVPAPDMGTGEQEMAWIRDTY-  195

Query  235  KTIGHLDINSHACVTGKPINQGGIHGRISATGRGVFHGLENFINEANYMSMIGTTPGWGG  294
            +     D++S ACVTGKPI+ GGI GR  ATG GVF+G+  F++    +   G TPG  G
Sbjct  196  QAFNTNDVDSMACVTGKPISSGGIRGRTEATGLGVFYGIREFLSYEEVLKKTGLTPGIKG  255

Query  295  KTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEHDGSIFNPEGIDPKQLEDYRIETGSIVGF  354
            K+ ++QGFGNVG  + ++  +AGA  I V EH+G+++N +G++   L  Y+++ G+ + F
Sbjct  256  KSIVIQGFGNVGYFAAKFFEQAGAKVIAVAEHNGAVYNADGLNIDALNKYKLQHGTFIDF  315

Query  355  PGAKP-YEGENLMYEPCDIFIPAAIEKVITKDNAGRIQAKIVAEAANGPTTPAADQILIE  413
            PGA    +    +  PCDI IPAA+EK I   N   IQAK++ EAANGP TP ADQIL+ 
Sbjct  316  PGATNIVDSVKALEIPCDILIPAALEKQIHIGNVADIQAKLIGEAANGPMTPRADQILLN  375

Query  414  RNILVIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLESVQQSLERESV  473
            R  ++IPDL +NAGGVTVS+FEWLKNL+HV +GRL  K+E  S   LLE V+ ++ ++  
Sbjct  376  RGHVIIPDLLLNAGGVTVSYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFVESTVNKKLS  435

Query  474  QESLERRFGRVGGRIPVTPSEAFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKFNL  533
            +   ER                    I GA E DIV SGL+ TM+ +     KTA + N 
Sbjct  436  EA--ERSL-----------------IIHGADEIDIVRSGLEDTMQNACAETRKTANEKN-  475

Query  534  GLDLRTAAYANSIEKIFTTYSEAGLAF  560
              D R+AA  N+I KI   Y  +G  F
Sbjct  476  -TDYRSAALYNAIMKIKAVYESSGNVF  501



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584683.1 glutamate dehydrogenase, mitochondrial isoform X2
[Cephus cinctus]

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHE3_DROME  unnamed protein product                                   972     0.0   
Q9VCN3_DROME  unnamed protein product                                 501     1e-173
DHE3_DICDI  unnamed protein product                                   454     1e-155


>DHE3_DROME unnamed protein product
Length=562

 Score = 972 bits (2513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/567 (82%), Positives = 513/567 (90%), Gaps = 21/567 (4%)

Query  1    MFHLKTLAKSSAALKQGVDVQGALARAVPAAI--QARNFA-DHQIPDRLKDVPTAPNPKF  57
            M+HLK+LA+  A  +Q +     LA+A+P A+   +R +A +HQIPDRLKDVPTA +P+F
Sbjct  1    MYHLKSLARQGARRQQEL---ATLAKALPTAVMQSSRGYATEHQIPDRLKDVPTAKDPRF  57

Query  58   FDMVEYFFHRACQIVEDKLVEDIGKGSKLSVEDRKKKVKGILMLMQPCDHILETSFPLRR  117
            FDMVEYFFHR CQI E+ LV+D+ KG KL+ +++K+KVKGILMLMQPCDHI+E +FPLRR
Sbjct  58   FDMVEYFFHRGCQIAEESLVDDM-KG-KLTRDEKKQKVKGILMLMQPCDHIIEIAFPLRR  115

Query  118  DSGDYEMITGYRAQHSTHRTPCKGGIRFSMDVCRDEVKALSALMTFKCACVDVPFGGAKA  177
            D+G+YEMITGYRAQHSTH+TP KGGIRFS+DV RDEVKALSALMTFKCACVDVPFGGAKA
Sbjct  116  DAGNYEMITGYRAQHSTHKTPTKGGIRFSLDVSRDEVKALSALMTFKCACVDVPFGGAKA  175

Query  178  GIKINPKAYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTI  237
            G+KINPK YSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTI
Sbjct  176  GLKINPKEYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYAKTI  235

Query  238  GHLDINSHACVTGKPINQGGIHGRISATGRGVFHGLENFINEANYMSMIGTTPGWGGKTF  297
            GHLDIN+HACVTGKPINQGGIHGR+SATGRGVFHGLENFINEANYMS IGTTPGWGGKTF
Sbjct  236  GHLDINAHACVTGKPINQGGIHGRVSATGRGVFHGLENFINEANYMSQIGTTPGWGGKTF  295

Query  298  IVQGFGNVGLHSMRYLHRAGAVCIGVIEHDGSIFNPEGIDPKQLEDYRIETGSIVGFPGA  357
            IVQGFGNVGLH+ RYL RAGA CIGVIEHDG+++NPEGIDPK LEDY+ E G+IVG+  A
Sbjct  296  IVQGFGNVGLHTTRYLTRAGATCIGVIEHDGTLYNPEGIDPKLLEDYKNEHGTIVGYQNA  355

Query  358  KPYEGENLMYEPCDIFIPAAIEKVITKDNAGRIQAKIVAEAANGPTTPAADQILIERNIL  417
            KPYEGENLM+E CDIFIPAA+EKVIT +NA RIQAKI+AEAANGPTTPAAD+ILI+RNIL
Sbjct  356  KPYEGENLMFEKCDIFIPAAVEKVITSENANRIQAKIIAEAANGPTTPAADKILIDRNIL  415

Query  418  VIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLL-------------ESV  464
            VIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLL             ESV
Sbjct  416  VIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLASVQQSIERIINDESV  475

Query  465  QESLERRFGRVGGRIPVTPSEAFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKFNL  524
            QESLERRFGRVGGRIPVTPSE+FQKRISGASEKDIVHSGLDYTMERSARAIMKTAMK+NL
Sbjct  476  QESLERRFGRVGGRIPVTPSESFQKRISGASEKDIVHSGLDYTMERSARAIMKTAMKYNL  535

Query  525  GLDLRTAAYANSIEKIFTTYSEAGLAF  551
            GLDLRTAAY NSIEKIFTTY +AGLAF
Sbjct  536  GLDLRTAAYVNSIEKIFTTYRDAGLAF  562


>Q9VCN3_DROME unnamed protein product
Length=535

 Score = 501 bits (1291),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 248/519 (48%), Positives = 349/519 (67%), Gaps = 5/519 (1%)

Query  33   QARNFADHQIPDRLKDVPTAPNPKFFDMVEYFFHRACQIVEDKLVEDIGKGSKLSVEDRK  92
            Q    + HQ+P++LK V T  +P+F +MV Y++H+A Q +E  L++++ K   +  E+R+
Sbjct  19   QVLKRSAHQVPEKLKKVETDKDPEFSEMVLYYYHKAAQTMEPALLKEMEKYPHMKPEERQ  78

Query  93   KKVKGILMLMQPCDHILETSFPLRRDSGDYEMITGYRAQHSTHRTPCKGGIRFSMDVCRD  152
             +V  IL L+      +E +FP+ R +G YE+I+GYR+ H  HR P KGGIR+++DV   
Sbjct  79   ARVTAILNLLGSVSTSVEVNFPIVRKNGTYEIISGYRSHHVRHRLPLKGGIRYALDVNES  138

Query  153  EVKALSALMTFKCACVDVPFGGAKAGIKINPKAYSEHELEKITRRFTLELAKKGFIGPGV  212
            EVKAL+A+MTFKCACV+VP+GG+K GI I+PK Y+  EL+ ITRR+T+EL K+  IGPG+
Sbjct  139  EVKALAAIMTFKCACVNVPYGGSKGGICIDPKKYTVDELQTITRRYTMELLKRNMIGPGI  198

Query  213  DVPAPDMGTGEREMSWIADTYAKTIGHLDINSHACVTGKPINQGGIHGRISATGRGVFHG  272
            DVPAPD+ TG REMSWI D Y KT G+ DINS A VTGKP++ GGI+GR SATGRGV+  
Sbjct  199  DVPAPDVNTGPREMSWIVDQYQKTFGYKDINSSAIVTGKPVHNGGINGRHSATGRGVWKA  258

Query  273  LENFINEANYMSMIGTTPGWGGKTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEHDGSIFN  332
             + F+ +  +M ++    GW  KT IVQGFGNVG  + +Y+H AGA  IG+ E D S+ N
Sbjct  259  GDLFLKDKEWMDLLKWKTGWKDKTVIVQGFGNVGSFAAKYVHEAGAKVIGIKEFDVSLVN  318

Query  333  PEGIDPKQLEDYRIETGSIVGFPGAKPYEGENLMYEPCDIFIPAAIEKVITKDNAGRIQA  392
             +GID   L +Y  E  +I G+P A+  + E+L+    DI +P A +KVIT DNA  I+A
Sbjct  319  KDGIDINDLFEYTEEKKTIKGYPKAQESK-EDLLVAETDILMPCATQKVITTDNAKDIKA  377

Query  393  KIVAEAANGPTTPAADQILIERNILVIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKY  452
            K++ E ANGPTTP+ ++IL+++ +L++PDLY NAGGVTVS+FE+LKN+NHVSYG++  K 
Sbjct  378  KLILEGANGPTTPSGEKILLDKGVLLVPDLYCNAGGVTVSYFEYLKNINHVSYGKMNSKS  437

Query  453  ERESNYHLLESVQESLERRFGRVGGRIP-VTPSEAFQKRISGASEKDIVHSGLDYTMERS  511
              E    L+ S+ ESL         ++P + P++  ++     +E DIV S L   ME +
Sbjct  438  TSELIIELMNSINESLHE---CPDSQLPNICPNKKLKRIQQCTTEADIVDSALQTVMESA  494

Query  512  ARAIMKTAMKFNLGLDLRTAAYANSIEKIFTTYSEAGLA  550
            AR I + A KF L  DLR AAY  S  KIF     +G++
Sbjct  495  ARGIKEMAHKFELCNDLRRAAYVWSSFKIFQAMESSGIS  533


>DHE3_DICDI unnamed protein product
Length=502

 Score = 454 bits (1169),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 236/499 (47%), Positives = 316/499 (63%), Gaps = 36/499 (7%)

Query  55   PKFFDMVEYFFHRACQIVEDKLVEDIGKGSKLSVEDRKKKVKGILMLMQPCDHILETSFP  114
            P+F +  + FF +A  +   K                     G+L  M+ C+  L   FP
Sbjct  37   PRFLECFKTFFDKAAGLTNLK--------------------PGVLNNMKECNVALRVEFP  76

Query  115  LRRDSGDYEMITGYRAQHSTHRTPCKGGIRFSMDVCRDEVKALSALMTFKCACVDVPFGG  174
            ++ + GD ++I GYRAQHS HR PCKGGIRFS +V   EV AL++LMT+KCA VDVPFGG
Sbjct  77   IKNEHGDVDIIAGYRAQHSHHRLPCKGGIRFSEEVDLQEVMALASLMTYKCAVVDVPFGG  136

Query  175  AKAGIKINPKAYSEHELEKITRRFTLELAKKGFIGPGVDVPAPDMGTGEREMSWIADTYA  234
            AK G++I+PK Y+  + EKITR +TL L +K FIGPGVDVPAPDMGTGE+EM+WI DTY 
Sbjct  137  AKGGVRIDPKKYTVAQREKITRAYTLLLCQKNFIGPGVDVPAPDMGTGEQEMAWIRDTY-  195

Query  235  KTIGHLDINSHACVTGKPINQGGIHGRISATGRGVFHGLENFINEANYMSMIGTTPGWGG  294
            +     D++S ACVTGKPI+ GGI GR  ATG GVF+G+  F++    +   G TPG  G
Sbjct  196  QAFNTNDVDSMACVTGKPISSGGIRGRTEATGLGVFYGIREFLSYEEVLKKTGLTPGIKG  255

Query  295  KTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEHDGSIFNPEGIDPKQLEDYRIETGSIVGF  354
            K+ ++QGFGNVG  + ++  +AGA  I V EH+G+++N +G++   L  Y+++ G+ + F
Sbjct  256  KSIVIQGFGNVGYFAAKFFEQAGAKVIAVAEHNGAVYNADGLNIDALNKYKLQHGTFIDF  315

Query  355  PGAKP-YEGENLMYEPCDIFIPAAIEKVITKDNAGRIQAKIVAEAANGPTTPAADQILIE  413
            PGA    +    +  PCDI IPAA+EK I   N   IQAK++ EAANGP TP ADQIL+ 
Sbjct  316  PGATNIVDSVKALEIPCDILIPAALEKQIHIGNVADIQAKLIGEAANGPMTPRADQILLN  375

Query  414  RNILVIPDLYINAGGVTVSFFEWLKNLNHVSYGRLTFKYERESNYHLLESVQESLERRFG  473
            R  ++IPDL +NAGGVTVS+FEWLKNL+HV +GRL  K+E  S   LLE V+ ++ ++  
Sbjct  376  RGHVIIPDLLLNAGGVTVSYFEWLKNLSHVRFGRLNKKWEESSKKLLLEFVESTVNKKL-  434

Query  474  RVGGRIPVTPSEAFQKR-ISGASEKDIVHSGLDYTMERSARAIMKTAMKFNLGLDLRTAA  532
                      SEA +   I GA E DIV SGL+ TM+ +     KTA + N   D R+AA
Sbjct  435  ----------SEAERSLIIHGADEIDIVRSGLEDTMQNACAETRKTANEKN--TDYRSAA  482

Query  533  YANSIEKIFTTYSEAGLAF  551
              N+I KI   Y  +G  F
Sbjct  483  LYNAIMKIKAVYESSGNVF  501



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584684.1 glutamate dehydrogenase, mitochondrial isoform X3
[Cephus cinctus]

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DHE3_DROME  unnamed protein product                                   789     0.0   
Q9VCN3_DROME  unnamed protein product                                 400     8e-136
DHE3_DICDI  unnamed protein product                                   385     2e-130


>DHE3_DROME unnamed protein product
Length=562

 Score = 789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/418 (90%), Positives = 397/418 (95%), Gaps = 4/418 (1%)

Query  1    MDVCRDEVKALSALMTFKCACVDVPFGGAKAGIKINPKAYSEHELEKITRRFTLELAKKG  60
            +DV RDEVKALSALMTFKCACVDVPFGGAKAG+KINPK YSEHELEKITRRFTLELAKKG
Sbjct  145  LDVSRDEVKALSALMTFKCACVDVPFGGAKAGLKINPKEYSEHELEKITRRFTLELAKKG  204

Query  61   FIGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDINSHACVTGKPINQGGIHGRISATG  120
            FIGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDIN+HACVTGKPINQGGIHGR+SATG
Sbjct  205  FIGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDINAHACVTGKPINQGGIHGRVSATG  264

Query  121  RGVFHGLENFINEANYMSMIGTTPGWGGKTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEH  180
            RGVFHGLENFINEANYMS IGTTPGWGGKTFIVQGFGNVGLH+ RYL RAGA CIGVIEH
Sbjct  265  RGVFHGLENFINEANYMSQIGTTPGWGGKTFIVQGFGNVGLHTTRYLTRAGATCIGVIEH  324

Query  181  DGSIFNPEGIDPKQLEDYRIETGSIVGFPGAKPYEGENLMYEPCDIFIPAAIEKVITKDN  240
            DG+++NPEGIDPK LEDY+ E G+IVG+  AKPYEGENLM+E CDIFIPAA+EKVIT +N
Sbjct  325  DGTLYNPEGIDPKLLEDYKNEHGTIVGYQNAKPYEGENLMFEKCDIFIPAAVEKVITSEN  384

Query  241  AGRIQAKIVAEAANGPTTPAADQILIERNILVIPDLYINAGGVTVSFFEWLKNLNHVSYG  300
            A RIQAKI+AEAANGPTTPAAD+ILI+RNILVIPDLYINAGGVTVSFFEWLKNLNHVSYG
Sbjct  385  ANRIQAKIIAEAANGPTTPAADKILIDRNILVIPDLYINAGGVTVSFFEWLKNLNHVSYG  444

Query  301  RLTFKYERESNYHLLESVQQSLER----ESVQESLERRFGRVGGRIPVTPSEAFQKRISG  356
            RLTFKYERESNYHLL SVQQS+ER    ESVQESLERRFGRVGGRIPVTPSE+FQKRISG
Sbjct  445  RLTFKYERESNYHLLASVQQSIERIINDESVQESLERRFGRVGGRIPVTPSESFQKRISG  504

Query  357  ASEKDIVHSGLDYTMERSARAIMKTAMKFNLGLDLRTAAYANSIEKIFTTYSEAGLAF  414
            ASEKDIVHSGLDYTMERSARAIMKTAMK+NLGLDLRTAAY NSIEKIFTTY +AGLAF
Sbjct  505  ASEKDIVHSGLDYTMERSARAIMKTAMKYNLGLDLRTAAYVNSIEKIFTTYRDAGLAF  562


>Q9VCN3_DROME unnamed protein product
Length=535

 Score = 400 bits (1027),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 203/413 (49%), Positives = 274/413 (66%), Gaps = 12/413 (3%)

Query  1    MDVCRDEVKALSALMTFKCACVDVPFGGAKAGIKINPKAYSEHELEKITRRFTLELAKKG  60
            +DV   EVKAL+A+MTFKCACV+VP+GG+K GI I+PK Y+  EL+ ITRR+T+EL K+ 
Sbjct  133  LDVNESEVKALAAIMTFKCACVNVPYGGSKGGICIDPKKYTVDELQTITRRYTMELLKRN  192

Query  61   FIGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDINSHACVTGKPINQGGIHGRISATG  120
             IGPG+DVPAPD+ TG REMSWI D Y KT G+ DINS A VTGKP++ GGI+GR SATG
Sbjct  193  MIGPGIDVPAPDVNTGPREMSWIVDQYQKTFGYKDINSSAIVTGKPVHNGGINGRHSATG  252

Query  121  RGVFHGLENFINEANYMSMIGTTPGWGGKTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEH  180
            RGV+   + F+ +  +M ++    GW  KT IVQGFGNVG  + +Y+H AGA  IG+ E 
Sbjct  253  RGVWKAGDLFLKDKEWMDLLKWKTGWKDKTVIVQGFGNVGSFAAKYVHEAGAKVIGIKEF  312

Query  181  DGSIFNPEGIDPKQLEDYRIETGSIVGFPGAKPYEGENLMYEPCDIFIPAAIEKVITKDN  240
            D S+ N +GID   L +Y  E  +I G+P A+  + E+L+    DI +P A +KVIT DN
Sbjct  313  DVSLVNKDGIDINDLFEYTEEKKTIKGYPKAQESK-EDLLVAETDILMPCATQKVITTDN  371

Query  241  AGRIQAKIVAEAANGPTTPAADQILIERNILVIPDLYINAGGVTVSFFEWLKNLNHVSYG  300
            A  I+AK++ E ANGPTTP+ ++IL+++ +L++PDLY NAGGVTVS+FE+LKN+NHVSYG
Sbjct  372  AKDIKAKLILEGANGPTTPSGEKILLDKGVLLVPDLYCNAGGVTVSYFEYLKNINHVSYG  431

Query  301  RLTFKYERESNYHLLESVQQSLERESVQESLERRFGRVGGRIPVTPSEAFQKRISGASEK  360
            ++  K   E    L+ S+ +SL  E     L            + P++  ++     +E 
Sbjct  432  KMNSKSTSELIIELMNSINESL-HECPDSQLPN----------ICPNKKLKRIQQCTTEA  480

Query  361  DIVHSGLDYTMERSARAIMKTAMKFNLGLDLRTAAYANSIEKIFTTYSEAGLA  413
            DIV S L   ME +AR I + A KF L  DLR AAY  S  KIF     +G++
Sbjct  481  DIVDSALQTVMESAARGIKEMAHKFELCNDLRRAAYVWSSFKIFQAMESSGIS  533


>DHE3_DICDI unnamed protein product
Length=502

 Score = 385 bits (988),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 201/414 (49%), Positives = 268/414 (65%), Gaps = 23/414 (6%)

Query  2    DVCRDEVKALSALMTFKCACVDVPFGGAKAGIKINPKAYSEHELEKITRRFTLELAKKGF  61
            +V   EV AL++LMT+KCA VDVPFGGAK G++I+PK Y+  + EKITR +TL L +K F
Sbjct  110  EVDLQEVMALASLMTYKCAVVDVPFGGAKGGVRIDPKKYTVAQREKITRAYTLLLCQKNF  169

Query  62   IGPGVDVPAPDMGTGEREMSWIADTYAKTIGHLDINSHACVTGKPINQGGIHGRISATGR  121
            IGPGVDVPAPDMGTGE+EM+WI DTY +     D++S ACVTGKPI+ GGI GR  ATG 
Sbjct  170  IGPGVDVPAPDMGTGEQEMAWIRDTY-QAFNTNDVDSMACVTGKPISSGGIRGRTEATGL  228

Query  122  GVFHGLENFINEANYMSMIGTTPGWGGKTFIVQGFGNVGLHSMRYLHRAGAVCIGVIEHD  181
            GVF+G+  F++    +   G TPG  GK+ ++QGFGNVG  + ++  +AGA  I V EH+
Sbjct  229  GVFYGIREFLSYEEVLKKTGLTPGIKGKSIVIQGFGNVGYFAAKFFEQAGAKVIAVAEHN  288

Query  182  GSIFNPEGIDPKQLEDYRIETGSIVGFPGAKP-YEGENLMYEPCDIFIPAAIEKVITKDN  240
            G+++N +G++   L  Y+++ G+ + FPGA    +    +  PCDI IPAA+EK I   N
Sbjct  289  GAVYNADGLNIDALNKYKLQHGTFIDFPGATNIVDSVKALEIPCDILIPAALEKQIHIGN  348

Query  241  AGRIQAKIVAEAANGPTTPAADQILIERNILVIPDLYINAGGVTVSFFEWLKNLNHVSYG  300
               IQAK++ EAANGP TP ADQIL+ R  ++IPDL +NAGGVTVS+FEWLKNL+HV +G
Sbjct  349  VADIQAKLIGEAANGPMTPRADQILLNRGHVIIPDLLLNAGGVTVSYFEWLKNLSHVRFG  408

Query  301  RLTFKYERESNYHLLESVQQSLERESVQESLERRFGRVGGRIPVTPSEAFQKRISGASEK  360
            RL  K+E  S   LLE V+ ++ ++  +   ER                    I GA E 
Sbjct  409  RLNKKWEESSKKLLLEFVESTVNKKLSEA--ERSL-----------------IIHGADEI  449

Query  361  DIVHSGLDYTMERSARAIMKTAMKFNLGLDLRTAAYANSIEKIFTTYSEAGLAF  414
            DIV SGL+ TM+ +     KTA + N   D R+AA  N+I KI   Y  +G  F
Sbjct  450  DIVRSGLEDTMQNACAETRKTANEKN--TDYRSAALYNAIMKIKAVYESSGNVF  501



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584685.1 carbonic anhydrase 9 [Cephus cinctus]

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTU8_DROME  unnamed protein product                                 187     3e-57
M9PF87_DROME  unnamed protein product                                 153     4e-45
Q9V396_DROME  unnamed protein product                                 119     6e-32


>Q9VTU8_DROME unnamed protein product
Length=335

 Score = 187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/310 (33%), Positives = 170/310 (55%), Gaps = 14/310 (5%)

Query  1    MMLLYVLFIIPLTLAHSAYGDFGYSRRH--QHTWAQEHKACAGKWQSPIALSSARAVALP  58
            +++  +L    L LA     DFGY  RH  +H W++++  C+GK QSPI +    AV   
Sbjct  11   IVIAPILICASLVLAQ----DFGYEGRHGPEH-WSEDYARCSGKHQSPINIDQVSAVEKK  65

Query  59   LPAVEMIGYHNLLSGPVKLTNNGHSVALSLNKALSKKRLPFVFGGMLNKDQ--DYELEGL  116
             P +E   +  ++   +++TNNGH+V + +  + ++  +P V GG L +     Y+ E  
Sbjct  66   FPKLEFFNF-KVVPDNLQMTNNGHTVLVKM--SYNEDEIPSVRGGPLAEKTPLGYQFEQF  122

Query  117  HFHWGIKNNRGSEHILNGIRFPMEMHVIHRNMKYPDLASALQHEDGLTVLGIFFQLQEEE  176
            HFHWG  +  GSE ++N   +P E+HV+ RN++YPD ASAL  + G+ V+  FFQ+ ++ 
Sbjct  123  HFHWGENDTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKS  182

Query  177  NEHLYPILRTLPNIQWINTEAELNVSITLASLMPRDTEIFYTYRGSLTTPPCSEAVTWIL  236
                      L  I        +   + L   + +  E +++Y GSLTTPPCSE VTWI 
Sbjct  183  TGGYEGFTNLLSQIDRKGKSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWID  242

Query  237  FPTTVPISFRQMNKFRMLSNGEEVLADNFRRLQDIGNRKVYVRRIE--PYFASNVEMIDL  294
            F T + I+ +Q+N FR+L+  ++ L +NFR +Q + +R +Y   IE   +   ++ ++D 
Sbjct  243  FTTPIDITEKQLNAFRLLTANDDHLKNNFRPIQPLNDRTLYKNYIEIPIHNMGSIPLVDA  302

Query  295  NVESLQWYWQ  304
               + +W  Q
Sbjct  303  ENAAGKWRAQ  312


>M9PF87_DROME unnamed protein product
Length=253

 Score = 153 bits (387),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/208 (37%), Positives = 120/208 (58%), Gaps = 4/208 (2%)

Query  77   LTNNGHSVALSLNKALSKKRLPFVFGGMLNKDQ--DYELEGLHFHWGIKNNRGSEHILNG  134
            +TNNGH+V + +  + ++  +P V GG L +     Y+ E  HFHWG  +  GSE ++N 
Sbjct  1    MTNNGHTVLVKM--SYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINN  58

Query  135  IRFPMEMHVIHRNMKYPDLASALQHEDGLTVLGIFFQLQEEENEHLYPILRTLPNIQWIN  194
              +P E+HV+ RN++YPD ASAL  + G+ V+  FFQ+ ++           L  I    
Sbjct  59   RAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKG  118

Query  195  TEAELNVSITLASLMPRDTEIFYTYRGSLTTPPCSEAVTWILFPTTVPISFRQMNKFRML  254
                +   + L   + +  E +++Y GSLTTPPCSE VTWI F T + I+ +Q+N FR+L
Sbjct  119  KSVNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRLL  178

Query  255  SNGEEVLADNFRRLQDIGNRKVYVRRIE  282
            +  ++ L +NFR +Q + +R +Y   IE
Sbjct  179  TANDDHLKNNFRPIQPLNDRTLYKNYIE  206


>Q9V396_DROME unnamed protein product
Length=270

 Score = 119 bits (299),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 127/259 (49%), Gaps = 24/259 (9%)

Query  32   WAQEHKACAGKWQSPIALSSARAVALPLPAVEMIGYHNLLSGPVKLTNNGHSVALSLNKA  91
            WA+E+   +G  QSP+ ++ + A       V  + +  +      L N G+   + +N A
Sbjct  16   WAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEHTKSLVNPGYCWRVDVNGA  75

Query  92   LSKKRLPFVFGGMLNKDQDYELEGLHFHWGIKNNRGSEHILNGIRFPMEMHVIHRNM-KY  150
             S+     + GG L  DQ ++LE  H HWG  +++GSEH ++G+ +  E+H++H N  KY
Sbjct  76   DSE-----LTGGPLG-DQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTTKY  129

Query  151  PDLASALQHEDGLTVLGIFFQLQEEENEHLYPILRTLPNIQWINTEAELNVSITLASLMP  210
                 A    DGL VLG+F +      E L  +   L  +        L        L+P
Sbjct  130  KSFGEAAAAPDGLAVLGVFLKAGNHHAE-LDKVTSLLQFVLHKGDRVTLPQGCDPGQLLP  188

Query  211  RDTEIFYTYRGSLTTPPCSEAVTWILFPTTVPISFRQMNKFRMLS-------------NG  257
             D   ++TY GSLTTPPCSE+V WI+F T + +S  Q+N  R L+             NG
Sbjct  189  -DVHTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEFNG  247

Query  258  EEVLADNFRRLQDIGNRKV  276
            + +  +NFR    +G R++
Sbjct  248  KVI--NNFRPPLPLGKREL  264



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584687.1 carbonic anhydrase 2 [Cephus cinctus]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTU8_DROME  unnamed protein product                                 164     3e-48
M9PF87_DROME  unnamed protein product                                 142     1e-40
Q9V396_DROME  unnamed protein product                                 118     2e-31


>Q9VTU8_DROME unnamed protein product
Length=335

 Score = 164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 138/252 (55%), Gaps = 13/252 (5%)

Query  47   PEEWKVYNSNCNGQRQSPVNILSANMALIETANP-LTWKGYREQPLNMSLENNGHAVEIK  105
            PE W    + C+G+ QSP+NI    ++ +E   P L +  ++  P N+ + NNGH V +K
Sbjct  36   PEHWSEDYARCSGKHQSPINI--DQVSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVK  93

Query  106  VQW-EHNPPYITGGAAGDSV---YVFDSMHFHWAHHDEVGSEHTVNNYSFPIEMHLVHHN  161
            + + E   P + GG   +     Y F+  HFHW  +D +GSE  +NN ++P E+H+V  N
Sbjct  94   MSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN  153

Query  162  NRYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSHVNIK-PFPLER  220
              Y  F  A +   G+ V+AFF+++ ++S    +     L  I   G  VN+  P PL  
Sbjct  154  LEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGE  213

Query  221  FHLEFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIHLSNKDDH---NN  277
            +  +  + Y +Y GSLTTPPC E V WI  + P+ +T KQ+  FR   L+  DDH   N 
Sbjct  214  YISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRL--LTANDDHLKNNF  271

Query  278  RPTQPLNNRRIF  289
            RP QPLN+R ++
Sbjct  272  RPIQPLNDRTLY  283


>M9PF87_DROME unnamed protein product
Length=253

 Score = 142 bits (357),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 112/203 (55%), Gaps = 10/203 (5%)

Query  95   LENNGHAVEIKVQW-EHNPPYITGGAAGDSV---YVFDSMHFHWAHHDEVGSEHTVNNYS  150
            + NNGH V +K+ + E   P + GG   +     Y F+  HFHW  +D +GSE  +NN +
Sbjct  1    MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRA  60

Query  151  FPIEMHLVHHNNRYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSH  210
            +P E+H+V  N  Y  F  A +   G+ V+AFF+++ ++S    +     L  I   G  
Sbjct  61   YPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKS  120

Query  211  VNIK-PFPLERFHLEFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIHL  269
            VN+  P PL  +  +  + Y +Y GSLTTPPC E V WI  + P+ +T KQ+  FR   L
Sbjct  121  VNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRL--L  178

Query  270  SNKDDH---NNRPTQPLNNRRIF  289
            +  DDH   N RP QPLN+R ++
Sbjct  179  TANDDHLKNNFRPIQPLNDRTLY  201


>Q9V396_DROME unnamed protein product
Length=270

 Score = 118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 121/260 (47%), Gaps = 24/260 (9%)

Query  46   NPEEWKVYNSNCNGQRQSPVNIL--SANMALIETANPLTWKGYREQPLNMSLENNGHAVE  103
             P  W       +G RQSPV+I   SA         PL WK   E     SL N G+   
Sbjct  12   GPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEH--TKSLVNPGYCWR  69

Query  104  IKVQWEHNPPYITGGAAGDSVYVFDSMHFHWAHHDEVGSEHTVNNYSFPIEMHLVHHN-N  162
            + V    +   +TGG  GD ++  +  H HW   D  GSEHTV+  S+  E+HLVH N  
Sbjct  70   VDVNGADS--ELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTT  127

Query  163  RYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSHVNIKPFPLERFH  222
            +Y+SF EA    DGL V+  F +     +  LD +   L+ +   G  V + P   +   
Sbjct  128  KYKSFGEAAAAPDGLAVLGVFLKAGNH-HAELDKVTSLLQFVLHKGDRVTL-PQGCDPGQ  185

Query  223  L--EFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIH------------  268
            L  + H  +T Y GSLTTPPC ESV+WI+   P+ ++  Q+   R ++            
Sbjct  186  LLPDVHTYWT-YEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNE  244

Query  269  LSNKDDHNNRPTQPLNNRRI  288
             + K  +N RP  PL  R +
Sbjct  245  FNGKVINNFRPPLPLGKREL  264



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584688.1 carbonic anhydrase 2 [Cephus cinctus]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTU8_DROME  unnamed protein product                                 164     3e-48
M9PF87_DROME  unnamed protein product                                 142     1e-40
Q9V396_DROME  unnamed protein product                                 118     2e-31


>Q9VTU8_DROME unnamed protein product
Length=335

 Score = 164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 138/252 (55%), Gaps = 13/252 (5%)

Query  47   PEEWKVYNSNCNGQRQSPVNILSANMALIETANP-LTWKGYREQPLNMSLENNGHAVEIK  105
            PE W    + C+G+ QSP+NI    ++ +E   P L +  ++  P N+ + NNGH V +K
Sbjct  36   PEHWSEDYARCSGKHQSPINI--DQVSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVK  93

Query  106  VQW-EHNPPYITGGAAGDSV---YVFDSMHFHWAHHDEVGSEHTVNNYSFPIEMHLVHHN  161
            + + E   P + GG   +     Y F+  HFHW  +D +GSE  +NN ++P E+H+V  N
Sbjct  94   MSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN  153

Query  162  NRYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSHVNIK-PFPLER  220
              Y  F  A +   G+ V+AFF+++ ++S    +     L  I   G  VN+  P PL  
Sbjct  154  LEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGE  213

Query  221  FHLEFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIHLSNKDDH---NN  277
            +  +  + Y +Y GSLTTPPC E V WI  + P+ +T KQ+  FR   L+  DDH   N 
Sbjct  214  YISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRL--LTANDDHLKNNF  271

Query  278  RPTQPLNNRRIF  289
            RP QPLN+R ++
Sbjct  272  RPIQPLNDRTLY  283


>M9PF87_DROME unnamed protein product
Length=253

 Score = 142 bits (357),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 112/203 (55%), Gaps = 10/203 (5%)

Query  95   LENNGHAVEIKVQW-EHNPPYITGGAAGDSV---YVFDSMHFHWAHHDEVGSEHTVNNYS  150
            + NNGH V +K+ + E   P + GG   +     Y F+  HFHW  +D +GSE  +NN +
Sbjct  1    MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRA  60

Query  151  FPIEMHLVHHNNRYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSH  210
            +P E+H+V  N  Y  F  A +   G+ V+AFF+++ ++S    +     L  I   G  
Sbjct  61   YPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKS  120

Query  211  VNIK-PFPLERFHLEFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIHL  269
            VN+  P PL  +  +  + Y +Y GSLTTPPC E V WI  + P+ +T KQ+  FR   L
Sbjct  121  VNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRL--L  178

Query  270  SNKDDH---NNRPTQPLNNRRIF  289
            +  DDH   N RP QPLN+R ++
Sbjct  179  TANDDHLKNNFRPIQPLNDRTLY  201


>Q9V396_DROME unnamed protein product
Length=270

 Score = 118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 121/260 (47%), Gaps = 24/260 (9%)

Query  46   NPEEWKVYNSNCNGQRQSPVNIL--SANMALIETANPLTWKGYREQPLNMSLENNGHAVE  103
             P  W       +G RQSPV+I   SA         PL WK   E     SL N G+   
Sbjct  12   GPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEH--TKSLVNPGYCWR  69

Query  104  IKVQWEHNPPYITGGAAGDSVYVFDSMHFHWAHHDEVGSEHTVNNYSFPIEMHLVHHN-N  162
            + V    +   +TGG  GD ++  +  H HW   D  GSEHTV+  S+  E+HLVH N  
Sbjct  70   VDVNGADS--ELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTT  127

Query  163  RYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSHVNIKPFPLERFH  222
            +Y+SF EA    DGL V+  F +     +  LD +   L+ +   G  V + P   +   
Sbjct  128  KYKSFGEAAAAPDGLAVLGVFLKAGNH-HAELDKVTSLLQFVLHKGDRVTL-PQGCDPGQ  185

Query  223  L--EFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIH------------  268
            L  + H  +T Y GSLTTPPC ESV+WI+   P+ ++  Q+   R ++            
Sbjct  186  LLPDVHTYWT-YEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNE  244

Query  269  LSNKDDHNNRPTQPLNNRRI  288
             + K  +N RP  PL  R +
Sbjct  245  FNGKVINNFRPPLPLGKREL  264



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


Query= XP_015584689.1 uncharacterized protein LOC107262717 isoform X1
[Cephus cinctus]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZG4_DROME  unnamed protein product                                 37.7    0.026
E1JH62_DROME  unnamed protein product                                 37.7    0.026
A0A0B4K7P8_DROME  unnamed protein product                             37.7    0.026


>B7YZG4_DROME unnamed protein product
Length=5368

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  26    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  85
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5219  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5270

Query  86    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  139
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5271  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5328

Query  140   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  167
               PS   TP  +S + +FS    RTS   TP
Sbjct  5329  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5359


>E1JH62_DROME unnamed protein product
Length=5388

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  26    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  85
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5239  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5290

Query  86    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  139
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5291  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5348

Query  140   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  167
               PS   TP  +S + +FS    RTS   TP
Sbjct  5349  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5379


>A0A0B4K7P8_DROME unnamed protein product
Length=5394

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  26    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  85
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5245  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5296

Query  86    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  139
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5297  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5354

Query  140   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  167
               PS   TP  +S + +FS    RTS   TP
Sbjct  5355  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5385



Lambda      K        H
   0.318    0.134    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 44153647560


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584690.1 carbonic anhydrase 2 [Cephus cinctus]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTU8_DROME  unnamed protein product                                 164     3e-48
M9PF87_DROME  unnamed protein product                                 142     1e-40
Q9V396_DROME  unnamed protein product                                 118     2e-31


>Q9VTU8_DROME unnamed protein product
Length=335

 Score = 164 bits (414),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 91/252 (36%), Positives = 138/252 (55%), Gaps = 13/252 (5%)

Query  47   PEEWKVYNSNCNGQRQSPVNILSANMALIETANP-LTWKGYREQPLNMSLENNGHAVEIK  105
            PE W    + C+G+ QSP+NI    ++ +E   P L +  ++  P N+ + NNGH V +K
Sbjct  36   PEHWSEDYARCSGKHQSPINI--DQVSAVEKKFPKLEFFNFKVVPDNLQMTNNGHTVLVK  93

Query  106  VQW-EHNPPYITGGAAGDSV---YVFDSMHFHWAHHDEVGSEHTVNNYSFPIEMHLVHHN  161
            + + E   P + GG   +     Y F+  HFHW  +D +GSE  +NN ++P E+H+V  N
Sbjct  94   MSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRAYPAELHVVLRN  153

Query  162  NRYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSHVNIK-PFPLER  220
              Y  F  A +   G+ V+AFF+++ ++S    +     L  I   G  VN+  P PL  
Sbjct  154  LEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKSVNMTNPLPLGE  213

Query  221  FHLEFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIHLSNKDDH---NN  277
            +  +  + Y +Y GSLTTPPC E V WI  + P+ +T KQ+  FR   L+  DDH   N 
Sbjct  214  YISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRL--LTANDDHLKNNF  271

Query  278  RPTQPLNNRRIF  289
            RP QPLN+R ++
Sbjct  272  RPIQPLNDRTLY  283


>M9PF87_DROME unnamed protein product
Length=253

 Score = 142 bits (357),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 112/203 (55%), Gaps = 10/203 (5%)

Query  95   LENNGHAVEIKVQW-EHNPPYITGGAAGDSV---YVFDSMHFHWAHHDEVGSEHTVNNYS  150
            + NNGH V +K+ + E   P + GG   +     Y F+  HFHW  +D +GSE  +NN +
Sbjct  1    MTNNGHTVLVKMSYNEDEIPSVRGGPLAEKTPLGYQFEQFHFHWGENDTIGSEDLINNRA  60

Query  151  FPIEMHLVHHNNRYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSH  210
            +P E+H+V  N  Y  F  A +   G+ V+AFF+++ ++S    +     L  I   G  
Sbjct  61   YPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLSQIDRKGKS  120

Query  211  VNIK-PFPLERFHLEFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIHL  269
            VN+  P PL  +  +  + Y +Y GSLTTPPC E V WI  + P+ +T KQ+  FR   L
Sbjct  121  VNMTNPLPLGEYISKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLNAFRL--L  178

Query  270  SNKDDH---NNRPTQPLNNRRIF  289
            +  DDH   N RP QPLN+R ++
Sbjct  179  TANDDHLKNNFRPIQPLNDRTLY  201


>Q9V396_DROME unnamed protein product
Length=270

 Score = 118 bits (296),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/260 (33%), Positives = 121/260 (47%), Gaps = 24/260 (9%)

Query  46   NPEEWKVYNSNCNGQRQSPVNIL--SANMALIETANPLTWKGYREQPLNMSLENNGHAVE  103
             P  W       +G RQSPV+I   SA         PL WK   E     SL N G+   
Sbjct  12   GPAHWAKEYPQASGHRQSPVDITPSSAKKGSELNVAPLKWKYVPEH--TKSLVNPGYCWR  69

Query  104  IKVQWEHNPPYITGGAAGDSVYVFDSMHFHWAHHDEVGSEHTVNNYSFPIEMHLVHHN-N  162
            + V    +   +TGG  GD ++  +  H HW   D  GSEHTV+  S+  E+HLVH N  
Sbjct  70   VDVNGADS--ELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHLVHWNTT  127

Query  163  RYQSFEEARENFDGLLVVAFFYELNEESNYALDSLREGLKAITETGSHVNIKPFPLERFH  222
            +Y+SF EA    DGL V+  F +     +  LD +   L+ +   G  V + P   +   
Sbjct  128  KYKSFGEAAAAPDGLAVLGVFLKAGNH-HAELDKVTSLLQFVLHKGDRVTL-PQGCDPGQ  185

Query  223  L--EFHDKYTAYLGSLTTPPCQESVLWILASEPLSLTRKQIELFRTIH------------  268
            L  + H  +T Y GSLTTPPC ESV+WI+   P+ ++  Q+   R ++            
Sbjct  186  LLPDVHTYWT-YEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNE  244

Query  269  LSNKDDHNNRPTQPLNNRRI  288
             + K  +N RP  PL  R +
Sbjct  245  FNGKVINNFRPPLPLGKREL  264



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584691.1 V-type proton ATPase 116 kDa subunit a isoform X1
[Cephus cinctus]

Length=846
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZ10_DROME  unnamed protein product                                 1293    0.0  
Q8IML5_DROME  unnamed protein product                                 1291    0.0  
Q86M57_DROME  unnamed protein product                                 1285    0.0  


>Q9XZ10_DROME unnamed protein product
Length=855

 Score = 1293 bits (3346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 661/862 (77%), Positives = 726/862 (84%), Gaps = 23/862 (3%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEA-----EHGGVVS--------QMADPNREEEQVTLLGEE  167
            NFLELTELKHILRKTQ+FFDE+     +  G  S        QMAD   E+EQ  LLGEE
Sbjct  121  NFLELTELKHILRKTQVFFDESVPTVYKSSGAYSSSKYRRYPQMADNQNEDEQAQLLGEE  180

Query  168  GLRAG--GQALKLGFVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQV  225
            G+RA   GQ LKLGFVAGVILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV
Sbjct  181  GVRASQPGQNLKLGFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQV  240

Query  226  FKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT  285
             KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT
Sbjct  241  HKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT  300

Query  286  QDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQL  345
            QDHRHRVLVAAAKN+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQL
Sbjct  301  QDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQL  360

Query  346  ALRRGTERSGSSVPPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYT  405
            ALRRGTERSGSSVPPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYT
Sbjct  361  ALRRGTERSGSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYT  420

Query  406  IITFPFLFAVMFGDTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGL  465
            IITFPFLFAVMFGD GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+
Sbjct  421  IITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGV  480

Query  466  FSMYTGFIYNDFFSKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPV  525
            FSMYTG IYND FSKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+
Sbjct  481  FSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPI  539

Query  526  WQLS-ENKIVFLNSYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLL  584
            WQ++  NKI+F N+YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL
Sbjct  540  WQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLL  599

Query  585  FLFFYMVLLMFIKWIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSG  644
             LFFYMVLLMFIKWIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF G
Sbjct  600  LLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMG  659

Query  645  QLGVQRALLILAVLCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNA  704
            Q  +Q   +++AV CIP ML AKP L+M+  K    Q +       G           N+
Sbjct  660  QHFIQVLFVLVAVGCIPVMLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNS  713

Query  705  GTVQGGHKEEEQHDIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNM  764
            G+  GG   EE+ ++ EIF+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW M
Sbjct  714  GSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTM  773

Query  765  VMRNGLRYENWYGGVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGA  824
            V+  GL+ E   GG++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G 
Sbjct  774  VLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQ  833

Query  825  GYTFQPFSFEIILDSAQATVED  846
            GY FQPFSF+ I+++  A  E+
Sbjct  834  GYAFQPFSFDAIIENGAAAAEE  855


>Q8IML5_DROME unnamed protein product
Length=833

 Score = 1291 bits (3342),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/849 (78%), Positives = 721/849 (85%), Gaps = 19/849 (2%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEAEHGGVVSQMADPNREEEQVTLLGEEGLRAG--GQALKL  178
            NFLELTELKHILRKTQ+FFDE         MAD   E+EQ  LLGEEG+RA   GQ LKL
Sbjct  121  NFLELTELKHILRKTQVFFDE---------MADNQNEDEQAQLLGEEGVRASQPGQNLKL  171

Query  179  GFVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQ  238
            GFVAGVILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVFIIFFQGDQ
Sbjct  172  GFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQ  231

Query  239  LKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAK  298
            LKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAK
Sbjct  232  LKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAK  291

Query  299  NIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSV  358
            N+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSV
Sbjct  292  NLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSV  351

Query  359  PPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFG  418
            PPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFG
Sbjct  352  PPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFG  411

Query  419  DTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFF  478
            D GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND F
Sbjct  412  DLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIF  471

Query  479  SKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLN  537
            SKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N
Sbjct  472  SKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHN  530

Query  538  SYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIK  597
            +YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFYMVLLMFIK
Sbjct  531  AYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIK  590

Query  598  WIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAV  657
            WIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV
Sbjct  591  WIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAV  650

Query  658  LCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQH  717
             CIP ML AKP L+M+  K    Q +       G           N+G+  GG   EE+ 
Sbjct  651  GCIPVMLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEE  704

Query  718  DIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYG  777
            ++ EIF+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   G
Sbjct  705  ELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVG  764

Query  778  GVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIIL  837
            G++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+
Sbjct  765  GIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAII  824

Query  838  DSAQATVED  846
            ++  A  E+
Sbjct  825  ENGAAAAEE  833


>Q86M57_DROME unnamed protein product
Length=833

 Score = 1285 bits (3326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/849 (77%), Positives = 719/849 (85%), Gaps = 19/849 (2%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEAEHGGVVSQMADPNREEEQVTLLGEEGLRAG--GQALKL  178
            NFLELTELKHILRKTQ+FFDE         MAD   E+EQ  LLGEEG+RA   GQ LKL
Sbjct  121  NFLELTELKHILRKTQVFFDE---------MADNQNEDEQAQLLGEEGVRASQPGQNLKL  171

Query  179  GFVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQ  238
            GFVAGVILRER+PAFERMLWRACRGNVFLR+A IETPLEDP+ GDQV KSVFIIFFQGDQ
Sbjct  172  GFVAGVILRERLPAFERMLWRACRGNVFLRRAMIETPLEDPTNGDQVHKSVFIIFFQGDQ  231

Query  239  LKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAK  298
            LKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAK
Sbjct  232  LKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAK  291

Query  299  NIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSV  358
            N+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSV
Sbjct  292  NLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSV  351

Query  359  PPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFG  418
            PPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFG
Sbjct  352  PPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFG  411

Query  419  DTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFF  478
            D GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND F
Sbjct  412  DLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIF  471

Query  479  SKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLN  537
            SKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N
Sbjct  472  SKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHN  530

Query  538  SYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIK  597
            +YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++ LL LFFYMVLLMFIK
Sbjct  531  AYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVLLLLLFFYMVLLMFIK  590

Query  598  WIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAV  657
            WIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV
Sbjct  591  WIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAV  650

Query  658  LCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQH  717
             CIP ML AKP L+M+  K    Q +       G           N+G+  GG   EE+ 
Sbjct  651  GCIPVMLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEE  704

Query  718  DIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYG  777
            ++ EIF+HQSI TIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   G
Sbjct  705  ELSEIFIHQSIDTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVG  764

Query  778  GVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIIL  837
            G++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+
Sbjct  765  GIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAII  824

Query  838  DSAQATVED  846
            ++  A  E+
Sbjct  825  ENGAAAAEE  833



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584692.1 V-type proton ATPase 116 kDa subunit a isoform X2
[Cephus cinctus]

Length=842
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IML3_DROME  unnamed protein product                                 1300    0.0  
Q8IML4_DROME  unnamed protein product                                 1290    0.0  
Q6NLA3_DROME  unnamed protein product                                 1290    0.0  


>Q8IML3_DROME unnamed protein product
Length=836

 Score = 1300 bits (3364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/843 (78%), Positives = 722/843 (86%), Gaps = 8/843 (1%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEQEHAGLNPTESMTRALISDDNIARQSALGPVQLGFVAGV  180
            NFLELTELKHILRKTQ+FFDEQE      TESMTRALI+D+     +++GPVQLGFVAGV
Sbjct  121  NFLELTELKHILRKTQVFFDEQEGGVNQTTESMTRALITDEARTAGASMGPVQLGFVAGV  180

Query  181  ILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQLKTRVK  240
            ILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVFIIFFQGDQLKTRVK
Sbjct  181  ILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVK  240

Query  241  KICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWF  300
            KICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKN+KNWF
Sbjct  241  KICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWF  300

Query  301  VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSVPPILNR  360
            VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSVPPILNR
Sbjct  301  VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNR  360

Query  361  METFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDTGHGM  420
            M+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGD GHG 
Sbjct  361  MQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGA  420

Query  421  IMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFFSKSLNI  480
            IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND FSKSLNI
Sbjct  421  IMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNI  480

Query  481  FGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLNSYKMKI  539
            FG++W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N+YKMKI
Sbjct  481  FGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKI  539

Query  540  SIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIKWIKYAP  599
            SIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFYMVLLMFIKWIK+A 
Sbjct  540  SIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAA  599

Query  600  TNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAVLCIPWM  659
            TN++     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV CIP M
Sbjct  600  TNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAVGCIPVM  659

Query  660  LFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQHDIGEIF  719
            L AKP L+M+  K    Q +       G           N+G+  GG   EE+ ++ EIF
Sbjct  660  LLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEEELSEIF  713

Query  720  VHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYGGVILWV  779
            +HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   GG++L  
Sbjct  714  IHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTC  773

Query  780  VFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIILDSAQAT  839
            VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+++  A 
Sbjct  774  VFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAA  833

Query  840  VED  842
             E+
Sbjct  834  AEE  836


>Q8IML4_DROME unnamed protein product
Length=850

 Score = 1290 bits (3337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 656/857 (77%), Positives = 722/857 (84%), Gaps = 22/857 (3%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEQEHAGLNPTESMTRALISDDNIARQSALGPVQLG-----  175
            NFLELTELKHILRKTQ+FFDEQE      TESMTRALI+D+     +++GPVQLG     
Sbjct  121  NFLELTELKHILRKTQVFFDEQEGGVNQTTESMTRALITDEARTAGASMGPVQLGYMEKS  180

Query  176  ---------FVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVF  226
                     FVAGVILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVF
Sbjct  181  NEREDYLPCFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVF  240

Query  227  IIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRH  286
            IIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRH
Sbjct  241  IIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRH  300

Query  287  RVLVAAAKNIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRG  346
            RVLVAAAKN+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRG
Sbjct  301  RVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRG  360

Query  347  TERSGSSVPPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFP  406
            TERSGSSVPPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFP
Sbjct  361  TERSGSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFP  420

Query  407  FLFAVMFGDTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYT  466
            FLFAVMFGD GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYT
Sbjct  421  FLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYT  480

Query  467  GFIYNDFFSKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-  525
            G IYND FSKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+WQ++ 
Sbjct  481  GLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAG  539

Query  526  ENKIVFLNSYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFY  585
             NKI+F N+YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFY
Sbjct  540  ANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFY  599

Query  586  MVLLMFIKWIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQ  645
            MVLLMFIKWIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q
Sbjct  600  MVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQ  659

Query  646  RALLILAVLCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQG  705
               +++AV CIP ML AKP L+M+  K    Q +       G           N+G+  G
Sbjct  660  VLFVLVAVGCIPVMLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGG  713

Query  706  GHKEEEQHDIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNG  765
            G   EE+ ++ EIF+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  G
Sbjct  714  GGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIG  773

Query  766  LRYENWYGGVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQ  825
            L+ E   GG++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQ
Sbjct  774  LKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQ  833

Query  826  PFSFEIILDSAQATVED  842
            PFSF+ I+++  A  E+
Sbjct  834  PFSFDAIIENGAAAAEE  850


>Q6NLA3_DROME unnamed protein product
Length=852

 Score = 1290 bits (3337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 654/857 (76%), Positives = 724/857 (84%), Gaps = 20/857 (2%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEQEHAGLNPTESMTRALISDDNIARQSALGPVQLG-----  175
            NFLELTELKHILRKTQ+FFDEQE      TESMTRALI+D+     +++GPVQLG     
Sbjct  121  NFLELTELKHILRKTQVFFDEQEGGVNQTTESMTRALITDEARTAGASMGPVQLGYMEKS  180

Query  176  ---------FVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVF  226
                     FVAGVILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVF
Sbjct  181  NEREDYLPCFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVF  240

Query  227  IIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRH  286
            IIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRH
Sbjct  241  IIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRH  300

Query  287  RVLVAAAKNIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRG  346
            RVLVAAAKN+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRG
Sbjct  301  RVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRG  360

Query  347  TERSGSSVPPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFP  406
            TERSGSSVPPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFP
Sbjct  361  TERSGSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFP  420

Query  407  FLFAVMFGDTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYT  466
            FLFAVMFGD GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYT
Sbjct  421  FLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYT  480

Query  467  GFIYNDFFSKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-  525
            G IYND FSKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+WQ++ 
Sbjct  481  GLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAG  539

Query  526  ENKIVFLNSYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFY  585
             NKI+F N+YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFY
Sbjct  540  ANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFY  599

Query  586  MVLLMFIKWIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQ  645
            MVLLMFIKWIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q
Sbjct  600  MVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQ  659

Query  646  RALLILAVLCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQG  705
               +++AV CIP ML AKP L+M+  K + ++++        D E G  +   + G    
Sbjct  660  VLFVLVAVGCIPVMLLAKPLLIMQARK-QANEEVQPIAGATSDAEAGGVSNSGSHGGGG-  717

Query  706  GHKEEEQHDIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNG  765
                EE+ ++ EIF+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  G
Sbjct  718  --GHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIG  775

Query  766  LRYENWYGGVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQ  825
            L+ E   GG++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQ
Sbjct  776  LKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQ  835

Query  826  PFSFEIILDSAQATVED  842
            PFSF+ I+++  A  E+
Sbjct  836  PFSFDAIIENGAAAAEE  852



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584693.1 V-type proton ATPase 116 kDa subunit a isoform X3
[Cephus cinctus]

Length=837
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IML5_DROME  unnamed protein product                                 1300    0.0  
Q86M57_DROME  unnamed protein product                                 1294    0.0  
Q9XZ10_DROME  unnamed protein product                                 1288    0.0  


>Q8IML5_DROME unnamed protein product
Length=833

 Score = 1300 bits (3364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/840 (78%), Positives = 721/840 (86%), Gaps = 10/840 (1%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEMADPNREEEQVTLLGEEGLRAG--GQALKLGFVAGVILR  178
            NFLELTELKHILRKTQ+FFDEMAD   E+EQ  LLGEEG+RA   GQ LKLGFVAGVILR
Sbjct  121  NFLELTELKHILRKTQVFFDEMADNQNEDEQAQLLGEEGVRASQPGQNLKLGFVAGVILR  180

Query  179  ERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQLKTRVKKIC  238
            ER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVFIIFFQGDQLKTRVKKIC
Sbjct  181  ERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVKKIC  240

Query  239  EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFVKV  298
            EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKN+KNWFVKV
Sbjct  241  EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKV  300

Query  299  RKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSVPPILNRMET  358
            RKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSVPPILNRM+T
Sbjct  301  RKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQT  360

Query  359  FEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDTGHGMIMA  418
            FE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGD GHG IMA
Sbjct  361  FENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMA  420

Query  419  LFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFFSKSLNIFGT  478
            LFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND FSKSLNIFG+
Sbjct  421  LFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGS  480

Query  479  YWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLNSYKMKISII  537
            +W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N+YKMKISII
Sbjct  481  HWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISII  539

Query  538  FGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIKWIKYAPTNE  597
            FGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFYMVLLMFIKWIK+A TN+
Sbjct  540  FGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATND  599

Query  598  EINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAVLCIPWMLFA  657
            +     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV CIP ML A
Sbjct  600  KPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAVGCIPVMLLA  659

Query  658  KPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQHDIGEIFVHQ  717
            KP L+M+  K    Q +       G           N+G+  GG   EE+ ++ EIF+HQ
Sbjct  660  KPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEEELSEIFIHQ  713

Query  718  SIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYGGVILWVVFA  777
            SIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   GG++L  VFA
Sbjct  714  SIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFA  773

Query  778  LWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIILDSAQATVED  837
             WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+++  A  E+
Sbjct  774  FWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAAAEE  833


>Q86M57_DROME unnamed protein product
Length=833

 Score = 1294 bits (3349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/840 (78%), Positives = 719/840 (86%), Gaps = 10/840 (1%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEMADPNREEEQVTLLGEEGLRAG--GQALKLGFVAGVILR  178
            NFLELTELKHILRKTQ+FFDEMAD   E+EQ  LLGEEG+RA   GQ LKLGFVAGVILR
Sbjct  121  NFLELTELKHILRKTQVFFDEMADNQNEDEQAQLLGEEGVRASQPGQNLKLGFVAGVILR  180

Query  179  ERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQLKTRVKKIC  238
            ER+PAFERMLWRACRGNVFLR+A IETPLEDP+ GDQV KSVFIIFFQGDQLKTRVKKIC
Sbjct  181  ERLPAFERMLWRACRGNVFLRRAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVKKIC  240

Query  239  EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFVKV  298
            EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKN+KNWFVKV
Sbjct  241  EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKV  300

Query  299  RKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSVPPILNRMET  358
            RKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSVPPILNRM+T
Sbjct  301  RKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQT  360

Query  359  FEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDTGHGMIMA  418
            FE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGD GHG IMA
Sbjct  361  FENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMA  420

Query  419  LFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFFSKSLNIFGT  478
            LFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND FSKSLNIFG+
Sbjct  421  LFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGS  480

Query  479  YWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLNSYKMKISII  537
            +W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N+YKMKISII
Sbjct  481  HWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISII  539

Query  538  FGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIKWIKYAPTNE  597
            FGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++ LL LFFYMVLLMFIKWIK+A TN+
Sbjct  540  FGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVLLLLLFFYMVLLMFIKWIKFAATND  599

Query  598  EINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAVLCIPWMLFA  657
            +     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV CIP ML A
Sbjct  600  KPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAVGCIPVMLLA  659

Query  658  KPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQHDIGEIFVHQ  717
            KP L+M+  K    Q +       G           N+G+  GG   EE+ ++ EIF+HQ
Sbjct  660  KPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEEELSEIFIHQ  713

Query  718  SIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYGGVILWVVFA  777
            SI TIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   GG++L  VFA
Sbjct  714  SIDTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFA  773

Query  778  LWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIILDSAQATVED  837
             WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+++  A  E+
Sbjct  774  FWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAAAEE  833


>Q9XZ10_DROME unnamed protein product
Length=855

 Score = 1288 bits (3332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/862 (76%), Positives = 721/862 (84%), Gaps = 32/862 (4%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDE----------------------MADPNREEEQVTLLGEE  158
            NFLELTELKHILRKTQ+FFDE                      MAD   E+EQ  LLGEE
Sbjct  121  NFLELTELKHILRKTQVFFDESVPTVYKSSGAYSSSKYRRYPQMADNQNEDEQAQLLGEE  180

Query  159  GLRAG--GQALKLGFVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQV  216
            G+RA   GQ LKLGFVAGVILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV
Sbjct  181  GVRASQPGQNLKLGFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQV  240

Query  217  FKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT  276
             KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT
Sbjct  241  HKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT  300

Query  277  QDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQL  336
            QDHRHRVLVAAAKN+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQL
Sbjct  301  QDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQL  360

Query  337  ALRRGTERSGSSVPPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYT  396
            ALRRGTERSGSSVPPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYT
Sbjct  361  ALRRGTERSGSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYT  420

Query  397  IITFPFLFAVMFGDTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGL  456
            IITFPFLFAVMFGD GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+
Sbjct  421  IITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGV  480

Query  457  FSMYTGFIYNDFFSKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPV  516
            FSMYTG IYND FSKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+
Sbjct  481  FSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPI  539

Query  517  WQLS-ENKIVFLNSYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLL  575
            WQ++  NKI+F N+YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL
Sbjct  540  WQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLL  599

Query  576  FLFFYMVLLMFIKWIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSG  635
             LFFYMVLLMFIKWIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF G
Sbjct  600  LLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMG  659

Query  636  QLGVQRALLILAVLCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNA  695
            Q  +Q   +++AV CIP ML AKP L+M+  K    Q +       G           N+
Sbjct  660  QHFIQVLFVLVAVGCIPVMLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNS  713

Query  696  GTVQGGHKEEEQHDIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNM  755
            G+  GG   EE+ ++ EIF+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW M
Sbjct  714  GSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTM  773

Query  756  VMRNGLRYENWYGGVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGA  815
            V+  GL+ E   GG++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G 
Sbjct  774  VLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQ  833

Query  816  GYTFQPFSFEIILDSAQATVED  837
            GY FQPFSF+ I+++  A  E+
Sbjct  834  GYAFQPFSFDAIIENGAAAAEE  855



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584694.1 V-type proton ATPase 116 kDa subunit a isoform X4
[Cephus cinctus]

Length=826
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IML3_DROME  unnamed protein product                                 1257    0.0  
Q9XZ10_DROME  unnamed protein product                                 1254    0.0  
Q8IML5_DROME  unnamed protein product                                 1254    0.0  


>Q8IML3_DROME unnamed protein product
Length=836

 Score = 1257 bits (3253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/844 (76%), Positives = 706/844 (84%), Gaps = 26/844 (3%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEH---------------LYTAADTIGAHYRNP--LSFVAG  163
            NFLELTELKHILRKTQ+FFDE                +   A T GA    P  L FVAG
Sbjct  121  NFLELTELKHILRKTQVFFDEQEGGVNQTTESMTRALITDEARTAGASM-GPVQLGFVAG  179

Query  164  VILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQLKTRV  223
            VILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVFIIFFQGDQLKTRV
Sbjct  180  VILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRV  239

Query  224  KKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNW  283
            KKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKN+KNW
Sbjct  240  KKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNW  299

Query  284  FVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSVPPILN  343
            FVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSVPPILN
Sbjct  300  FVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILN  359

Query  344  RMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDTGHG  403
            RM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGD GHG
Sbjct  360  RMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHG  419

Query  404  MIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFFSKSLN  463
             IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND FSKSLN
Sbjct  420  AIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLN  479

Query  464  IFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLNSYKMK  522
            IFG++W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N+YKMK
Sbjct  480  IFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHNAYKMK  538

Query  523  ISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIKWIKYA  582
            ISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFYMVLLMFIKWIK+A
Sbjct  539  ISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFA  598

Query  583  PTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAVLCIPW  642
             TN++     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV CIP 
Sbjct  599  ATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAVGCIPV  658

Query  643  MLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQHDIGEI  702
            ML AKP L+M+  K    Q +       G           N+G+  GG   EE+ ++ EI
Sbjct  659  MLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEEELSEI  712

Query  703  FVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYGGVILW  762
            F+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   GG++L 
Sbjct  713  FIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLT  772

Query  763  VVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIILDSAQA  822
             VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+++  A
Sbjct  773  CVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAIIENGAA  832

Query  823  TVED  826
              E+
Sbjct  833  AAEE  836


>Q9XZ10_DROME unnamed protein product
Length=855

 Score = 1254 bits (3245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/862 (75%), Positives = 708/862 (82%), Gaps = 43/862 (5%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEHLYTAADTIGAH----YRN--------------------  156
            NFLELTELKHILRKTQ+FFDE + T   + GA+    YR                     
Sbjct  121  NFLELTELKHILRKTQVFFDESVPTVYKSSGAYSSSKYRRYPQMADNQNEDEQAQLLGEE  180

Query  157  -----------PLSFVAGVILRERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQV  205
                        L FVAGVILRER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV
Sbjct  181  GVRASQPGQNLKLGFVAGVILRERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQV  240

Query  206  FKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT  265
             KSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT
Sbjct  241  HKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQT  300

Query  266  QDHRHRVLVAAAKNIKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQL  325
            QDHRHRVLVAAAKN+KNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQL
Sbjct  301  QDHRHRVLVAAAKNLKNWFVKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQL  360

Query  326  ALRRGTERSGSSVPPILNRMETFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYT  385
            ALRRGTERSGSSVPPILNRM+TFE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYT
Sbjct  361  ALRRGTERSGSSVPPILNRMQTFENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYT  420

Query  386  IITFPFLFAVMFGDTGHGMIMALFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGL  445
            IITFPFLFAVMFGD GHG IMALFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+
Sbjct  421  IITFPFLFAVMFGDLGHGAIMALFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGV  480

Query  446  FSMYTGFIYNDFFSKSLNIFGTYWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPV  505
            FSMYTG IYND FSKSLNIFG++W ++YN +TV     LQL P G DY   PYP GMDP+
Sbjct  481  FSMYTGLIYNDIFSKSLNIFGSHWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPI  539

Query  506  WQLS-ENKIVFLNSYKMKISIIFGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLL  564
            WQ++  NKI+F N+YKMKISIIFGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL
Sbjct  540  WQVAGANKIIFHNAYKMKISIIFGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLL  599

Query  565  FLFFYMVLLMFIKWIKYAPTNEEINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSG  624
             LFFYMVLLMFIKWIK+A TN++     CAPS+LITFI+MVLF     P E C+ +MF G
Sbjct  600  LLFFYMVLLMFIKWIKFAATNDKPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMG  659

Query  625  QLGVQRALLILAVLCIPWMLFAKPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNA  684
            Q  +Q   +++AV CIP ML AKP L+M+  K    Q +       G           N+
Sbjct  660  QHFIQVLFVLVAVGCIPVMLLAKPLLIMQARKQANVQPI------AGATSDAEAGGVSNS  713

Query  685  GTVQGGHKEEEQHDIGEIFVHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNM  744
            G+  GG   EE+ ++ EIF+HQSIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW M
Sbjct  714  GSHGGGGGHEEEEELSEIFIHQSIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTM  773

Query  745  VMRNGLRYENWYGGVILWVVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGA  804
            V+  GL+ E   GG++L  VFA WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G 
Sbjct  774  VLSIGLKQEGPVGGIVLTCVFAFWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQ  833

Query  805  GYTFQPFSFEIILDSAQATVED  826
            GY FQPFSF+ I+++  A  E+
Sbjct  834  GYAFQPFSFDAIIENGAAAAEE  855


>Q8IML5_DROME unnamed protein product
Length=833

 Score = 1254 bits (3245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/840 (76%), Positives = 703/840 (84%), Gaps = 21/840 (3%)

Query  1    MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60
            MGSLFRSEEM LCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
Sbjct  1    MGSLFRSEEMALCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE  60

Query  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120
            MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
Sbjct  61   MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR  120

Query  121  NFLELTELKHILRKTQIFFDEHLYTAADTI--------GAHYRNP-----LSFVAGVILR  167
            NFLELTELKHILRKTQ+FFDE      +          G     P     L FVAGVILR
Sbjct  121  NFLELTELKHILRKTQVFFDEMADNQNEDEQAQLLGEEGVRASQPGQNLKLGFVAGVILR  180

Query  168  ERIPAFERMLWRACRGNVFLRQAEIETPLEDPSTGDQVFKSVFIIFFQGDQLKTRVKKIC  227
            ER+PAFERMLWRACRGNVFLRQA IETPLEDP+ GDQV KSVFIIFFQGDQLKTRVKKIC
Sbjct  181  ERLPAFERMLWRACRGNVFLRQAMIETPLEDPTNGDQVHKSVFIIFFQGDQLKTRVKKIC  240

Query  228  EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNIKNWFVKV  287
            EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKN+KNWFVKV
Sbjct  241  EGFRATLYPCPEAPADRREMAMGVMTRIEDLNTVLGQTQDHRHRVLVAAAKNLKNWFVKV  300

Query  288  RKIKAIYHTLNLFNLDVTQKCLIAECWVPVLDIETIQLALRRGTERSGSSVPPILNRMET  347
            RKIKAIYHTLNLFNLDVTQKCLIAECWVP+LDIETIQLALRRGTERSGSSVPPILNRM+T
Sbjct  301  RKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDIETIQLALRRGTERSGSSVPPILNRMQT  360

Query  348  FEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDTGHGMIMA  407
            FE+PPTYNRTNKFTK FQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGD GHG IMA
Sbjct  361  FENPPTYNRTNKFTKAFQALIDAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGAIMA  420

Query  408  LFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIVFLMGLFSMYTGFIYNDFFSKSLNIFGT  467
            LFG WM+ KEK LAA+K+DNEIWNIFFGGRYI+FLMG+FSMYTG IYND FSKSLNIFG+
Sbjct  421  LFGLWMIRKEKGLAAQKTDNEIWNIFFGGRYIIFLMGVFSMYTGLIYNDIFSKSLNIFGS  480

Query  468  YWKVNYNWTTVSSLPSLQLDPNGTDYLQRPYPIGMDPVWQLS-ENKIVFLNSYKMKISII  526
            +W ++YN +TV     LQL P G DY   PYP GMDP+WQ++  NKI+F N+YKMKISII
Sbjct  481  HWHLSYNKSTVMENKFLQLSPKG-DYEGAPYPFGMDPIWQVAGANKIIFHNAYKMKISII  539

Query  527  FGVIHMIFGVVVGLWNHMYFKKRINVICDFIPQMIFLLFLFFYMVLLMFIKWIKYAPTNE  586
            FGVIHMIFGVV+   NH YF+ RI+++ +FIPQ++FLL LFFYMVLLMFIKWIK+A TN+
Sbjct  540  FGVIHMIFGVVMSWHNHTYFRNRISLLYEFIPQLVFLLLLFFYMVLLMFIKWIKFAATND  599

Query  587  EINGPYCAPSVLITFINMVLFKANVAPSEVCDPWMFSGQLGVQRALLILAVLCIPWMLFA  646
            +     CAPS+LITFI+MVLF     P E C+ +MF GQ  +Q   +++AV CIP ML A
Sbjct  600  KPYSEACAPSILITFIDMVLFNTPKPPPENCETYMFMGQHFIQVLFVLVAVGCIPVMLLA  659

Query  647  KPFLLMRNMKSKMHQQLNNHGTENGDVEGGAGAVQQNAGTVQGGHKEEEQHDIGEIFVHQ  706
            KP L+M+  K    Q +       G           N+G+  GG   EE+ ++ EIF+HQ
Sbjct  660  KPLLIMQARKQANVQPI------AGATSDAEAGGVSNSGSHGGGGGHEEEEELSEIFIHQ  713

Query  707  SIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLRYENWYGGVILWVVFA  766
            SIHTIEYVLGSVSHTASYLRLWALSLAHAQL+EVLW MV+  GL+ E   GG++L  VFA
Sbjct  714  SIHTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWTMVLSIGLKQEGPVGGIVLTCVFA  773

Query  767  LWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYMGAGYTFQPFSFEIILDSAQATVED  826
             WA+LTVGILVLMEGLSAFLHTLRLHWVEFQSKFY G GY FQPFSF+ I+++  A  E+
Sbjct  774  FWAILTVGILVLMEGLSAFLHTLRLHWVEFQSKFYKGQGYAFQPFSFDAIIENGAAAAEE  833



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584695.1 glycerol-3-phosphate dehydrogenase [NAD(+)],
cytoplasmic isoform X3 [Cephus cinctus]

Length=368
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPDA_DROME  unnamed protein product                                   550     0.0   
Q7JMU1_CAEEL  unnamed protein product                                 451     3e-159
A7LPE6_CAEEL  unnamed protein product                                 447     1e-157


>GPDA_DROME unnamed protein product
Length=363

 Score = 550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/351 (77%), Positives = 308/351 (88%), Gaps = 0/351 (0%)

Query  1    MAAKQRVCIIGSGNWGSAIAKIVGSNAEKLPIFEDRVTMYVYEEIVNGRKLTELINETHE  60
            MA K  VCI+GSGNWGSAIAKIVG+NA  LP FE+RVTM+VYEE+++G+KLTE+INETHE
Sbjct  1    MADKVNVCIVGSGNWGSAIAKIVGANAAALPEFEERVTMFVYEELIDGKKLTEIINETHE  60

Query  61   NVKYLPGHILPANVVAVPDVLEAAKDADILIFVVPHQFIQRICSTLLGKIKPTAIGLSLI  120
            NVKYL GH LP NVVAVPD++EAAK+ADILIFVVPHQFI   C  LLGKIKP AI +SLI
Sbjct  61   NVKYLKGHKLPPNVVAVPDLVEAAKNADILIFVVPHQFIPNFCKQLLGKIKPNAIAISLI  120

Query  121  KGFDKKDGGGIELISHIISRELHIPVSVLMGANLAGEVANEMFCETTIGCKDEEKAPILR  180
            KGFDK +GGGI+LISHII+R L IP +VLMGANLA EVA   FCETTIGC D++   +LR
Sbjct  121  KGFDKAEGGGIDLISHIITRHLKIPCAVLMGANLANEVAEGNFCETTIGCTDKKYGKVLR  180

Query  181  DLIQTSYFRVVVVEDVDSVECCGALKNIVACGAGFVDGMNLGDNTKAAVIRLGLMEMIKF  240
            DL Q ++FRVVVV+D D+VE CGALKNIVACGAGFVDG+ LGDNTKAAVIRLGLMEMI+F
Sbjct  181  DLFQANHFRVVVVDDADAVEVCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRF  240

Query  241  VDVFFPGGKLSTFFESCGVADLITTCYGGRNRKVSEAFVRTGKSIDTLEKEMLNGQKLQG  300
            VDVF+PG KLSTFFESCGVADLITTCYGGRNR+VSEAFV +GK+I+ LEKEMLNGQKLQG
Sbjct  241  VDVFYPGSKLSTFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQG  300

Query  301  PFTAEEVNYMLKAKDMESRFPLFTAIHRICIGELKPTDLIDCIRSHPEHMD  351
            P TAEEVNYMLK K +E +FPLFTAIH+IC  +LKP DLIDCIR+HPEHMD
Sbjct  301  PPTAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHPEHMD  351


>Q7JMU1_CAEEL unnamed protein product
Length=371

 Score = 451 bits (1161),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 215/348 (62%), Positives = 269/348 (77%), Gaps = 2/348 (1%)

Query  5    QRVCIIGSGNWGSAIAKIVGSNAEKLPI-FEDRVTMYVYEEIVNGRKLTELINETHENVK  63
            ++V IIGSGNWGSAIA+IVGS  +  P  F+  V M+V+EEIVNG KL+E+IN  HEN+K
Sbjct  24   KKVTIIGSGNWGSAIARIVGSTTKSFPDEFDPTVRMWVFEEIVNGEKLSEVINNRHENIK  83

Query  64   YLPGHILPANVVAVPDVLEAAKDADILIFVVPHQFIQRICSTLLGKIKPTAIGLSLIKGF  123
            YLPG +LP NVVAV D++E+ + +++L+FVVPHQF++ IC  L+GKI      +SLIKG 
Sbjct  84   YLPGKVLPNNVVAVTDLVESCEGSNVLVFVVPHQFVKGICEKLVGKIPADTQAISLIKGV  143

Query  124  DKKDGGGIELISHIISRELHIPVSVLMGANLAGEVANEMFCETTIGCKDE-EKAPILRDL  182
              +  GG++LIS  I   L I VSVLMGANLA EVAN+ FCE TIGCK + E  P+L+ L
Sbjct  144  STEKRGGLKLISEEIKEILKIEVSVLMGANLAPEVANDNFCEATIGCKRKAEDGPLLKKL  203

Query  183  IQTSYFRVVVVEDVDSVECCGALKNIVACGAGFVDGMNLGDNTKAAVIRLGLMEMIKFVD  242
              T  FR+ VVED  +VE CGALKN+VAC AGF DG+  GDNTKAAVIRLGLME  KFV+
Sbjct  204  FHTDNFRINVVEDAHTVELCGALKNVVACAAGFTDGLGYGDNTKAAVIRLGLMETTKFVE  263

Query  243  VFFPGGKLSTFFESCGVADLITTCYGGRNRKVSEAFVRTGKSIDTLEKEMLNGQKLQGPF  302
             ++PG  L TFFESCG+ADLITTCYGGRNRKV EAFV+TGKS+  +EKE+LNGQ  QGP 
Sbjct  264  HYYPGSNLQTFFESCGIADLITTCYGGRNRKVCEAFVKTGKSMAEVEKELLNGQSAQGPL  323

Query  303  TAEEVNYMLKAKDMESRFPLFTAIHRICIGELKPTDLIDCIRSHPEHM  350
            TAEEV  M+    ++++FPLFTA+H+IC GE+KP +L+DC+R+HPEHM
Sbjct  324  TAEEVYLMMHKTGLDAKFPLFTAVHKICAGEMKPAELVDCLRNHPEHM  371


>A7LPE6_CAEEL unnamed protein product
Length=360

 Score = 447 bits (1149),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 218/357 (61%), Positives = 272/357 (76%), Gaps = 11/357 (3%)

Query  5    QRVCIIGSGNWGSAIAKIVGSNAEKLPI-FEDRVTMYVYEEIVNGRKLTELINETHENVK  63
            ++V IIGSGNWGSAIA+IVGS  +  P  F+  V M+V+EEIVNG KL+E+IN  HEN+K
Sbjct  4    KKVTIIGSGNWGSAIARIVGSTTKSFPDEFDPTVRMWVFEEIVNGEKLSEVINNRHENIK  63

Query  64   YLPGHILPANVVAVPDVLEAAKDADILIFVVPHQFIQRICSTLLGKIKPTAIGLSLIKG-  122
            YLPG +LP NVVAV D++E+ + +++L+FVVPHQF++ IC  L+GKI      +SLIKG 
Sbjct  64   YLPGKVLPNNVVAVTDLVESCEGSNVLVFVVPHQFVKGICEKLVGKIPADTQAISLIKGI  123

Query  123  -FDKKDGG-------GIELISHIISRELHIPVSVLMGANLAGEVANEMFCETTIGCKDE-  173
             FDK + G       G++LIS  I   L I VSVLMGANLA EVAN+ FCE TIGCK + 
Sbjct  124  SFDKTNQGVSTEKRGGLKLISEEIKEILKIEVSVLMGANLAPEVANDNFCEATIGCKRKA  183

Query  174  EKAPILRDLIQTSYFRVVVVEDVDSVECCGALKNIVACGAGFVDGMNLGDNTKAAVIRLG  233
            E  P+L+ L  T  FR+ VVED  +VE CGALKN+VAC AGF DG+  GDNTKAAVIRLG
Sbjct  184  EDGPLLKKLFHTDNFRINVVEDAHTVELCGALKNVVACAAGFTDGLGYGDNTKAAVIRLG  243

Query  234  LMEMIKFVDVFFPGGKLSTFFESCGVADLITTCYGGRNRKVSEAFVRTGKSIDTLEKEML  293
            LME  KFV+ ++PG  L TFFESCG+ADLITTCYGGRNRKV EAFV+TGKS+  +EKE+L
Sbjct  244  LMETTKFVEHYYPGSNLQTFFESCGIADLITTCYGGRNRKVCEAFVKTGKSMAEVEKELL  303

Query  294  NGQKLQGPFTAEEVNYMLKAKDMESRFPLFTAIHRICIGELKPTDLIDCIRSHPEHM  350
            NGQ  QGP TAEEV  M+    ++++FPLFTA+H+IC GE+KP +L+DC+R+HPEHM
Sbjct  304  NGQSAQGPLTAEEVYLMMHKTGLDAKFPLFTAVHKICAGEMKPAELVDCLRNHPEHM  360



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584696.1 glycerol-3-phosphate dehydrogenase [NAD(+)],
cytoplasmic isoform X4 [Cephus cinctus]

Length=366
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GPDA_DROME  unnamed protein product                                   514     0.0   
Q7JMU1_CAEEL  unnamed protein product                                 433     5e-152
GPDH2_CAEEL  unnamed protein product                                  431     5e-151


>GPDA_DROME unnamed protein product
Length=363

 Score = 514 bits (1323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/348 (75%), Positives = 292/348 (84%), Gaps = 1/348 (0%)

Query  5    KKKVCIVGSGNWGSAIAKIVGANVVKFNNKFEEEVTMYVYEEMINNKKLTEIINEQHENV  64
            K  VCIVGSGNWGSAIAKIVGAN      +FEE VTM+VYEE+I+ KKLTEIINE HENV
Sbjct  4    KVNVCIVGSGNWGSAIAKIVGANAAALP-EFEERVTMFVYEELIDGKKLTEIINETHENV  62

Query  65   KYLPGHKLPANVVAVPDVVNAAREADILVFVIPHQFIRTLCATLLGKIKPTAVGLSLIKG  124
            KYL GHKLP NVVAVPD+V AA+ ADIL+FV+PHQFI   C  LLGKIKP A+ +SLIKG
Sbjct  63   KYLKGHKLPPNVVAVPDLVEAAKNADILIFVVPHQFIPNFCKQLLGKIKPNAIAISLIKG  122

Query  125  FDQGDGTSIELISKIIEKHLNIPCYVLMGANLANEVAEEKFCETTIGCKDKRLAPLLRDV  184
            FD+ +G  I+LIS II +HL IPC VLMGANLANEVAE  FCETTIGC DK+   +LRD+
Sbjct  123  FDKAEGGGIDLISHIITRHLKIPCAVLMGANLANEVAEGNFCETTIGCTDKKYGKVLRDL  182

Query  185  IQTPNFRVVVVEDAEAVEVCGALKNIVACAAGFVDGLGLGDNTKAAVIRLGLMEMVKFVD  244
             Q  +FRVVVV+DA+AVEVCGALKNIVAC AGFVDGL LGDNTKAAVIRLGLMEM++FVD
Sbjct  183  FQANHFRVVVVDDADAVEVCGALKNIVACGAGFVDGLKLGDNTKAAVIRLGLMEMIRFVD  242

Query  245  TFYGGSKLSTFFESCGVADLITTCYGGRNRRVCEQFVKTAKTIKELEDELLAGQKLQGPA  304
             FY GSKLSTFFESCGVADLITTCYGGRNRRV E FV + KTI+ELE E+L GQKLQGP 
Sbjct  243  VFYPGSKLSTFFESCGVADLITTCYGGRNRRVSEAFVTSGKTIEELEKEMLNGQKLQGPP  302

Query  305  TADEVNAMLKNRNLMDKFPLFTAVHRICTKDLKPTELIDQIRSHPEHV  352
            TA+EVN MLKN+ L DKFPLFTA+H+ICT  LKP +LID IR+HPEH+
Sbjct  303  TAEEVNYMLKNKGLEDKFPLFTAIHKICTNQLKPNDLIDCIRNHPEHM  350


>Q7JMU1_CAEEL unnamed protein product
Length=371

 Score = 433 bits (1113),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 209/350 (60%), Positives = 263/350 (75%), Gaps = 1/350 (0%)

Query  4    TKKKVCIVGSGNWGSAIAKIVGANVVKFNNKFEEEVTMYVYEEMINNKKLTEIINEQHEN  63
            + KKV I+GSGNWGSAIA+IVG+    F ++F+  V M+V+EE++N +KL+E+IN +HEN
Sbjct  22   SPKKVTIIGSGNWGSAIARIVGSTTKSFPDEFDPTVRMWVFEEIVNGEKLSEVINNRHEN  81

Query  64   VKYLPGHKLPANVVAVPDVVNAAREADILVFVIPHQFIRTLCATLLGKIKPTAVGLSLIK  123
            +KYLPG  LP NVVAV D+V +   +++LVFV+PHQF++ +C  L+GKI      +SLIK
Sbjct  82   IKYLPGKVLPNNVVAVTDLVESCEGSNVLVFVVPHQFVKGICEKLVGKIPADTQAISLIK  141

Query  124  GFDQGDGTSIELISKIIEKHLNIPCYVLMGANLANEVAEEKFCETTIGCKDK-RLAPLLR  182
            G        ++LIS+ I++ L I   VLMGANLA EVA + FCE TIGCK K    PLL+
Sbjct  142  GVSTEKRGGLKLISEEIKEILKIEVSVLMGANLAPEVANDNFCEATIGCKRKAEDGPLLK  201

Query  183  DVIQTPNFRVVVVEDAEAVEVCGALKNIVACAAGFVDGLGLGDNTKAAVIRLGLMEMVKF  242
             +  T NFR+ VVEDA  VE+CGALKN+VACAAGF DGLG GDNTKAAVIRLGLME  KF
Sbjct  202  KLFHTDNFRINVVEDAHTVELCGALKNVVACAAGFTDGLGYGDNTKAAVIRLGLMETTKF  261

Query  243  VDTFYGGSKLSTFFESCGVADLITTCYGGRNRRVCEQFVKTAKTIKELEDELLAGQKLQG  302
            V+ +Y GS L TFFESCG+ADLITTCYGGRNR+VCE FVKT K++ E+E ELL GQ  QG
Sbjct  262  VEHYYPGSNLQTFFESCGIADLITTCYGGRNRKVCEAFVKTGKSMAEVEKELLNGQSAQG  321

Query  303  PATADEVNAMLKNRNLMDKFPLFTAVHRICTKDLKPTELIDQIRSHPEHV  352
            P TA+EV  M+    L  KFPLFTAVH+IC  ++KP EL+D +R+HPEH+
Sbjct  322  PLTAEEVYLMMHKTGLDAKFPLFTAVHKICAGEMKPAELVDCLRNHPEHM  371


>GPDH2_CAEEL unnamed protein product
Length=392

 Score = 431 bits (1108),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 268/359 (75%), Gaps = 10/359 (3%)

Query  4    TKKKVCIVGSGNWGSAIAKIVGANVVKFNNKFEEEVTMYVYEEMINNKKLTEIINEQHEN  63
            + KKV I+GSGNWGSAIA+IVG+    F ++F+  V M+V+EE++N +KL+E+IN +HEN
Sbjct  34   SPKKVTIIGSGNWGSAIARIVGSTTKSFPDEFDPTVRMWVFEEIVNGEKLSEVINNRHEN  93

Query  64   VKYLPGHKLPANVVAVPDVVNAAREADILVFVIPHQFIRTLCATLLGKIKPTAVGLSLIK  123
            +KYLPG  LP NVVAV D+V +   +++LVFV+PHQF++ +C  L+GKI      +SLIK
Sbjct  94   IKYLPGKVLPNNVVAVTDLVESCEGSNVLVFVVPHQFVKGICEKLVGKIPADTQAISLIK  153

Query  124  G--FDQGD-GTSIE------LISKIIEKHLNIPCYVLMGANLANEVAEEKFCETTIGCKD  174
            G  FD+ + G S E      LIS+ I++ L I   VLMGANLA EVA + FCE TIGCK 
Sbjct  154  GISFDKTNQGVSTEKRGGLKLISEEIKEILKIEVSVLMGANLAPEVANDNFCEATIGCKR  213

Query  175  K-RLAPLLRDVIQTPNFRVVVVEDAEAVEVCGALKNIVACAAGFVDGLGLGDNTKAAVIR  233
            K    PLL+ +  T NFR+ VVEDA  VE+CGALKN+VACAAGF DGLG GDNTKAAVIR
Sbjct  214  KAEDGPLLKKLFHTDNFRINVVEDAHTVELCGALKNVVACAAGFTDGLGYGDNTKAAVIR  273

Query  234  LGLMEMVKFVDTFYGGSKLSTFFESCGVADLITTCYGGRNRRVCEQFVKTAKTIKELEDE  293
            LGLME  KFV+ +Y GS L TFFESCG+ADLITTCYGGRNR+VCE FVKT K++ E+E E
Sbjct  274  LGLMETTKFVEHYYPGSNLQTFFESCGIADLITTCYGGRNRKVCEAFVKTGKSMAEVEKE  333

Query  294  LLAGQKLQGPATADEVNAMLKNRNLMDKFPLFTAVHRICTKDLKPTELIDQIRSHPEHV  352
            LL GQ  QGP TA+EV  M+    L  KFPLFTAVH+IC  ++KP EL+D +R+HPEH+
Sbjct  334  LLNGQSAQGPLTAEEVYLMMHKTGLDAKFPLFTAVHKICAGEMKPAELVDCLRNHPEHM  392



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584697.1 uncharacterized protein LOC107262717 isoform X1
[Cephus cinctus]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZG4_DROME  unnamed protein product                                 37.7    0.026
E1JH62_DROME  unnamed protein product                                 37.7    0.026
A0A0B4K7P8_DROME  unnamed protein product                             37.7    0.026


>B7YZG4_DROME unnamed protein product
Length=5368

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  26    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  85
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5219  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5270

Query  86    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  139
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5271  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5328

Query  140   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  167
               PS   TP  +S + +FS    RTS   TP
Sbjct  5329  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5359


>E1JH62_DROME unnamed protein product
Length=5388

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  26    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  85
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5239  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5290

Query  86    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  139
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5291  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5348

Query  140   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  167
               PS   TP  +S + +FS    RTS   TP
Sbjct  5349  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5379


>A0A0B4K7P8_DROME unnamed protein product
Length=5394

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  26    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  85
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5245  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5296

Query  86    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  139
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5297  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5354

Query  140   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  167
               PS   TP  +S + +FS    RTS   TP
Sbjct  5355  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5385



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584699.1 THAP domain-containing protein 2 isoform X1 [Cephus
cinctus]

Length=251
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJ27_DROME  unnamed protein product                                 40.8    8e-04
Q22354_CAEEL  unnamed protein product                                 30.4    1.5  


>Q9VJ27_DROME unnamed protein product
Length=762

 Score = 40.8 bits (94),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 55/109 (50%), Gaps = 10/109 (9%)

Query  8    CKKRSDKSQGLSFHRFPSNTTNR-QQWLDILGKSKD-VPGKGAAICSSHFDSKSFRYGLV  65
            C  +   +  +SFHRFP    +  Q+W +   +S   +P K +A+CS HF  + F     
Sbjct  10   CSHKYVHAGSISFHRFPFKRKDLLQKWKEFTQRSAQWMPSKWSALCSRHFGDEDF--NCS  67

Query  66   NGKEFLKPGSKPTLNLRKQDQTSVAINISNKIDESFTNNRSDNWNSISS  114
            N ++ LK  + P++ + + D      ++S  +++   +NR  +  ++SS
Sbjct  68   NNRKTLKKNAVPSIRVSEDD------SMSGHLEQVSPSNRPTHKQTLSS  110


>Q22354_CAEEL unnamed protein product
Length=862

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 31/58 (53%), Gaps = 5/58 (9%)

Query  145  IEKRT--ILNKRRQDTPLSEVITKKKKRLTEIT--WEELS-KSSKQGEMLWEIAKQEL  197
            IEK    ILN++++DT L     K +K   EI    E LS KS KQ E +WEI   E 
Sbjct  87   IEKEMFRILNQKKEDTDLEYPTYKLEKDWREIVHNHESLSDKSIKQQEAIWEIVTTEF  144



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584700.1 peroxiredoxin-6 [Cephus cinctus]

Length=220
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z892_DROME  unnamed protein product                                 346     1e-122
Q9GPQ1_DROME  unnamed protein product                                 346     1e-122
Q7JX87_DROME  unnamed protein product                                 346     2e-122


>A1Z892_DROME unnamed protein product
Length=220

 Score = 346 bits (888),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 180/220 (82%), Gaps = 0/220 (0%)

Query  1    MRLNTIIPNFHAETTQGPIDFYNWQGNSWVVLFSHPADFTPVCTTELGRLAVHQPHFDRR  60
            MRL   +PNF A+TT+GPI F+ WQGNSWVVLFSHPADFTPVCTTELGR+AVHQP F +R
Sbjct  1    MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKR  60

Query  61   NTKLLAHSVDKLKDHVDWVNDIKSYCQDIPGSFPYPIIADHDRDLAVKLDMIDEESKSDP  120
            NTK LAHSVD L  HVDWVNDIKSYC DIPG FPYPIIAD  RDLAV L M+DEE K DP
Sbjct  61   NTKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVTLGMLDEEQKKDP  120

Query  121  NLAMTVRALYVISPDHRLRLSMHYPSSTGRNVDEILRVIDSLQLVDRIPEIATPANWVPG  180
             +  T+RAL++ISPDH++RLSM YP STGRNVDEILR IDSLQL DR+  +ATPANW PG
Sbjct  121  EVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPG  180

Query  181  EKVMILPTVKESEVQRLFPGGVDRVSMPSGKVYVRTTTDY  220
             KVMILPTV + E  +LFP G D+VSMPSG  YVRTT +Y
Sbjct  181  TKVMILPTVTDEEAHKLFPKGFDKVSMPSGVNYVRTTENY  220


>Q9GPQ1_DROME unnamed protein product
Length=220

 Score = 346 bits (888),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 180/220 (82%), Gaps = 0/220 (0%)

Query  1    MRLNTIIPNFHAETTQGPIDFYNWQGNSWVVLFSHPADFTPVCTTELGRLAVHQPHFDRR  60
            MRL   +PNF A+TT+GPI F+ WQGNSWVVLFSHPADFTPVCTTELGR+AVHQP F +R
Sbjct  1    MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKR  60

Query  61   NTKLLAHSVDKLKDHVDWVNDIKSYCQDIPGSFPYPIIADHDRDLAVKLDMIDEESKSDP  120
            NTK LAHSVD L  HVDWVNDIKSYC DIPG FPYPIIAD  RDLAV L M+DEE K DP
Sbjct  61   NTKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVSLGMLDEEQKKDP  120

Query  121  NLAMTVRALYVISPDHRLRLSMHYPSSTGRNVDEILRVIDSLQLVDRIPEIATPANWVPG  180
             +  T+RAL++ISPDH++RLSM YP STGRNVDEILR IDSLQL DR+  +ATPANW PG
Sbjct  121  EVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPG  180

Query  181  EKVMILPTVKESEVQRLFPGGVDRVSMPSGKVYVRTTTDY  220
             KVMILPTV + E  +LFP G D+VSMPSG  YVRTT +Y
Sbjct  181  TKVMILPTVTDEEAHKLFPKGFDKVSMPSGVNYVRTTENY  220


>Q7JX87_DROME unnamed protein product
Length=220

 Score = 346 bits (887),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 180/220 (82%), Gaps = 0/220 (0%)

Query  1    MRLNTIIPNFHAETTQGPIDFYNWQGNSWVVLFSHPADFTPVCTTELGRLAVHQPHFDRR  60
            MRL   +PNF A+TT+GPI F+ WQGNSWVVLFSHPADFTPVCTTELGR+AVHQP F +R
Sbjct  1    MRLGQTVPNFEADTTKGPIKFHEWQGNSWVVLFSHPADFTPVCTTELGRIAVHQPEFAKR  60

Query  61   NTKLLAHSVDKLKDHVDWVNDIKSYCQDIPGSFPYPIIADHDRDLAVKLDMIDEESKSDP  120
            NTK LAHSVD L  HVDWVNDIKSYC DIPG FPYPIIAD  RDLAV L M+DEE K DP
Sbjct  61   NTKCLAHSVDALNSHVDWVNDIKSYCLDIPGDFPYPIIADPTRDLAVSLGMLDEEQKKDP  120

Query  121  NLAMTVRALYVISPDHRLRLSMHYPSSTGRNVDEILRVIDSLQLVDRIPEIATPANWVPG  180
             +  T+RAL++ISPDH++RLSM YP STGRNVDEILR IDSLQL DR+  +ATPANW PG
Sbjct  121  EVGKTIRALFIISPDHKVRLSMFYPMSTGRNVDEILRTIDSLQLTDRLKVVATPANWTPG  180

Query  181  EKVMILPTVKESEVQRLFPGGVDRVSMPSGKVYVRTTTDY  220
             KVMILPTV + E  +LFP G D+VSMPSG  YVRTT +Y
Sbjct  181  TKVMILPTVTDEEAHKLFPKGFDKVSMPSGVNYVRTTDNY  220



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584701.1 28S ribosomal protein S18c, mitochondrial [Cephus
cinctus]

Length=142
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABCA3_DICDI  unnamed protein product                                  29.3    1.2  
O46091_DROME  unnamed protein product                                 26.9    7.9  
Q7JUF8_DROME  unnamed protein product                                 26.9    8.4  


>ABCA3_DICDI unnamed protein product
Length=1702

 Score = 29.3 bits (64),  Expect = 1.2, Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 29/66 (44%), Gaps = 4/66 (6%)

Query  46   FMRNPYKYKKQECILCKLNIKPDYKNVRLLSQFQSRFTGRIYGRHITGLCKNQQRKVEQE  105
            F  N Y+Y   + +   +++  DY N   + Q   R   +IY RH        Q  V+Q 
Sbjct  139  FDENDYRYNAPKVLKYSISVDADYTNDNNI-QISPRSDSQIYLRH---YFTQIQTAVDQA  194

Query  106  ILKAQN  111
            I  AQN
Sbjct  195  IFMAQN  200


>O46091_DROME unnamed protein product
Length=995

 Score = 26.9 bits (58),  Expect = 7.9, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  114  LMGYYTKDVAFCKDPKLFDPN  134
             MG YT DVAF +  +L+D N
Sbjct  643  FMGNYTMDVAFIRGLQLYDTN  663


>Q7JUF8_DROME unnamed protein product
Length=982

 Score = 26.9 bits (58),  Expect = 8.4, Method: Composition-based stats.
 Identities = 11/21 (52%), Positives = 14/21 (67%), Gaps = 0/21 (0%)

Query  114  LMGYYTKDVAFCKDPKLFDPN  134
             MG YT DVAF +  +L+D N
Sbjct  643  FMGNYTMDVAFIRGLQLYDTN  663



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584704.1 multidrug resistance-associated protein 9 isoform X1
[Cephus cinctus]

Length=1468
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTC0_DROME  unnamed protein product                                 325     1e-90
Q9VK56_DROME  unnamed protein product                                 323     6e-90
Q7KTC2_DROME  unnamed protein product                                 321     2e-89


>Q7KTC0_DROME unnamed protein product
Length=1549

 Score = 325 bits (832),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 287/1175 (24%), Positives = 539/1175 (46%), Gaps = 124/1175 (11%)

Query  333   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  390
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  391   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  450
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  451   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTM--  503
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T  +  
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATYVLID  581

Query  504   --AILLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDT  561
                +L   K  VS     +L   L  L   I N   +  S++R    ++K      L   
Sbjct  582   ENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNR----INKF-----LNSE  632

Query  562   ERYPDKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTP  618
             E  P+  +  S     ++I +G F+W  +                               
Sbjct  633   ELDPNSVLHDSSKPHPMSIENGEFSWGDEI------------------------------  662

Query  619   TDTLTDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWL  678
               TL +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+
Sbjct  663   --TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWI  720

Query  679   LEGTLKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIA  736
                T+++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+
Sbjct  721   QNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRIS  780

Query  737   LARAVYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDI  794
             LARAVY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D 
Sbjct  781   LARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDS  840

Query  795   IYVMREGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLM  850
             IYV++ G I E GT ++L++    +   I        + + +  +   QIS T+    L+
Sbjct  841   IYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELL  900

Query  851   AAVPRGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTD  887
               V + +       L+   +  S DS++                D +  +  L+ + + +
Sbjct  901   GTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE  960

Query  888   FPIKYCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKT  944
               +   +++    +++ +Y  Y     + + +  L    +F  F I        +   + 
Sbjct  961   GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQN  1020

Query  945   IKDNIHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHI-S  998
             + ++  +   +  + G+   FG  ++  +   +     F  AK +H+  +  I +  +  
Sbjct  1021  VANDTGLRDMYLGVYGA-FGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCR  1079

Query  999   LFTTTPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIF  1058
              F  TP+  LLN ++  +  VD  LP ++ + +  I +   +  ++ L +P   I +A+ 
Sbjct  1080  FFDITPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTP---IFLAVI  1136

Query  1059  VLITIFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFY  1115
             V I   Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++  
Sbjct  1137  VPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESD  1196

Query  1116  RYCDNNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFI  1172
                D N    +       W+  R++M+     G +I + ASL  +   +    L+GL+  
Sbjct  1197  AKVDKNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVS  1251

Query  1173  CTLQFAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNI  1228
               LQ   ++ +L   ++    + +++  I  Y E   +E P         P NWP E  +
Sbjct  1252  YALQVTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRV  1310

Query  1229  KFDNVLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYI  1287
             +F N  +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I
Sbjct  1311  EFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISI  1370

Query  1288  GNTNIADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVS  1347
                +IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V 
Sbjct  1371  DGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVK  1430

Query  1348  KLSDKLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVL  1403
              L+  L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +
Sbjct  1431  SLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTI  1489

Query  1404  RDVFGGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1436
             R  F   T++ ++++   +   ++ ++L+ G++ E
Sbjct  1490  RTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1524


 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  586   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  645
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1300  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1350

Query  646   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  692
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1351  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1410

Query  693   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  750
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1411  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1470

Query  751   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  810
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1471  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1529

Query  811   ELL  813
             ELL
Sbjct  1530  ELL  1532


 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  78   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  135
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281


>Q9VK56_DROME unnamed protein product
Length=1549

 Score = 323 bits (827),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 284/1171 (24%), Positives = 540/1171 (46%), Gaps = 116/1171 (10%)

Query  333   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  390
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  391   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  450
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  451   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTMAI  505
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T    +
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATY---V  578

Query  506   LLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDTERYP  565
             L +  + +S   + V + L   +K  +  + L M S+    T +   +    L   E  P
Sbjct  579   LTSEANQLSVEKVLVSIALFDLMKLPL--TILPMLSVDIAETQVSVNRINKFLNSEELDP  636

Query  566   DKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTL  622
             +  +  S     ++I +G F+W  +                                 TL
Sbjct  637   NSVLHDSSKPHPMSIENGEFSWGDEI--------------------------------TL  664

Query  623   TDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWLLEGT  682
              +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+   T
Sbjct  665   RNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNAT  724

Query  683   LKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARA  740
             +++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+LARA
Sbjct  725   VRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARA  784

Query  741   VYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDIIYVM  798
             VY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D IYV+
Sbjct  785   VYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVI  844

Query  799   REGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLMAAVP  854
             + G I E GT ++L++    +   I        + + +  +   QIS T+    L+  V 
Sbjct  845   KMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVE  904

Query  855   RGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTDFPIK  891
             + +       L+   +  S DS++                D +  +  L+ + + +  + 
Sbjct  905   KAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLI  964

Query  892   YCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKTIKDN  948
               +++    +++ +Y  Y     + + +  L    +F  F I        +   + + ++
Sbjct  965   ETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAND  1024

Query  949   IHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHI-SLFTT  1002
               +   +  + G+   FG  ++  +   +     F  AK +H+  +  I +  +   F  
Sbjct  1025  TGLRDMYLGVYGA-FGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCRFFDI  1083

Query  1003  TPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIFVLIT  1062
             TP+  LLN ++  +  VD  LP ++ + +  I +   +  ++ L +P   I +A+ V I 
Sbjct  1084  TPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTP---IFLAVIVPIA  1140

Query  1063  IFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFYRYCD  1119
               Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++     D
Sbjct  1141  FLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVD  1200

Query  1120  NNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFICTLQ  1176
              N    +       W+  R++M+     G +I + ASL  +   +    L+GL+    LQ
Sbjct  1201  KNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVSYALQ  1255

Query  1177  FAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNIKFDN  1232
                ++ +L   ++    + +++  I  Y E   +E P         P NWP E  ++F N
Sbjct  1256  VTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRVEFQN  1314

Query  1233  VLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYIGNTN  1291
               +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I   +
Sbjct  1315  FQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVD  1374

Query  1292  IADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVSKLSD  1351
             IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V  L+ 
Sbjct  1375  IASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAA  1434

Query  1352  KLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVLRDVF  1407
              L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +R  F
Sbjct  1435  GLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTIRTEF  1493

Query  1408  GGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1436
                T++ ++++   +   ++ ++L+ G++ E
Sbjct  1494  KECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1524


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  586   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  645
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1300  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1350

Query  646   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  692
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1351  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1410

Query  693   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  750
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1411  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1470

Query  751   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  810
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1471  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1529

Query  811   ELL  813
             ELL
Sbjct  1530  ELL  1532


 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  78   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  135
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281


>Q7KTC2_DROME unnamed protein product
Length=1548

 Score = 321 bits (823),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 281/1174 (24%), Positives = 542/1174 (46%), Gaps = 123/1174 (10%)

Query  333   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  390
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  391   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  450
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  451   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTM--  503
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T  +  
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATYVLID  581

Query  504   --AILLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDT  561
                +L   K  VS     +L   L  L   I N   +  S++R    ++K      L   
Sbjct  582   ENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNR----INKF-----LNSE  632

Query  562   ERYPDKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTP  618
             E  P+  +  S     ++I +G F+W  +                               
Sbjct  633   ELDPNSVLHDSSKPHPMSIENGEFSWGDEI------------------------------  662

Query  619   TDTLTDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWL  678
               TL +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+
Sbjct  663   --TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWI  720

Query  679   LEGTLKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIA  736
                T+++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+
Sbjct  721   QNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRIS  780

Query  737   LARAVYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDI  794
             LARAVY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D 
Sbjct  781   LARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDS  840

Query  795   IYVMREGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQI-STSSTQLLM  850
             IYV++ G I E GT ++L++    +   I        + + +  +   QI ST+    L+
Sbjct  841   IYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELL  900

Query  851   AAVPRGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTD  887
               V + +       L+   +  S DS++                D +  +  L+ + + +
Sbjct  901   GTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE  960

Query  888   FPIKYCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKT  944
               +   +++    +++ +Y  Y     + + +  L    +F  F I        +   + 
Sbjct  961   GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQN  1020

Query  945   IKDNIHIIITFAVMLGSCLVFGLILMGIYNKTVFNV-----AKKVHDRWMDTICKAHISL  999
             + ++  +   +  + G+   FG ++ G  +  + ++     A+ +H+  +    +  + +
Sbjct  1021  VANDTGLRDMYLGVYGA-FGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEM  1079

Query  1000  FTTTPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIFV  1059
             F  TP+  ++N ++  +  +D+ LP ++  +++ +     +  ++ L +P   I +A+ V
Sbjct  1080  FDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTP---IFLAVIV  1136

Query  1060  LITIFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFYR  1116
              I   Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++   
Sbjct  1137  PIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDA  1196

Query  1117  YCDNNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFIC  1173
               D N    +       W+  R++M+     G +I + ASL  +   +    L+GL+   
Sbjct  1197  KVDKNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVSY  1251

Query  1174  TLQFAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNIK  1229
              LQ   ++ +L   ++    + +++  I  Y E   +E P         P NWP E  ++
Sbjct  1252  ALQVTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRVE  1310

Query  1230  FDNVLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYIG  1288
             F N  +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I 
Sbjct  1311  FQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISID  1370

Query  1289  NTNIADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVSK  1348
               +IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V  
Sbjct  1371  GVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKS  1430

Query  1349  LSDKLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVLR  1404
             L+  L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +R
Sbjct  1431  LAAGLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTIR  1489

Query  1405  DVFGGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1436
               F   T++ ++++   +   ++ ++L+ G++ E
Sbjct  1490  TEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1523


 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  586   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  645
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1299  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1349

Query  646   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  692
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1350  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1409

Query  693   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  750
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1410  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1469

Query  751   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  810
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1470  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1528

Query  811   ELL  813
             ELL
Sbjct  1529  ELL  1531


 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  78   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  135
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584705.1 uncharacterized protein LOC107262717 isoform X2
[Cephus cinctus]

Length=451
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZG4_DROME  unnamed protein product                                 37.4    0.029
E1JH62_DROME  unnamed protein product                                 37.4    0.030
A0A0B4K7Y9_DROME  unnamed protein product                             37.4    0.030


>B7YZG4_DROME unnamed protein product
Length=5368

 Score = 37.4 bits (85),  Expect = 0.029, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  22    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  81
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5219  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5270

Query  82    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  135
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5271  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5328

Query  136   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  163
               PS   TP  +S + +FS    RTS   TP
Sbjct  5329  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5359


>E1JH62_DROME unnamed protein product
Length=5388

 Score = 37.4 bits (85),  Expect = 0.030, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  22    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  81
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5239  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5290

Query  82    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  135
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5291  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5348

Query  136   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  163
               PS   TP  +S + +FS    RTS   TP
Sbjct  5349  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5379


>A0A0B4K7Y9_DROME unnamed protein product
Length=5408

 Score = 37.4 bits (85),  Expect = 0.030, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  22    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  81
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5259  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5310

Query  82    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  135
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5311  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5368

Query  136   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  163
               PS   TP  +S + +FS    RTS   TP
Sbjct  5369  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5399



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584706.1 multidrug resistance-associated protein 9 isoform X2
[Cephus cinctus]

Length=1463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTC0_DROME  unnamed protein product                                 325     7e-91
Q9VK56_DROME  unnamed protein product                                 323     3e-90
Q9I7N0_DROME  unnamed protein product                                 322     1e-89


>Q7KTC0_DROME unnamed protein product
Length=1549

 Score = 325 bits (834),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 287/1175 (24%), Positives = 539/1175 (46%), Gaps = 124/1175 (11%)

Query  328   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  385
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  386   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  445
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  446   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTM--  498
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T  +  
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATYVLID  581

Query  499   --AILLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDT  556
                +L   K  VS     +L   L  L   I N   +  S++R    ++K      L   
Sbjct  582   ENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNR----INKF-----LNSE  632

Query  557   ERYPDKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTP  613
             E  P+  +  S     ++I +G F+W  +                               
Sbjct  633   ELDPNSVLHDSSKPHPMSIENGEFSWGDEI------------------------------  662

Query  614   TDTLTDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWL  673
               TL +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+
Sbjct  663   --TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWI  720

Query  674   LEGTLKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIA  731
                T+++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+
Sbjct  721   QNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRIS  780

Query  732   LARAVYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDI  789
             LARAVY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D 
Sbjct  781   LARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDS  840

Query  790   IYVMREGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLM  845
             IYV++ G I E GT ++L++    +   I        + + +  +   QIS T+    L+
Sbjct  841   IYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELL  900

Query  846   AAVPRGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTD  882
               V + +       L+   +  S DS++                D +  +  L+ + + +
Sbjct  901   GTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE  960

Query  883   FPIKYCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKT  939
               +   +++    +++ +Y  Y     + + +  L    +F  F I        +   + 
Sbjct  961   GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQN  1020

Query  940   IKDNIHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHI-S  993
             + ++  +   +  + G+   FG  ++  +   +     F  AK +H+  +  I +  +  
Sbjct  1021  VANDTGLRDMYLGVYGA-FGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCR  1079

Query  994   LFTTTPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIF  1053
              F  TP+  LLN ++  +  VD  LP ++ + +  I +   +  ++ L +P   I +A+ 
Sbjct  1080  FFDITPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTP---IFLAVI  1136

Query  1054  VLITIFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFY  1110
             V I   Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++  
Sbjct  1137  VPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESD  1196

Query  1111  RYCDNNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFI  1167
                D N    +       W+  R++M+     G +I + ASL  +   +    L+GL+  
Sbjct  1197  AKVDKNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVS  1251

Query  1168  CTLQFAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNI  1223
               LQ   ++ +L   ++    + +++  I  Y E   +E P         P NWP E  +
Sbjct  1252  YALQVTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRV  1310

Query  1224  KFDNVLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYI  1282
             +F N  +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I
Sbjct  1311  EFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISI  1370

Query  1283  GNTNIADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVS  1342
                +IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V 
Sbjct  1371  DGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVK  1430

Query  1343  KLSDKLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVL  1398
              L+  L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +
Sbjct  1431  SLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTI  1489

Query  1399  RDVFGGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1431
             R  F   T++ ++++   +   ++ ++L+ G++ E
Sbjct  1490  RTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1524


 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  581   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  640
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1300  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1350

Query  641   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  687
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1351  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1410

Query  688   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  745
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1411  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1470

Query  746   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  805
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1471  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1529

Query  806   ELL  808
             ELL
Sbjct  1530  ELL  1532


 Score = 36.6 bits (83),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  73   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  130
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281


>Q9VK56_DROME unnamed protein product
Length=1549

 Score = 323 bits (829),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 284/1171 (24%), Positives = 540/1171 (46%), Gaps = 116/1171 (10%)

Query  328   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  385
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  386   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  445
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  446   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTMAI  500
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T    +
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATY---V  578

Query  501   LLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDTERYP  560
             L +  + +S   + V + L   +K  +  + L M S+    T +   +    L   E  P
Sbjct  579   LTSEANQLSVEKVLVSIALFDLMKLPL--TILPMLSVDIAETQVSVNRINKFLNSEELDP  636

Query  561   DKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTL  617
             +  +  S     ++I +G F+W  +                                 TL
Sbjct  637   NSVLHDSSKPHPMSIENGEFSWGDEI--------------------------------TL  664

Query  618   TDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWLLEGT  677
              +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+   T
Sbjct  665   RNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNAT  724

Query  678   LKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARA  735
             +++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+LARA
Sbjct  725   VRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARA  784

Query  736   VYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDIIYVM  793
             VY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D IYV+
Sbjct  785   VYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVI  844

Query  794   REGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLMAAVP  849
             + G I E GT ++L++    +   I        + + +  +   QIS T+    L+  V 
Sbjct  845   KMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVE  904

Query  850   RGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTDFPIK  886
             + +       L+   +  S DS++                D +  +  L+ + + +  + 
Sbjct  905   KAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLI  964

Query  887   YCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKTIKDN  943
               +++    +++ +Y  Y     + + +  L    +F  F I        +   + + ++
Sbjct  965   ETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAND  1024

Query  944   IHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHI-SLFTT  997
               +   +  + G+   FG  ++  +   +     F  AK +H+  +  I +  +   F  
Sbjct  1025  TGLRDMYLGVYGA-FGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCRFFDI  1083

Query  998   TPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIFVLIT  1057
             TP+  LLN ++  +  VD  LP ++ + +  I +   +  ++ L +P   I +A+ V I 
Sbjct  1084  TPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTP---IFLAVIVPIA  1140

Query  1058  IFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFYRYCD  1114
               Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++     D
Sbjct  1141  FLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVD  1200

Query  1115  NNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFICTLQ  1171
              N    +       W+  R++M+     G +I + ASL  +   +    L+GL+    LQ
Sbjct  1201  KNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVSYALQ  1255

Query  1172  FAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNIKFDN  1227
                ++ +L   ++    + +++  I  Y E   +E P         P NWP E  ++F N
Sbjct  1256  VTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRVEFQN  1314

Query  1228  VLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYIGNTN  1286
               +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I   +
Sbjct  1315  FQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVD  1374

Query  1287  IADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVSKLSD  1346
             IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V  L+ 
Sbjct  1375  IASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAA  1434

Query  1347  KLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVLRDVF  1402
              L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +R  F
Sbjct  1435  GLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTIRTEF  1493

Query  1403  GGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1431
                T++ ++++   +   ++ ++L+ G++ E
Sbjct  1494  KECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1524


 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  581   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  640
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1300  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1350

Query  641   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  687
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1351  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1410

Query  688   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  745
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1411  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1470

Query  746   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  805
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1471  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1529

Query  806   ELL  808
             ELL
Sbjct  1530  ELL  1532


 Score = 36.6 bits (83),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  73   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  130
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281


>Q9I7N0_DROME unnamed protein product
Length=1548

 Score = 322 bits (824),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 290/1175 (25%), Positives = 540/1175 (46%), Gaps = 125/1175 (11%)

Query  328   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  385
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  386   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  445
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  446   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTM--  498
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T  +  
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATYVLID  581

Query  499   --AILLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDT  556
                +L   K  VS     +L   L  L   I N   +  S++R    ++K      L   
Sbjct  582   ENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNR----INKF-----LNSE  632

Query  557   ERYPDKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTP  613
             E  P+  +  S     ++I +G F+W  +                               
Sbjct  633   ELDPNSVLHDSSKPHPMSIENGEFSWGDEI------------------------------  662

Query  614   TDTLTDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWL  673
               TL +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+
Sbjct  663   --TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWI  720

Query  674   LEGTLKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIA  731
                T+++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+
Sbjct  721   QNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRIS  780

Query  732   LARAVYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDI  789
             LARAVY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D 
Sbjct  781   LARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDS  840

Query  790   IYVMREGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLM  845
             IYV++ G I E GT ++L++    +   I        + + +  +   QIS T+    L+
Sbjct  841   IYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELL  900

Query  846   AAVPRGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTD  882
               V + +       L+   +  S DS++                D +  +  L+ + + +
Sbjct  901   GTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE  960

Query  883   FPIKYCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKT  939
               +   +++    +++ +Y  Y     + + +  L    +F  F I        +   + 
Sbjct  961   GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQN  1020

Query  940   IKDNIHIIITFAVMLGSCLVFGLILMGIYNKTVFNVAK-----KVHDRWMDTICKAHISL  994
             + ++  +   +  + G+   FG +L    +     +        V ++ ++T  K  + L
Sbjct  1021  VANDTGLRDMYLGVYGA-FGFGQVLSKYLSGLALAIGGLHCSMNVFNKLLNTGLKWPMEL  1079

Query  995   FTTTPMTILLNIYTLYLQQVDSALPRSIITIL-IHIGISAFSASILGLISPWLLIPIAIF  1053
             F TTP+  +L+ Y+  +  VDS LP   + +L    G+ A +  ++ L +P   I +A+ 
Sbjct  1080  FDTTPLGRILSRYSKDVDTVDSVLPAITVQLLNTCFGVLA-TIVVISLSTP---IFLAVI  1135

Query  1054  VLITIFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFY  1110
             V I   Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++  
Sbjct  1136  VPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESD  1195

Query  1111  RYCDNNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFI  1167
                D N    +       W+  R++M+     G +I + ASL  +   +    L+GL+  
Sbjct  1196  AKVDKNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVS  1250

Query  1168  CTLQFAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNI  1223
               LQ   ++ +L   ++    + +++  I  Y E   +E P         P NWP E  +
Sbjct  1251  YALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETK-QEAPWELEQDKNKPKNWPQEGRV  1309

Query  1224  KFDNVLLPNGLEADANQEPINFTIASGEKVGIITTLDCGES-LVSALYKFTDVPTGKIYI  1282
             +F N  +      D     ++F I  GEKVGI+     G+S L  AL++  +   G+I I
Sbjct  1310  EFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISI  1369

Query  1283  GNTNIADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVS  1342
                +IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V 
Sbjct  1370  DGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVK  1429

Query  1343  KLSDKLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVL  1398
              L+  L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +
Sbjct  1430  SLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTI  1488

Query  1399  RDVFGGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1431
             R  F   T++ ++++   +   ++ ++L+ G++ E
Sbjct  1489  RTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1523


 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  581   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  640
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1299  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1349

Query  641   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  687
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1350  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1409

Query  688   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  745
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1410  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1469

Query  746   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  805
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1470  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1528

Query  806   ELL  808
             ELL
Sbjct  1529  ELL  1531


 Score = 36.6 bits (83),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  73   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  130
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


Query= XP_015584707.1 multidrug resistance-associated protein 9 isoform X3
[Cephus cinctus]

Length=1443
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTC0_DROME  unnamed protein product                                 324     1e-90
Q9VK56_DROME  unnamed protein product                                 323     5e-90
Q7KTB7_DROME  unnamed protein product                                 321     2e-89


>Q7KTC0_DROME unnamed protein product
Length=1549

 Score = 324 bits (831),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 287/1175 (24%), Positives = 539/1175 (46%), Gaps = 124/1175 (11%)

Query  308   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  365
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  366   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  425
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  426   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTM--  478
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T  +  
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATYVLID  581

Query  479   --AILLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDT  536
                +L   K  VS     +L   L  L   I N   +  S++R    ++K      L   
Sbjct  582   ENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNR----INKF-----LNSE  632

Query  537   ERYPDKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTP  593
             E  P+  +  S     ++I +G F+W  +                               
Sbjct  633   ELDPNSVLHDSSKPHPMSIENGEFSWGDEI------------------------------  662

Query  594   TDTLTDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWL  653
               TL +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+
Sbjct  663   --TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWI  720

Query  654   LEGTLKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIA  711
                T+++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+
Sbjct  721   QNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRIS  780

Query  712   LARAVYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDI  769
             LARAVY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D 
Sbjct  781   LARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDS  840

Query  770   IYVMREGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLM  825
             IYV++ G I E GT ++L++    +   I        + + +  +   QIS T+    L+
Sbjct  841   IYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELL  900

Query  826   AAVPRGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTD  862
               V + +       L+   +  S DS++                D +  +  L+ + + +
Sbjct  901   GTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE  960

Query  863   FPIKYCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKT  919
               +   +++    +++ +Y  Y     + + +  L    +F  F I        +   + 
Sbjct  961   GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQN  1020

Query  920   IKDNIHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHI-S  973
             + ++  +   +  + G+   FG  ++  +   +     F  AK +H+  +  I +  +  
Sbjct  1021  VANDTGLRDMYLGVYGA-FGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCR  1079

Query  974   LFTTTPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIF  1033
              F  TP+  LLN ++  +  VD  LP ++ + +  I +   +  ++ L +P   I +A+ 
Sbjct  1080  FFDITPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTP---IFLAVI  1136

Query  1034  VLITIFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFY  1090
             V I   Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++  
Sbjct  1137  VPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESD  1196

Query  1091  RYCDNNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFI  1147
                D N    +       W+  R++M+     G +I + ASL  +   +    L+GL+  
Sbjct  1197  AKVDKNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVS  1251

Query  1148  CTLQFAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNI  1203
               LQ   ++ +L   ++    + +++  I  Y E   +E P         P NWP E  +
Sbjct  1252  YALQVTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRV  1310

Query  1204  KFDNVLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYI  1262
             +F N  +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I
Sbjct  1311  EFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISI  1370

Query  1263  GNTNIADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVS  1322
                +IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V 
Sbjct  1371  DGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVK  1430

Query  1323  KLSDKLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVL  1378
              L+  L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +
Sbjct  1431  SLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTI  1489

Query  1379  RDVFGGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1411
             R  F   T++ ++++   +   ++ ++L+ G++ E
Sbjct  1490  RTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1524


 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  561   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  620
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1300  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1350

Query  621   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  667
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1351  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1410

Query  668   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  725
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1411  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1470

Query  726   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  785
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1471  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1529

Query  786   ELL  788
             ELL
Sbjct  1530  ELL  1532


 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  78   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  135
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281


>Q9VK56_DROME unnamed protein product
Length=1549

 Score = 323 bits (827),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 284/1171 (24%), Positives = 540/1171 (46%), Gaps = 116/1171 (10%)

Query  308   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  365
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  366   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  425
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  426   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTMAI  480
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T    +
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATY---V  578

Query  481   LLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDTERYP  540
             L +  + +S   + V + L   +K  +  + L M S+    T +   +    L   E  P
Sbjct  579   LTSEANQLSVEKVLVSIALFDLMKLPL--TILPMLSVDIAETQVSVNRINKFLNSEELDP  636

Query  541   DKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTL  597
             +  +  S     ++I +G F+W  +                                 TL
Sbjct  637   NSVLHDSSKPHPMSIENGEFSWGDEI--------------------------------TL  664

Query  598   TDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWLLEGT  657
              +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+   T
Sbjct  665   RNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNAT  724

Query  658   LKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARA  715
             +++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+LARA
Sbjct  725   VRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARA  784

Query  716   VYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDIIYVM  773
             VY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D IYV+
Sbjct  785   VYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVI  844

Query  774   REGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLMAAVP  829
             + G I E GT ++L++    +   I        + + +  +   QIS T+    L+  V 
Sbjct  845   KMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVE  904

Query  830   RGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTDFPIK  866
             + +       L+   +  S DS++                D +  +  L+ + + +  + 
Sbjct  905   KAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVEGKLI  964

Query  867   YCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKTIKDN  923
               +++    +++ +Y  Y     + + +  L    +F  F I        +   + + ++
Sbjct  965   ETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVAND  1024

Query  924   IHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHI-SLFTT  977
               +   +  + G+   FG  ++  +   +     F  AK +H+  +  I +  +   F  
Sbjct  1025  TGLRDMYLGVYGA-FGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCRFFDI  1083

Query  978   TPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSASILGLISPWLLIPIAIFVLIT  1037
             TP+  LLN ++  +  VD  LP ++ + +  I +   +  ++ L +P   I +A+ V I 
Sbjct  1084  TPIGRLLNSFSGDMDVVDEELPATMDSFMTFIFMVLATIVVISLSTP---IFLAVIVPIA  1140

Query  1038  IFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFYRYCD  1094
               Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++     D
Sbjct  1141  FLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVD  1200

Query  1095  NNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFICTLQ  1151
              N    +       W+  R++M+     G +I + ASL  +   +    L+GL+    LQ
Sbjct  1201  KNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVSYALQ  1255

Query  1152  FAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNIKFDN  1207
                ++ +L   ++    + +++  I  Y E   +E P         P NWP E  ++F N
Sbjct  1256  VTQTLNWLVRMSSDIETNIVSVERIKEYGET-KQEAPWELEQDKNKPKNWPQEGRVEFQN  1314

Query  1208  VLLPNGLEADANQEPINFTIASGEKVGIITTLDCGE-SLVSALYKFTDVPTGKIYIGNTN  1266
               +      D     ++F I  GEKVGI+     G+ SL  AL++  +   G+I I   +
Sbjct  1315  FQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVD  1374

Query  1267  IADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVSKLSD  1326
             IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V  L+ 
Sbjct  1375  IASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAA  1434

Query  1327  KLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVLRDVF  1382
              L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +R  F
Sbjct  1435  GLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTIRTEF  1493

Query  1383  GGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1411
                T++ ++++   +   ++ ++L+ G++ E
Sbjct  1494  KECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1524


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  561   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  620
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1300  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1350

Query  621   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  667
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1351  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1410

Query  668   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  725
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1411  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1470

Query  726   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  785
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1471  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1529

Query  786   ELL  788
             ELL
Sbjct  1530  ELL  1532


 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  78   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  135
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281


>Q7KTB7_DROME unnamed protein product
Length=1548

 Score = 321 bits (822),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 285/1175 (24%), Positives = 540/1175 (46%), Gaps = 125/1175 (11%)

Query  308   RLRSACLALMYKKLIR--SSVRFQASAHQTITYFVPDGETLYELITNGPMIITGPFLLIL  365
             R+R+A +  +Y+K +R  +S + +++  + +     D +   EL T   MI + P  + L
Sbjct  403   RIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGL  462

Query  366   TSMLLWFLIGHWGLIGIAALIVLYLCLILTAYLTKVFATKAIEYSLKRLCLMEEFLGKIY  425
                 LW  +G   L G+A +I+L     + A   K +  + ++Y  +R+ LM E L  I 
Sbjct  463   ALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIK  522

Query  426   LAKITLWDEYFKSKIEDTRCDELADIR-----RGGLSEGWSLCMVHIIPIITVCTMTM--  478
             + K+  W+  F+ ++ D R  E+A +R       G S  WS C   ++ ++T  T  +  
Sbjct  523   VLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS-CAPFLVSLVTFATYVLID  581

Query  479   --AILLTHKHIVSTHYIPVLVLLLINLKHCIRNSWLSMSSISRGVTSLHKLKTILTLKDT  536
                +L   K  VS     +L   L  L   I N   +  S++R    ++K      L   
Sbjct  582   ENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNR----INKF-----LNSE  632

Query  537   ERYPDKPIDRSLA---VTINHGNFTWVKDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTP  593
             E  P+  +  S     ++I +G F+W  +                               
Sbjct  633   ELDPNSVLHDSSKPHPMSIENGEFSWGDEI------------------------------  662

Query  594   TDTLTDINFYAPKGKLIGICGQPGSGKTSLLLSLMGHLHHISGHVAMDGSCAYVPELPWL  653
               TL +IN    KG L+ + G  GSGK+S++ + +G +  ++G V   G  AYVP+  W+
Sbjct  663   --TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWI  720

Query  654   LEGTLKENILFGEIFNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIA  711
                T+++NILFG+ ++  RY + I +C L  D++ L   D T++    + +   QKQRI+
Sbjct  721   QNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRIS  780

Query  712   LARAVYVHREINLLDNPLADVDINESKDIFEKCI--MHAMGSKTVIMVTDKIQFLNRCDI  769
             LARAVY   ++ LLD+PL+ VD +  K IFE+ I     +  K+ ++VT  + FL + D 
Sbjct  781   LARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDS  840

Query  770   IYVMREGRIVEQGTHEELLQWNSEYTQLI---NFCMKKYQRKYYREGEQIS-TSSTQLLM  825
             IYV++ G I E GT ++L++    +   I        + + +  +   QIS T+    L+
Sbjct  841   IYVIKMGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELL  900

Query  826   AAVPRGV-------LTSISTNASLDSVL----------------DDIDDSDLLQHEHDTD  862
               V + +       L+   +  S DS++                D +  +  L+ + + +
Sbjct  901   GTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE  960

Query  863   FPIKYCKENGKPLIQYGIYVKYANGYCLNIFICLLA---IFYTFLIAVAPLCFTYVAQKT  919
               +   +++    +++ +Y  Y     + + +  L    +F  F I        +   + 
Sbjct  961   GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQN  1020

Query  920   IKDNIHIIITFAVMLGSCLVFGLILMGIYNKTV-----FNVAKKVHDRWMDTICKAHISL  974
             + ++  +   +  + G+   FG      ++         + AK +H   ++ + +A +++
Sbjct  1021  VANDTGLRDMYLGVYGA-FGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTM  1079

Query  975   FTTTPMTILLNIYTLYLQQVDSALPRSIITILIHIGISAFSA-SILGLISPWLLIPIAIF  1033
             F TTP+  +L+ ++  ++ VD  +P+ +I   I       +   ++ L +P   I +A+ 
Sbjct  1080  FDTTPVGRILSRFSKDVESVDQKMPQ-VINDCIWCAFEVLATIVVISLSTP---IFLAVI  1135

Query  1034  VLITIFYSIYVRGAILT---LYKAKVSSTVPMFNHSVNTINGRSVIQAYHKERDFTKKFY  1090
             V I   Y    R  + T   L + +  S  P+++H   T+ G S I+AY+    F ++  
Sbjct  1136  VPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESD  1195

Query  1091  RYCDNNSAFDFMLYSVKLWIEYRIKMISGLTLGVIIFMCASLTTI---RDRFELMGLAFI  1147
                D N    +       W+  R++M+     G +I + ASL  +   +    L+GL+  
Sbjct  1196  AKVDKNQVCKYPSVIANRWLAIRLEMV-----GNLIILFASLFAVLGGQTNPGLVGLSVS  1250

Query  1148  CTLQFAMSVIYLTGTTTRAYFSFMALNGIDNYIENIIKEQP----GTARLPNNWPVESNI  1203
               LQ   ++ +L   ++    + +++  I  Y E   +E P         P NWP E  +
Sbjct  1251  YALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETK-QEAPWELEQDKNKPKNWPQEGRV  1309

Query  1204  KFDNVLLPNGLEADANQEPINFTIASGEKVGIITTLDCGES-LVSALYKFTDVPTGKIYI  1262
             +F N  +      D     ++F I  GEKVGI+     G+S L  AL++  +   G+I I
Sbjct  1310  EFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISI  1369

Query  1263  GNTNIADVPLEKLRQCISYIPSNPHLFDGSIRHNLDPTGKVTDKILMTVLQRVFLWEKVS  1322
                +IA + L  LR  ++ IP +P LF GS+R NLDP    TD  +   L+   L   V 
Sbjct  1370  DGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVK  1429

Query  1323  KLSDKLE---TDARHIFTTGEKKLMFLARAILKKTSKIIIMEESTTNLGPD-EEIVEIVL  1378
              L+  L     +     + G+++L+ LARA+L+KT K+++++E+T  +  + +++++  +
Sbjct  1430  SLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKT-KVLVLDEATAAVDLETDDLIQKTI  1488

Query  1379  RDVFGGYTIIVLSNQ--RVRYCERTLILNNGKVNE  1411
             R  F   T++ ++++   +   ++ ++L+ G++ E
Sbjct  1489  RTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIE  1523


 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/243 (24%), Positives = 112/243 (46%), Gaps = 25/243 (10%)

Query  561   KDKSLTEKAIKRSSQFYVENHEGIPVRFQVLTPTDTLTDINFYAPKGKLIGICGQPGSGK  620
             K K+  ++       F V   EG+ +          L  ++F    G+ +GI G+ G+GK
Sbjct  1299  KPKNWPQEGRVEFQNFQVRYREGLDL---------VLRGVSFNIQGGEKVGIVGRTGAGK  1349

Query  621   TSLLLSLMGHLHHISGHVAMDG-------------SCAYVPELPWLLEGTLKENILFGEI  667
             +SL L+L   +    G +++DG                 +P+ P L  G+L+ N+   EI
Sbjct  1350  SSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEI  1409

Query  668   FNSNRYYRAIHSCLLHNDMNCLPESDDTDLA--FVKMRPAQKQRIALARAVYVHREINLL  725
                +  ++A+    L + +  L    + ++A     +   Q+Q + LARA+    ++ +L
Sbjct  1410  KTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVL  1469

Query  726   DNPLADVDINESKDIFEKCIMHAMGSKTVIMVTDKIQFLNRCDIIYVMREGRIVEQGTHE  785
             D   A VD+ E+ D+ +K I       TV+ +  ++  +   D + V+ +G+I+E  +  
Sbjct  1470  DEATAAVDL-ETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPT  1528

Query  786   ELL  788
             ELL
Sbjct  1529  ELL  1531


 Score = 36.6 bits (83),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  78   LPLDKIGLFSSVSFSWLNEYLSAGCKNGMTEKPLPTIAPQDSCTTNGPRLEGLWHAHV  135
            +P       S +++ W ++    G +N + EK L  + PQDSC+   P     W+ +V
Sbjct  224  IPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNV  281



Lambda      K        H
   0.318    0.134    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2820203236


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584708.1 transcription elongation factor B polypeptide 3
isoform X1 [Cephus cinctus]

Length=776
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ELOA1_DROME  unnamed protein product                                  248     5e-72
ELOA1_CAEEL  unnamed protein product                                  89.0    2e-18


>ELOA1_DROME unnamed protein product
Length=643

 Score = 248 bits (633),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 154/392 (39%), Positives = 221/392 (56%), Gaps = 54/392 (14%)

Query  422  KKKVKQEINGDEGIDCNSGASFAEALGMCTMPLPSRKRNNNS-------PNLSPTKVIKT  474
            K K K E +  +G D + GA+F + LG+  +P+ S+K ++NS       P  +P+    +
Sbjct  269  KVKSKSEEDSADGFDSSMGANFDDVLGLLNIPISSKKSSSNSKSKFVAKPTAAPSSSALS  328

Query  475  EPSTSSSVTNIPSMNIKTEAPCVVDPHQPSLLAPNVKLEPLSVDLASTLPEINPNYKPLP  534
             P+T+ S     S + +  +       +P LLA   KLEPL  ++A  LP I+ NYKP+P
Sbjct  329  APTTAGSSKEALSTSSRPTS------KKPELLASTAKLEPLDPNIALELPTISNNYKPMP  382

Query  535  YVNPI----------HRKQE-----EDRALSEVIYAKNQRTKVYSGNKS-TYTNVPSLYE  578
                +          H+ Q      E  AL++ I +K  RTK+YSG ++     VPSL++
Sbjct  383  LNQTVMDVVFNQGGSHKAQASRYFNESEALAQGISSKTMRTKIYSGVRTGQILQVPSLFD  442

Query  579  MCIRILIENIEALEFTGGVPYDIIKPVLERATADQLFMLEHHNPYLIEDTDPLWQFHCSR  638
            +C R+L +NI+ALE+TGGVP+++++PVLERAT  QL   E +NPYL++D+D LWQ H  R
Sbjct  443  LCTRVLQKNIDALEYTGGVPFEVLRPVLERATPQQLLNFEEYNPYLMDDSDVLWQQHVQR  502

Query  639  EFRCKQREEMETWREMYMRCLDEREAKLKALTANIKQSIDKS-LPVRSAKLAYVDNVVKP  697
              R ++REEMETWREM++RC +E++ KL  L  +IK S   S  PVR  +LA+VD++VKP
Sbjct  503  HCRSQRREEMETWREMFLRCQEEKDRKLSILAESIKASQKISEAPVRKTQLAFVDSMVKP  562

Query  698  PRHVLRKQAKYGTATATPSSTSDLKKKLIAGGGSNSATNISVPP-------------PPM  744
            PR V RKQ +YGT           K KLIA   +  A   SV P                
Sbjct  563  PRSVQRKQEQYGT-----------KGKLIATPAARVAALSSVTPNAAKVGDARLRVLAAA  611

Query  745  PRSKTSSSGVLKKTKAPLMAKALQLIKGRYKR  776
              +    +G  +  KAPLMAK LQ ++GR KR
Sbjct  612  RDTAQVGAGPARSKKAPLMAKTLQFMRGRLKR  643


 Score = 112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 106/176 (60%), Gaps = 14/176 (8%)

Query  3    VVDKIQHYQRNIVKCSDNVERMMHCISKLYSLPVTVQHLQETGVGRTVNALRKYDGDVGE  62
            ++D ++HYQR+I K  ++ +R++HCI+KL++LP+  +HLQETG+G+TVNALRK  G+VG 
Sbjct  7    LLDVVRHYQRSIEKHGEDEQRLLHCITKLFNLPIKFEHLQETGIGKTVNALRKISGEVGV  66

Query  63   AAKALVAKWKTMVADEESSDG-------DYEDEGCALDPPEDNDENSNSSKIDADDAKEL  115
            AAK LV KWK MVA E+ S         + ED G      ED D+ +     ++   ++L
Sbjct  67   AAKTLVTKWKAMVAKEDPSIASTPTAIHNEEDSGKTKSSDEDPDQENKGG--NSSSGEDL  124

Query  116  GHSSHETKQRHTNKLDRNKSSKESSKNSSMDSSKTKDKSHSSSGNDRHKHSKVDKE  171
              S H++K   + K +R+ SS+  SK     S    DK H SS +D+ K    D+E
Sbjct  125  NTSKHKSKHAKSTKHERSSSSRSHSK-----SRSDSDKKHKSSRHDKSKDRDKDRE  175


>ELOA1_CAEEL unnamed protein product
Length=434

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 137/281 (49%), Gaps = 41/281 (15%)

Query  518  DLASTLPEINPNYKP---LPYVNPIHRKQEEDRALSEVIYAKNQRTKVYSGN-KSTYTNV  573
            D A  +P   P+ +P   +P    +H       A   +   + +R KV++G  K     V
Sbjct  167  DYAPVVPTCKPSGQPKKAIPQSKSLH-------ADENMFKPRKERQKVFAGRRKRVGEGV  219

Query  574  PSLYEMCIRILIENIEALEFTGGVPYDIIKPVLERATADQLFMLEHHNPYLIEDTDPLWQ  633
             +L  +C  +L+ +I+ ++  G VP+D++KPVL+ A+ DQL  +   NP L+ED D ++ 
Sbjct  220  STLVSLCQTVLMSHIDMIDHVGIVPFDLLKPVLDHASTDQLRHILDVNPMLVEDADEMFH  279

Query  634  FHCSREF-RCKQREEM-ETWREMYMRCLDEREA----KLKALTANIKQSIDKSLPVRSAK  687
               SREF +   RE+   TWREMY R +++++     KL+ LT+ I +S        SA+
Sbjct  280  EMVSREFPKYANREKSGWTWREMYDRLVEKKQKKENDKLEMLTSRIGKS-------NSAQ  332

Query  688  LAYVDNVVKPPRHV-LRKQAKYGTA-------TATPSS--TSDLKKKLIAGGGSNSAT--  735
                  +V    H  +R ++ + T        +ATPS+   S  +K +   G +   T  
Sbjct  333  SQGRQTMVIDMAHTRVRSKSFFNTVKDSQVKMSATPSALQLSQARKNVKIEGKAQLRTIT  392

Query  736  --NISVPPPPMPRS---KTSSSGVLKKTKAPLMAKALQLIK  771
                 VP     RS      ++G++ K  APLMAK  +++K
Sbjct  393  PRGGGVPSTSRSRSNNNNNMNNGLVVKKTAPLMAKCKKMLK  433



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584709.1 transcription elongation factor B polypeptide 3
isoform X2 [Cephus cinctus]

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ELOA1_DROME  unnamed protein product                                  251     3e-73
ELOA1_CAEEL  unnamed protein product                                  89.0    2e-18


>ELOA1_DROME unnamed protein product
Length=643

 Score = 251 bits (641),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/381 (39%), Positives = 220/381 (58%), Gaps = 33/381 (9%)

Query  422  KKKVKQEINGDEGIDCNSGASFAEALGMCTMPLPSRKRNNNS-------PNLSPTKVIKT  474
            K K K E +  +G D + GA+F + LG+  +P+ S+K ++NS       P  +P+    +
Sbjct  269  KVKSKSEEDSADGFDSSMGANFDDVLGLLNIPISSKKSSSNSKSKFVAKPTAAPSSSALS  328

Query  475  EPSTSSSVTNIPSMNIKTEAPCVVDPHQPSLLAPNVKLEPLSVDLASTLPEINPNYKPLP  534
             P+T+ S     S + +  +       +P LLA   KLEPL  ++A  LP I+ NYKP+P
Sbjct  329  APTTAGSSKEALSTSSRPTS------KKPELLASTAKLEPLDPNIALELPTISNNYKPMP  382

Query  535  YVNPI----------HRKQE-----EDRALSEVIYAKNQRTKVYSGNKS-TYTNVPSLYE  578
                +          H+ Q      E  AL++ I +K  RTK+YSG ++     VPSL++
Sbjct  383  LNQTVMDVVFNQGGSHKAQASRYFNESEALAQGISSKTMRTKIYSGVRTGQILQVPSLFD  442

Query  579  MCIRILIENIEALEFTGGVPYDIIKPVLERATADQLFMLEHHNPYLIEDTDPLWQFHCSR  638
            +C R+L +NI+ALE+TGGVP+++++PVLERAT  QL   E +NPYL++D+D LWQ H  R
Sbjct  443  LCTRVLQKNIDALEYTGGVPFEVLRPVLERATPQQLLNFEEYNPYLMDDSDVLWQQHVQR  502

Query  639  EFRCKQREEMETWREMYMRCLDEREAKLKALTANIKQSIDKS-LPVRSAKLAYVDNVVKP  697
              R ++REEMETWREM++RC +E++ KL  L  +IK S   S  PVR  +LA+VD++VKP
Sbjct  503  HCRSQRREEMETWREMFLRCQEEKDRKLSILAESIKASQKISEAPVRKTQLAFVDSMVKP  562

Query  698  PRHVLRKQAKYGT---ATATPSSTSDLKKKLIAGGGSNSATNISVPPPPMPRSKTSSGVL  754
            PR V RKQ +YGT     ATP++       +           + V       ++  +G  
Sbjct  563  PRSVQRKQEQYGTKGKLIATPAARVAALSSVTPNAAKVGDARLRVLAAARDTAQVGAGPA  622

Query  755  KKTKAPLMAKALQLIKGRYKR  775
            +  KAPLMAK LQ ++GR KR
Sbjct  623  RSKKAPLMAKTLQFMRGRLKR  643


 Score = 112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 106/176 (60%), Gaps = 14/176 (8%)

Query  3    VVDKIQHYQRNIVKCSDNVERMMHCISKLYSLPVTVQHLQETGVGRTVNALRKYDGDVGE  62
            ++D ++HYQR+I K  ++ +R++HCI+KL++LP+  +HLQETG+G+TVNALRK  G+VG 
Sbjct  7    LLDVVRHYQRSIEKHGEDEQRLLHCITKLFNLPIKFEHLQETGIGKTVNALRKISGEVGV  66

Query  63   AAKALVAKWKTMVADEESSDG-------DYEDEGCALDPPEDNDENSNSSKIDADDAKEL  115
            AAK LV KWK MVA E+ S         + ED G      ED D+ +     ++   ++L
Sbjct  67   AAKTLVTKWKAMVAKEDPSIASTPTAIHNEEDSGKTKSSDEDPDQENKGG--NSSSGEDL  124

Query  116  GHSSHETKQRHTNKLDRNKSSKESSKNSSMDSSKTKDKSHSSSGNDRHKHSKVDKE  171
              S H++K   + K +R+ SS+  SK     S    DK H SS +D+ K    D+E
Sbjct  125  NTSKHKSKHAKSTKHERSSSSRSHSK-----SRSDSDKKHKSSRHDKSKDRDKDRE  175


>ELOA1_CAEEL unnamed protein product
Length=434

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 137/281 (49%), Gaps = 42/281 (15%)

Query  518  DLASTLPEINPNYKP---LPYVNPIHRKQEEDRALSEVIYAKNQRTKVYSGN-KSTYTNV  573
            D A  +P   P+ +P   +P    +H       A   +   + +R KV++G  K     V
Sbjct  167  DYAPVVPTCKPSGQPKKAIPQSKSLH-------ADENMFKPRKERQKVFAGRRKRVGEGV  219

Query  574  PSLYEMCIRILIENIEALEFTGGVPYDIIKPVLERATADQLFMLEHHNPYLIEDTDPLWQ  633
             +L  +C  +L+ +I+ ++  G VP+D++KPVL+ A+ DQL  +   NP L+ED D ++ 
Sbjct  220  STLVSLCQTVLMSHIDMIDHVGIVPFDLLKPVLDHASTDQLRHILDVNPMLVEDADEMFH  279

Query  634  FHCSREF-RCKQREEM-ETWREMYMRCLDEREA----KLKALTANIKQSIDKSLPVRSAK  687
               SREF +   RE+   TWREMY R +++++     KL+ LT+ I +S        SA+
Sbjct  280  EMVSREFPKYANREKSGWTWREMYDRLVEKKQKKENDKLEMLTSRIGKS-------NSAQ  332

Query  688  LAYVDNVVKPPRHV-LRKQAKYGTA-------TATPSS--TSDLKKKLIAGGGSNSAT--  735
                  +V    H  +R ++ + T        +ATPS+   S  +K +   G +   T  
Sbjct  333  SQGRQTMVIDMAHTRVRSKSFFNTVKDSQVKMSATPSALQLSQARKNVKIEGKAQLRTIT  392

Query  736  --NISVPPPPMPRS----KTSSGVLKKTKAPLMAKALQLIK  770
                 VP     RS      ++G++ K  APLMAK  +++K
Sbjct  393  PRGGGVPSTSRSRSNNNNNMNNGLVVKKTAPLMAKCKKMLK  433



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584710.1 laccase-4 [Cephus cinctus]

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLC3_DROME  unnamed protein product                                 442     1e-143
Q8SYT6_DROME  unnamed protein product                                 432     2e-139
A1Z6F4_DROME  unnamed protein product                                 393     1e-126


>Q9VLC3_DROME unnamed protein product
Length=959

 Score = 442 bits (1137),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 247/704 (35%), Positives = 361/704 (51%), Gaps = 90/704 (13%)

Query  25   QSFRIAAMTRGFNVNDTNPEILGGS---HHHCYRKCTAG-DVRTCYYSFTLVQYTSMSFV  80
            Q+ RI  +    NV ++  +I       +H C R C  G +  TC Y F +  Y + S  
Sbjct  216  QTARIEELQD--NVAESTDDIWTAEWYRNHPCNRDCQVGAEPMTCRYKFVVEWYQTFSKA  273

Query  81   CGECPYIRTDCYKNGCISAGGYVRSVTVANHMLPGPSIQVCQGDTVRVDVINTFTSDSTT  140
            C +CP   TDC +  C+   G  RS+TV N M+PGP+I+VC+GD + VDV N    +ST+
Sbjct  274  CYDCPRNLTDCSRPHCVMGDGLERSITVVNRMMPGPAIEVCEGDEIVVDVKNHLLGESTS  333

Query  141  IHWHGIHQVDSPYMDGTPYLTQCPIAPHNSFQYQFVAQPAGTHIWHSHIGFEEADGLYSS  200
            IHWHG+HQ  +PYMDG P++TQCPI PH +F+Y F A  +GTH WHSH G +  DG++ +
Sbjct  334  IHWHGLHQKKTPYMDGVPHITQCPITPHATFRYSFPADLSGTHFWHSHTGMQRGDGVFGA  393

Query  201  LIVR--KNDDPLAKYYDYDLADHVMIIWHWYHSSTAAILTAALHTSDSVSGYSFLING--  256
            LI+R  K  +P    YD+DL++HVMI+  W H + A+I +   H+      ++ L+NG  
Sbjct  394  LIIRKPKTAEPHGGLYDFDLSEHVMIVQDWIHDTGASIFSYHHHSRGDNKPHNLLVNGKG  453

Query  257  --------------------------------------LTADIEYTKDNITYTTP-----  273
                                                  L       K N T   P     
Sbjct  454  RYYNRIWAEAKQAHRRAEERTTQPVEPLPKSQVDFVQTLPRQARLAKTNTTKLFPVNSRQ  513

Query  274  -RAVFNVV-------------QGQRYRFRVIYNNAVYCPVQVSIDNHTLLMIASESGTFE  319
             R   N +             +G RYRFR+I    + CP+ VSID H L  I S+    E
Sbjct  514  KRGNLNEIPLELVPHQIYTVRRGFRYRFRIINAEYLNCPIVVSIDGHNLTAINSDGFDIE  573

Query  320  PVEVDSFMINGGERFDFVLSANQTPDNYWIRYRGVGDCETSLVTVSKEAILRYNGADNIE  379
             ++V S +   GERFDFVL+AN    NYWIR +G+ DC     +  + AILRY GA + E
Sbjct  574  AMDVGSIVTYSGERFDFVLNANLEVGNYWIRLKGLMDCSEVFTSAFQVAILRYEGAPDEE  633

Query  380  PSGTTTYEDANRAGVLFNAVQMSTNNYPNNTVIKVVDL----NNTATNPANISGTPDYTF  435
            P+   +Y      G+  N +          TV ++  L    + +  +   +    DY F
Sbjct  634  PTAELSY-GHKAEGIELNVMNRGPGYPDTKTVAEMRALPIYDHVSGIDHDTLKPEADYKF  692

Query  436  YLHFLFNTFNS--FHSPGPY--------------PQINNISFEYPSFPLLTQYEHITDDI  479
            ++++ F T N+  FH    Y              PQ+N+I+  +PS  LL     + D  
Sbjct  693  FIYYDFYTKNNPDFHDKDLYAMDMEMTQQNRLYTPQLNHITLNFPSLALLPSRSQLKDSD  752

Query  480  YCTEDN--DTAKECIGDYCTCPYLYPVSKNSLVEVVLVDLSLNRDQDHPMHLHGYEFYVV  537
            +C E +  D   +C  ++C C ++  V   ++VE+++VD       +HP HLHG  F V+
Sbjct  753  FCNETSLMDQGIDCRQEFCKCHHVLQVPLGAVVEMIIVDEGFQYYANHPFHLHGNAFRVM  812

Query  538  AMESVGVNISLDEIKRLNEAGLLDKKLYGAPVKDNIGVPSRGYTIIRFVASNPGYWFFHC  597
             +E +G N++++ IK+L++  LL + L   PVKD + +P  GYTIIRF ASNPGYW FHC
Sbjct  813  GLERLGENVTVEMIKQLDQFNLLKRNLDNPPVKDTVTIPDGGYTIIRFEASNPGYWLFHC  872

Query  598  HVTNHAEMGMGVVFKVGEHEEMIQPPKTFPRCGNWKLTASSSNG  641
            H+  HAE+GM +VFKVG  ++M+  P+ FP CG++     S  G
Sbjct  873  HIEFHAEIGMALVFKVGNDDQMVPVPENFPTCGDYNPDLRSDGG  916


>Q8SYT6_DROME unnamed protein product
Length=959

 Score = 432 bits (1110),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 247/704 (35%), Positives = 360/704 (51%), Gaps = 90/704 (13%)

Query  25   QSFRIAAMTRGFNVNDTNPEILGGS---HHHCYRKCTAG-DVRTCYYSFTLVQYTSMSFV  80
            Q+ RI  +    NV ++  +I       +H C R C  G +  TC Y F +  Y + S  
Sbjct  216  QTARIEELQD--NVAESTDDIWTAEWYRNHPCNRDCQVGAEPMTCRYKFVVEWYQTFSKA  273

Query  81   CGECPYIRTDCYKNGCISAGGYVRSVTVANHMLPGPSIQVCQGDTVRVDVINTFTSDSTT  140
            C +CP   TDC +  C+   G  RS+TV N M+PGP+I+VC+GD + VDV N    +ST+
Sbjct  274  CYDCPRNLTDCSRPHCVMGDGLERSITVVNRMMPGPAIEVCEGDEIVVDVKNHLLGESTS  333

Query  141  IHWHGIHQVDSPYMDGTPYLTQCPIAPHNSFQYQFVAQPAGTHIWHSHIGFEEADGLYSS  200
            IHWHG+HQ  +PYMDG P++TQCPI PH +F+Y F A  +GTH WHSH G +  DG++S+
Sbjct  334  IHWHGLHQKKTPYMDGVPHITQCPITPHATFRYSFPADLSGTHFWHSHTGMQRGDGVFSA  393

Query  201  LIVR--KNDDPLAKYYDYDLADHVMIIWHWYHSSTAAILTAALHTSDSVSGYSFLING--  256
            LI+R  K  +P    YD+DL++HVMI+  W H + A+I +   H+      ++ L+NG  
Sbjct  394  LIIRKPKTAEPHGGLYDFDLSEHVMIVQDWIHDTGASIFSYHHHSRGDNKPHNLLVNGKG  453

Query  257  --------------------------------------LTADIEYTKDNITYTTP-----  273
                                                  L       K N T   P     
Sbjct  454  RYYNRIWAEAKQAHRRAEERTTQPVEPLPKSQVDFVQTLPRQARLAKTNTTKLFPVNSRQ  513

Query  274  -RAVFNVVQGQ---------RYRFRVIYN--NAVY--CPVQVSIDNHTLLMIASESGTFE  319
             R   N +  +         R  FR  +   NA Y  CP+ VSID H L  I S+    E
Sbjct  514  KRGNLNEIPLELVPHQIYTVRRGFRYRFRIINAEYLNCPIVVSIDGHNLTAINSDGFDIE  573

Query  320  PVEVDSFMINGGERFDFVLSANQTPDNYWIRYRGVGDCETSLVTVSKEAILRYNGADNIE  379
             ++V S +   GERFDFVL+AN    NYWIR +G+ DC     +  + AILRY GA + E
Sbjct  574  AMDVGSIVTYSGERFDFVLNANLEVGNYWIRLKGLMDCSEVFTSAFQVAILRYEGAPDEE  633

Query  380  PSGTTTYEDANRAGVLFNAVQMSTNNYPNNTVIKVVDL----NNTATNPANISGTPDYTF  435
            P+   +Y      G+  N +          TV ++  L    + +  +   +    DY F
Sbjct  634  PTAELSY-GHKAEGIELNVMNRGPGYPDTKTVAEMRALPIYDHVSGIDHDTLKPEADYKF  692

Query  436  YLHFLFNTFNS--FHSPGPY--------------PQINNISFEYPSFPLLTQYEHITDDI  479
            ++++ F T N+  FH    Y              PQ+N+I+  +PS  LL     + D  
Sbjct  693  FIYYDFYTKNNPDFHDKDLYAMDMEMTQQNRLYTPQLNHITLNFPSLALLPSRSQLKDSD  752

Query  480  YCTEDN--DTAKECIGDYCTCPYLYPVSKNSLVEVVLVDLSLNRDQDHPMHLHGYEFYVV  537
            +C E +  D   +C  ++C C ++  V   ++VE+++VD       +HP HLHG  F V+
Sbjct  753  FCNETSLMDQGIDCRQEFCKCHHVLQVPLGAVVEMIIVDEGFQYYANHPFHLHGNAFRVM  812

Query  538  AMESVGVNISLDEIKRLNEAGLLDKKLYGAPVKDNIGVPSRGYTIIRFVASNPGYWFFHC  597
             +E +G N++++ IK+L++  LL + L   PVKD + +P  GYTIIRF ASNPGYW FHC
Sbjct  813  GLERLGENVTVEMIKQLDQFNLLKRNLDNPPVKDTVTIPDGGYTIIRFEASNPGYWLFHC  872

Query  598  HVTNHAEMGMGVVFKVGEHEEMIQPPKTFPRCGNWKLTASSSNG  641
            H+  HAE+GM +VFKVG  ++M+  P+ FP CG++     S  G
Sbjct  873  HIEFHAEIGMALVFKVGNDDQMVPVPENFPTCGDYNPDLRSDGG  916


>A1Z6F4_DROME unnamed protein product
Length=784

 Score = 393 bits (1010),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 222/604 (37%), Positives = 313/604 (52%), Gaps = 30/604 (5%)

Query  52   HCYRKCTAGDV-RTCYYSFTLVQYTSMSFVCGECPYIRTDCYKN--GCISAGGYVRSVTV  108
             C R C  G+  R CYY FTL  YT +   C  C    T+   +   C+ A G  R +  
Sbjct  179  ECARACREGEPPRICYYHFTLEYYTVLGAACQVCTPNATNTVWSHCQCVLADGVERGILT  238

Query  109  ANHMLPGPSIQVCQGDTVRVDVINTFTSDSTTIHWHGIHQVDSPYMDGTPYLTQCPIAPH  168
            AN M+PGPSIQVC+ D V +DV N       TIHWHGI Q  S Y DG P++TQCPI   
Sbjct  239  ANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQG  298

Query  169  NSFQYQFVAQPAGTHIWHSHIGFEEADGLYSSLIVRK--NDDPLAKYYDYDLADHVMIIW  226
            N+F+YQ+    AGTH WH+H G ++ DGLY S++VR+  + DP +  YD+DL  H+M+I 
Sbjct  299  NTFRYQWTGN-AGTHFWHAHTGLQKLDGLYGSVVVRQPPSRDPNSHLYDFDLTTHIMLIS  357

Query  227  HWYHSSTAAILTAALHTSDSVSGYSFLINGLTADIEYTKDNITYTTPRAVFNVVQGQRYR  286
             W H   A      L  +      S LING               TP  +F +  G+RYR
Sbjct  358  DWLHEDAAERYPGRLAVNTGQDPESMLING-KGQFRDPNTGFMTNTPLEIFTITPGRRYR  416

Query  287  FRVIYNNAVYCPVQVSIDNHTLLMIASESGTFEPVEVDSFMINGGERFDFVLSANQTPDN  346
            FR+I   A  CP QV+I+ H + +IA++     PV+V++ +   GER+DFV+SA+Q    
Sbjct  417  FRMINAFASVCPAQVTIEGHGMTVIATDGEPVHPVDVNTIISFSGERYDFVISADQPVGA  476

Query  347  YWIRYRGVGDCETSLVTVSKEAILRYNGADNIEPSGTTTYEDANRAGVLFNAVQMSTNNY  406
            YWI+ RG+G+C   +    + AILRY        S   TY+     GV+ N +    N  
Sbjct  477  YWIQLRGLGEC--GIRRAQQLAILRYARGPYQPASSPPTYDVGIPQGVVMNPLDAQCNRQ  534

Query  407  PNNTVIKVVDLNNTATNPANISGTPDYTFYLHFLF-----------NTFNSFHSPGPYPQ  455
             N+ +      N    +   ++  PD   +L F F           NT+N F        
Sbjct  535  RNDAICVSQLKNALEIDRGILAEKPDVKIFLPFRFFVYRAEDLFQPNTYNRFLVASDADH  594

Query  456  ----INNISFEYPSFPLLTQYEHITDDIYCTEDNDTAKECIGDYCTCPYLYPVSKNSLVE  511
                I+ +S+  P  P+L+QY  I  + YC  DN    +C G+ C C +   V  N++VE
Sbjct  595  LISLIDEVSYISPPSPMLSQYNDIPQEYYCNGDNRPV-DC-GENCQCTHKIDVPLNAIVE  652

Query  512  VVLVDLSLNRDQDHPMHLHGYEFYVVAM----ESVGVNISLDEIKRLNEAGLLDKKLYGA  567
            VVLVD     +  HP HLHG  FYV+ +    +     ++L     L++ GLL+++    
Sbjct  653  VVLVDEVQQINISHPFHLHGTSFYVLGLGRSPDKQIQRMNLKHALELDQRGLLERQYLKP  712

Query  568  PVKDNIGVPSRGYTIIRFVASNPGYWFFHCHVTNHAEMGMGVVFKVGEHEEMIQPPKTFP  627
             +KD + VP+ GY I+RF A NPG+W FHCH   H  +GM +VF++G   ++   P  FP
Sbjct  713  SLKDTVAVPNNGYAILRFRADNPGFWLFHCHFQYHIVIGMNLVFQIGTPNDLPPVPPNFP  772

Query  628  RCGN  631
            RCGN
Sbjct  773  RCGN  776



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584711.1 TAF5-like RNA polymerase II p300/CBP-associated
factor-associated factor 65 kDa subunit 5L [Cephus cinctus]

Length=589
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCN9_DROME  unnamed protein product                                 250     1e-73
TAF5_DROME  unnamed protein product                                   207     3e-58
Q9VT91_DROME  unnamed protein product                                 145     4e-36


>Q9VCN9_DROME unnamed protein product
Length=743

 Score = 250 bits (638),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 200/710 (28%), Positives = 312/710 (44%), Gaps = 133/710 (19%)

Query  9    DIINATVESYLKRRRYQDGDVFRKSERTGCQSSEEMTLTTTVECSTSRDNSIVFS---AI  65
            D++   V   LK++ Y   + FR+S+    Q+ ++  +   ++      NS  FS    I
Sbjct  37   DLLRCAVGLLLKQKNYVSNERFRRSDFLLLQNKQQFAVNKMLDTDLHGGNSFTFSNVQVI  96

Query  66   INDVAAADQTYQRLKMWINNIVNDKLKLELKGLLYPVFCHLYLEMLHGGNRQAAVQFLKT  125
             N+    DQ + R   ++     + L+LE+K    P+ CH YL++L     + AV+ L+ 
Sbjct  97   TNNQHTVDQQFGRFSQFVEAQA-EPLRLEMKRFYGPMLCHFYLDLLKAREPRGAVELLRK  155

Query  126  H--------------------------QSDF----------VSETERDF----LEELSSV  145
            +                          +S F            +TE D+    ++ LS  
Sbjct  156  YAHLVAPVDMYDAPPPTKINGCSTTANESTFNIRFAKEAQDTGDTELDYFMRLVQTLSGY  215

Query  146  FSIQDIELRPLVNAFRTRKYKVDMSDEAHICLQKFLAKHGHVILMQVINT--HVTIIKK-  202
              ++  E    V  FR+ KY++  +      +  +L + GHV++M ++ T  HV I++  
Sbjct  216  TRLEAAESDDTVAHFRSSKYELHTTAVVVNRICAYLQRRGHVLIMNLLYTWLHVHIVENE  275

Query  203  -----------------------------------IADIHPMDEETSGEWVQRN------  221
                                                 DI P    T     +R       
Sbjct  276  QRAFSEDHLLGLTDDLEGEDGEDDVVSKPAVTLNTRGDIRPSKSLTEKSNRKRPAEEPNI  335

Query  222  --EVGINGHVEQPSGT-------GVDREMRELQEAIRLIRSSEHHPLRVYTINNSFENAS  272
              E  I   VE             +D  +  L+ A   I  S+    R   I+      +
Sbjct  336  MLETDIKQEVETDESAELSKLQLNIDACLDTLKSATEQILKSQVELPRFLRISERSRGLT  395

Query  273  TAVITPNMDRLAAAFCTSEIRLWGI------GDRVLTR-PRFKLPSVSLACDVLSTSRPP  325
            +A + P+   + A F  S ++LW +      G     R P+ + P     C         
Sbjct  396  SAHLDPSECHMLAGFDNSAVQLWQLNQSYCRGKSFYRRYPQKRCPWELNNC-ANQEEETD  454

Query  326  EDNNDTD-------------------------EAGAVVLRGHTDIVHDLRFIPESEILVS  360
            ED++D D                         E G   LRGHT  V D+RF     ++ S
Sbjct  455  EDSSDEDVKCSEEERRERNRARHCKYADNSYNEYGGFQLRGHTKGVTDVRFSAHYPLMYS  514

Query  361  VSSDKDMRAWRLNDYSCAAVYNGHNYPIWCMDTSVFNLYIATGSHDRTAKLWSLDRTFPL  420
            VS D  MR WR ++  CAA+Y  HNYPIWC+D S    Y+ TGS D +A+LWSL++   L
Sbjct  515  VSKDATMRCWRAHNLHCAAIYRSHNYPIWCLDESPVGQYVVTGSKDLSARLWSLEKEHAL  574

Query  421  RIFAGHFLDVNSVRFHPNARYLATGSADKTVRLWSKDDGSLVRVYVGAQSTIYSLAFSPD  480
             I+AGH  DV  V FHPN  Y+ATGSAD +VRLW    G L+RV+   +  +  LAFSPD
Sbjct  575  IIYAGHTQDVECVAFHPNGNYIATGSADHSVRLWCATSGKLMRVFADCRQAVTQLAFSPD  634

Query  481  GKYLAAAGDDKCVSVWDLATNALLTELKGHQETIMNLDWSSDGQYIASASMDGIIRLWST  540
            GK LAAAG++  V ++DLA  A L ELK H  +I +L WS+  +++A+A  DG +RLW  
Sbjct  635  GKMLAAAGEETKVRIFDLAAGAQLAELKDHSASISSLSWSTHNRHLATACSDGTLRLWDI  694

Query  541  QEHINVANSGSANSQTEVHSPQVYSTN--CSSILSLRYYRKNNSLVCIGT  588
            ++   ++++ SA S +   + +V + N  C  ++ + +Y  + +L CIGT
Sbjct  695  KKLSPMSDNSSAGSSSSATTNRVLTVNSSCQRLVDV-FYGTSKTLYCIGT  743


>TAF5_DROME unnamed protein product
Length=704

 Score = 207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 195/363 (54%), Gaps = 24/363 (7%)

Query  240  EMRELQEA-IRLIRSSEHHPLRV-YTINNSFENASTAVITPNMDRLAAAFCTSEIRLWGI  297
            +++ L+EA  RL  S +  P  V YT+ NS +  + A I+ +   LA  F  S +R+W +
Sbjct  347  KLKALREASKRLALSKDQLPSAVFYTVLNSHQGVTCAEISDDSTMLACGFGDSSVRIWSL  406

Query  298  GDRVLTRPRFKLPSVSLACDVLSTSRPPEDNND---TDEAGAVV--LRGHTDIVHDLRFI  352
                      KL ++  A  +    +   D N     D +G V   L GHT  V+   F 
Sbjct  407  TPA-------KLRTLKDADSLRELDKESADINVRMLDDRSGEVTRSLMGHTGPVYRCAFA  459

Query  353  PESEILVSVSSDKDMRAWRLNDYSCAAVYNGHNYPIWCMDTSVFNLYIATGSHDRTAKLW  412
            PE  +L+S S D  +R W L  +SC   Y GH YP+W +  +    Y  + S+D+TA+LW
Sbjct  460  PEMNLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVWDVRFAPHGYYFVSCSYDKTARLW  519

Query  413  SLDRTFPLRIFAGHFLDVNSVRFHPNARYLATGSADKTVRLWSKDDGSLVRVYVGAQSTI  472
            + D    LR+F GH  DV+ V+FHPN+ Y+ATGS+D+TVRLW    G  VR+  G + ++
Sbjct  520  ATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSV  579

Query  473  YSLAFSPDGKYLAAAGDDKCVSVWDLATNALLTELKGHQETIMNLDWSSDGQYIASASMD  532
             SLAFS  G+YLA+   D  + +WDL+  +L+T L  H  T+  + +S DG  +A+A +D
Sbjct  580  SSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLD  639

Query  533  GIIRLWSTQE--------HINVANSGSANSQTEVHSPQVYSTNCSSILSLRYYRKNNSLV  584
              + LW   +        HI V++    N + +V+  + + +  S  +SL + R+ N L+
Sbjct  640  NNLTLWDFHKVTEDYISNHITVSHHQDENDE-DVYLMRTFPSKNSPFVSLHFTRR-NLLM  697

Query  585  CIG  587
            C+G
Sbjct  698  CVG  700


>Q9VT91_DROME unnamed protein product
Length=942

 Score = 145 bits (365),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 108/206 (52%), Gaps = 0/206 (0%)

Query  339  LRGHTDIVHDLRFIPESEILVSVSSDKDMRAWRLNDYSCAAVYNGHNYPIWCMDTSVFNL  398
            L GH   V+   F PE   L++ S D  +R W L  +SC  +++GH  P+  +  +    
Sbjct  622  LYGHQGPVYGCSFNPEDRFLITCSEDFSVRLWCLLSWSCVVIFSGHLAPVCFVVFAPRGY  681

Query  399  YIATGSHDRTAKLWSLDRTFPLRIFAGHFLDVNSVRFHPNARYLATGSADKTVRLWSKDD  458
            Y AT S D TA++W  D T P RI  GH  ++    FHPN  Y+ATGSAD TVR+W    
Sbjct  682  YFATASDDCTARVWMQDNTKPARILQGHLAELGVCLFHPNRHYMATGSADCTVRIWDIVK  741

Query  459  GSLVRVYVGAQSTIYSLAFSPDGKYLAAAGDDKCVSVWDLATNALLTELKGHQETIMNLD  518
               VR++ G +S I +L +S  G+YL + GDD  + +WD A   L+     H+ +I  ++
Sbjct  742  AVQVRIFRGHKSRITALIYSICGRYLVSGGDDNLIMIWDTANEILMQFFDHHKASINTME  801

Query  519  WSSDGQYIASASMDGIIRLWSTQEHI  544
             S D   +     D  + LW  ++ I
Sbjct  802  ISLDNNILVVGGQDCQLTLWDFEQVI  827


 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (45%), Gaps = 0/163 (0%)

Query  336  AVVLRGHTDIVHDLRFIPESEILVSVSSDKDMRAWRLNDYSCAAVYNGHNYPIWCMDTSV  395
             V+  GH   V  + F P      + S D   R W  ++   A +  GH   +       
Sbjct  661  VVIFSGHLAPVCFVVFAPRGYYFATASDDCTARVWMQDNTKPARILQGHLAELGVCLFHP  720

Query  396  FNLYIATGSHDRTAKLWSLDRTFPLRIFAGHFLDVNSVRFHPNARYLATGSADKTVRLWS  455
               Y+ATGS D T ++W + +   +RIF GH   + ++ +    RYL +G  D  + +W 
Sbjct  721  NRHYMATGSADCTVRIWDIVKAVQVRIFRGHKSRITALIYSICGRYLVSGGDDNLIMIWD  780

Query  456  KDDGSLVRVYVGAQSTIYSLAFSPDGKYLAAAGDDKCVSVWDL  498
              +  L++ +   +++I ++  S D   L   G D  +++WD 
Sbjct  781  TANEILMQFFDHHKASINTMEISLDNNILVVGGQDCQLTLWDF  823


 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 59/131 (45%), Gaps = 0/131 (0%)

Query  416  RTFPLRIFAGHFLDVNSVRFHPNARYLATGSADKTVRLWSKDDGSLVRVYVGAQSTIYSL  475
            + F  R   GH   V    F+P  R+L T S D +VRLW     S V ++ G  + +  +
Sbjct  615  KKFTRRTLYGHQGPVYGCSFNPEDRFLITCSEDFSVRLWCLLSWSCVVIFSGHLAPVCFV  674

Query  476  AFSPDGKYLAAAGDDKCVSVWDLATNALLTELKGHQETIMNLDWSSDGQYIASASMDGII  535
             F+P G Y A A DD    VW          L+GH   +    +  +  Y+A+ S D  +
Sbjct  675  VFAPRGYYFATASDDCTARVWMQDNTKPARILQGHLAELGVCLFHPNRHYMATGSADCTV  734

Query  536  RLWSTQEHINV  546
            R+W   + + V
Sbjct  735  RIWDIVKAVQV  745



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584712.1 golgin-45 [Cephus cinctus]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHE3_DROME  unnamed protein product                                 227     3e-69
SPD5_CAEEL  unnamed protein product                                   31.6    2.0  
Q8II80_PLAF7  unnamed protein product                                 30.4    4.7  


>Q9VHE3_DROME unnamed protein product
Length=448

 Score = 227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 130/291 (45%), Positives = 182/291 (63%), Gaps = 23/291 (8%)

Query  76   TLIYHPMNLKQFNSTPPVAPTGTIVNITPKCVMQVKKEKHILSSLKSKEPKFIPYEPYKA  135
            TL   P N+ +  S  PV P G +V + P+ V        +    K+K PKF+PYEPY  
Sbjct  88   TLYRRPENVTR--SLAPVVPKGELVQMRPRLVTSADS---LPEHKKTKAPKFVPYEPYPG  142

Query  136  AVNPIV--PYEKKQRKSSRNNLDINVMVSQMAMLKTDEVGAKFNKEVEKEERDDKCSNEW  193
            AVNP++  P  K +    +NNLDI V+V Q++ L+T E+     +  + +E D   S+E 
Sbjct  143  AVNPMISEPTNKHKIHRDKNNLDIAVLVDQVSTLRTQELE---TETTDIKETDTASSHEV  199

Query  194  IQQKKAYETEIQKLKEENTQLESQLKFQAQVNGELKNLLVAAVGEDLETKVHLLTEDKLQ  253
                 + + E+ K+++E    ++Q KFQ QVN ELK+LLVA+VGEDL+T+V+LLTEDKLQ
Sbjct  200  ----NSLKEELAKMRDERNYFQAQYKFQTQVNSELKSLLVASVGEDLQTRVNLLTEDKLQ  255

Query  254  LARALLNSAQHLSTHQEQTEWLAGQCEVWRSKFLASSLMVEELARWKAALCQRTTDLQEA  313
            LARALL++A +L+TH EQ E+LAGQCEVWRSKFLASS+MVEELARWKA L Q+   L E+
Sbjct  256  LARALLDTANNLTTHTEQIEFLAGQCEVWRSKFLASSVMVEELARWKADLTQKNQLLNES  315

Query  314  IKRLLEERSKVRDTSLRTYRILSILRENFDSVATVSNKRHELPSTNIIGLT  364
             K+LL    ++R+  L   + L  L            +   LP+T++I L+
Sbjct  316  TKQLLHATHQIREIQLDMLKQLKFL---------AKIRFLNLPATDVISLS  357


>SPD5_CAEEL unnamed protein product
Length=1198

 Score = 31.6 bits (70),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 48/85 (56%), Gaps = 12/85 (14%)

Query  190  SNEWIQQKKAYETEIQKLKEENTQLESQL-KFQA---QVN---GELK---NLLVAAVGED  239
            +N   +  +  E  +QK KEEN+ L+SQ  + +A   QVN   GE++   N  +A V  +
Sbjct  742  TNRMFEDLEVSEATLQKAKEENSTLKSQFAELEANLHQVNSKLGEVRCELNEALARVDGE  801

Query  240  LETKVHLLTEDKLQLARALLNSAQH  264
             ET+V    E+ L+ AR L++S +H
Sbjct  802  QETRVK--AENALEEARQLISSLKH  824


>Q8II80_PLAF7 unnamed protein product
Length=1570

 Score = 30.4 bits (67),  Expect = 4.7, Method: Composition-based stats.
 Identities = 25/96 (26%), Positives = 46/96 (48%), Gaps = 8/96 (8%)

Query  144  EKKQRKSSRNNLDINVMVSQMAMLKTDEVGAKFNKEVEKEERDDKCSNEWIQQKKAYETE  203
            EK +++  +N  D      Q    + DE     NKE + E+RDD+ + E   Q+K  + +
Sbjct  279  EKNEKEEQQNEQDDEKNKEQQKCKQDDEK----NKEQQNEQRDDEQNKE---QQKCKQDD  331

Query  204  IQKLKEENTQLESQLKFQAQVNGELKNLLVAAVGED  239
             Q  +++N Q + + +   + N  +  +L   V ED
Sbjct  332  EQNKEQQNEQRDDE-QINMEDNNNICEILKNYVQED  366



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584713.1 uncharacterized protein LOC107262717 isoform X4
[Cephus cinctus]

Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZG4_DROME  unnamed protein product                                 37.7    0.025
E1JH62_DROME  unnamed protein product                                 37.7    0.026
A0A0B4K7P8_DROME  unnamed protein product                             37.7    0.026


>B7YZG4_DROME unnamed protein product
Length=5368

 Score = 37.7 bits (86),  Expect = 0.025, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  21    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  80
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5219  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5270

Query  81    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  134
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5271  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5328

Query  135   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  162
               PS   TP  +S + +FS    RTS   TP
Sbjct  5329  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5359


>E1JH62_DROME unnamed protein product
Length=5388

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  21    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  80
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5239  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5290

Query  81    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  134
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5291  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5348

Query  135   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  162
               PS   TP  +S + +FS    RTS   TP
Sbjct  5349  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5379


>A0A0B4K7P8_DROME unnamed protein product
Length=5394

 Score = 37.7 bits (86),  Expect = 0.026, Method: Composition-based stats.
 Identities = 44/151 (29%), Positives = 63/151 (42%), Gaps = 19/151 (13%)

Query  21    SCGTGVSPGIVGSCGAGGARLGVRGASTVGVRGPVRRSREFGYYPMEEHPTHSYRTHLFL  80
             S  TG++PG  GS    G++   R  S  G + P R          ++H      + +  
Sbjct  5245  STRTGLTPG--GS--RAGSKPNSRPLSRQGSKPPSRHGSTLSLDSTDDHTP----SRIPQ  5296

Query  81    SPPAGGTTSAGPDELTERLG------PGPRRNSGPLIRWGGGTAGGSASINKRKQNGNQP  134
               P+ G+T++G      RL       PG R N    I     TA GSAS    ++N +  
Sbjct  5297  RKPSTGSTASGTTPRPARLSVTTTTTPGSRLNGTSTIT--RKTASGSASPAPTRRNISGS  5354

Query  135   KEPSEPPTP-TASRQVSFSGN--RTSGTYTP  162
               PS   TP  +S + +FS    RTS   TP
Sbjct  5355  STPSGMQTPRKSSAEPTFSSTMRRTSRGTTP  5385



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584714.1 LIM and senescent cell antigen-like-containing domain
protein 1 isoform X1 [Cephus cinctus]

Length=434
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8INQ9_DROME  unnamed protein product                                 562     0.0  
Q8INR0_DROME  unnamed protein product                                 562     0.0  
Q9XYA7_DROME  unnamed protein product                                 560     0.0  


>Q8INQ9_DROME unnamed protein product
Length=348

 Score = 562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 295/335 (88%), Gaps = 0/335 (0%)

Query  97   TGMSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCE  156
              MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE
Sbjct  12   ANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCE  71

Query  157  HDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHI  216
             DFHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH 
Sbjct  72   RDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHE  131

Query  217  CNARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPG  276
            CNA+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG
Sbjct  132  CNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPG  191

Query  277  YAANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR  336
             AAN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR
Sbjct  192  LAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR  251

Query  337  HYEKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTK  396
            HYEK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+K
Sbjct  252  HYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSK  311

Query  397  FFEFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  431
            F+E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  312  FYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  346


>Q8INR0_DROME unnamed protein product
Length=345

 Score = 562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/342 (77%), Positives = 297/342 (87%), Gaps = 0/342 (0%)

Query  90   PYKKTGITGMSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEF  149
            P  +     MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEF
Sbjct  2    PPVQVQAANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEF  61

Query  150  EGRKYCEHDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQ  209
            EGRKYCE DFHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q
Sbjct  62   EGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQ  121

Query  210  GRALCHICNARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAR  269
             RALCH CNA+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AR
Sbjct  122  NRALCHECNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAR  181

Query  270  EVRSRPGYAANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCE  329
            EV+SRPG AAN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCE
Sbjct  182  EVKSRPGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCE  241

Query  330  KPFLGHRHYEKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQ  389
            KPFLGHRHYEK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD 
Sbjct  242  KPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDT  301

Query  390  KMNQKTKFFEFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  431
            KM QK+KF+E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  302  KMTQKSKFYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  343


>Q9XYA7_DROME unnamed protein product
Length=335

 Score = 560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/333 (79%), Positives = 295/333 (89%), Gaps = 0/333 (0%)

Query  99   MSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCEHD  158
            MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE D
Sbjct  1    MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERD  60

Query  159  FHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHICN  218
            FHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH CN
Sbjct  61   FHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECN  120

Query  219  ARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPGYA  278
            A+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG A
Sbjct  121  AKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLA  180

Query  279  ANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  338
            AN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
Sbjct  181  ANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  240

Query  339  EKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTKFF  398
            EK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+KF+
Sbjct  241  EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY  300

Query  399  EFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  431
            E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  301  EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  333



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584715.1 LIM and senescent cell antigen-like-containing domain
protein 1 isoform X2 [Cephus cinctus]

Length=342
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8INQ9_DROME  unnamed protein product                                 558     0.0  
Q8INR0_DROME  unnamed protein product                                 557     0.0  
Q9XYA7_DROME  unnamed protein product                                 556     0.0  


>Q8INQ9_DROME unnamed protein product
Length=348

 Score = 558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 295/335 (88%), Gaps = 0/335 (0%)

Query  5    TGMSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCE  64
              MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE
Sbjct  12   ANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCE  71

Query  65   HDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHI  124
             DFHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH 
Sbjct  72   RDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHE  131

Query  125  CNARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPG  184
            CNA+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG
Sbjct  132  CNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPG  191

Query  185  YAANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR  244
             AAN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR
Sbjct  192  LAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR  251

Query  245  HYEKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTK  304
            HYEK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+K
Sbjct  252  HYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSK  311

Query  305  FFEFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  339
            F+E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  312  FYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  346


 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 64/138 (46%), Gaps = 11/138 (8%)

Query  2    PGITGMSLDHMFCSRCREGF----------ESHEKIVNSHGELWHPQCFVCAQCFRPFPE  51
            PG+    ++ ++C RC +               E++V + G+ WH + FVCA+C +PF  
Sbjct  190  PGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLG  249

Query  52   GIFYEFEGRKYCEHDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELAD-  110
               YE  G  YCE  +H LF   C  C + + G V  A+N  W    F C  C+ ++   
Sbjct  250  HRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQK  309

Query  111  AGFIKCQGRALCHICNAR  128
            + F +   + +C  C  R
Sbjct  310  SKFYEYDEKPVCKKCYDR  327


>Q8INR0_DROME unnamed protein product
Length=345

 Score = 557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 295/335 (88%), Gaps = 0/335 (0%)

Query  5    TGMSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCE  64
              MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE
Sbjct  9    ANMSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCE  68

Query  65   HDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHI  124
             DFHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH 
Sbjct  69   RDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHE  128

Query  125  CNARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPG  184
            CNA+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG
Sbjct  129  CNAKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPG  188

Query  185  YAANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR  244
             AAN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR
Sbjct  189  LAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHR  248

Query  245  HYEKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTK  304
            HYEK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+K
Sbjct  249  HYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSK  308

Query  305  FFEFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  339
            F+E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  309  FYEYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  343


 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 64/138 (46%), Gaps = 11/138 (8%)

Query  2    PGITGMSLDHMFCSRCREGF----------ESHEKIVNSHGELWHPQCFVCAQCFRPFPE  51
            PG+    ++ ++C RC +               E++V + G+ WH + FVCA+C +PF  
Sbjct  187  PGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLG  246

Query  52   GIFYEFEGRKYCEHDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELAD-  110
               YE  G  YCE  +H LF   C  C + + G V  A+N  W    F C  C+ ++   
Sbjct  247  HRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQK  306

Query  111  AGFIKCQGRALCHICNAR  128
            + F +   + +C  C  R
Sbjct  307  SKFYEYDEKPVCKKCYDR  324


>Q9XYA7_DROME unnamed protein product
Length=335

 Score = 556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/333 (79%), Positives = 295/333 (89%), Gaps = 0/333 (0%)

Query  7    MSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCEHD  66
            MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE D
Sbjct  1    MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERD  60

Query  67   FHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHICN  126
            FHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH CN
Sbjct  61   FHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECN  120

Query  127  ARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPGYA  186
            A+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG A
Sbjct  121  AKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLA  180

Query  187  ANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  246
            AN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
Sbjct  181  ANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  240

Query  247  EKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTKFF  306
            EK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+KF+
Sbjct  241  EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY  300

Query  307  EFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  339
            E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  301  EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  333


 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 64/138 (46%), Gaps = 11/138 (8%)

Query  2    PGITGMSLDHMFCSRCREGF----------ESHEKIVNSHGELWHPQCFVCAQCFRPFPE  51
            PG+    ++ ++C RC +               E++V + G+ WH + FVCA+C +PF  
Sbjct  177  PGLAANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLG  236

Query  52   GIFYEFEGRKYCEHDFHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELAD-  110
               YE  G  YCE  +H LF   C  C + + G V  A+N  W    F C  C+ ++   
Sbjct  237  HRHYEKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQK  296

Query  111  AGFIKCQGRALCHICNAR  128
            + F +   + +C  C  R
Sbjct  297  SKFYEYDEKPVCKKCYDR  314



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584716.1 LIM and senescent cell antigen-like-containing domain
protein 1 isoform X3 [Cephus cinctus]

Length=336
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8INQ9_DROME  unnamed protein product                                 557     0.0  
Q8INR0_DROME  unnamed protein product                                 556     0.0  
Q9XYA7_DROME  unnamed protein product                                 555     0.0  


>Q8INQ9_DROME unnamed protein product
Length=348

 Score = 557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/333 (79%), Positives = 295/333 (89%), Gaps = 0/333 (0%)

Query  1    MSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCEHD  60
            MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE D
Sbjct  14   MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERD  73

Query  61   FHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHICN  120
            FHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH CN
Sbjct  74   FHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECN  133

Query  121  ARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPGYA  180
            A+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG A
Sbjct  134  AKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLA  193

Query  181  ANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  240
            AN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
Sbjct  194  ANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  253

Query  241  EKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTKFF  300
            EK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+KF+
Sbjct  254  EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY  313

Query  301  EFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  333
            E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  314  EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  346


>Q8INR0_DROME unnamed protein product
Length=345

 Score = 556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/333 (79%), Positives = 295/333 (89%), Gaps = 0/333 (0%)

Query  1    MSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCEHD  60
            MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE D
Sbjct  11   MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERD  70

Query  61   FHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHICN  120
            FHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH CN
Sbjct  71   FHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECN  130

Query  121  ARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPGYA  180
            A+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG A
Sbjct  131  AKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLA  190

Query  181  ANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  240
            AN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
Sbjct  191  ANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  250

Query  241  EKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTKFF  300
            EK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+KF+
Sbjct  251  EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY  310

Query  301  EFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  333
            E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  311  EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  343


>Q9XYA7_DROME unnamed protein product
Length=335

 Score = 555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/333 (79%), Positives = 295/333 (89%), Gaps = 0/333 (0%)

Query  1    MSLDHMFCSRCREGFESHEKIVNSHGELWHPQCFVCAQCFRPFPEGIFYEFEGRKYCEHD  60
            MSL  M C+RC +GFE  EKIVNS+GELWH QCFVCAQCFRPF +GIFYEFEGRKYCE D
Sbjct  1    MSLGAMHCTRCADGFEPTEKIVNSNGELWHTQCFVCAQCFRPFQDGIFYEFEGRKYCERD  60

Query  61   FHVLFAPCCGKCGEFVIGRVIKAMNANWHPGCFCCEECNGELADAGFIKCQGRALCHICN  120
            FHVLFAPCC KCGEFVIGRVIKAM+A+WHP CF C+ C  ELAD GFIK Q RALCH CN
Sbjct  61   FHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECN  120

Query  121  ARVKAGALGKHICHQCHGVIDDKPLRFRGEVYHPYHFNCTACGIELNSDAREVRSRPGYA  180
            A+VKA   G+++C +CHG+ID++PLRFRGEVYH YHF+CTACG EL+S AREV+SRPG A
Sbjct  121  AKVKAEITGRYVCQKCHGLIDEEPLRFRGEVYHGYHFSCTACGTELDSTAREVKSRPGLA  180

Query  181  ANEMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  240
            AN+MNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY
Sbjct  181  ANDMNELYCLRCHDKMGIPICGACRRPIEERVVTALGKHWHVEHFVCAKCEKPFLGHRHY  240

Query  241  EKKGLAYCETHYHQLFGNLCFVCNQVIAGDVFTALNKAWCVHHFACAFCDQKMNQKTKFF  300
            EK+GLAYCETHYHQLFGNLCFVCNQVI GDVFTALNKAWCVHHFAC+ CD KM QK+KF+
Sbjct  241  EKRGLAYCETHYHQLFGNLCFVCNQVIGGDVFTALNKAWCVHHFACSVCDTKMTQKSKFY  300

Query  301  EFDLRPACKKCYEKFPQELKKRMRRMYDLNPKK  333
            E+D +P CKKCY++FP EL++R+R  +++  KK
Sbjct  301  EYDEKPVCKKCYDRFPNELRRRLRTAHEMTMKK  333



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584717.1 renin receptor isoform X1 [Cephus cinctus]

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHG4_DROME  unnamed protein product                                 101     7e-24
Q9XTY9_CAEEL  unnamed protein product                                 68.9    1e-12


>Q9VHG4_DROME unnamed protein product
Length=320

 Score = 101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 59/86 (69%), Gaps = 3/86 (3%)

Query  342  QTTDSTNGAKQAEKSSTGKEVIRDIHQLNLSKDYDEDYPVIFNILLWFGVVFVFSLLAIC  401
            QTT+    A +A++ +         +  NL+  Y  DYPVIFNI+LWF VVF  SLLAIC
Sbjct  238  QTTEKDVAASRAKRDTIAASTT---NPYNLAVYYGSDYPVIFNIILWFMVVFGLSLLAIC  294

Query  402  IAIADMDPGRDSIIYRMTSNRMKKDN  427
             AIA MDPGRDSIIYRMTS R+KKDN
Sbjct  295  YAIAAMDPGRDSIIYRMTSTRIKKDN  320


 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/270 (22%), Positives = 120/270 (44%), Gaps = 17/270 (6%)

Query  1    MFKLILLALATLVTVQATGDLVILHSPDSVTFKGNEEVNQSLLKEICAAALGFTVKQKST  60
            M ++ ++    +  + A+G+  +L+ P +++FKGN+ +    + ++  A++G  V   + 
Sbjct  1    MLRVFVIFSLFIAAINASGEFTVLNRPKAISFKGNDALESHYVGDVLYASMGNAVSGDTN  60

Query  61   WSGISINNPFHLPEAFVGFAVEGINSLHSPRG-KRFPLNVDEVEETTWQALSGRLEERDN  119
            W+G++IN+PF+L +  +   V+GI  + +    K + L     + +     +      + 
Sbjct  61   WNGLTINDPFNLAKGVILVHVQGIGHVTTAGNVKTYELTGSGTDASLNALAAELEAANEP  120

Query  120  DNTLVRIYLGDGLDALGQSALGEL-----KPTAIDESSLKFLSLENEEDRKFLEEVQLLR  174
               +      DG+ A  +S  G+      KPT     SL      +  D++FL+EV  + 
Sbjct  121  VCDINFEQFDDGVQAW-KSCFGDFEAPAAKPTKHLNPSL------HTADKQFLQEVGFIN  173

Query  175  AIAQKVPSAIRADSIPDVYWLVVSEIRPVLDFHGEESAAAKEALTLLNDALSDVSKAFMD  234
            + A  +    +    P    ++   +  V   HGE+S A +EA  LL+ A+S +  A   
Sbjct  174  SAADHLAEMAK----PSNVLMLRVSVDGVAKAHGEKSVAVEEANKLLSAAISRLLAASQK  229

Query  235  VYENKVLIAAFTNDASQVRHTRSVILERET  264
              ++ + +     D +  R  R  I    T
Sbjct  230  SSDSVLFVQTTEKDVAASRAKRDTIAASTT  259


>Q9XTY9_CAEEL unnamed protein product
Length=324

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 90/187 (48%), Gaps = 10/187 (5%)

Query  248  DASQVRHTRSVIL-ERETRDTASNTSSGSGTKIKRSSEIKETPTDNEINTTEKPDQQDDI  306
            DA+ ++  RS ++ E E     +     +G ++  ++++        +  TE   +++ +
Sbjct  140  DATVIKTKRSTLVKELEAVYQLAAAIKSAGVQMDNNADVFRVSITGLVGITESAQKEEAV  199

Query  307  DEKKKKITNEDGTEVGATSGDNNND--NSEHANNPIEQTTDST-----NGAKQAEKSSTG  359
             + K  I     +   A  G    +    E  +   E++T+S      N  K+  KS T 
Sbjct  200  ADVKAAIEALTASINNAYGGQAVIELLAFEAESGAAEKSTESREIPNHNIQKRDTKSKTP  259

Query  360  KEVIRDIHQLNLSKDYDEDYPVIFNILLWFGVVFVFSLLAICIAIADMDPGRDSIIYRMT  419
             ++ R+   L ++     DYP IF I L   V+ V +L+ I + +A +DP +DSIIYRMT
Sbjct  260  TQLARE--NLQVTVPVSSDYPAIFAIFLGLVVILVVALIYIVVGMASIDPEKDSIIYRMT  317

Query  420  SNRMKKD  426
            + RMKKD
Sbjct  318  TTRMKKD  324



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584718.1 renin receptor isoform X2 [Cephus cinctus]

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHG4_DROME  unnamed protein product                                 147     3e-41
Q9XTY9_CAEEL  unnamed protein product                                 77.8    6e-16
VPS53_CAEEL  unnamed protein product                                  29.3    6.5  


>Q9VHG4_DROME unnamed protein product
Length=320

 Score = 147 bits (371),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 108/362 (30%), Positives = 176/362 (49%), Gaps = 43/362 (12%)

Query  1    MFKLILLALATLVTVQATGDLVILHSPDSVTFKGNEEVNQSLLKEICAAALGFTVKQKST  60
            M ++ ++    +  + A+G+  +L+ P +++FKGN+ +    + ++  A++G  V   + 
Sbjct  1    MLRVFVIFSLFIAAINASGEFTVLNRPKAISFKGNDALESHYVGDVLYASMGNAVSGDTN  60

Query  61   WSGISINNPFHLPEAFVGFAVEGINSLHSPRG-KRFPLNVDEVEETTWQALSGRLEERDN  119
            W+G++IN+PF+L +  +   V+GI  + +    K + L     + +     +      + 
Sbjct  61   WNGLTINDPFNLAKGVILVHVQGIGHVTTAGNVKTYELTGSGTDASLNALAAELEAANEP  120

Query  120  DNTLVRIYLGDGLDALGQSALGELKPTAIDESSLKFLSLENEEDRKFLEEVQLLRAIAQK  179
               +      DG+ A  +S  G+ +  A   +     SL    D++FL+EV  + + A  
Sbjct  121  VCDINFEQFDDGVQAW-KSCFGDFEAPAAKPTKHLNPSLHTA-DKQFLQEVGFINSAADH  178

Query  180  VPSAIRADSIPDVYWLVVSEIRPVLDFHGEESAAAKEALTLLNDALSDVSKAFMDVYENK  239
            +    +    P    ++   +  V   HGE+S A +EA  LL+ A+S             
Sbjct  179  LAEMAK----PSNVLMLRVSVDGVAKAHGEKSVAVEEANKLLSAAISR------------  222

Query  240  VLIAAFTNDASQVRHTRSVILERETRDTASNTSSGSGTKIKRSSEIKETPTDNEINTTEK  299
             L+AA     SQ      + ++   +D A+       ++ KR         D    +T  
Sbjct  223  -LLAA-----SQKSSDSVLFVQTTEKDVAA-------SRAKR---------DTIAASTTN  260

Query  300  PDQLNLSKDYDEDYPVIFNILLWFGVVFVFSLLAICIAIADMDPGRDSIIYRMTSNRMKK  359
            P   NL+  Y  DYPVIFNI+LWF VVF  SLLAIC AIA MDPGRDSIIYRMTS R+KK
Sbjct  261  P--YNLAVYYGSDYPVIFNIILWFMVVFGLSLLAICYAIAAMDPGRDSIIYRMTSTRIKK  318

Query  360  DN  361
            DN
Sbjct  319  DN  320


>Q9XTY9_CAEEL unnamed protein product
Length=324

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 87/361 (24%), Positives = 165/361 (46%), Gaps = 39/361 (11%)

Query  2    FKLILLALATLVTVQATGDLVILHSPDSVTF-KGNEEVNQSLLKEICAAALGFTVKQKST  60
             K +LL ++ LV   A   L I+ +P S+ F   +  +  +L+  +    LG + +Q   
Sbjct  1    MKFVLL-VSALVAACAASSLEIIAAPASLKFPDADATLKTTLISTLNENILGLSARQVDG  59

Query  61   WSGISINNPFHLPEAFVGFAVEGINSLHSPRGKRFPLNVDEVEETTWQALSGRLEERDND  120
            +S +S++  F  P A     V G ++L+   GK +    D VE   +      +   D +
Sbjct  60   FS-VSVDM-FSRPRALAVVTVIGADNLN-LGGKTYSTKSDGVENVGFDQDMALIFGADRE  116

Query  121  NTLVRIYLGDGLDALGQSALGELKPTAIDESSLKFLSLENEEDRKFLEEVQLLRAIAQKV  180
            N  V++  G G+   G       +  A+D + +K       +    ++E++ +  +A  +
Sbjct  117  N--VQVSAG-GIT--GSMLALAAQQEAVDATVIK------TKRSTLVKELEAVYQLAAAI  165

Query  181  PSA-IRADSIPDVYWLVVSEIRPVLDFHGEESAAAKEALTLLNDALSDVSKAFMDVYENK  239
             SA ++ D+  DV+ + ++ +  +      ESA  +EA+  +  A+  ++ +  + Y  +
Sbjct  166  KSAGVQMDNNADVFRVSITGLVGI-----TESAQKEEAVADVKAAIEALTASINNAYGGQ  220

Query  240  VLIAAFTNDASQVRHTRSVILERETRDTASNTSSGSGTKIKRSSEIKETPTDNEINTTEK  299
             +I     +A      +S     E+R+  ++      TK K  +++              
Sbjct  221  AVIELLAFEAESGAAEKST----ESREIPNHNIQKRDTKSKTPTQLAR------------  264

Query  300  PDQLNLSKDYDEDYPVIFNILLWFGVVFVFSLLAICIAIADMDPGRDSIIYRMTSNRMKK  359
             + L ++     DYP IF I L   V+ V +L+ I + +A +DP +DSIIYRMT+ RMKK
Sbjct  265  -ENLQVTVPVSSDYPAIFAIFLGLVVILVVALIYIVVGMASIDPEKDSIIYRMTTTRMKK  323

Query  360  D  360
            D
Sbjct  324  D  324


>VPS53_CAEEL unnamed protein product
Length=798

 Score = 29.3 bits (64),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 29/64 (45%), Gaps = 2/64 (3%)

Query  171  QLLRAIAQKVPSAIRA--DSIPDVYWLVVSEIRPVLDFHGEESAAAKEALTLLNDALSDV  228
            Q L+ + Q V S   A   SI  V W  V  +     F G   A  ++A+ L+ D LSD 
Sbjct  535  QSLQVLVQDVESTCDAALQSISKVNWTAVDCVGDESPFIGSMRAHLRQAVPLIRDMLSDR  594

Query  229  SKAF  232
             K F
Sbjct  595  RKYF  598



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584719.1 heterogeneous nuclear ribonucleoprotein L isoform X1
[Cephus cinctus]

Length=479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4K8A1_DROME  unnamed protein product                             486     5e-169
A0A0B4K7W3_DROME  unnamed protein product                             481     2e-167
A0A0B4K852_DROME  unnamed protein product                             479     1e-166


>A0A0B4K8A1_DROME unnamed protein product
Length=515

 Score = 486 bits (1251),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 257/473 (54%), Positives = 325/473 (69%), Gaps = 49/473 (10%)

Query  30   DEPRRKREDNNKPNHVLLFTIINPVYPITVEVLHTISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+ RRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  62   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  121

Query  90   DSVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D++++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T      K 
Sbjct  122  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKE  181

Query  149  DTTGNGRPAPLLAEPRYGAAPQPYGST-------------------PQVAFPPGSG---H  186
               GNGR +PLL EP YG  PQPY  +                   P  AFPP      H
Sbjct  182  --IGNGR-SPLLQEPLYGTRPQPYSKSLFSIPENVVMLESQPPLLGPGAAFPPFGAPEYH  238

Query  187  DRFEESFNGPATYAEPYAERYGLKNDFGGREPLHPTPPRPGYVPTLGQTPPSSTQGSVMM  246
                E++ G A +        GL  +  G  P    P        +  TP    QG+VMM
Sbjct  239  TTTPENWKGAAIHPT------GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMM  284

Query  247  VYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQMGDSIAVERCLQNLNNVTIG  306
            VYGL  D  NTDKLFNL CLYGNV ++KFLKTKEG AM+QMGD++AVERC+Q+LNN+ +G
Sbjct  285  VYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVG  344

Query  307  TDGKLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIV  366
            T GK+Q+ FSKQ FLS+V NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+
Sbjct  345  TGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKIL  404

Query  367  HFFNTPPDLTEETVNRVFIERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECN  426
            HFFNTPP LTE+ +  +F  + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CN
Sbjct  405  HFFNTPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCN  463

Query  427  HTALENSNGKFPYIMKLCFSSSRTIPTSFPPSSGSTSSNSAGNGHVKMQQDSE  479
            H  +E    KFP+IMKLCFSSS+++  ++        +N+A  G ++ + + +
Sbjct  464  HLPIEGKGTKFPFIMKLCFSSSKSMNGAW--------NNAASEGMIEKENEVD  508


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 481 bits (1238),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 252/454 (56%), Positives = 321/454 (71%), Gaps = 39/454 (9%)

Query  30   DEPRRKREDNNKPNHVLLFTIINPVYPITVEVLHTISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+ RRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DSVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D++++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T+       
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKE-----  181

Query  149  DTTGNGRPAPLLAEPRYGAAPQPYGSTPQVAFPPGSG---HDRFEESFNGPATYAEPYAE  205
               GNGR +PLL EP Y    +P    P  AFPP      H    E++ G A +      
Sbjct  182  --IGNGR-SPLLQEPLY----EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPT----  230

Query  206  RYGLKNDFGGREPLHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFC  265
              GL  +  G  P    P        +  TP    QG+VMMVYGL  D  NTDKLFNL C
Sbjct  231  --GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  280

Query  266  LYGNVTKVKFLKTKEGCAMIQMGDSIAVERCLQNLNNVTIGTDGKLQLGFSKQAFLSDVT  325
            LYGNV ++KFLKTKEG AM+QMGD++AVERC+Q+LNN+ +GT GK+Q+ FSKQ FLS+V 
Sbjct  281  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  340

Query  326  NPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVNRVFI  385
            NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F 
Sbjct  341  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  400

Query  386  ERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCF  445
             + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCF
Sbjct  401  IKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  459

Query  446  SSSRTIPTSFPPSSGSTSSNSAGNGHVKMQQDSE  479
            SSS+++  ++        +N+A  G ++ + + +
Sbjct  460  SSSKSMNGAW--------NNAASEGMIEKENEVD  485


>A0A0B4K852_DROME unnamed protein product
Length=497

 Score = 479 bits (1234),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 253/454 (56%), Positives = 321/454 (71%), Gaps = 34/454 (7%)

Query  30   DEPRRKREDNNKPNHVLLFTIINPVYPITVEVLHTISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+ RRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DSVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTLGSSAHKN  148
            D++++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T      K 
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPIKE  186

Query  149  DTTGNGRPAPLLAEPRYGAAPQPYGSTPQVAFPPGSG---HDRFEESFNGPATYAEPYAE  205
               GNGR +PLL EP Y    +P    P  AFPP      H    E++ G A +      
Sbjct  187  --IGNGR-SPLLQEPLY----EPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPT----  235

Query  206  RYGLKNDFGGREPLHPTPPRPGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFC  265
              GL  +  G  P    P        +  TP    QG+VMMVYGL  D  NTDKLFNL C
Sbjct  236  --GLMKEPAGVVPGRNAP--------VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVC  285

Query  266  LYGNVTKVKFLKTKEGCAMIQMGDSIAVERCLQNLNNVTIGTDGKLQLGFSKQAFLSDVT  325
            LYGNV ++KFLKTKEG AM+QMGD++AVERC+Q+LNN+ +GT GK+Q+ FSKQ FLS+V 
Sbjct  286  LYGNVARIKFLKTKEGTAMVQMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVI  345

Query  326  NPYILPDKTASFKDFTGSKNNRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVNRVFI  385
            NP++LPD + SFK++TGSKNNRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F 
Sbjct  346  NPFLLPDHSPSFKEYTGSKNNRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFN  405

Query  386  ERGIEAPTTVKLFPLKSERSSSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCF  445
             + + A T+V+LFPLK+ERSSSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCF
Sbjct  406  IKDVPA-TSVRLFPLKTERSSSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCF  464

Query  446  SSSRTIPTSFPPSSGSTSSNSAGNGHVKMQQDSE  479
            SSS+++  ++        +N+A  G ++ + + +
Sbjct  465  SSSKSMNGAW--------NNAASEGMIEKENEVD  490



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584720.1 heterogeneous nuclear ribonucleoprotein L isoform X2
[Cephus cinctus]

Length=448
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JMZ7_DROME  unnamed protein product                                 473     5e-165
Q6NND8_DROME  unnamed protein product                                 471     6e-164
A0A0B4K7W3_DROME  unnamed protein product                             468     1e-162


>Q7JMZ7_DROME unnamed protein product
Length=475

 Score = 473 bits (1218),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 243/427 (57%), Positives = 309/427 (72%), Gaps = 33/427 (8%)

Query  30   DEPRRKREDNNKPNHVLLFTIINPVYPITVEVLHTISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+ RRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DSVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTT----PTLGST  144
            D++++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT     P LG  
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTEPPLLG--  184

Query  145  PQVAFPPGSG---HDRFEESFNGPATYAEPYAERYGLKNDFGGREPLHPTPPRPGYVPTL  201
            P  AFPP      H    E++ G A +        GL  +  G  P    P        +
Sbjct  185  PGAAFPPFGAPEYHTTTPENWKGAAIHPT------GLMKEPAGVVPGRNAP--------V  230

Query  202  GQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQMGDSIA  261
              TP    QG+VMMVYGL  D  NTDKLFNL CLYGNV ++KFLKTKEG AM+QMGD++A
Sbjct  231  AFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQMGDAVA  290

Query  262  VERCLQNLNNVTIGTDGKLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNRFLNPA  321
            VERC+Q+LNN+ +GT GK+Q+ FSKQ FLS+V NP++LPD + SFK++TGSKNNRFL+PA
Sbjct  291  VERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNRFLSPA  350

Query  322  MANKNRIQPPSKIVHFFNTPPDLTEETVNRVFIERGIEAPTTVKLFPLKSERSSSGLIEF  381
             A+KNRIQPPSKI+HFFNTPP LTE+ +  +F  + + A T+V+LFPLK+ERSSSGLIEF
Sbjct  351  QASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSSGLIEF  409

Query  382  SSVGIAVAAIMECNHTALENSNGKFPYIMKLCFSSSRTIPTSFPPSSGSTSSNSAGNGHV  441
            S++  AV AIM+CNH  +E    KFP+IMKLCFSSS+++  ++        +N+A  G +
Sbjct  410  SNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAW--------NNAASEGMI  461

Query  442  KMQQDSE  448
            + + + +
Sbjct  462  EKENEVD  468


>Q6NND8_DROME unnamed protein product
Length=480

 Score = 471 bits (1211),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 243/432 (56%), Positives = 309/432 (72%), Gaps = 38/432 (9%)

Query  30   DEPRRKREDNNKPNHVLLFTIINPVYPITVEVLHTISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+ RRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DSVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTT---------P  139
            D++++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT          P
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTGEILPKPP  186

Query  140  TLGSTPQVAFPPGSG---HDRFEESFNGPATYAEPYAERYGLKNDFGGREPLHPTPPRPG  196
             LG  P  AFPP      H    E++ G A +        GL  +  G  P    P    
Sbjct  187  LLG--PGAAFPPFGAPEYHTTTPENWKGAAIHPT------GLMKEPAGVVPGRNAP----  234

Query  197  YVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMIQM  256
                +  TP    QG+VMMVYGL  D  NTDKLFNL CLYGNV ++KFLKTKEG AM+QM
Sbjct  235  ----VAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMVQM  290

Query  257  GDSIAVERCLQNLNNVTIGTDGKLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKNNR  316
            GD++AVERC+Q+LNN+ +GT GK+Q+ FSKQ FLS+V NP++LPD + SFK++TGSKNNR
Sbjct  291  GDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKNNR  350

Query  317  FLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVNRVFIERGIEAPTTVKLFPLKSERSSS  376
            FL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F  + + A T+V+LFPLK+ERSSS
Sbjct  351  FLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERSSS  409

Query  377  GLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCFSSSRTIPTSFPPSSGSTSSNSA  436
            GLIEFS++  AV AIM+CNH  +E    KFP+IMKLCFSSS+++  ++        +N+A
Sbjct  410  GLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAW--------NNAA  461

Query  437  GNGHVKMQQDSE  448
              G ++ + + +
Sbjct  462  SEGMIEKENEVD  473


>A0A0B4K7W3_DROME unnamed protein product
Length=492

 Score = 468 bits (1203),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 240/434 (55%), Positives = 310/434 (71%), Gaps = 30/434 (7%)

Query  30   DEPRRKREDNNKPNHVLLFTIINPVYPITVEVLHTISAPSGQVQRIVIFKKNGVQAMVEF  89
            D+ RRKR +  +PNH+LLFTIINP YPITV+VLH I  P GQV RIVIFKKNGVQAMVEF
Sbjct  67   DDLRRKRPETTRPNHILLFTIINPFYPITVDVLHKICHPHGQVLRIVIFKKNGVQAMVEF  126

Query  90   DSVESATRAKETLHGADIYSGCCTLKIDFAKPTKLNVYKNDAE-SWDYTTPTL-----GS  143
            D++++ATRA+E L+GADIY+GCCTLKID+AKP KLNVYKN+ + SWDYT  T+     G 
Sbjct  127  DNLDAATRARENLNGADIYAGCCTLKIDYAKPEKLNVYKNEPDTSWDYTLSTVKEIGNGR  186

Query  144  TPQVAFPPGSGHDRFEESFNGPATYAEPYA--ERYGLKNDFGGREPLHPTPPR-------  194
            +P +  P       +E    GP     P+   E +    +      +HPT          
Sbjct  187  SPLLQEP------LYEPPLLGPGAAFPPFGAPEYHTTTPENWKGAAIHPTGLMKEPAGVV  240

Query  195  PGYVPTLGQTPPSSTQGSVMMVYGLQPDKVNTDKLFNLFCLYGNVTKVKFLKTKEGCAMI  254
            PG    +  TP    QG+VMMVYGL  D  NTDKLFNL CLYGNV ++KFLKTKEG AM+
Sbjct  241  PGRNAPVAFTPQGQAQGAVMMVYGLDHDTSNTDKLFNLVCLYGNVARIKFLKTKEGTAMV  300

Query  255  QMGDSIAVERCLQNLNNVTIGTDGKLQLGFSKQAFLSDVTNPYILPDKTASFKDFTGSKN  314
            QMGD++AVERC+Q+LNN+ +GT GK+Q+ FSKQ FLS+V NP++LPD + SFK++TGSKN
Sbjct  301  QMGDAVAVERCVQHLNNIPVGTGGKIQIAFSKQNFLSEVINPFLLPDHSPSFKEYTGSKN  360

Query  315  NRFLNPAMANKNRIQPPSKIVHFFNTPPDLTEETVNRVFIERGIEAPTTVKLFPLKSERS  374
            NRFL+PA A+KNRIQPPSKI+HFFNTPP LTE+ +  +F  + + A T+V+LFPLK+ERS
Sbjct  361  NRFLSPAQASKNRIQPPSKILHFFNTPPGLTEDQLIGIFNIKDVPA-TSVRLFPLKTERS  419

Query  375  SSGLIEFSSVGIAVAAIMECNHTALENSNGKFPYIMKLCFSSSRTIPTSFPPSSGSTSSN  434
            SSGLIEFS++  AV AIM+CNH  +E    KFP+IMKLCFSSS+++  ++        +N
Sbjct  420  SSGLIEFSNISQAVLAIMKCNHLPIEGKGTKFPFIMKLCFSSSKSMNGAW--------NN  471

Query  435  SAGNGHVKMQQDSE  448
            +A  G ++ + + +
Sbjct  472  AASEGMIEKENEVD  485



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584721.1 protein stum [Cephus cinctus]

Length=1025
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STUM_DROME  unnamed protein product                                   168     4e-42


>STUM_DROME unnamed protein product
Length=1870

 Score = 168 bits (426),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 95/156 (61%), Gaps = 10/156 (6%)

Query  836   CGALWRRLFA-RCKSSRPDVERTRSIRAKQSLTSVAAPPVSEEPKVKIPEVLVEHNSLMR  894
             C   W  L   R +  R    R +SIRA         PP SE+ + K+   LVE++S M+
Sbjct  1694  CKRFWLMLLCCRKRKRRESNARRQSIRA---------PPPSEDTRKKLHVDLVEYSSKMK  1744

Query  895   GAIPCLPVTLAWFCLVWNVLLPGSGTLWSGLFNLYVGQPRFSAVAGPKARFGAFIVNLVV  954
             GAIP LP+ LAWFC   NV+ PG GTL SGLF L VG PRFS     +AR G+FI+N++V
Sbjct  1745  GAIPVLPLYLAWFCAFCNVVFPGLGTLLSGLFCLCVGIPRFSQFDSARARIGSFIINIIV  1804

Query  955   GAGQLFTVLFCLVGWGWSIWWGVTMVRLARKYKRFR  990
                Q F VLFC VGWGWSIWWG  M+R A+K  + +
Sbjct  1805  AVSQFFCVLFCFVGWGWSIWWGTIMLRCAKKLSKIK  1840



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584722.1 uncharacterized protein LOC107262717 isoform X5
[Cephus cinctus]

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATPB_DICDI  unnamed protein product                                   34.3    0.20 
NU214_CAEEL  unnamed protein product                                  32.0    1.1  
NSF2_DROME  unnamed protein product                                   30.0    4.2  


>ATPB_DICDI unnamed protein product
Length=651

 Score = 34.3 bits (77),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 34/126 (27%), Positives = 57/126 (45%), Gaps = 20/126 (16%)

Query  217  LLTNMERNADFPFITYYLINKQSTDPVDFYHE-VQCAALRKFDPRDLRYAASHTLDLFNE  275
            L+ N+ + A   F  +  + +++ +  D YHE V+   ++K  P              ++
Sbjct  269  LINNIAK-AHGGFSVFTGVGERTREGNDLYHEMVEAGVIKKEGPG-------------SK  314

Query  276  VATIARPPLEPPGGRPPIPSTGYIVS-IFKVFEGDDGLKFEQNWLYWT--GARM--IYRY  330
            VA +     EPPG R  +  TG  V+  F+  EG D L F  N   +T  G+ M  +   
Sbjct  315  VALVFGQMNEPPGARARVTLTGLTVAEYFRDAEGQDVLLFIDNIFRFTQAGSEMSALLGR  374

Query  331  LPKSVG  336
            +P +VG
Sbjct  375  IPSAVG  380


>NU214_CAEEL unnamed protein product
Length=1390

 Score = 32.0 bits (71),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 0/50 (0%)

Query  56    WGGGTAGGSASINKRKQNGNQPKEPSEPPTPTASRQVSFSGNRTSGTYTP  105
             +GGG+   S+      Q G QP + S P T TAS   SF+   TS +  P
Sbjct  1111  FGGGSKAASSPFGSFGQAGCQPAKTSNPATSTASVTFSFNTGATSASAKP  1160


>NSF2_DROME unnamed protein product
Length=752

 Score = 30.0 bits (66),  Expect = 4.2, Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 14/85 (16%)

Query  181  PLDPLVESPLSRPLVLQRDTAAE------LVAEIAPSASQSILLTNMERNADFPFITYYL  234
            P+  L+E  +   L +Q+  A E      ++ E AP++ +S L  N+ + +DFPF+    
Sbjct  518  PVTELLEDGM---LSVQQAKATESSGLVSVLIEGAPNSGKSALAANLAQLSDFPFVKVC-  573

Query  235  INKQSTDPVDFYHEVQCAALRK-FD  258
                  D V F    +C  +RK FD
Sbjct  574  ---SPEDMVGFTESAKCLHIRKIFD  595



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584724.1 uncharacterized protein LOC107262737 isoform X1
[Cephus cinctus]

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTN1_CAEEL  unnamed protein product                                   40.0    0.006
TALB_DICDI  unnamed protein product                                   36.2    0.087
SOS_DROME  unnamed protein product                                    35.0    0.21 


>TTN1_CAEEL unnamed protein product
Length=18562

 Score = 40.0 bits (92),  Expect = 0.006, Method: Composition-based stats.
 Identities = 56/238 (24%), Positives = 92/238 (39%), Gaps = 49/238 (21%)

Query  190   QKVDRAHQSVVIHILCVVV----SVVVLAIQTMSFQRFESQRINGRKLPWAMWLKKHRDQ  245
             +K+ +     V H+L  V+    S++ + +     Q  E      +    ++W       
Sbjct  2234  EKMTKKGADTVTHVLNSVLQHVASIINVILVAQDHQPIEVHAETTKTAEVSVWYSFDVHP  2293

Query  246   ELEDL----EEKKPLQSSSATP---------IPKEDAIETEQIAVEI-DIVALPEAPQSK  291
             E ED+    +E+   +  S+TP            +D+  T ++ V   D +  P AP  K
Sbjct  2294  ESEDIIGIVDEEPTNRRPSSTPRGSTRSSNLTTSQDSQATTKMTVSSEDTIEAPIAPPRK  2353

Query  292   EVRKLSDQSLPDLKRQISQTPPLPPRNAH-----LMPPPTPLRGVTSVTPLPVPEMPAPP  346
               R LS     D +R +   P  PPR +      L P PTP+     +T +   E PAP 
Sbjct  2354  G-RSLSR----DAERLLEIQPRAPPRRSRQSGDTLSPEPTPV-----LTLVKSDETPAPV  2403

Query  347   RPDSIAWNLDAEEPESANPGFVTRSVSIAESTHRTHSLRLPQ--RKYSTKGLEEDDPV  402
             RP         +E              +AE++     +R P+   ++S   LEE  PV
Sbjct  2404  RPPRSRSRHSGDE--------------LAETSPEAQPIRPPRSHSRHSGDELEEVQPV  2447


 Score = 33.9 bits (76),  Expect = 0.42, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 51/136 (38%), Gaps = 29/136 (21%)

Query  251   EEKKPLQSSSATP----IPKEDA-IETEQIAVEIDIVALPEAPQSKEVRKLSDQSLPDL-  304
             EE+ P  +  + P    +PK  A +E  QI  E+  VA P  P   +V K +  S P   
Sbjct  3360  EEEVPKVAEPSEPTQADVPKIAAPLEQSQIQQEVPTVAAPSEPTQADVPKEAAPSEPSQA  3419

Query  305   ----------KRQISQ-----TPPLPPRNAHLMPPPTPLRGVTSVTPLPVPEMPAPPRPD  349
                       + QI Q       PL P  A +     PL    S     VP + AP  P 
Sbjct  3420  DVPKVAAPLEQTQIQQEVPMVAAPLEPTQADVPKVAAPLE--QSQIQQEVPTVAAPSEPT  3477

Query  350   SIAWNLDAEEPESANP  365
                    A+ P+ A P
Sbjct  3478  Q------ADVPKEAAP  3487


 Score = 30.0 bits (66),  Expect = 7.2, Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 52/148 (35%), Gaps = 23/148 (16%)

Query  255   PLQSSSATPIPKEDA-IETEQIAVEIDIVALPEAPQSKEVRKLSDQSLPDLKRQISQTPP  313
             PL+ + A  +PK  A +E  QI  E+  VA P  P   +V K              +  P
Sbjct  3443  PLEPTQAD-VPKVAAPLEQSQIQQEVPTVAAPSEPTQADVPK--------------EAAP  3487

Query  314   LPPRNAHLMPPPTPLRGVTSVTPLPVPEMPAPPRPDSIAWNLDAEEPESANPGFVTRSVS  373
               P  A +     PL        +P+   P  P  + +       EP   +   V +  +
Sbjct  3488  SEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPIQEEVPKEAAPSEPTQED---VPKGAA  3544

Query  374   IAESTHRTHSLRLPQRKYSTKGLEEDDP  401
               E T       +P+    +   +ED P
Sbjct  3545  PLEPTQED----VPKEAAPSGPTQEDVP  3568


>TALB_DICDI unnamed protein product
Length=2614

 Score = 36.2 bits (82),  Expect = 0.087, Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 48/121 (40%), Gaps = 23/121 (19%)

Query  236   AMWLKKHRDQELEDLEEKKPLQSS---------------SATPIPKEDAIETEQIAVEID  280
             A  + K  DQ+++ L+ KK L+ +               +  P P +D+      ++ + 
Sbjct  2422  AQIISKEMDQQIQILKLKKELEQAEKKLFSIRKKEYSDQTGNPSPAKDSDNKPTTSISVG  2481

Query  281   IVALPEAPQSKEVRKLSDQSLPDLKRQISQTPPLPPRNAHLMPPPTPLRGVTS-VTPLPV  339
             I      P  +  +           +Q + TP LPPR   LM  P P +  +S V P+  
Sbjct  2482  IT-----PTKRTTQASPPSPPLTPTQQAAGTPTLPPRP--LMKKPAPSQAPSSPVAPVSA  2534

Query  340   P  340
             P
Sbjct  2535  P  2535


>SOS_DROME unnamed protein product
Length=1596

 Score = 35.0 bits (79),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query  294   RKLSDQSLPDL--KRQISQTPPLPPRNAHLMPPPTPLR  329
             RK   +S  D+  KRQ    P LPPR+  L PPP P R
Sbjct  1350  RKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPR  1387



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584725.1 uncharacterized protein LOC107262737 isoform X2
[Cephus cinctus]

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTN1_CAEEL  unnamed protein product                                   39.3    0.009
TALB_DICDI  unnamed protein product                                   36.2    0.086
SOS_DROME  unnamed protein product                                    35.0    0.21 


>TTN1_CAEEL unnamed protein product
Length=18562

 Score = 39.3 bits (90),  Expect = 0.009, Method: Composition-based stats.
 Identities = 59/258 (23%), Positives = 98/258 (38%), Gaps = 49/258 (19%)

Query  169   LQAWFQAAPQAIFQTHLLFRVQKVDRAHQSVIHILCVVV----SVVVLAIQTMSFQRFES  224
             +Q  F    + I     L + +   +   +V H+L  V+    S++ + +     Q  E 
Sbjct  2214  IQELFVKIEKEINTIAELCKEKMTKKGADTVTHVLNSVLQHVASIINVILVAQDHQPIEV  2273

Query  225   QRINGRKLPWAMWLKKHRDQELEDL----EEKKPLQSSSATP---------IPKEDAIET  271
                  +    ++W       E ED+    +E+   +  S+TP            +D+  T
Sbjct  2274  HAETTKTAEVSVWYSFDVHPESEDIIGIVDEEPTNRRPSSTPRGSTRSSNLTTSQDSQAT  2333

Query  272   EQIAVEI-DIVALPEAPQSKEVRKLSDQSLPDLKRQISQTPPLPPRNAH-----LMPPPT  325
              ++ V   D +  P AP  K  R LS     D +R +   P  PPR +      L P PT
Sbjct  2334  TKMTVSSEDTIEAPIAPPRKG-RSLSR----DAERLLEIQPRAPPRRSRQSGDTLSPEPT  2388

Query  326   PLRGVTSVTPLPVPEMPAPPRPDSIAWNLDAEEPESANPGFVTRSVSIAESTHRTHSLRL  385
             P+     +T +   E PAP RP         +E              +AE++     +R 
Sbjct  2389  PV-----LTLVKSDETPAPVRPPRSRSRHSGDE--------------LAETSPEAQPIRP  2429

Query  386   PQ--RKYSTKGLEEDDPV  401
             P+   ++S   LEE  PV
Sbjct  2430  PRSHSRHSGDELEEVQPV  2447


 Score = 34.3 bits (77),  Expect = 0.41, Method: Composition-based stats.
 Identities = 38/136 (28%), Positives = 51/136 (38%), Gaps = 29/136 (21%)

Query  250   EEKKPLQSSSATP----IPKEDA-IETEQIAVEIDIVALPEAPQSKEVRKLSDQSLPDL-  303
             EE+ P  +  + P    +PK  A +E  QI  E+  VA P  P   +V K +  S P   
Sbjct  3360  EEEVPKVAEPSEPTQADVPKIAAPLEQSQIQQEVPTVAAPSEPTQADVPKEAAPSEPSQA  3419

Query  304   ----------KRQISQ-----TPPLPPRNAHLMPPPTPLRGVTSVTPLPVPEMPAPPRPD  348
                       + QI Q       PL P  A +     PL    S     VP + AP  P 
Sbjct  3420  DVPKVAAPLEQTQIQQEVPMVAAPLEPTQADVPKVAAPLE--QSQIQQEVPTVAAPSEPT  3477

Query  349   SIAWNLDAEEPESANP  364
                    A+ P+ A P
Sbjct  3478  Q------ADVPKEAAP  3487


 Score = 30.0 bits (66),  Expect = 7.1, Method: Composition-based stats.
 Identities = 33/148 (22%), Positives = 52/148 (35%), Gaps = 23/148 (16%)

Query  254   PLQSSSATPIPKEDA-IETEQIAVEIDIVALPEAPQSKEVRKLSDQSLPDLKRQISQTPP  312
             PL+ + A  +PK  A +E  QI  E+  VA P  P   +V K              +  P
Sbjct  3443  PLEPTQAD-VPKVAAPLEQSQIQQEVPTVAAPSEPTQADVPK--------------EAAP  3487

Query  313   LPPRNAHLMPPPTPLRGVTSVTPLPVPEMPAPPRPDSIAWNLDAEEPESANPGFVTRSVS  372
               P  A +     PL        +P+   P  P  + +       EP   +   V +  +
Sbjct  3488  SEPSQADVPKVAAPLEQTQIQQEVPMVAAPLEPIQEEVPKEAAPSEPTQED---VPKGAA  3544

Query  373   IAESTHRTHSLRLPQRKYSTKGLEEDDP  400
               E T       +P+    +   +ED P
Sbjct  3545  PLEPTQED----VPKEAAPSGPTQEDVP  3568


>TALB_DICDI unnamed protein product
Length=2614

 Score = 36.2 bits (82),  Expect = 0.086, Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 48/121 (40%), Gaps = 23/121 (19%)

Query  235   AMWLKKHRDQELEDLEEKKPLQSS---------------SATPIPKEDAIETEQIAVEID  279
             A  + K  DQ+++ L+ KK L+ +               +  P P +D+      ++ + 
Sbjct  2422  AQIISKEMDQQIQILKLKKELEQAEKKLFSIRKKEYSDQTGNPSPAKDSDNKPTTSISVG  2481

Query  280   IVALPEAPQSKEVRKLSDQSLPDLKRQISQTPPLPPRNAHLMPPPTPLRGVTS-VTPLPV  338
             I      P  +  +           +Q + TP LPPR   LM  P P +  +S V P+  
Sbjct  2482  IT-----PTKRTTQASPPSPPLTPTQQAAGTPTLPPRP--LMKKPAPSQAPSSPVAPVSA  2534

Query  339   P  339
             P
Sbjct  2535  P  2535


>SOS_DROME unnamed protein product
Length=1596

 Score = 35.0 bits (79),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query  293   RKLSDQSLPDL--KRQISQTPPLPPRNAHLMPPPTPLR  328
             RK   +S  D+  KRQ    P LPPR+  L PPP P R
Sbjct  1350  RKERTESCADMAQKRQAPDAPTLPPRDGELSPPPIPPR  1387



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584726.1 cell division control protein 6 homolog [Cephus
cinctus]

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSM9_DROME  unnamed protein product                                 451     6e-152
P91155_CAEEL  unnamed protein product                                 152     9e-40 
ORC1_DROME  unnamed protein product                                   150     5e-38 


>Q9VSM9_DROME unnamed protein product
Length=662

 Score = 451 bits (1159),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 218/414 (53%), Positives = 293/414 (71%), Gaps = 13/414 (3%)

Query  148  KYQNARKALHSSTPENLPGREAELAQLYDFMYVHMKNKTSGSLYVSGPPGTGKTACLSKT  207
            KYQNAR+ L+S+  +NLPGRE++L +L +F   H++++TSGSLYVSG PGTGKTACLS  
Sbjct  251  KYQNARRVLNSAETQNLPGRESQLQELREFFSNHLESQTSGSLYVSGQPGTGKTACLSLL  310

Query  208  MLHPEFKSSFKIIYVNCTTMKSATTIYAKIVQELGLGITKSVQASK-AAIEKYLISNHKM  266
            +  P+F    + +Y+NCT++ S   +Y K+  EL L ++   +     AI+++L +  +M
Sbjct  311  LRDPDFSKRLQRVYINCTSIASVGAVYKKLCTELQLKVSGRTERDHLEAIQRHLKTAKRM  370

Query  267  ILLILDEIDQLDCKKQSVLYSIFEWPSKPNSKLILVGIANALDLTDRILPRLQARCELKP  326
            +LL+LDEIDQL   +Q VLY+IFEWP+ P S+++LVGIAN+LDLTDR L RL ARCELKP
Sbjct  371  LLLVLDEIDQLCTSRQEVLYTIFEWPALPGSRILLVGIANSLDLTDRALMRLNARCELKP  430

Query  327  KLMHFAPYSKQEIVNIITDRLKQADVSDVFTTMAMQMLAGKVAAVSGDVRRALDISRRVV  386
            +LMHF PYSKQ+IV I   RL +A+V DVF  + +Q+LA KV+A+SGDVRRALDI RRVV
Sbjct  431  RLMHFPPYSKQQIVEIFKSRLAEAEVLDVFPPVTLQLLAAKVSAISGDVRRALDIGRRVV  490

Query  387  ELAESQN-------TAQVLQPTNHNEKNTGSPKKQNVHVEKPVDFKEVVTVLNGVYGGSQ  439
            E+AE Q          + LQ     E       K+     KPV   +V  VLN VYG SQ
Sbjct  491  EIAEQQKRDGEKEFNMKALQ----LEGKDAVEAKEKQDTLKPVQVTQVAAVLNKVYGASQ  546

Query  440  NINKD-ENTFPLQQKFLLCSLMLILNKGKNKVVTIGKLQEVYKKVCRKRNIHAVDISEFV  498
            N+ +D E +FPLQQK +LC+L+L+L   +NK +++G+L EVY++VC KRNI A+D +EF 
Sbjct  547  NLEEDIEASFPLQQKLMLCTLVLMLRNERNKDISMGRLHEVYRRVCAKRNILALDQAEFT  606

Query  499  GLCSLVETRGIIRVSGKKEPRLSKVHLQWDQDELGAALQDKHLMAEIINDVTCL  552
            G   LVETRGI+R+  KKEPRL KV LQWD++E+ AAL DK L+A I++D  CL
Sbjct  607  GTVDLVETRGILRIMRKKEPRLHKVLLQWDEEEVHAALSDKQLIASILSDTACL  660


>P91155_CAEEL unnamed protein product
Length=518

 Score = 152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 113/383 (30%), Positives = 189/383 (49%), Gaps = 42/383 (11%)

Query  164  LPGREAELAQLYDFMYVHMKNKTSGSLYVSGPPGTGKTACLSKTMLHPEFKSSFKIIYVN  223
            L GR  E   L  ++    +  TS S+YVSG PGTGKTA   + +       S +   VN
Sbjct  172  LKGRREEFDSLKLWIMKSKETNTSLSIYVSGQPGTGKTATTMRVL--KSLGKSVRSCIVN  229

Query  224  CTTMKSATTIYAKIVQELGLGITKSVQASKAAIEKYLISNHKMILLILDEIDQLDCKKQS  283
            C +  + + ++  I + L L      + ++   EK++      ++L+LDEID L  +K +
Sbjct  230  CASTNTKSALFKTIFESLDL----DGKPNEEIFEKHVKQFKTPLVLVLDEIDHLANRKNA  285

Query  284  VLYSIFEWPSKPNSKLILVGIANALDLTDRILPRLQARCELKPKLMHFAPYSKQEIVNII  343
             LY+ F+WP   + K+I++GIAN++DLT+R+LP+L       PK + F PY+K +IV I+
Sbjct  286  ALYAAFQWPETLSRKIIILGIANSIDLTERLLPKLM--LAKPPKRLVFEPYTKDDIVEIL  343

Query  344  TDRLKQADVSDVFTTMAMQMLAGKVAAVSGDVRRALDISRRVVELAESQNTAQVLQPTNH  403
             D++K  + S      A+++ A KVAA+SGD+R AL I +        Q  ++++     
Sbjct  344  NDKMKNEETS--IDAKAIELTARKVAAMSGDLRTALHIFK--------QQKSRMIP---D  390

Query  404  NEKNTGSPKKQNVHVEKPVDFKEVVTVLNGVYGGSQNINKDENTFPLQQKFLLCSLMLIL  463
            + K  G+P             +EV+ ++N VY       +     PLQ + LL ++ L L
Sbjct  391  DSKVPGTPVN---------GCREVLGIINNVYSSPLARAR----LPLQPRILL-AVSLTL  436

Query  464  NKGKNKVVTIGKLQEVYKKVCRKRNIHAVDISEFVGLCSLVETRGIIR-VSGKKEPRLSK  522
            +  K        L   Y K C    + A+D  E       +E++  +R ++G       K
Sbjct  437  SANKKCTFDRNSLLRAYYKACEALRMPALDDDELHSAFQTLESQSFVRQLNG------GK  490

Query  523  VHLQWDQDELGAALQDKHLMAEI  545
            + LQ D     +A+ D  ++ +I
Sbjct  491  LVLQVDAPTAKSAISDNAMLDQI  513


>ORC1_DROME unnamed protein product
Length=924

 Score = 150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 153/263 (58%), Gaps = 17/263 (6%)

Query  140  PKRLFASEKYQNARKALHSST-PENLPGREAELAQLYDFMYVHMKNKTSGSLYVSGPPGT  198
            P +  +  + Q AR+ LH S  P++LP RE E   +Y F+   ++++  G +YVSG PGT
Sbjct  543  PAKDSSKSELQLAREQLHVSVVPKSLPCREREFENIYAFLEGKIQDQCGGCMYVSGVPGT  602

Query  199  GKTACLS------KTMLHPEFKSSFKIIYVNCTTMKSATTIYAKIVQELGLGITKSVQAS  252
            GKTA ++      + M       +F+ + +N   +      Y +I ++L  G T S + +
Sbjct  603  GKTATVTGVIRTLQRMAKQNELPAFEYLEINGMRLTEPRQAYVQIYKQL-TGKTVSWEQA  661

Query  253  KAAIEKYLIS---NHKMILLILDEIDQLDCKKQSVLYSIFEWPSKPNSKLILVGIANALD  309
             A +EK   +        +L++DE+D L  ++Q V+Y++ +WP+K  +KL++V IAN +D
Sbjct  662  HALLEKRFTTPAPRRVTTVLLVDELDILCNRRQDVVYNLLDWPTKSAAKLVVVTIANTMD  721

Query  310  LTDRIL-PRLQARCELKPKLMHFAPYSKQEIVNIITDRLKQADVSDVFTTMAMQMLAGKV  368
            L +R+L  ++ +R  L    + F PYS +++  I+T RL     S+ F   A+Q++A KV
Sbjct  722  LPERLLMGKVTSRLGL--TRLTFQPYSHKQLQEIVTARLGG---SETFKGEAVQLVARKV  776

Query  369  AAVSGDVRRALDISRRVVELAES  391
            AAVSGD RRALDI RR  E+A++
Sbjct  777  AAVSGDARRALDICRRATEIADT  799



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


Query= XP_015584727.1 ATPase WRNIP1 isoform X2 [Cephus cinctus]

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RFC2_DROME  unnamed protein product                                   52.8    2e-07
Q383X4_TRYB2  unnamed protein product                                 49.7    2e-06
Q38DH5_TRYB2  unnamed protein product                                 49.3    4e-06


>RFC2_DROME unnamed protein product
Length=331

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 81/176 (46%), Gaps = 9/176 (5%)

Query  58   KSSYIPLAEKMRPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTTLAII  117
            K S++P  EK RP+   + VG +   D    L     +   P++I+ GPPG GKTT    
Sbjct  12   KRSHLPWIEKYRPVKFKEIVGNE---DTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQC  68

Query  118  IAGLNNQEGESKATRFVKLSATSS-GIGDIKEAVN---EAKNEVKFGRQTIIFMDEIHRF  173
            +A +    G+S     ++L+A++  GI  ++  +    + K  +  GR  I+ +DE    
Sbjct  69   LARI--LLGDSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVILDEADSM  126

Query  174  NKLQQDIFLPHVEAGTITLIGATTENPSFSLNSALLSRCRVFVLEKLASTELISIL  229
             +  Q      +E  + T   A   N S  +   + SRC +    KL+  ++++ L
Sbjct  127  TEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKL  182


>Q383X4_TRYB2 unnamed protein product
Length=341

 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/193 (25%), Positives = 79/193 (41%), Gaps = 24/193 (12%)

Query  62   IPLAEKMRPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTTLAIIIAG-  120
            +P  EK RP+S+   VG     D    L  +  +  +P+++L GPPG GKTT  + +A  
Sbjct  6    VPWVEKYRPMSMEDIVGNA---DAVARLQVIAREGNLPNLLLCGPPGTGKTTSMLCLARS  62

Query  121  -LNNQEGESKATRFVK-----LSATSS-GIGDIKEAVN-------------EAKNEVKFG  160
             L++ +G       +K     L+A+   G+  ++E +                 N  K  
Sbjct  63   LLSDPDGGGSNNNALKDAVLELNASDDRGLDVVREKIKLFAQTKKTLPQRVGDSNNRKIN  122

Query  161  RQTIIFMDEIHRFNKLQQDIFLPHVEAGTITLIGATTENPSFSLNSALLSRCRVFVLEKL  220
               I+ +DE        Q      +E  + T   A   N S  +   + SRC V    KL
Sbjct  123  LHKIVILDEADSMTPAAQQALRRTIELHSSTTRFAFACNNSHKIIEPIQSRCAVVRFRKL  182

Query  221  ASTELISILQKAI  233
            + T+++  L   I
Sbjct  183  SHTDILRRLMYII  195


>Q38DH5_TRYB2 unnamed protein product
Length=357

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query  58   KSSYIPLAEKMRPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTT  113
            K+S +P  EK RP +L   V  + ILD      +L+    +P ++ +GPPG GKTT
Sbjct  14   KNSTLPWVEKYRPTTLDDVVAHEEILD---TTRRLMNSGSMPHLLFYGPPGTGKTT  66



Lambda      K        H
   0.304    0.122    0.334 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9597638088


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584728.1 ATPase WRNIP1 isoform X3 [Cephus cinctus]

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RFC2_DROME  unnamed protein product                                   52.8    2e-07
Q383X4_TRYB2  unnamed protein product                                 50.1    2e-06
Q38DH5_TRYB2  unnamed protein product                                 49.3    3e-06


>RFC2_DROME unnamed protein product
Length=331

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 81/176 (46%), Gaps = 9/176 (5%)

Query  58   KSSYIPLAEKMRPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTTLAII  117
            K S++P  EK RP+   + VG +   D    L     +   P++I+ GPPG GKTT    
Sbjct  12   KRSHLPWIEKYRPVKFKEIVGNE---DTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQC  68

Query  118  IAGLNNQEGESKATRFVKLSATSS-GIGDIKEAVN---EAKNEVKFGRQTIIFMDEIHRF  173
            +A +    G+S     ++L+A++  GI  ++  +    + K  +  GR  I+ +DE    
Sbjct  69   LARI--LLGDSYKEAVLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVILDEADSM  126

Query  174  NKLQQDIFLPHVEAGTITLIGATTENPSFSLNSALLSRCRVFVLEKLASTELISIL  229
             +  Q      +E  + T   A   N S  +   + SRC +    KL+  ++++ L
Sbjct  127  TEGAQQALRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKL  182


>Q383X4_TRYB2 unnamed protein product
Length=341

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/186 (25%), Positives = 77/186 (41%), Gaps = 24/186 (13%)

Query  62   IPLAEKMRPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTTLAIIIAG-  120
            +P  EK RP+S+   VG     D    L  +  +  +P+++L GPPG GKTT  + +A  
Sbjct  6    VPWVEKYRPMSMEDIVGNA---DAVARLQVIAREGNLPNLLLCGPPGTGKTTSMLCLARS  62

Query  121  -LNNQEGESKATRFVK-----LSATSS-GIGDIKEAVN-------------EAKNEVKFG  160
             L++ +G       +K     L+A+   G+  ++E +                 N  K  
Sbjct  63   LLSDPDGGGSNNNALKDAVLELNASDDRGLDVVREKIKLFAQTKKTLPQRVGDSNNRKIN  122

Query  161  RQTIIFMDEIHRFNKLQQDIFLPHVEAGTITLIGATTENPSFSLNSALLSRCRVFVLEKL  220
               I+ +DE        Q      +E  + T   A   N S  +   + SRC V    KL
Sbjct  123  LHKIVILDEADSMTPAAQQALRRTIELHSSTTRFAFACNNSHKIIEPIQSRCAVVRFRKL  182

Query  221  ASTELI  226
            + T+++
Sbjct  183  SHTDIL  188


>Q38DH5_TRYB2 unnamed protein product
Length=357

 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query  58   KSSYIPLAEKMRPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTT  113
            K+S +P  EK RP +L   V  + ILD      +L+    +P ++ +GPPG GKTT
Sbjct  14   KNSTLPWVEKYRPTTLDDVVAHEEILD---TTRRLMNSGSMPHLLFYGPPGTGKTT  66



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584729.1 ATPase WRNIP1 isoform X4 [Cephus cinctus]

Length=450
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPAST_CAEEL  unnamed protein product                                  45.4    7e-05
G5EEF8_CAEEL  unnamed protein product                                 45.4    7e-05
RFC2_DROME  unnamed protein product                                   43.5    2e-04


>SPAST_CAEEL unnamed protein product
Length=512

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 78/170 (46%), Gaps = 33/170 (19%)

Query  28   KNEIPSMILWGPPGCGKTTLAIIIAGLNNQEGESKATRFVKLSA---TSSGIGDIKEAVN  84
            +  +  ++L+GPPG GKT LA  +AG + Q        F  +SA   TS  +GD ++ + 
Sbjct  269  RQPVKGILLFGPPGNGKTLLAKAVAGESKQ-------MFFNISASSLTSKWVGDSEKTIR  321

Query  85   EAKNEVKFGRQTIIFMDEIHRF--NKLQQDI---------FLPHVEAGT------ITLIG  127
                  +  + +IIF+DEI      + ++D          FL   +  T      I +IG
Sbjct  322  GLFQIARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIG  381

Query  128  ATTENPSFSLNSALLSRCRVFVL----EKLASTELISILQKAIVLMNGKI  173
            AT  N    L+ A+L R    ++    ++ A  ELI+   K   +M+G I
Sbjct  382  AT--NRPHELDDAVLRRFPKRIMLNLPDEEARKELITKTLKKHNMMDGLI  429


>G5EEF8_CAEEL unnamed protein product
Length=512

 Score = 45.4 bits (106),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 78/170 (46%), Gaps = 33/170 (19%)

Query  28   KNEIPSMILWGPPGCGKTTLAIIIAGLNNQEGESKATRFVKLSA---TSSGIGDIKEAVN  84
            +  +  ++L+GPPG GKT LA  +AG + Q        F  +SA   TS  +GD ++ + 
Sbjct  269  RQPVKGILLFGPPGNGKTLLAKAVAGESKQ-------MFFNISASSLTSKWVGDSEKTIR  321

Query  85   EAKNEVKFGRQTIIFMDEIHRF--NKLQQDI---------FLPHVEAGT------ITLIG  127
                  +  + +IIF+DEI      + ++D          FL   +  T      I +IG
Sbjct  322  GLFQIARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIG  381

Query  128  ATTENPSFSLNSALLSRCRVFVL----EKLASTELISILQKAIVLMNGKI  173
            AT  N    L+ A+L R    ++    ++ A  ELI+   K   +M+G I
Sbjct  382  AT--NRPHELDDAVLRRFPKRIMLNLPDEEARKELITKTLKKHNMMDGLI  429


>RFC2_DROME unnamed protein product
Length=331

 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (45%), Gaps = 17/169 (10%)

Query  2    RPLSLSQYVGQKHILDYGTVLYQLLEKNEIPSMILWGPPGCGKTT----LAIIIAGLNNQ  57
            RP+   + VG +   D    L     +   P++I+ GPPG GKTT    LA I+ G + +
Sbjct  23   RPVKFKEIVGNE---DTVARLSVFATQGNAPNIIIAGPPGVGKTTTIQCLARILLGDSYK  79

Query  58   EGESKATRFVKLSATSS-GIGDIKEAVN---EAKNEVKFGRQTIIFMDEIHRFNKLQQDI  113
            E        ++L+A++  GI  ++  +    + K  +  GR  I+ +DE     +  Q  
Sbjct  80   EA------VLELNASNERGIDVVRNKIKMFAQQKVTLPRGRHKIVILDEADSMTEGAQQA  133

Query  114  FLPHVEAGTITLIGATTENPSFSLNSALLSRCRVFVLEKLASTELISIL  162
                +E  + T   A   N S  +   + SRC +    KL+  ++++ L
Sbjct  134  LRRTMEIYSSTTRFALACNTSEKIIEPIQSRCAMLRFTKLSDAQVLAKL  182



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584730.1 ATPase WRNIP1 isoform X5 [Cephus cinctus]

Length=415


***** No hits found *****



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584731.1 probable serine/threonine-protein kinase fhkB isoform
X1 [Cephus cinctus]

Length=290


***** No hits found *****



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584732.1 uncharacterized protein LOC107262742 [Cephus cinctus]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584Y2_TRYB2  unnamed protein product                                 36.6    0.016
KIFA3_STRPU  unnamed protein product                                  31.6    0.81 
Q9VUH6_DROME  unnamed protein product                                 30.0    2.6  


>Q584Y2_TRYB2 unnamed protein product
Length=349

 Score = 36.6 bits (83),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 51/104 (49%), Gaps = 4/104 (4%)

Query  128  DIEDLVELLKRDNAKNIFVATVPAELAYVDYLVVVNARSQKHMNALANFVRKAYKLKRHK  187
            D+++++E+L+    ++I    V  + +  DY++       +H++  A  V++A  LKR  
Sbjct  199  DVKEILEVLRSLKVRDICAIDVSNKTSNFDYMLFGTCEGPRHIHLAAWAVQEADALKRVC  258

Query  188  TDQIPKVEGANSKDWLALDLGNIALHIFSSEARELYDLDTLWAV  231
              +  +V+      W  + +G I +++     RE   L+  WAV
Sbjct  259  KIRRKQVD----HTWEVVPVGRIIVNLMQESLREELSLERKWAV  298


>KIFA3_STRPU unnamed protein product
Length=828

 Score = 31.6 bits (70),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 43/81 (53%), Gaps = 3/81 (4%)

Query  103  ELNTEIETVDPYNGLNMNHGVNGVFDIEDLVELLKRDNAKNIFVATVPAELAY-VDYLVV  161
            EL  +++   PY G  +N   N + DIED +ELL  DN + +    +  +LA   D L  
Sbjct  112  ELTGKLKDPPPYEGTELNEVAN-INDIEDYIELLYEDNPEKVRGTALILQLARNPDNLEE  170

Query  162  VNARSQKHMNALANFVRKAYK  182
            + + ++  + ALA  +R+ +K
Sbjct  171  LQS-NETVLGALARVLREEWK  190


>Q9VUH6_DROME unnamed protein product
Length=1833

 Score = 30.0 bits (66),  Expect = 2.6, Method: Composition-based stats.
 Identities = 20/65 (31%), Positives = 31/65 (48%), Gaps = 2/65 (3%)

Query  18    QTGKVFYQSSYYRTTNLLQYSRVSHVRLYSSNNIHKKL--TDEEISEDNNEEHNLPTGIA  75
             QTGK  Y S Y + T+ L+ S+ S    +S +   + +  TD EI+  +N      + I 
Sbjct  1204  QTGKYEYSSGYQQDTSSLKGSQASQSYQFSQSGKQQSVGTTDSEIASRSNTATGFDSPIV  1263

Query  76    EKYKV  80
                KV
Sbjct  1264  SHTKV  1268



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584733.1 protein slowmo isoform X1 [Cephus cinctus]

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLMO_DROME  unnamed protein product                                   309     8e-108
PREL_DROME  unnamed protein product                                   73.6    1e-15 
RETM_DROME  unnamed protein product                                   57.0    2e-09 


>SLMO_DROME unnamed protein product
Length=215

 Score = 309 bits (792),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 169/217 (78%), Gaps = 4/217 (2%)

Query  1    MKIWTSEHIFNHPWETVTQAAWRKYPNPMNPAVIGTDVIDRKVVNGVLHTHRLVSSKWGF  60
            MKIWTSEHIFNHPWETVTQAAWRKYPNPM P++IGTDV++R+VV+GVLHTHRLV SKW F
Sbjct  1    MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVDGVLHTHRLVQSKWYF  60

Query  61   PKWAQALIGHASVCYASERSEVDPTNRQMVLKTRNLTFCNYIAVDETLRYMPDPRDAGKT  120
            PKW  ALIG A  C+ASERS VDP  +QMVLKT NLTFC  I+VDE L Y P P DA KT
Sbjct  61   PKWTHALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKT  120

Query  121  LLTQEAVVTVQGVPLTHYMEDLLTSKISFNAGKGRQAMEWVIGKIELEVKDLANTAVKST  180
            LL QEA VTV GVPL+HYMEDLLTS IS NAGKGRQ +EWVIG I  EVK +A    + T
Sbjct  121  LLKQEATVTVFGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIA----RGT  176

Query  181  DELLFQTRRQLDDLTSKTRKSMDDLQHAAKKSFDEIH  217
            DELL  TRR +D++T   RKSMD++   A K+   +H
Sbjct  177  DELLHNTRRSIDEVTESARKSMDEISAQAAKAAKAMH  213


>PREL_DROME unnamed protein product
Length=236

 Score = 73.6 bits (179),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (46%), Gaps = 3/160 (2%)

Query  6    SEHIFNHPWETVTQAAWRKYPNPMNPAVIGTDVIDRKVVNGVLHTHRLVSSKWGFPKWAQ  65
            +E +F++ W  V  A W +YPNP +  V+  D I R+V +G L + RL+S     PKW  
Sbjct  10   TETVFDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRDGKLFSRRLLSKTNPVPKWGA  69

Query  66   ALIGHASVCYASERSEVDPTNRQMVLKTRNLTFCNYIAVDETLRYMPDPRDAGKTLLTQE  125
                +  V    E S +DP  +     TRNL     + VDE + Y  + +D G TL  + 
Sbjct  70   RFYNNVPVKIV-EDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVY-SEQKD-GSTLAVRR  126

Query  126  AVVTVQGVPLTHYMEDLLTSKISFNAGKGRQAMEWVIGKI  165
            A ++ Q    +  +      +   N  K      +V+ ++
Sbjct  127  AYISSQVFGFSRAIRAFGIERFKANGNKASNGFNYVLRRM  166


>RETM_DROME unnamed protein product
Length=659

 Score = 57.0 bits (136),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 79/164 (48%), Gaps = 5/164 (3%)

Query  9    IFNHPWETVTQAAWRKYPN-PMNPAVIGTDVI-DRKVVNGV-LHTHRLVSSKWGFPKWAQ  65
            ++ +P+E V +A  R++P  P  P V+  +VI D  + +G   +T R        P   +
Sbjct  11   VYKYPFELVMKAYERRFPTCPQMPIVLDCEVIKDESLEDGAKRNTSRRCKLAVDAPYIFK  70

Query  66   ALIGHASVCYASERSEVDPTNRQMVLKTRNLTFCNYIAVDETLRYMPDPRDAGKTLLTQE  125
             LIG   V Y  + + +D  NR + ++  N +F + I + E  RY   P ++  T   Q 
Sbjct  71   KLIGVDHV-YFLQHNFLDLANRTLSIEAVNESFSSRIEIFERCRYYAHPDNSEWTCFDQS  129

Query  126  AVVTVQG-VPLTHYMEDLLTSKISFNAGKGRQAMEWVIGKIELE  168
            A + ++      H ME +   + +    KG++ +E+ IG++  E
Sbjct  130  ATLDIKNFFGFEHSMEKMGMKQYTQTTLKGKEIIEFFIGQLREE  173



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584734.1 protein slowmo isoform X2 [Cephus cinctus]

Length=202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLMO_DROME  unnamed protein product                                   253     3e-86
PREL_DROME  unnamed protein product                                   53.5    1e-08
RETM_DROME  unnamed protein product                                   36.6    0.010


>SLMO_DROME unnamed protein product
Length=215

 Score = 253 bits (647),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 147/217 (68%), Gaps = 33/217 (15%)

Query  1    MKIWTSEHIFNHPWETVTQAAWRKYPNPMNPAVIGTDVIDRKVVNGVLHTHRLVSSKWGF  60
            MKIWTSEHIFNHPWETVTQAAWRKYPNPM P++IGTDV++R+VV+GVLHTHRLV SKW F
Sbjct  1    MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVDGVLHTHRLVQSKWYF  60

Query  61   PKWAQAL-----------------------------TFCNYIAVDETLRYMPDPRDAGKT  91
            PKW  AL                             TFC  I+VDE L Y P P DA KT
Sbjct  61   PKWTHALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKT  120

Query  92   LLTQEAVVTVQGVPLTHYMEDLLTSKISFNAGKGRQAMEWVIGKIELEVKDLANTAVKST  151
            LL QEA VTV GVPL+HYMEDLLTS IS NAGKGRQ +EWVIG I  EVK +A    + T
Sbjct  121  LLKQEATVTVFGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIA----RGT  176

Query  152  DELLFQTRRQLDDLTSKTRKSMDDLQHAAKKSFDEIH  188
            DELL  TRR +D++T   RKSMD++   A K+   +H
Sbjct  177  DELLHNTRRSIDEVTESARKSMDEISAQAAKAAKAMH  213


>PREL_DROME unnamed protein product
Length=236

 Score = 53.5 bits (127),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/159 (24%), Positives = 65/159 (41%), Gaps = 30/159 (19%)

Query  6    SEHIFNHPWETVTQAAWRKYPNPMNPAVIGTDVIDRKVVNGVLHTHRLVSS-----KWG-  59
            +E +F++ W  V  A W +YPNP +  V+  D I R+V +G L + RL+S      KWG 
Sbjct  10   TETVFDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRDGKLFSRRLLSKTNPVPKWGA  69

Query  60   ----------------------FPKWAQALTFCNYIAVDETLRYMPDPRDAGKTLLTQEA  97
                                  F  + + L     + VDE + Y  + +D G TL  + A
Sbjct  70   RFYNNVPVKIVEDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVY-SEQKD-GSTLAVRRA  127

Query  98   VVTVQGVPLTHYMEDLLTSKISFNAGKGRQAMEWVIGKI  136
             ++ Q    +  +      +   N  K      +V+ ++
Sbjct  128  YISSQVFGFSRAIRAFGIERFKANGNKASNGFNYVLRRM  166


>RETM_DROME unnamed protein product
Length=659

 Score = 36.6 bits (83),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 34/163 (21%), Positives = 65/163 (40%), Gaps = 32/163 (20%)

Query  9    IFNHPWETVTQAAWRKYPN-PMNPAVIGTDVIDR-------------------------K  42
            ++ +P+E V +A  R++P  P  P V+  +VI                           K
Sbjct  11   VYKYPFELVMKAYERRFPTCPQMPIVLDCEVIKDESLEDGAKRNTSRRCKLAVDAPYIFK  70

Query  43   VVNGVLHTHRLVSSKWGFPKWAQAL-----TFCNYIAVDETLRYMPDPRDAGKTLLTQEA  97
             + GV H + L  +         ++     +F + I + E  RY   P ++  T   Q A
Sbjct  71   KLIGVDHVYFLQHNFLDLANRTLSIEAVNESFSSRIEIFERCRYYAHPDNSEWTCFDQSA  130

Query  98   VVTVQGV-PLTHYMEDLLTSKISFNAGKGRQAMEWVIGKIELE  139
             + ++      H ME +   + +    KG++ +E+ IG++  E
Sbjct  131  TLDIKNFFGFEHSMEKMGMKQYTQTTLKGKEIIEFFIGQLREE  173



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584735.1 uncharacterized protein LOC107262741 [Cephus cinctus]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38BD2_TRYB2  unnamed protein product                                 29.6    1.6  
PTP10_DROME  unnamed protein product                                  29.3    6.3  
M9PDK6_DROME  unnamed protein product                                 29.3    6.5  


>Q38BD2_TRYB2 unnamed protein product
Length=112

 Score = 29.6 bits (65),  Expect = 1.6, Method: Composition-based stats.
 Identities = 18/65 (28%), Positives = 32/65 (49%), Gaps = 1/65 (2%)

Query  115  KEPRTMDNFENFEQSYT-WNKPKPHGDDVLQQAHANCNFLRVNALPQIADNWKVYQDCLK  173
            KEP    N +   Q  T  N P     D+ ++  A C  + VNA+ +  D++++    +K
Sbjct  6    KEPDGPCNIDTIRQYVTPLNYPLEKMSDMAEEMRAECKEIVVNAIEKHEDSYELAARHIK  65

Query  174  REMNK  178
             +M+K
Sbjct  66   EQMDK  70


>PTP10_DROME unnamed protein product
Length=1990

 Score = 29.3 bits (64),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 36/71 (51%), Gaps = 5/71 (7%)

Query  59   PGTFYNTKVATSSSNDMNLPFYNYYQGLPTDLRYLPPSIQQHPINGVRSERVNVLHKEPR  118
            PG  YN  V T S ++++LP    Y+ +P  LR L  +  +   + + S    VL + P+
Sbjct  284  PGRAYNISVQTMSEDEISLPTTAQYRTVP--LRPLNVTFDR---DFITSNSFRVLWEAPK  338

Query  119  TMDNFENFEQS  129
             +  F+ ++ S
Sbjct  339  GISEFDKYQVS  349


>M9PDK6_DROME unnamed protein product
Length=878

 Score = 29.3 bits (64),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 2/83 (2%)

Query  247  GNADILRLARLTTTEGSVDLNYGWSTTTEGKVVRSVESTEKAVGRKAHSRYGEYKKILNT  306
            GNA ++ +     +  +  ++ G   ++      S +S+E   G    SR+ +   +LN 
Sbjct  314  GNATLIEMGHSRNSSNTSQMSKGSGYSSFSHSQHSRQSSEGDSGHA--SRFRKSVSLLNR  371

Query  307  LPQRVVRIVKDDVNCKQMNGQKG  329
            L QR + ++K ++   + NGQKG
Sbjct  372  LNQRAINVMKFNIPHSRQNGQKG  394



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584736.1 uncharacterized protein LOC107262744 isoform X1
[Cephus cinctus]

Length=1203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z0K1_DROME  unnamed protein product                                 66.6    1e-10
Q59DX2_DROME  unnamed protein product                                 66.6    1e-10
Q6XK20_DROME  unnamed protein product                                 66.6    1e-10


>B7Z0K1_DROME unnamed protein product
Length=1137

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  701  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  755
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  816  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  875

Query  756  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  803
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  876  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  924


 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  517   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  569
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  812   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  871

Query  570   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  619
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  872   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  930

Query  620   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  679
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  931   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  971

Query  680   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  735
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  972   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1031

Query  736   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  785
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1032  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1085


>Q59DX2_DROME unnamed protein product
Length=1567

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  701   MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  755
             +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  1246  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  1305

Query  756   PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  803
             P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  1306  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  1354


 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  517   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  569
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  1242  KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  1301

Query  570   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  619
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  1302  RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  1360

Query  620   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  679
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  1361  DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  1401

Query  680   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  735
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  1402  KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1461

Query  736   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  785
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1462  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1515


>Q6XK20_DROME unnamed protein product
Length=1102

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  701  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  755
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  840

Query  756  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  803
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  841  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  889


 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  517   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  569
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  777   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  836

Query  570   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  619
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  837   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  895

Query  620   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  679
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  896   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  936

Query  680   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  735
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  937   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  996

Query  736   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  785
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  997   TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1050



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584742.1 uncharacterized protein LOC107262744 isoform X2
[Cephus cinctus]

Length=1191
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z0K1_DROME  unnamed protein product                                 66.6    9e-11
Q6XK20_DROME  unnamed protein product                                 66.6    1e-10
Q59DX2_DROME  unnamed protein product                                 66.6    1e-10


>B7Z0K1_DROME unnamed protein product
Length=1137

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  689  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  743
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  816  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  875

Query  744  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  791
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  876  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  924


 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/291 (21%), Positives = 116/291 (40%), Gaps = 45/291 (15%)

Query  508   VLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRAQFL  560
              L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   +F 
Sbjct  815   ALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFH  874

Query  561   VQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELTLSG  610
                 +  S +  +  W+       D LG   ++L QG       S W +   R E     
Sbjct  875   TPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPFDEV  933

Query  611   SNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLTHRD  670
             +     + V + + P  +++    SR SSI   +S+                   L    
Sbjct  934   ATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LRKFG  974

Query  671   ADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYKSSI  726
               I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K+ +
Sbjct  975   GSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPV  1034

Query  727   KKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  773
              K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1035  VKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1085


>Q6XK20_DROME unnamed protein product
Length=1102

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  689  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  743
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  840

Query  744  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  791
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  841  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  889


 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 61/291 (21%), Positives = 116/291 (40%), Gaps = 45/291 (15%)

Query  508   VLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRAQFL  560
              L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   +F 
Sbjct  780   ALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFH  839

Query  561   VQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELTLSG  610
                 +  S +  +  W+       D LG   ++L QG       S W +   R E     
Sbjct  840   TPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPFDEV  898

Query  611   SNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLTHRD  670
             +     + V + + P  +++    SR SSI   +S+                   L    
Sbjct  899   ATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LRKFG  939

Query  671   ADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYKSSI  726
               I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K+ +
Sbjct  940   GSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPV  999

Query  727   KKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  773
              K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1000  VKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1050


>Q59DX2_DROME unnamed protein product
Length=1567

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  689   MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  743
             +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  1246  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  1305

Query  744   PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  791
             P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  1306  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  1354


 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/291 (21%), Positives = 116/291 (40%), Gaps = 45/291 (15%)

Query  508   VLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRAQFL  560
              L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   +F 
Sbjct  1245  ALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFH  1304

Query  561   VQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELTLSG  610
                 +  S +  +  W+       D LG   ++L QG       S W +   R E     
Sbjct  1305  TPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPFDEV  1363

Query  611   SNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLTHRD  670
             +     + V + + P  +++    SR SSI   +S+                   L    
Sbjct  1364  ATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LRKFG  1404

Query  671   ADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYKSSI  726
               I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K+ +
Sbjct  1405  GSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQKTPV  1464

Query  727   KKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  773
              K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1465  VKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1515



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584743.1 uncharacterized protein LOC107262744 isoform X3
[Cephus cinctus]

Length=1143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DX2_DROME  unnamed protein product                                 66.6    1e-10
B7Z0K1_DROME  unnamed protein product                                 66.6    1e-10
Q6XK20_DROME  unnamed protein product                                 66.2    1e-10


>Q59DX2_DROME unnamed protein product
Length=1567

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641   MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
             +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  1246  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  1305

Query  696   PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
             P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  1306  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  1354


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  1242  KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  1301

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  1302  RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  1360

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  1361  DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  1401

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  1402  KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1461

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1462  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1515


>B7Z0K1_DROME unnamed protein product
Length=1137

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  816  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  875

Query  696  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  876  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  924


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  812   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  871

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  872   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  930

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  931   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  971

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  972   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1031

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1032  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1085


>Q6XK20_DROME unnamed protein product
Length=1102

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  840

Query  696  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  841  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  889


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  777   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  836

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  837   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  895

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  896   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  936

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  937   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  996

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  997   TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1050



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584744.1 uncharacterized protein LOC107262744 isoform X3
[Cephus cinctus]

Length=1143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DX2_DROME  unnamed protein product                                 66.6    1e-10
B7Z0K1_DROME  unnamed protein product                                 66.6    1e-10
Q6XK20_DROME  unnamed protein product                                 66.2    1e-10


>Q59DX2_DROME unnamed protein product
Length=1567

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641   MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
             +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  1246  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  1305

Query  696   PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
             P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  1306  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  1354


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  1242  KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  1301

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  1302  RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  1360

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  1361  DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  1401

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  1402  KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1461

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1462  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1515


>B7Z0K1_DROME unnamed protein product
Length=1137

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  816  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  875

Query  696  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  876  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  924


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  812   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  871

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  872   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  930

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  931   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  971

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  972   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1031

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1032  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1085


>Q6XK20_DROME unnamed protein product
Length=1102

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  840

Query  696  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  841  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  889


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  777   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  836

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  837   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  895

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  896   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  936

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  937   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  996

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  997   TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1050



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584745.1 uncharacterized protein LOC107262744 isoform X3
[Cephus cinctus]

Length=1143
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DX2_DROME  unnamed protein product                                 66.6    1e-10
B7Z0K1_DROME  unnamed protein product                                 66.6    1e-10
Q6XK20_DROME  unnamed protein product                                 66.2    1e-10


>Q59DX2_DROME unnamed protein product
Length=1567

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641   MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
             +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  1246  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  1305

Query  696   PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
             P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  1306  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  1354


 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  1242  KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  1301

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  1302  RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  1360

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  1361  DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  1401

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  1402  KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1461

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1462  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1515


>B7Z0K1_DROME unnamed protein product
Length=1137

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  816  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  875

Query  696  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  876  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  924


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  812   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  871

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  872   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  930

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  931   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  971

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  972   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  1031

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  1032  TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1085


>Q6XK20_DROME unnamed protein product
Length=1102

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 62/111 (56%), Gaps = 10/111 (9%)

Query  641  MEVTLLRAKDLVAKDLN-GFSDPFCELKL----NNETKYKSSIKKKTLNPCWDESSIMGL  695
            +EV ++R KDL A D     SDP+ ++ L    +   K K+ +KK TLNP +DE+     
Sbjct  781  LEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETMRFHT  840

Query  696  PRAG---ETLDVMLWDHDTFGMRDYLGKVSLTLEDIRKLSSTDQSHWFLLR  743
            P +     TL + +W  D FG  D+LG+VS+ L+   +L    QS W+LL+
Sbjct  841  PISSLESRTLWLTVWHSDMFGRNDFLGEVSVNLQG--RLFDNPQSQWYLLQ  889


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 62/294 (21%), Positives = 117/294 (40%), Gaps = 45/294 (15%)

Query  457   KAGVLVVYIHSAEDL---NSDASQCNPYCMLF----NNRKKVKTTHYIRGTTAPRWETRA  509
             K   L V++   +DL   ++  ++ +PY  ++     ++   + T   + T  P ++   
Sbjct  777   KLSALEVHVVRCKDLAAVDAKRNRSDPYVKVYLLPDKSKAGKRKTKVKKHTLNPIFDETM  836

Query  510   QFLVQDYTQVSLSFVICSWNISKMADTDMLGLAMLSLTQG-------STWIV---RKELT  559
             +F     +  S +  +  W+       D LG   ++L QG       S W +   R E  
Sbjct  837   RFHTPISSLESRTLWLTVWHSDMFGRNDFLGEVSVNL-QGRLFDNPQSQWYLLQERSEPF  895

Query  560   LSGSNSMSTLTVSVLFYPVTSVQQVMTSRRSSIVPPASDDEPKAKRNSLPWMQQAKLLLT  619
                +     + V + + P  +++    SR SSI   +S+                   L 
Sbjct  896   DEVATYRGDIVVGLKYIPPENIKSSFFSRGSSITGSSSN-------------------LR  936

Query  620   HRDADIASSDISSLLSTGSGLMEVTLLRAKDLVAKDLNGFSDPFCELKL----NNETKYK  675
                  I S    S  ++  G + V +  AK L     NG  D FC+  L       +K K
Sbjct  937   KFGGSIKSVASKSERTSKGGQLHVLVKEAKHLSPIKANGTCDAFCKSYLLPDRTRSSKQK  996

Query  676   SSIKKKTLNPCWDESSI---MGLPRAGE-TLDVMLWDHDTFGMRDYLGKVSLTL  725
             + + K+TL+P W+ + +   + L    E  L++ +WDHD     +++G +  +L
Sbjct  997   TPVVKRTLHPSWNYTFVYEDVSLEELSERALELTVWDHDRLASNEFVGGIRFSL  1050



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584746.1 actin-related protein 6 [Cephus cinctus]

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARP6_DROME  unnamed protein product                                   71.6    4e-13
ARP2_DICDI  unnamed protein product                                   54.3    1e-07
Q9NA98_CAEEL  unnamed protein product                                 52.0    7e-07


>ARP6_DROME unnamed protein product
Length=398

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 81/338 (24%), Positives = 140/338 (41%), Gaps = 49/338 (14%)

Query  267  KTFVDHLFHQMGLTSILRKPNAVLMFCEPLAMHPILRQQLLHYLFQEVKVARVC-LVPKP  325
            KT  D++F + G+   L   N V+   EP      +++  L  LF+E KV  V       
Sbjct  75   KTVWDYIFSKDGIGCSLENRNIVI--TEPQMNFQSIQEATLEILFEEYKVDGVYKTTAAD  132

Query  326  LAAC---------AMLDVETCVVIDSGALSTTVAVVIGGRVMPDRWKLLPVGGWHVAHHL  376
            LAA            ++   C++ID G   T V   + GR +    + + +GG  + + L
Sbjct  133  LAAFNYVADSEERTTMESLNCIIIDVGYSFTHVVPFVLGRRVLQGIRRIDMGGKALTNQL  192

Query  377  KQAMHWQP----KEYHQIPVSYLDTMAVKERCRLSYNIEHEEKKR------------GPT  420
            K+ + ++      E H +     D   V E  + +  + + E+KR               
Sbjct  193  KELISYRHLNVMDESHVVNQIKEDVCFVAEDFKQAMQVHYSEEKRREVTVDYVLPDFTTV  252

Query  421  KREHINLRVDSYADYKQFWRVSLGSELYIAPEMMY-------ISLGLPQVIKEVTSGLSK  473
            KR ++ +      D +Q   VSL +E +  PE+++         +G+P+ + +       
Sbjct  253  KRGYVRVPGKPREDEEQQQMVSLCNERFTVPELLFNPSDIGVQQVGIPEAVADCLKACPW  312

Query  474  ELMHDCLSHILLTGGNTDLSGFELRLTKDLRELLPEHSGILEVK-SCPGTHSWNVAMGST  532
            E   + L +IL+ GG+    GF  RL +DLR L+P+    LEV   CP         G  
Sbjct  313  EAHRELLLNILIVGGSAQFPGFLPRLKRDLRALVPDD---LEVSLICPEDPVRYAWYGGK  369

Query  533  YVPLAVHPDKTPPEYVEGNPFWLSREEYVLFGCESLEQ  570
             V        T P + E   F  ++++Y  +G + + Q
Sbjct  370  EVA-------TSPNFEE---FVYTQDDYEEYGFQGINQ  397


>ARP2_DICDI unnamed protein product
Length=392

 Score = 54.3 bits (129),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 69/304 (23%), Positives = 134/304 (44%), Gaps = 45/304 (15%)

Query  290  LMFCEPLAMHPIL-RQQLLHYLFQEVKVARVCLVPKPLAACAMLDVETCVVIDSGALSTT  348
            ++  EP  M+P+  RQ+++  +F++     V +  + +       + T VV+DSG   T 
Sbjct  105  ILLTEP-PMNPVANRQKMIECMFEKYGFQAVYVAIQAVLTLYAQGLLTGVVVDSGDGVTH  163

Query  349  VAVVIGGRVMPDRWKLLPVGGWHVAHHLKQAMHWQPKEYHQIPVSYLDTMAVKER-CRLS  407
            +  V  G  +P   + L V G  V  +L + +  +   +++    +     +KE+ C ++
Sbjct  164  IIPVYEGYSIPHLTRRLDVAGRDVTRYLIKLLLLRGYAFNRT-ADFETIRQIKEKLCYVA  222

Query  408  YNIEHEEKKRGPTKREHINLRVDSYADYKQFWRVSLGSELYIAPEMMYISLGLPQVIKEV  467
            Y+++ E K    T      + V++Y        + +G E + A E ++     P ++ +V
Sbjct  223  YDVQQEMKLASET-----TVLVENYT-LPDGRVIKVGQERFQASEALFN----PSLV-DV  271

Query  468  TSGLSKELMHDCLS------------HILLTGGNTDLSGFELRLTKDLRELLPEH-----  510
              G   E + DC++            HI+L+GG++   G   RL K++R L  E      
Sbjct  272  EGGGVHEQLFDCITKADRDLQQGFYQHIVLSGGSSMYPGLPSRLEKEIRSLYLERVLKGN  331

Query  511  -SGILEVK---SCPGTHSWNVAMGSTYVPLAVHPDKTPPEYVEGNPFWLSREEYVLFGCE  566
              G+ + K     P      V +G      AV  D T     + + FW+++ EY+  G  
Sbjct  332  KEGLAKFKCRIEDPPRRKHMVFLGG-----AVLADLTK----DRDDFWITKAEYMEKGFG  382

Query  567  SLEQ  570
            +L++
Sbjct  383  ALDK  386


>Q9NA98_CAEEL unnamed protein product
Length=374

 Score = 52.0 bits (123),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 66/317 (21%), Positives = 133/317 (42%), Gaps = 34/317 (11%)

Query  262  TFSVLKTFVDHLFHQMGLTSILRKPNAVLMFCEPLAMHPIL-RQQLLHYLFQEVKVARVC  320
             +S ++   +++F Q  L  I  + + VL+   PL  +P+  R++     F+   V  + 
Sbjct  81   NWSDMEKIWEYIFGQDQL-KIFPEEHPVLLTDAPL--NPLKNRERSAEIFFETFNVPALY  137

Query  321  LVPKPLAACAMLDVETCVVIDSGALSTTVAVVIGGRVMPDRWKLLPVGGWHVAHHLKQAM  380
            +  + + +       T VV+DSG   T    ++ G  M    + + + G  V  +L+  +
Sbjct  138  IQMQAVLSLYATGRTTGVVLDSGDGVTHAVPIVKGFAMKHAIQRMDLAGRDVTEYLRVLL  197

Query  381  HWQPKEYHQIPVSYLDTMAVKERCRLSYNIEHEEKKRGPTKREHINLRVDSYADYKQFWR  440
              +  E+H+     +     +  C L+ +         PTK E+ +++  SYA      +
Sbjct  198  RREGYEFHRSNEFEIVREMKENACYLALD---------PTKVENNSVK-SSYA-LPDTTK  246

Query  441  VSLGSELYIAPEMMY----ISL---GLPQVIKEVTSGLSKELMHDCLSHILLTGGNTDLS  493
            + + + L+ APE+++    I     G+  V+ +       +L     S+I+L+GG T   
Sbjct  247  IEISNSLFRAPEVLFKPDLIGTEWPGMAHVVNQSIMKCDVDLRQTLYSNIVLSGGTTLFK  306

Query  494  GFELRLTKDLRELLPEHSGILEVKSCPGTHSWNVAMGSTYVPLAVHPDKTPPEYVEGNPF  553
            GF  RL  ++R++ P   G + + +    +S     GS    L                 
Sbjct  307  GFGDRLLGEMRKIAPA-DGKIRISASQERNSLTWIGGSIVASLDTF-----------RKM  354

Query  554  WLSREEYVLFGCESLEQ  570
            WL ++EY   G  ++ +
Sbjct  355  WLGKKEYEDMGASAMHK  371



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584748.1 gustatory and odorant receptor 24 [Cephus cinctus]

Length=443
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR24_ANOGA  unnamed protein product                                   399     4e-136
GR63A_DROME  unnamed protein product                                  373     2e-125
GR22_ANOGA  unnamed protein product                                   184     6e-53 


>GR24_ANOGA unnamed protein product
Length=457

 Score = 399 bits (1024),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 270/390 (69%), Gaps = 1/390 (0%)

Query  46   KISHPMRIPIEAF-KKHDKGELDVVYDNIKPVVTVIRIMGALPITRTRSGITRFKLASNA  104
            ++  P   P EAF       +  +V+++ KP+  V+R +G LP TR  SG T F LAS +
Sbjct  57   RVGFPPLTPKEAFVDAVPADQTCMVFESSKPIYLVLRAIGVLPYTRLPSGGTAFVLASPS  116

Query  105  MIYSAVVYFALTAHVLYVAWNRIRIVGAVEGRFEESVIAYLFIVYLMPNFLIPLLWYETP  164
            M Y  + +  LT ++ ++  NRI IV  +EGRFEESVIAYLFIV ++P  +IPL+WYE+ 
Sbjct  117  MTYCVLFFLLLTVYIAFILLNRIEIVRTLEGRFEESVIAYLFIVNILPILIIPLMWYESR  176

Query  165  KHAECFNHWKEFQIFYKRITTRDLPINLKRRALWTAILVPILSAAAMIGTHLTMINFSIW  224
            K     N W +F+  Y+  T R L + L+ +A   AIL+PIL + ++  TH+TM++F + 
Sbjct  177  KVVSVVNGWVDFETVYRETTGRALELRLRTKAQVIAILLPILCSLSVAITHVTMVDFKLL  236

Query  225  QIIPYVYVTAFINISGAYWYIHCAAISRSANVLAQDFKHALRNNVQATTVAEYRALWLHL  284
            Q+IPY  +     + G YWY+ C  +S +A +LA+DF+ ALR+   A  V+EYR+LWL L
Sbjct  237  QVIPYCVLDTITYMMGGYWYMACETLSITAKILAEDFQRALRHVGPAAKVSEYRSLWLRL  296

Query  285  NRITRKIGVMCCYSFTILTIYLFFSLTLSIYGLFSQLQDGLTIKDAGLTLSACSNIILLH  344
            +++ R  G   CY+FT + +YLFF +TLSIYGL SQ+ DG  +KD GL ++A  ++ LL 
Sbjct  297  SKLARDTGFSTCYTFTFICLYLFFIITLSIYGLMSQISDGFGVKDIGLAVTAFCSVGLLF  356

Query  345  FICDQAHAASQHVRVHFQKKLLLVEISDLNPDAQTEIDMFLRATEMNPSDMSLGGFFDVN  404
            +ICD+AH AS +VR +FQKKLL+VE+S +N DAQTEI+MFLRATEMNPS ++LGGFFDVN
Sbjct  357  YICDEAHYASFNVRTNFQKKLLMVELSWMNTDAQTEINMFLRATEMNPSSINLGGFFDVN  416

Query  405  RNLFKSFLGTMVTYLVVLLQFQISLPESKN  434
            R LFKS L TMVTYLVVLLQFQIS+P+  +
Sbjct  417  RTLFKSLLATMVTYLVVLLQFQISIPDEPS  446


>GR63A_DROME unnamed protein product
Length=512

 Score = 373 bits (958),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 192/376 (51%), Positives = 270/376 (72%), Gaps = 1/376 (0%)

Query  68   VVYDNIKPVVTVIRIMGALPITRTRSGITRFKLASNAMIYSAVVYFALTAHVLYVAWNRI  127
            V Y NI P+   +RI+G LPI R      +F++ S + IYS V +  L  +V YVA NRI
Sbjct  95   VFYRNIDPINWFLRIIGVLPIVRHGPARAKFEMNSASFIYSVVFFVLLACYVGYVANNRI  154

Query  128  RIVGAVEGRFEESVIAYLFIVYLMPNFLIPLLWYETPKHAECFNHWKEFQIFYKRITTRD  187
             IV ++ G FEE+VIAYLF+V ++P  +IP+LWYE  K A+ FN W +F++ Y +I+   
Sbjct  155  HIVRSLSGPFEEAVIAYLFLVNILPIMIIPILWYEARKIAKLFNDWDDFEVLYYQISGHS  214

Query  188  LPINLKRRALWTAILVPILSAAAMIGTHLTMINFSIWQIIPYVYVTAFINISGAYWYIHC  247
            LP+ L+++A++ AI++PILS  +++ TH+TM + +I Q++PY  +     + GA+W++ C
Sbjct  215  LPLKLRQKAVYIAIVLPILSVLSVVITHVTMSDLNINQVVPYCILDNLTAMLGAWWFLIC  274

Query  248  AAISRSANVLAQDFKHALRNNVQATTVAEYRALWLHLNRITRKIGVMCCYSFTILTIYLF  307
             A+S +A++LA+ F+ AL++   A  VA+YR LWL L+++TR  G   CY+F  +++YLF
Sbjct  275  EAMSITAHLLAERFQKALKHIGPAAMVADYRVLWLRLSKLTRDTGNALCYTFVFMSLYLF  334

Query  308  FSLTLSIYGLFSQLQDGLTIKDAGLTLSACSNIILLHFICDQAHAASQHVRVHFQKKLLL  367
            F +TLSIYGL SQL +G  IKD GLT++A  NI LL +ICD+AH AS +VR +FQKKLL+
Sbjct  335  FIITLSIYGLMSQLSEGFGIKDIGLTITALWNIGLLFYICDEAHYASVNVRTNFQKKLLM  394

Query  368  VEISDLNPDAQTEIDMFLRATEMNPSDMSLGGFFDVNRNLFKSFLGTMVTYLVVLLQFQI  427
            VE++ +N DAQTEI+MFLRATEMNPS ++ GGFFDVNR LFK  L TMVTYLVVLLQFQI
Sbjct  395  VELNWMNSDAQTEINMFLRATEMNPSTINCGGFFDVNRTLFKGLLTTMVTYLVVLLQFQI  454

Query  428  SLPESKNNDNATMDNI  443
            S+P  K  D+   +NI
Sbjct  455  SIPTDK-GDSEGANNI  469


>GR22_ANOGA unnamed protein product
Length=467

 Score = 184 bits (467),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 110/371 (30%), Positives = 197/371 (53%), Gaps = 8/371 (2%)

Query  67   DVVYDNIKPVVTVIRIMGALPITRTRSGI----TRFKLASNAMIYSAVVYFALTAHVLYV  122
            D  Y   K ++ + +IMG +PI R+  G+    T F   S A +++  +Y   T  VL V
Sbjct  67   DSFYHTTKSLLVLFQIMGVMPIMRSPKGVDMPRTTFTWCSKAFLWAYFIYACETVIVLVV  126

Query  123  AWNRI-RIVGAVEGRFEESVIAYLFIVYLMPNFLIPLL-WYETPKHAECFNHWKEFQIFY  180
            A  RI + +   + RF+E +   +F+  ++P+FL+P+  W    + A+  N W +FQ  Y
Sbjct  127  ARERINKFISTSDKRFDEVIYNIIFMSIMVPHFLLPVASWRNGSEVAKFKNMWTDFQYKY  186

Query  181  KRITTRDLPINLKRRALWTAILVP-ILSAAAMIGTHLTMINFSIWQIIPYVYVTAFINIS  239
              +T + +         WT  +V   LS   ++  +    +F       Y ++ A +N  
Sbjct  187  LIVTGKPIVFPKLYPITWTLCIVSWSLSLVIILSQYYLQPDFQFCHTFAYYHIIAMLNGF  246

Query  240  GAYWYIHCAAISRSANVLAQDFKHALRNNVQATTVAEYRALWLHLNRITRKIGVMCCYSF  299
             + W+++C A   ++   A++    L     A  + EYR LW+ L+ + +++G      +
Sbjct  247  CSLWFVNCTAFGTASKAFAKELTDVLATERPAAKLTEYRHLWVDLSHMMQQLGKAYSNMY  306

Query  300  TILTIYLFFSLTLSIYGLFSQL-QDGLTIKDAGLTLSACSNIILLHFICDQAHAASQHVR  358
             I  + +FF+  ++ YG  S++ + G T K+ GL +     + LL  IC++AH AS+ V 
Sbjct  307  GIYCLVIFFTTIIATYGSLSEIIEHGATYKEVGLFVIVFYCMSLLFIICNEAHHASKRVG  366

Query  359  VHFQKKLLLVEISDLNPDAQTEIDMFLRATEMNPSDMSLGGFFDVNRNLFKSFLGTMVTY  418
            ++FQ++LL V ++ ++   Q E++MFL A + NP  M+L G+ ++NR L  S +  M TY
Sbjct  367  LNFQERLLNVNLTAVDKATQKEVEMFLVAIDKNPPTMNLDGYANINRGLITSNISFMATY  426

Query  419  LVVLLQFQISL  429
            LVVL+QF+++L
Sbjct  427  LVVLMQFKLTL  437



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584749.2 ras-related protein Rab-39A isoform X1 [Cephus
cinctus]

Length=221
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3Q0_DROME  unnamed protein product                                 322     4e-113
Q8SYS5_DROME  unnamed protein product                                 320     4e-112
O18333_DROME  unnamed protein product                                 160     3e-49 


>Q9W3Q0_DROME unnamed protein product
Length=218

 Score = 322 bits (826),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 171/198 (86%), Gaps = 6/198 (3%)

Query  30   GRTTVQKCF------ELSDPTVGVDFFARLIEVKDGTRIKLQLWDTAGQERFRSITKSYY  83
            G++++ K F      ELSDPTVGVDFFARLIE+KDGT+IKLQLWDTAGQERFRSITKSYY
Sbjct  21   GKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYY  80

Query  84   RNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFALVGCKLDLVSNGGRREVSKE  143
            RNSVG LLVYD+ N ASFEHIP WMMEA+RHIEPHRPVFALVGCKLDL++ GG REV+ E
Sbjct  81   RNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFALVGCKLDLINAGGHREVTTE  140

Query  144  EARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRILTGEYKIEDGWDGIKTGFARP  203
            EA+ FA QHG+H +ETSA++G NVEEAF+ VTQEVY RI +GEYK EDGWDGIK+GF+RP
Sbjct  141  EAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRP  200

Query  204  GGLDFNLVEAEPTKSSCC  221
              LDFNLV AEP KSSCC
Sbjct  201  NSLDFNLVVAEPEKSSCC  218


>Q8SYS5_DROME unnamed protein product
Length=218

 Score = 320 bits (819),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 150/198 (76%), Positives = 170/198 (86%), Gaps = 6/198 (3%)

Query  30   GRTTVQKCF------ELSDPTVGVDFFARLIEVKDGTRIKLQLWDTAGQERFRSITKSYY  83
            G++++ K F      ELSDPTVGVDFFARLIE+KDGT+IKLQLWDTAGQERFRSITKSYY
Sbjct  21   GKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIKLQLWDTAGQERFRSITKSYY  80

Query  84   RNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFALVGCKLDLVSNGGRREVSKE  143
            RNSVG LLVYD+ N ASFEHIP WMMEA+RHIEPHR VFALVGCKLDL++ GG REV+ E
Sbjct  81   RNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRSVFALVGCKLDLINAGGHREVTTE  140

Query  144  EARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRILTGEYKIEDGWDGIKTGFARP  203
            EA+ FA QHG+H +ETSA++G NVEEAF+ VTQEVY RI +GEYK EDGWDGIK+GF+RP
Sbjct  141  EAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDGWDGIKSGFSRP  200

Query  204  GGLDFNLVEAEPTKSSCC  221
              LDFNLV AEP KSSCC
Sbjct  201  NSLDFNLVVAEPEKSSCC  218


>O18333_DROME unnamed protein product
Length=213

 Score = 160 bits (405),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 109/158 (69%), Gaps = 5/158 (3%)

Query  42   DPTVGVDFFARLIEVKDGTRIKLQLWDTAGQERFRSITKSYYRNSVGALLVYDVCNRASF  101
            D T+GV+F AR+I + DG +IKLQ+WDTAGQE FRSIT+SYYR + GALLVYD+  R +F
Sbjct  36   DLTIGVEFGARMITI-DGKQIKLQIWDTAGQEAFRSITRSYYRGAAGALLVYDITRRETF  94

Query  102  EHIPQWMMEARRHIEPHRPVFALVGCKLDLVSNGGRREVSKEEARAFADQHGVHHIETSA  161
             H+  W+ +AR+H   +  V  L+G K DL S   RREV KEE  AFA +HG+  +ETSA
Sbjct  95   NHLTTWLEDARQHSNSNM-VIMLIGNKSDLDS---RREVKKEEGEAFAREHGLVFMETSA  150

Query  162  KTGINVEEAFKTVTQEVYNRILTGEYKIEDGWDGIKTG  199
            +T  NVEEAF    +E+Y +I  G + I +  +GIK G
Sbjct  151  RTAANVEEAFINTAKEIYEKIQEGVFDINNEANGIKIG  188



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


Query= XP_015584751.1 lysM and putative peptidoglycan-binding
domain-containing protein 3 [Cephus cinctus]

Length=266
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2L003_CAEEL  unnamed protein product                                 30.4    1.8  
G5EF22_CAEEL  unnamed protein product                                 26.9    4.1  
D0UGE6_DROME  unnamed protein product                                 29.3    5.0  


>H2L003_CAEEL unnamed protein product
Length=840

 Score = 30.4 bits (67),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 17/61 (28%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  56   TSSPPRKVEVIKIQ----IKPEDTLQALALKYRCTISELKRINNIHKENEIYAHRVIKVP  111
            +S PP   ++   Q    I   DTL+ +A  + CT+ EL ++N +     ++  + I VP
Sbjct  8    SSVPPGSAKIPAFQMDYTITETDTLERVAASHDCTVGELMKLNKM-ASRMVFPGQKILVP  66

Query  112  I  112
            +
Sbjct  67   L  67


>G5EF22_CAEEL unnamed protein product
Length=67

 Score = 26.9 bits (58),  Expect = 4.1, Method: Composition-based stats.
 Identities = 14/36 (39%), Positives = 19/36 (53%), Gaps = 1/36 (3%)

Query  3   KKSINSGNEQKNIRQSAYIRSGQRESSPHYVLLYSD  38
           ++ + S   Q   R S YIR G+R   P+  LLY D
Sbjct  29  RRQVASEKRQPKAR-SGYIRFGKRRVDPNAELLYLD  63


>D0UGE6_DROME unnamed protein product
Length=2819

 Score = 29.3 bits (64),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 9/56 (16%)

Query  7    NSGNEQKNIRQSAYIRSGQRESSPHYVLLYSDD--------ENSGDEENIPLKPQT  54
             SG E+K+++ +A     + E+ P    + SD+        E SGDEE + LKP T
Sbjct  511  GSGEEEKDVKVTAAPEETEDEAKPTSAPVASDEKEQEPKPSEGSGDEE-LDLKPTT  565



Lambda      K        H
   0.317    0.131    0.368 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5340290880


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584752.1 ras-related protein Rab-39B isoform X2 [Cephus
cinctus]

Length=218
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3Q0_DROME  unnamed protein product                                 388     4e-139
Q8SYS5_DROME  unnamed protein product                                 385     4e-138
O18333_DROME  unnamed protein product                                 191     3e-61 


>Q9W3Q0_DROME unnamed protein product
Length=218

 Score = 388 bits (996),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)

Query  1    MVEPIFDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIK  60
            MVEPIF+YQFRLILIGDSTVGKSSLLK+FTDGKFAELSDPTVGVDFFARLIE+KDGT+IK
Sbjct  1    MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIK  60

Query  61   LQLWDTAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFA  120
            LQLWDTAGQERFRSITKSYYRNSVG LLVYD+ N ASFEHIP WMMEA+RHIEPHRPVFA
Sbjct  61   LQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFA  120

Query  121  LVGCKLDLVSNGGRREVSKEEARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRIL  180
            LVGCKLDL++ GG REV+ EEA+ FA QHG+H +ETSA++G NVEEAF+ VTQEVY RI 
Sbjct  121  LVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIR  180

Query  181  TGEYKIEDGWDGIKTGFARPGGLDFNLVEAEPTKSSCC  218
            +GEYK EDGWDGIK+GF+RP  LDFNLV AEP KSSCC
Sbjct  181  SGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC  218


>Q8SYS5_DROME unnamed protein product
Length=218

 Score = 385 bits (989),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)

Query  1    MVEPIFDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIK  60
            MVEPIF+YQFRLILIGDSTVGKSSLLK+FTDGKFAELSDPTVGVDFFARLIE+KDGT+IK
Sbjct  1    MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIK  60

Query  61   LQLWDTAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFA  120
            LQLWDTAGQERFRSITKSYYRNSVG LLVYD+ N ASFEHIP WMMEA+RHIEPHR VFA
Sbjct  61   LQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRSVFA  120

Query  121  LVGCKLDLVSNGGRREVSKEEARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRIL  180
            LVGCKLDL++ GG REV+ EEA+ FA QHG+H +ETSA++G NVEEAF+ VTQEVY RI 
Sbjct  121  LVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIR  180

Query  181  TGEYKIEDGWDGIKTGFARPGGLDFNLVEAEPTKSSCC  218
            +GEYK EDGWDGIK+GF+RP  LDFNLV AEP KSSCC
Sbjct  181  SGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC  218


>O18333_DROME unnamed protein product
Length=213

 Score = 191 bits (484),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 131/191 (69%), Gaps = 5/191 (3%)

Query  6    FDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIKLQLWD  65
            + Y F+ I+IGD+ VGKS LL  FTD +F  + D T+GV+F AR+I + DG +IKLQ+WD
Sbjct  3    YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI-DGKQIKLQIWD  61

Query  66   TAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFALVGCK  125
            TAGQE FRSIT+SYYR + GALLVYD+  R +F H+  W+ +AR+H   +  V  L+G K
Sbjct  62   TAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNM-VIMLIGNK  120

Query  126  LDLVSNGGRREVSKEEARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRILTGEYK  185
             DL S   RREV KEE  AFA +HG+  +ETSA+T  NVEEAF    +E+Y +I  G + 
Sbjct  121  SDLDS---RREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFD  177

Query  186  IEDGWDGIKTG  196
            I +  +GIK G
Sbjct  178  INNEANGIKIG  188



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584753.1 ras-related protein Rab-39B isoform X2 [Cephus
cinctus]

Length=218
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3Q0_DROME  unnamed protein product                                 388     4e-139
Q8SYS5_DROME  unnamed protein product                                 385     4e-138
O18333_DROME  unnamed protein product                                 191     3e-61 


>Q9W3Q0_DROME unnamed protein product
Length=218

 Score = 388 bits (996),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 199/218 (91%), Gaps = 0/218 (0%)

Query  1    MVEPIFDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIK  60
            MVEPIF+YQFRLILIGDSTVGKSSLLK+FTDGKFAELSDPTVGVDFFARLIE+KDGT+IK
Sbjct  1    MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIK  60

Query  61   LQLWDTAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFA  120
            LQLWDTAGQERFRSITKSYYRNSVG LLVYD+ N ASFEHIP WMMEA+RHIEPHRPVFA
Sbjct  61   LQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFA  120

Query  121  LVGCKLDLVSNGGRREVSKEEARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRIL  180
            LVGCKLDL++ GG REV+ EEA+ FA QHG+H +ETSA++G NVEEAF+ VTQEVY RI 
Sbjct  121  LVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIR  180

Query  181  TGEYKIEDGWDGIKTGFARPGGLDFNLVEAEPTKSSCC  218
            +GEYK EDGWDGIK+GF+RP  LDFNLV AEP KSSCC
Sbjct  181  SGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC  218


>Q8SYS5_DROME unnamed protein product
Length=218

 Score = 385 bits (989),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 180/218 (83%), Positives = 198/218 (91%), Gaps = 0/218 (0%)

Query  1    MVEPIFDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIK  60
            MVEPIF+YQFRLILIGDSTVGKSSLLK+FTDGKFAELSDPTVGVDFFARLIE+KDGT+IK
Sbjct  1    MVEPIFEYQFRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLIEMKDGTQIK  60

Query  61   LQLWDTAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFA  120
            LQLWDTAGQERFRSITKSYYRNSVG LLVYD+ N ASFEHIP WMMEA+RHIEPHR VFA
Sbjct  61   LQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRSVFA  120

Query  121  LVGCKLDLVSNGGRREVSKEEARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRIL  180
            LVGCKLDL++ GG REV+ EEA+ FA QHG+H +ETSA++G NVEEAF+ VTQEVY RI 
Sbjct  121  LVGCKLDLINAGGHREVTTEEAQKFAKQHGLHFVETSARSGANVEEAFRMVTQEVYARIR  180

Query  181  TGEYKIEDGWDGIKTGFARPGGLDFNLVEAEPTKSSCC  218
            +GEYK EDGWDGIK+GF+RP  LDFNLV AEP KSSCC
Sbjct  181  SGEYKAEDGWDGIKSGFSRPNSLDFNLVVAEPEKSSCC  218


>O18333_DROME unnamed protein product
Length=213

 Score = 191 bits (484),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 131/191 (69%), Gaps = 5/191 (3%)

Query  6    FDYQFRLILIGDSTVGKSSLLKYFTDGKFAELSDPTVGVDFFARLIEVKDGTRIKLQLWD  65
            + Y F+ I+IGD+ VGKS LL  FTD +F  + D T+GV+F AR+I + DG +IKLQ+WD
Sbjct  3    YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITI-DGKQIKLQIWD  61

Query  66   TAGQERFRSITKSYYRNSVGALLVYDVCNRASFEHIPQWMMEARRHIEPHRPVFALVGCK  125
            TAGQE FRSIT+SYYR + GALLVYD+  R +F H+  W+ +AR+H   +  V  L+G K
Sbjct  62   TAGQEAFRSITRSYYRGAAGALLVYDITRRETFNHLTTWLEDARQHSNSNM-VIMLIGNK  120

Query  126  LDLVSNGGRREVSKEEARAFADQHGVHHIETSAKTGINVEEAFKTVTQEVYNRILTGEYK  185
             DL S   RREV KEE  AFA +HG+  +ETSA+T  NVEEAF    +E+Y +I  G + 
Sbjct  121  SDLDS---RREVKKEEGEAFAREHGLVFMETSARTAANVEEAFINTAKEIYEKIQEGVFD  177

Query  186  IEDGWDGIKTG  196
            I +  +GIK G
Sbjct  178  INNEANGIKIG  188



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584754.1 uncharacterized protein LOC107262749 [Cephus cinctus]

Length=842
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ZN423_DROME  unnamed protein product                                  40.0    0.010
A0A0B4JD76_DROME  unnamed protein product                             40.0    0.010
SUHW_DROME  unnamed protein product                                   39.7    0.011


>ZN423_DROME unnamed protein product
Length=1228

 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 46/101 (46%), Gaps = 10/101 (10%)

Query  610  LQCEHCSRNFRQQRALDTHSRVCPKSPTNAHKTQERAARTAIDRSNGNDVDEK-QAVKKQ  668
             +CE+CS+ F+ +R+ D H ++     TN    +      A  RS+   +  K   ++K 
Sbjct  182  FKCEYCSKLFKHKRSRDRHKKL----HTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKP  237

Query  669  YTCKVCQEKFDVVVALARHARTNHSQRKKGRPAKIAIETKP  709
            + C +C   ++   AL     T+H Q+ K   A +A    P
Sbjct  238  FQCSMCNRGYNTAAAL-----TSHMQKHKKNAAILAAGGNP  273


 Score = 33.5 bits (75),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 1/51 (2%)

Query  657   NDVDEKQAVKKQYTCKVCQEKFDVVVALARHARTNHSQRKKGRPAKIAIET  707
             N + E  A  + Y C +C EKF     L  H R  H  R + RP    +E 
Sbjct  1106  NHMGEHGAHSRPYDCNLCPEKFFFRAELEHHQR-GHELRPQARPPAAKVEV  1155


 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (44%), Gaps = 4/57 (7%)

Query  750  CTDCGRWFPSAASLSAHCLQHATKMSEQQRRRCQTCKKLIKSRSLYIRHIKMHSKAR  806
            C  C + FP    L  H   HA    E    +C+ C KL K +    RH K+H+  R
Sbjct  156  CQFCEKTFPRLGYLKHHVQSHA----EHLPFKCEYCSKLFKHKRSRDRHKKLHTNER  208


>A0A0B4JD76_DROME unnamed protein product
Length=1366

 Score = 40.0 bits (92),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 26/101 (26%), Positives = 46/101 (46%), Gaps = 10/101 (10%)

Query  610  LQCEHCSRNFRQQRALDTHSRVCPKSPTNAHKTQERAARTAIDRSNGNDVDEK-QAVKKQ  668
             +CE+CS+ F+ +R+ D H ++     TN    +      A  RS+   +  K   ++K 
Sbjct  320  FKCEYCSKLFKHKRSRDRHKKL----HTNERNYKCPHCEAAFSRSDHLKIHMKTHDIQKP  375

Query  669  YTCKVCQEKFDVVVALARHARTNHSQRKKGRPAKIAIETKP  709
            + C +C   ++   AL     T+H Q+ K   A +A    P
Sbjct  376  FQCSMCNRGYNTAAAL-----TSHMQKHKKNAAILAAGGNP  411


 Score = 33.5 bits (75),  Expect = 0.97, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 22/51 (43%), Gaps = 1/51 (2%)

Query  657   NDVDEKQAVKKQYTCKVCQEKFDVVVALARHARTNHSQRKKGRPAKIAIET  707
             N + E  A  + Y C +C EKF     L  H R  H  R + RP    +E 
Sbjct  1244  NHMGEHGAHSRPYDCNLCPEKFFFRAELEHHQR-GHELRPQARPPAAKVEV  1293


 Score = 33.1 bits (74),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 25/57 (44%), Gaps = 4/57 (7%)

Query  750  CTDCGRWFPSAASLSAHCLQHATKMSEQQRRRCQTCKKLIKSRSLYIRHIKMHSKAR  806
            C  C + FP    L  H   HA    E    +C+ C KL K +    RH K+H+  R
Sbjct  294  CQFCEKTFPRLGYLKHHVQSHA----EHLPFKCEYCSKLFKHKRSRDRHKKLHTNER  346


>SUHW_DROME unnamed protein product
Length=941

 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 57/146 (39%), Gaps = 29/146 (20%)

Query  667  KQYTCKVCQEKFDVVVALARHARTNHSQRKKGRPAKIAIETKPETPPLPEPPTPEEEKRI  726
            K + C +C +KF  +VAL +H R +  +    +P    +  +               K +
Sbjct  439  KPFDCDLCDKKFSALVALKKHRRYHTGE----KPYSCTVCNQAFAV-----------KEV  483

Query  727  VVQKTRKKKNQSPNRIWNVKKLSCTDCGRWFPSAASLSAHCLQHATKMSEQQRRRCQTCK  786
            + +  ++   + P++        C +CG+ F  A  L  H   H           C+ C 
Sbjct  484  LNRHMKRHTGERPHK--------CDECGKSFIQATQLRTHSKTHIRPFP------CEQCD  529

Query  787  KLIKSRSLYIRHIKMHSKARTSVKSV  812
            +  K+     RH+K HS+ +  V S 
Sbjct  530  EKFKTEKQLERHVKTHSRTKRPVFSC  555


 Score = 37.0 bits (84),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 25/84 (30%), Positives = 33/84 (39%), Gaps = 16/84 (19%)

Query  609  VLQCEHCSRNFRQQRALDTHSRVCPKSPTNAHKTQERAARTAIDRSNGNDVDEKQAVKKQ  668
            V  C  C RNFR    L  H      SP    K Q  + R+A+             + ++
Sbjct  552  VFSCAECKRNFRTPALLKEHMDEGKHSP----KQQRSSMRSAV------------KIMER  595

Query  669  YTCKVCQEKFDVVVALARHARTNH  692
              C +C + FD    L RH RT H
Sbjct  596  TDCAICDKNFDSSDTLRRHIRTVH  619


 Score = 35.0 bits (79),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 1/57 (2%)

Query  748  LSCTDCGRWFPSAASLSAHCLQH-ATKMSEQQRRRCQTCKKLIKSRSLYIRHIKMHS  803
            +SC  C R F    +L +H  QH  T++ ++    C TCK    S S    HI+ H+
Sbjct  380  MSCKVCDRVFYRLDNLRSHLKQHLGTQVVKKPEYMCHTCKNCFYSLSTLNIHIRTHT  436



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584755.1 Y+L amino acid transporter 2 [Cephus cinctus]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VB75_DROME  unnamed protein product                                 695     0.0   
Q9Y1A7_DROME  unnamed protein product                                 531     0.0   
Q9VKC2_DROME  unnamed protein product                                 452     2e-155


>Q9VB75_DROME unnamed protein product
Length=517

 Score = 695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 404/484 (83%), Gaps = 1/484 (0%)

Query  17   NSAGDAKFTVNGDDQKVGKVRMKKQLGLLEGVAIILGIIFGSGIFVSPKGVIQEVGSVGL  76
            N A  A+      +    +V +KKQLGLLEGVAIILGIIFGSGIFVSPKGVI+EV SVG 
Sbjct  34   NPAEKAQCREGSAESDSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGA  93

Query  77   SLIIWVLCGLLSMVGALCYAELGTSIPRSGGDYAYIHEAFGALPSFLYLWAANLIFVPTT  136
            SL+IWVLCGLLSM+GALCYAELGT+IP+SGGDYAYI EA+G+LP+FLYLW A +IFVPTT
Sbjct  94   SLVIWVLCGLLSMIGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTT  153

Query  137  NAIMGLTFAQYVLQPFFPN-CPIPDAGVRLIAALTICLLTFVNCYDVKETSKMQNVFMFA  195
            NAIMGLTFA YVL+PFF   C IP   ++L+AA+TIC LT++N Y +K T+KMQNV MF 
Sbjct  154  NAIMGLTFASYVLEPFFGGACEIPKIALQLLAAITICFLTYLNSYYMKVTTKMQNVIMFT  213

Query  196  KIAALVIIIIAGLTWLMMGHAENFENAFEGTTTDPGKIAVAFYSGIFSYSGWNYLNFMTE  255
            KIAALV+II+ GL W+MMG+ ENF   F+ T TDPGK++VAFYSGIFSY+GWNYLNFMTE
Sbjct  214  KIAALVLIILVGLVWMMMGNVENFTRPFDNTETDPGKMSVAFYSGIFSYAGWNYLNFMTE  273

Query  256  ELKDPYVNLPRAIYISLPLVTLIYVLANIAYLSVLTPTAMISSHAIAVTLGDQLLGVMAW  315
            EL+DPY NLPRAIYISLPLVT IYVLAN+AYL+VL+P+ MI+S+AIAVT GD++LGV + 
Sbjct  274  ELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMIASNAIAVTFGDKILGVFSL  333

Query  316  TIPLMVAVSAFGGLSVHIMTSSRMCFVGARNGHFPSMLSHINVRRLTPTPALVFLCILSL  375
             IPLMVA+SAFGGLSVHIMTSSR+CFVGARNGH P++LSHI+V+  TP P+LVFLC LS+
Sbjct  334  IIPLMVAISAFGGLSVHIMTSSRICFVGARNGHMPAILSHISVKSYTPLPSLVFLCFLSI  393

Query  376  MMLCTSDVFVLITYCSIVESFFIMLSVAGILWLRYKQPNMMRPIKVSLWVPITFVVVCAF  435
            +ML  SDV+VLITY SIVESFFIMLSV+ +L+ RY +P M RPIKV++W+P  FV+VCAF
Sbjct  394  VMLVVSDVYVLITYASIVESFFIMLSVSAVLYFRYTRPCMERPIKVAMWIPALFVIVCAF  453

Query  436  LVLVPCYERPYEVGMGAVITLSGIPAYYMGVVWTQRPRGFQNLNVKATHTIQKLFMSARE  495
            LV+VP Y  PYEVGMG +IT+ GIP YY+GVVW  +P+  Q+     T T QKLFMSA+E
Sbjct  454  LVVVPIYVAPYEVGMGVLITIIGIPFYYVGVVWKNKPKWVQSTIDSVTFTCQKLFMSAKE  513

Query  496  ERDD  499
            E++D
Sbjct  514  EKED  517


>Q9Y1A7_DROME unnamed protein product
Length=499

 Score = 531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 351/464 (76%), Gaps = 9/464 (2%)

Query  3    KQVTHESPSEIQLMNSAGDAKFTVNGDDQKVGKVRMKKQLGLLEGVAIILGIIFGSGIFV  62
            +QV    P+E    NS  D+    +G       V++KKQ+GLL+GVAII+G+I GSGIFV
Sbjct  13   RQVFEVPPAEPN--NSTADSGSQGSG-------VKLKKQIGLLDGVAIIVGVIVGSGIFV  63

Query  63   SPKGVIQEVGSVGLSLIIWVLCGLLSMVGALCYAELGTSIPRSGGDYAYIHEAFGALPSF  122
            SPKGV++  GS+G SLI+WVL G+LSMVGALCYAELGT IP+SGGDYAYI  AFG LP+F
Sbjct  64   SPKGVLKFSGSIGQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAF  123

Query  123  LYLWAANLIFVPTTNAIMGLTFAQYVLQPFFPNCPIPDAGVRLIAALTICLLTFVNCYDV  182
            LYLW A LI VPT NAI  LTFA Y+L+PF+P+C  P   V+L+AA  IC+LT +NCY+V
Sbjct  124  LYLWVALLILVPTGNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCYNV  183

Query  183  KETSKMQNVFMFAKIAALVIIIIAGLTWLMMGHAENFENAFEGTTTDPGKIAVAFYSGIF  242
            K  +++ ++F   K+ AL++I+ AG+ WL  G+ E+++N F G   DPG IA+AFYSG+F
Sbjct  184  KWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLF  243

Query  243  SYSGWNYLNFMTEELKDPYVNLPRAIYISLPLVTLIYVLANIAYLSVLTPTAMISSHAIA  302
            SYSGWNYLNF+TEELKDPY NLP+AI IS+P+VT+IY++ NIAY SVL+P  ++SS A+A
Sbjct  244  SYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEILSSDAVA  303

Query  303  VTLGDQLLGVMAWTIPLMVAVSAFGGLSVHIMTSSRMCFVGARNGHFPSMLSHINVRRLT  362
            VT GD++LG M+W +P  VA S FG L+  I  SSR+ FVGARNGH P+ +S INV  LT
Sbjct  304  VTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLT  363

Query  363  PTPALVFLCILSLMMLCTSDVFVLITYCSIVESFFIMLSVAGILWLRYKQPNMMRPIKVS  422
            P P+L+FL +L+L++L   DV+VLI Y S VE+ F ++SV+G+LW+RYKQP   RPIKV+
Sbjct  364  PVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRYKQPKTERPIKVN  423

Query  423  LWVPITFVVVCAFLVLVPCYERPYEVGMGAVITLSGIPAYYMGV  466
            L +PI +++VC FLV+  C + PY VG+G +I LSGIP YY+ +
Sbjct  424  LALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTI  467


>Q9VKC2_DROME unnamed protein product
Length=500

 Score = 452 bits (1162),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 322/465 (69%), Gaps = 1/465 (0%)

Query  35   KVRMKKQLGLLEGVAIILGIIFGSGIFVSPKGVIQEVGSVGLSLIIWVLCGLLSMVGALC  94
            K+ +K++L L+ GVAII+G I GSGIF++P GV     SVG SL+IW+ CG+LS +GALC
Sbjct  34   KIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLIWLTCGILSTIGALC  93

Query  95   YAELGTSIPRSGGDYAYIHEAFGALPSFLYLWAANLIFVPTTNAIMGLTFAQYVLQPFFP  154
            YAELGT I RSGGDYAY+  +FG L  FL LW A LI  PTT  I+ L+FA Y ++PFFP
Sbjct  94   YAELGTCITRSGGDYAYLLVSFGPLVGFLRLWIALLIIRPTTQTIVALSFAHYAVKPFFP  153

Query  155  NCPIPDAGVRLIAALTICLLTFVNCYDVKETSKMQNVFMFAKIAALVIIIIAGLTWLMMG  214
             C  P   V+L+AA+ + LLT +NC  VK + K+Q+VF   K+ AL++II++GL ++  G
Sbjct  154  ECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIMIILSGLYYMATG  213

Query  215  HAENFENAFEGTTTDPGKIAVAFYSGIFSYSGWNYLNFMTEELKDPYVNLPRAIYISLPL  274
              ENF N +EG  T    I  AFYSG+F++ GWNYLNF+TEEL+DPY NLPRAI+I++PL
Sbjct  214  ELENFRNPWEGIYTA-RNIGYAFYSGLFAFGGWNYLNFVTEELQDPYKNLPRAIWIAMPL  272

Query  275  VTLIYVLANIAYLSVLTPTAMISSHAIAVTLGDQLLGVMAWTIPLMVAVSAFGGLSVHIM  334
            VT IYVL N+AY +V+    M+SS A+AVT G+++ G +A+ +P+ VA+S FGG++  + 
Sbjct  273  VTSIYVLVNLAYFAVVNKPEMLSSLAVAVTFGNRVFGPLAFMVPIFVALSTFGGVNGVLF  332

Query  335  TSSRMCFVGARNGHFPSMLSHINVRRLTPTPALVFLCILSLMMLCTSDVFVLITYCSIVE  394
            TS+R+   GA+ GH P      +V++ TP P+L+F C++SL+ML T +V+ LI Y S V 
Sbjct  333  TSARLFATGAQEGHLPKFFQLFHVKQQTPIPSLIFTCLMSLLMLLTDNVYQLINYFSSVL  392

Query  395  SFFIMLSVAGILWLRYKQPNMMRPIKVSLWVPITFVVVCAFLVLVPCYERPYEVGMGAVI  454
               ++ S+AG+LWLR+K+P++ RPIKV L +PITF+V C  LVL+P  E P  + +G  I
Sbjct  393  WLSVVASIAGMLWLRHKRPDLPRPIKVHLALPITFMVSCVTLVLLPNLEEPQNLLIGIGI  452

Query  455  TLSGIPAYYMGVVWTQRPRGFQNLNVKATHTIQKLFMSAREERDD  499
            TL+GIP YY  +   ++P+ +  L+       + +F +   E ++
Sbjct  453  TLAGIPFYYAFIARKKKPKCYGRLSNSVVEICRAIFNTTIIESNE  497



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584756.1 Y+L amino acid transporter 2 [Cephus cinctus]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VB75_DROME  unnamed protein product                                 695     0.0   
Q9Y1A7_DROME  unnamed protein product                                 531     0.0   
Q9VKC2_DROME  unnamed protein product                                 452     2e-155


>Q9VB75_DROME unnamed protein product
Length=517

 Score = 695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 404/484 (83%), Gaps = 1/484 (0%)

Query  17   NSAGDAKFTVNGDDQKVGKVRMKKQLGLLEGVAIILGIIFGSGIFVSPKGVIQEVGSVGL  76
            N A  A+      +    +V +KKQLGLLEGVAIILGIIFGSGIFVSPKGVI+EV SVG 
Sbjct  34   NPAEKAQCREGSAESDSSRVVIKKQLGLLEGVAIILGIIFGSGIFVSPKGVIREVESVGA  93

Query  77   SLIIWVLCGLLSMVGALCYAELGTSIPRSGGDYAYIHEAFGALPSFLYLWAANLIFVPTT  136
            SL+IWVLCGLLSM+GALCYAELGT+IP+SGGDYAYI EA+G+LP+FLYLW A +IFVPTT
Sbjct  94   SLVIWVLCGLLSMIGALCYAELGTAIPKSGGDYAYIFEAYGSLPAFLYLWDAMMIFVPTT  153

Query  137  NAIMGLTFAQYVLQPFFPN-CPIPDAGVRLIAALTICLLTFVNCYDVKETSKMQNVFMFA  195
            NAIMGLTFA YVL+PFF   C IP   ++L+AA+TIC LT++N Y +K T+KMQNV MF 
Sbjct  154  NAIMGLTFASYVLEPFFGGACEIPKIALQLLAAITICFLTYLNSYYMKVTTKMQNVIMFT  213

Query  196  KIAALVIIIIAGLTWLMMGHAENFENAFEGTTTDPGKIAVAFYSGIFSYSGWNYLNFMTE  255
            KIAALV+II+ GL W+MMG+ ENF   F+ T TDPGK++VAFYSGIFSY+GWNYLNFMTE
Sbjct  214  KIAALVLIILVGLVWMMMGNVENFTRPFDNTETDPGKMSVAFYSGIFSYAGWNYLNFMTE  273

Query  256  ELKDPYVNLPRAIYISLPLVTLIYVLANIAYLSVLTPTAMISSHAIAVTLGDQLLGVMAW  315
            EL+DPY NLPRAIYISLPLVT IYVLAN+AYL+VL+P+ MI+S+AIAVT GD++LGV + 
Sbjct  274  ELRDPYRNLPRAIYISLPLVTGIYVLANVAYLAVLSPSEMIASNAIAVTFGDKILGVFSL  333

Query  316  TIPLMVAVSAFGGLSVHIMTSSRMCFVGARNGHFPSMLSHINVRRLTPTPALVFLCILSL  375
             IPLMVA+SAFGGLSVHIMTSSR+CFVGARNGH P++LSHI+V+  TP P+LVFLC LS+
Sbjct  334  IIPLMVAISAFGGLSVHIMTSSRICFVGARNGHMPAILSHISVKSYTPLPSLVFLCFLSI  393

Query  376  MMLCTSDVFVLITYCSIVESFFIMLSVAGILWLRYKQPNMMRPIKVSLWVPITFVVVCAF  435
            +ML  SDV+VLITY SIVESFFIMLSV+ +L+ RY +P M RPIKV++W+P  FV+VCAF
Sbjct  394  VMLVVSDVYVLITYASIVESFFIMLSVSAVLYFRYTRPCMERPIKVAMWIPALFVIVCAF  453

Query  436  LVLVPCYERPYEVGMGAVITLSGIPAYYMGVVWTQRPRGFQNLNVKATHTIQKLFMSARE  495
            LV+VP Y  PYEVGMG +IT+ GIP YY+GVVW  +P+  Q+     T T QKLFMSA+E
Sbjct  454  LVVVPIYVAPYEVGMGVLITIIGIPFYYVGVVWKNKPKWVQSTIDSVTFTCQKLFMSAKE  513

Query  496  ERDD  499
            E++D
Sbjct  514  EKED  517


>Q9Y1A7_DROME unnamed protein product
Length=499

 Score = 531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/464 (57%), Positives = 351/464 (76%), Gaps = 9/464 (2%)

Query  3    KQVTHESPSEIQLMNSAGDAKFTVNGDDQKVGKVRMKKQLGLLEGVAIILGIIFGSGIFV  62
            +QV    P+E    NS  D+    +G       V++KKQ+GLL+GVAII+G+I GSGIFV
Sbjct  13   RQVFEVPPAEPN--NSTADSGSQGSG-------VKLKKQIGLLDGVAIIVGVIVGSGIFV  63

Query  63   SPKGVIQEVGSVGLSLIIWVLCGLLSMVGALCYAELGTSIPRSGGDYAYIHEAFGALPSF  122
            SPKGV++  GS+G SLI+WVL G+LSMVGALCYAELGT IP+SGGDYAYI  AFG LP+F
Sbjct  64   SPKGVLKFSGSIGQSLIVWVLSGVLSMVGALCYAELGTMIPKSGGDYAYIGTAFGPLPAF  123

Query  123  LYLWAANLIFVPTTNAIMGLTFAQYVLQPFFPNCPIPDAGVRLIAALTICLLTFVNCYDV  182
            LYLW A LI VPT NAI  LTFA Y+L+PF+P+C  P   V+L+AA  IC+LT +NCY+V
Sbjct  124  LYLWVALLILVPTGNAITALTFAIYLLKPFWPSCDAPIEAVQLLAAAMICVLTLINCYNV  183

Query  183  KETSKMQNVFMFAKIAALVIIIIAGLTWLMMGHAENFENAFEGTTTDPGKIAVAFYSGIF  242
            K  +++ ++F   K+ AL++I+ AG+ WL  G+ E+++N F G   DPG IA+AFYSG+F
Sbjct  184  KWVTRVTDIFTGTKVVALLVIVGAGVWWLFDGNTEHWDNPFSGGLQDPGYIALAFYSGLF  243

Query  243  SYSGWNYLNFMTEELKDPYVNLPRAIYISLPLVTLIYVLANIAYLSVLTPTAMISSHAIA  302
            SYSGWNYLNF+TEELKDPY NLP+AI IS+P+VT+IY++ NIAY SVL+P  ++SS A+A
Sbjct  244  SYSGWNYLNFVTEELKDPYRNLPKAICISMPVVTVIYMITNIAYFSVLSPDEILSSDAVA  303

Query  303  VTLGDQLLGVMAWTIPLMVAVSAFGGLSVHIMTSSRMCFVGARNGHFPSMLSHINVRRLT  362
            VT GD++LG M+W +P  VA S FG L+  I  SSR+ FVGARNGH P+ +S INV  LT
Sbjct  304  VTFGDKMLGYMSWIMPFAVACSTFGSLNGAIFASSRLFFVGARNGHLPAAISLINVNCLT  363

Query  363  PTPALVFLCILSLMMLCTSDVFVLITYCSIVESFFIMLSVAGILWLRYKQPNMMRPIKVS  422
            P P+L+FL +L+L++L   DV+VLI Y S VE+ F ++SV+G+LW+RYKQP   RPIKV+
Sbjct  364  PVPSLIFLGVLTLLLLFIEDVYVLINYVSYVEALFTLISVSGLLWMRYKQPKTERPIKVN  423

Query  423  LWVPITFVVVCAFLVLVPCYERPYEVGMGAVITLSGIPAYYMGV  466
            L +PI +++VC FLV+  C + PY VG+G +I LSGIP YY+ +
Sbjct  424  LALPIIYLIVCLFLVIFSCTQTPYVVGIGTIIILSGIPVYYLTI  467


>Q9VKC2_DROME unnamed protein product
Length=500

 Score = 452 bits (1162),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 322/465 (69%), Gaps = 1/465 (0%)

Query  35   KVRMKKQLGLLEGVAIILGIIFGSGIFVSPKGVIQEVGSVGLSLIIWVLCGLLSMVGALC  94
            K+ +K++L L+ GVAII+G I GSGIF++P GV     SVG SL+IW+ CG+LS +GALC
Sbjct  34   KIVLKRKLTLINGVAIIVGTIIGSGIFIAPTGVFIYTESVGSSLLIWLTCGILSTIGALC  93

Query  95   YAELGTSIPRSGGDYAYIHEAFGALPSFLYLWAANLIFVPTTNAIMGLTFAQYVLQPFFP  154
            YAELGT I RSGGDYAY+  +FG L  FL LW A LI  PTT  I+ L+FA Y ++PFFP
Sbjct  94   YAELGTCITRSGGDYAYLLVSFGPLVGFLRLWIALLIIRPTTQTIVALSFAHYAVKPFFP  153

Query  155  NCPIPDAGVRLIAALTICLLTFVNCYDVKETSKMQNVFMFAKIAALVIIIIAGLTWLMMG  214
             C  P   V+L+AA+ + LLT +NC  VK + K+Q+VF   K+ AL++II++GL ++  G
Sbjct  154  ECDPPQNAVKLLAAICLTLLTTINCLSVKVSMKVQDVFTVGKLLALIMIILSGLYYMATG  213

Query  215  HAENFENAFEGTTTDPGKIAVAFYSGIFSYSGWNYLNFMTEELKDPYVNLPRAIYISLPL  274
              ENF N +EG  T    I  AFYSG+F++ GWNYLNF+TEEL+DPY NLPRAI+I++PL
Sbjct  214  ELENFRNPWEGIYTA-RNIGYAFYSGLFAFGGWNYLNFVTEELQDPYKNLPRAIWIAMPL  272

Query  275  VTLIYVLANIAYLSVLTPTAMISSHAIAVTLGDQLLGVMAWTIPLMVAVSAFGGLSVHIM  334
            VT IYVL N+AY +V+    M+SS A+AVT G+++ G +A+ +P+ VA+S FGG++  + 
Sbjct  273  VTSIYVLVNLAYFAVVNKPEMLSSLAVAVTFGNRVFGPLAFMVPIFVALSTFGGVNGVLF  332

Query  335  TSSRMCFVGARNGHFPSMLSHINVRRLTPTPALVFLCILSLMMLCTSDVFVLITYCSIVE  394
            TS+R+   GA+ GH P      +V++ TP P+L+F C++SL+ML T +V+ LI Y S V 
Sbjct  333  TSARLFATGAQEGHLPKFFQLFHVKQQTPIPSLIFTCLMSLLMLLTDNVYQLINYFSSVL  392

Query  395  SFFIMLSVAGILWLRYKQPNMMRPIKVSLWVPITFVVVCAFLVLVPCYERPYEVGMGAVI  454
               ++ S+AG+LWLR+K+P++ RPIKV L +PITF+V C  LVL+P  E P  + +G  I
Sbjct  393  WLSVVASIAGMLWLRHKRPDLPRPIKVHLALPITFMVSCVTLVLLPNLEEPQNLLIGIGI  452

Query  455  TLSGIPAYYMGVVWTQRPRGFQNLNVKATHTIQKLFMSAREERDD  499
            TL+GIP YY  +   ++P+ +  L+       + +F +   E ++
Sbjct  453  TLAGIPFYYAFIARKKKPKCYGRLSNSVVEICRAIFNTTIIESNE  497



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584757.1 LDLR chaperone boca [Cephus cinctus]

Length=203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MESD_DROME  unnamed protein product                                   147     5e-45
Q8IG33_CAEEL  unnamed protein product                                 93.2    1e-23
CLOCK_DROME  unnamed protein product                                  32.3    0.25 


>MESD_DROME unnamed protein product
Length=180

 Score = 147 bits (372),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 113/149 (76%), Gaps = 0/149 (0%)

Query  29   SWRDKDITDMNDADLEHLLEEWEKDDEPLEPDELPEHLRPSPKIDLSQIDMSNPDNVLKM  88
            +W  KDI D ++ADLE LL++WE+D+EPLE DELPEHLRP PK+DLS +D  +P+++LK+
Sbjct  28   AWAKKDIRDYSEADLERLLDQWEEDEEPLEDDELPEHLRPQPKLDLSNLDSKSPEDLLKV  87

Query  89   TKKGKGVMMFVDVLEELSEEEADVVMKIWQSSLHNNHIIAERYPIDKKRSVYLFPEGSQA  148
            +KKG+ +M FV V    + EE+D + K+WQ+SL NNHI AERY +D  R+++LF +G+QA
Sbjct  88   SKKGRTLMTFVSVTGNPTREESDTITKLWQTSLWNNHIQAERYMVDDNRAIFLFKDGTQA  147

Query  149  IDAKNYLIEQPELSHITLEGQMYHGKNSK  177
             DAK++LIEQ     +T+E + Y G N+K
Sbjct  148  WDAKDFLIEQERCKGVTIENKEYPGVNAK  176


>Q8IG33_CAEEL unnamed protein product
Length=186

 Score = 93.2 bits (230),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 108/186 (58%), Gaps = 13/186 (7%)

Query  5    MIFLSIFLLLNTNFINESTATTQKSWRDKDITDMNDADLEHLLEEWEKDDEPLEPDELPE  64
            M + ++F+ L    I  +    +K    KD++   DA+LE L EEWE++DE    ++   
Sbjct  1    MKWRTVFIFLLAAHIGLANVKQKK----KDLSSYTDAELEKLYEEWEENDEDELEEDEKP  56

Query  65   -HLRPSPKIDLSQIDMS--NPDNVLKMTKKGKGVMMFVDVLEELSEEEADVV------MK  115
             H R  P++DL  +     +P+++L M+KKG+ +M+FV V++    + +D+        +
Sbjct  57   EHKRKPPQLDLESMKAKAKDPEDLLMMSKKGQTLMLFVGVVDPSQPDRSDIRPFTEKWTQ  116

Query  116  IWQSSLHNNHIIAERYPIDKKRSVYLFPEGSQAIDAKNYLIEQPELSHITLEGQMYHGKN  175
            IWQS L+NNH+  + + ID  R++++F  G QA +AK +L++Q  +S +T+EGQ + G  
Sbjct  117  IWQSQLYNNHVDLQVFVIDDNRAIFMFKNGEQAFEAKKFLLKQEFVSEVTIEGQSFDGPA  176

Query  176  SKAKTA  181
             K KT 
Sbjct  177  KKFKTG  182


>CLOCK_DROME unnamed protein product
Length=1027

 Score = 32.3 bits (72),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 44/95 (46%), Gaps = 9/95 (9%)

Query  7    FLSIFLLLNTNFINESTATTQKSWRDKDITDMNDADLEHLLEEWEKDDEPLEPDELPEHL  66
            F+ +F  + + F    + T+Q  +  +D+ +M   DL      +E D E L    L   +
Sbjct  102  FMMVFSSMGSIFYASESITSQLGYLPQDLYNMTIYDLA-----YEMDHEAL----LNIFM  152

Query  67   RPSPKIDLSQIDMSNPDNVLKMTKKGKGVMMFVDV  101
             P+P I+  Q D+S+ + +   T   +G M  VD 
Sbjct  153  NPTPVIEPRQTDISSSNQITFYTHLRRGGMEKVDA  187



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584758.1 V-type proton ATPase subunit F 1 [Cephus cinctus]

Length=123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VATF1_DROME  unnamed protein product                                  226     4e-78
VATF_CAEEL  unnamed protein product                                   181     3e-60
Q4GYJ5_TRYB2  unnamed protein product                                 89.0    9e-24


>VATF1_DROME unnamed protein product
Length=124

 Score = 226 bits (576),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 107/122 (88%), Positives = 116/122 (95%), Gaps = 0/122 (0%)

Query  1    MALHSAGKGKLLAVIGDEDTCVGFLLGGVGEINKNRQSNFMVVDKNTAVSEIEDTFKRFI  60
            MALHSA KGKL++VIGDEDTCVGFLLGGVGEINKNR  NFMVVDKNTAVSE+ED FKRF+
Sbjct  1    MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVSELEDCFKRFL  60

Query  61   KRDDIDIILINQNIAEMIRHVIDSHTQPIPSVLEIPSKDHPYDASKDSILRRARGMFNPE  120
            KRDDIDIILINQN AE+IRHVID+HT P+P+VLEIPSKDHPYDASKDSILRRARGMFNPE
Sbjct  61   KRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDHPYDASKDSILRRARGMFNPE  120

Query  121  DI  122
            D+
Sbjct  121  DL  122


>VATF_CAEEL unnamed protein product
Length=121

 Score = 181 bits (458),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 0/121 (0%)

Query  3    LHSAGKGKLLAVIGDEDTCVGFLLGGVGEINKNRQSNFMVVDKNTAVSEIEDTFKRFIKR  62
            + SA KGK+LAVIGDEDT VGFLLGGVGE+NK R+ N+++VDK T V EIE+ F  F  R
Sbjct  1    MASAAKGKILAVIGDEDTVVGFLLGGVGELNKARKPNYLIVDKQTTVQEIEEAFNGFCAR  60

Query  63   DDIDIILINQNIAEMIRHVIDSHTQPIPSVLEIPSKDHPYDASKDSILRRARGMFNPEDI  122
            DDI IILINQ+IAEMIR+ +D+HTQ IP+VLEIPSK+ PYD SKDSIL RARG+FNPED 
Sbjct  61   DDIAIILINQHIAEMIRYAVDNHTQSIPAVLEIPSKEAPYDPSKDSILNRARGLFNPEDF  120

Query  123  H  123
             
Sbjct  121  R  121


>Q4GYJ5_TRYB2 unnamed protein product
Length=133

 Score = 89.0 bits (219),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 69/118 (58%), Gaps = 17/118 (14%)

Query  7    GKGKLLAVIGDEDTCVGFLLGGVGEINKNR--------------QSNFMVVDKNTAVSEI  52
            G+ +++ +IGDEDT  GFLL G+G+   NR              Q N+ V+  +T +++I
Sbjct  9    GEERIVGIIGDEDTVTGFLLAGIGD---NRPVEAQATGDRKAVAQPNYAVITPSTPLADI  65

Query  53   EDTFKRFIKRDDIDIILINQNIAEMIRHVIDSHTQPIPSVLEIPSKDHPYDASKDSIL  110
            ED F        I +I+I Q+IA  IRH+++  T  IP +LEIPSK   YDASKD +L
Sbjct  66   EDAFTNMTANPSIGVIIICQHIANEIRHLMEGFTDHIPCILEIPSKGGVYDASKDQVL  123



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584759.1 mitotic-spindle organizing protein 1 [Cephus cinctus]

Length=81
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6ILY6_DROME  unnamed protein product                                 38.1    4e-05
A0A0B4KFV0_DROME  unnamed protein product                             28.9    0.36 
Q7K2X1_DROME  unnamed protein product                                 28.9    0.37 


>Q6ILY6_DROME unnamed protein product
Length=82

 Score = 38.1 bits (87),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 28/47 (60%), Gaps = 0/47 (0%)

Query  16  FQTLHQISKLLNTNLDAATLSICVRLCENGVNPHALASVVKELQREV  62
           F  L  +S ++++ L    L IC+ L +NGV   ALA V++ ++ E+
Sbjct  14  FTILQTLSDVVDSGLSKEALKICIELVDNGVCGGALAHVIRTIREEI  60


>A0A0B4KFV0_DROME unnamed protein product
Length=434

 Score = 28.9 bits (63),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (54%), Gaps = 5/56 (9%)

Query  16   FQTLHQISKLLNTNLDAATLSICVRLCENGVNPHALASVVKELQREVNAMHNAQTD  71
             Q++  IS +L     AA  +   RL +N  +PH LA+ V  L+RE+    + +T+
Sbjct  159  IQSMEGISAIL-----AAGSADADRLLKNEADPHVLANWVSTLKRELRQCESKKTE  209


>Q7K2X1_DROME unnamed protein product
Length=435

 Score = 28.9 bits (63),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (54%), Gaps = 5/56 (9%)

Query  16   FQTLHQISKLLNTNLDAATLSICVRLCENGVNPHALASVVKELQREVNAMHNAQTD  71
             Q++  IS +L     AA  +   RL +N  +PH LA+ V  L+RE+    + +T+
Sbjct  159  IQSMEGISAIL-----AAGSADADRLLKNEADPHVLANWVSTLKRELRQCESKKTE  209



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584760.1 transcription initiation factor TFIID subunit 3
isoform X1 [Cephus cinctus]

Length=994
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSB9_DROME  unnamed protein product                                 153     3e-40
Q9V4D4_DROME  unnamed protein product                                 156     2e-38
Q9XZU7_DROME  unnamed protein product                                 155     4e-38


>Q8MSB9_DROME unnamed protein product
Length=370

 Score = 153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHIDS--  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


>Q9V4D4_DROME unnamed protein product
Length=1406

 Score = 156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)

Query  915   YYDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQVAPDTNENWYCRVCIAKK  974
             Y D  G +IWICPACG  DDGSAMIGCD CDAWYHW+CVGI  AP  N++W+CRVC+ KK
Sbjct  1332  YVDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  1391

Query  975   Q  975
             +
Sbjct  1392  R  1392


 Score = 33.5 bits (75),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 8/68 (12%)

Query  779   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  833
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  834   RPPKQKSA  841
              PPK K +
Sbjct  1209  GPPKNKQS  1216


 Score = 32.0 bits (71),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490


>Q9XZU7_DROME unnamed protein product
Length=1408

 Score = 155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 141/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARNMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV  V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVAPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 107/246 (43%), Gaps = 52/246 (21%)

Query  779   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  833
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  834   RPPKQKSASKKYDEGTLDASPALPSDTSFSTNHTSVPLASIPRAKKALFKT---------  884
              PPK K +   +   +  A   +PS  +       +P++                     
Sbjct  1209  GPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLQLPVSQTSSNSAGWLSNPNNSNTASS  1268

Query  885   -----------QPLRVPSPPVH-------------------YDPPSKSSSPALPQQQA--  912
                        Q +  P   ++                     PP+ S   A   Q A  
Sbjct  1269  TLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAES  1328

Query  913   ---AFYYDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQVAPDTNENWYCRV  969
                + Y D  G +IWICPACG  D+GSAMIGCD CDAWYHW+CVGI  AP  N++W+CRV
Sbjct  1329  SRPSSYVDTEGNRIWICPACGKVDEGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRV  1388

Query  970   CIAKKQ  975
             C+ KK+
Sbjct  1389  CVTKKR  1394


 Score = 32.0 bits (71),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584761.1 transcription initiation factor TFIID subunit 3
isoform X2 [Cephus cinctus]

Length=990
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSB9_DROME  unnamed protein product                                 153     3e-40
Q9V4D4_DROME  unnamed protein product                                 156     2e-38
Q9XZU7_DROME  unnamed protein product                                 155     4e-38


>Q8MSB9_DROME unnamed protein product
Length=370

 Score = 153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHIDS--  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


>Q9V4D4_DROME unnamed protein product
Length=1406

 Score = 156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)

Query  911   YYDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQVAPDTNENWYCRVCIAKK  970
             Y D  G +IWICPACG  DDGSAMIGCD CDAWYHW+CVGI  AP  N++W+CRVC+ KK
Sbjct  1332  YVDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  1391

Query  971   Q  971
             +
Sbjct  1392  R  1392


 Score = 33.5 bits (75),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 34/68 (50%), Gaps = 8/68 (12%)

Query  775   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  829
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  830   RPPKQKSA  837
              PPK K +
Sbjct  1209  GPPKNKQS  1216


 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490


>Q9XZU7_DROME unnamed protein product
Length=1408

 Score = 155 bits (392),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 141/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARNMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV  V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVAPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 107/246 (43%), Gaps = 52/246 (21%)

Query  775   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  829
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  830   RPPKQKSASKKYDEGTLDASPALPSDTSFSTNHTSVPLASIPRAKKALFKT---------  880
              PPK K +   +   +  A   +PS  +       +P++                     
Sbjct  1209  GPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLQLPVSQTSSNSAGWLSNPNNSNTASS  1268

Query  881   -----------QPLRVPSPPVH-------------------YDPPSKSSSPALPQQQA--  908
                        Q +  P   ++                     PP+ S   A   Q A  
Sbjct  1269  TLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAES  1328

Query  909   ---AFYYDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQVAPDTNENWYCRV  965
                + Y D  G +IWICPACG  D+GSAMIGCD CDAWYHW+CVGI  AP  N++W+CRV
Sbjct  1329  SRPSSYVDTEGNRIWICPACGKVDEGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRV  1388

Query  966   CIAKKQ  971
             C+ KK+
Sbjct  1389  CVTKKR  1394


 Score = 32.0 bits (71),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584762.1 transcription initiation factor TFIID subunit 3
isoform X3 [Cephus cinctus]

Length=963
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSB9_DROME  unnamed protein product                                 153     3e-40
Q9V4D4_DROME  unnamed protein product                                 156     2e-38
Q9XZU7_DROME  unnamed protein product                                 155     4e-38


>Q8MSB9_DROME unnamed protein product
Length=370

 Score = 153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHIDS--  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


>Q9V4D4_DROME unnamed protein product
Length=1406

 Score = 156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 49/61 (80%), Gaps = 0/61 (0%)

Query  884   YYDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQVAPDTNENWYCRVCIAKK  943
             Y D  G +IWICPACG  DDGSAMIGCD CDAWYHW+CVGI  AP  N++W+CRVC+ KK
Sbjct  1332  YVDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRVCVTKK  1391

Query  944   Q  944
             +
Sbjct  1392  R  1392


 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490


>Q9XZU7_DROME unnamed protein product
Length=1408

 Score = 155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 141/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARNMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV  V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVAPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 107/246 (43%), Gaps = 52/246 (21%)

Query  748   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  802
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  803   RPPKQKSASKKYDEGTLDASPALPSDTSFSTNHTSVPLASIPRAKKALFKT---------  853
              PPK K +   +   +  A   +PS  +       +P++                     
Sbjct  1209  GPPKNKQSETLHLGNSSTAVLPVPSPVAVRAVQLQLPVSQTSSNSAGWLSNPNNSNTASS  1268

Query  854   -----------QPLRVPSPPVH-------------------YDPPSKSSSPALPQQQA--  881
                        Q +  P   ++                     PP+ S   A   Q A  
Sbjct  1269  TLSASSVLLPQQLMLAPHTIMNNFVPAMCNSTGTVSKSGLCSSPPNTSEENANAMQIAES  1328

Query  882   ---AFYYDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQVAPDTNENWYCRV  938
                + Y D  G +IWICPACG  D+GSAMIGCD CDAWYHW+CVGI  AP  N++W+CRV
Sbjct  1329  SRPSSYVDTEGNRIWICPACGKVDEGSAMIGCDGCDAWYHWICVGITFAPKDNDDWFCRV  1388

Query  939   CIAKKQ  944
             C+ KK+
Sbjct  1389  CVTKKR  1394


 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584763.1 transcription initiation factor TFIID subunit 3
isoform X4 [Cephus cinctus]

Length=951
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MSB9_DROME  unnamed protein product                                 153     3e-40
Q9V4D4_DROME  unnamed protein product                                 156     1e-38
Q9XZU7_DROME  unnamed protein product                                 155     3e-38


>Q8MSB9_DROME unnamed protein product
Length=370

 Score = 153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHIDS--  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


>Q9V4D4_DROME unnamed protein product
Length=1406

 Score = 156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 142/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARDMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV+ V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVEPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 56/78 (72%), Gaps = 4/78 (5%)

Query  859   ENGGNTLAIT----PATTVDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQV  914
             E   N + I     P++ VD  G +IWICPACG  DDGSAMIGCD CDAWYHW+CVGI  
Sbjct  1315  EENANAMQIAESSRPSSYVDAEGNRIWICPACGKVDDGSAMIGCDGCDAWYHWICVGITF  1374

Query  915   APDTNENWYCRVCIAKKQ  932
             AP  N++W+CRVC+ KK+
Sbjct  1375  APKDNDDWFCRVCVTKKR  1392


 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 35/69 (51%), Gaps = 8/69 (12%)

Query  779   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  833
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  834   RPPKQKSAK  842
              PPK K ++
Sbjct  1209  GPPKNKQSE  1217


 Score = 32.0 bits (71),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490


>Q9XZU7_DROME unnamed protein product
Length=1408

 Score = 155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/241 (37%), Positives = 141/241 (59%), Gaps = 24/241 (10%)

Query  1    MTTEYSRAVLRMVVAQICQTIGWHSINSTPLEFMVDLMQEYLLRVSKLTHQYSEVLGRTE  60
            M   Y+  +  +VVAQI QTIG+    S PLE + D++Q+++   ++  H++ E   R E
Sbjct  2    MADRYASDLALVVVAQITQTIGYSCTLSAPLELLQDILQKFVQEFARNMHRHMEHANRIE  61

Query  61   ANLDDLGLAFQHMNIDIQELAEYVKNVDSVACAIEVPKFPVHRDNHLNFLKPGSREVVTR  120
             NL D  L+ ++++I++QEL +Y+ NV  V    +VP+FP+ +  ++NFLKPGS E +TR
Sbjct  62   PNLKDARLSIKNLSINVQELLDYIGNVAPVGFIRDVPQFPIGKSVNMNFLKPGSAETLTR  121

Query  121  PVHVHEHLPAMH--------PDTEEEYTSERAESLTNGTSEVASTNGTPSGGSVNVSPQR  172
            PV++ E+LP M          D ++E+ SE+ E  +   +E +STN     G+ ++    
Sbjct  122  PVYIFEYLPPMQDPELREIPADVQKEF-SEKQEFCSK--AEYSSTNAADKLGAKHI--DS  176

Query  173  VSPQVVFKRPGDPVSFESPIAKRAKVMEEGRPLREIHSVMMTTSGFLSPAREGKLPEART  232
            +SP  V       ++F S     A  ++ G  +RE+ SV+MTT GF+SPA EGKLPE   
Sbjct  177  ISPNTV-------INFRS----NAFELDVGSSVREMSSVVMTTGGFISPAIEGKLPEDII  225

Query  233  P  233
            P
Sbjct  226  P  226


 Score = 123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 56/78 (72%), Gaps = 4/78 (5%)

Query  859   ENGGNTLAIT----PATTVDQVGKQIWICPACGNQDDGSAMIGCDDCDAWYHWVCVGIQV  914
             E   N + I     P++ VD  G +IWICPACG  D+GSAMIGCD CDAWYHW+CVGI  
Sbjct  1317  EENANAMQIAESSRPSSYVDTEGNRIWICPACGKVDEGSAMIGCDGCDAWYHWICVGITF  1376

Query  915   APDTNENWYCRVCIAKKQ  932
             AP  N++W+CRVC+ KK+
Sbjct  1377  APKDNDDWFCRVCVTKKR  1394


 Score = 33.5 bits (75),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 35/69 (51%), Gaps = 8/69 (12%)

Query  779   VPKITFKLGP-----ASPRPPTPDNAPMKKITIKPLVKKPEEDVNREPSPELAKISALVT  833
             +PK+T KL       +S      D   +K+ TI     K  E   R+ SPELA+ S LVT
Sbjct  1152  IPKLTLKLSGKSTLFSSSEKEMTDAGKLKQTTILSSENKKRE---RDNSPELARFSPLVT  1208

Query  834   RPPKQKSAK  842
              PPK K ++
Sbjct  1209  GPPKNKQSE  1217


 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 14/18 (78%), Positives = 17/18 (94%), Gaps = 0/18 (0%)

Query  380  SEPDKQKLNIFKKISKPR  397
            SEP++ KL+IFKKISKPR
Sbjct  473  SEPERSKLDIFKKISKPR  490



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584764.1 uncharacterized protein LOC107262754 [Cephus cinctus]

Length=195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PERC_AEDAE  unnamed protein product                                   30.0    1.3  
PP11_DROME  unnamed protein product                                   28.1    5.5  


>PERC_AEDAE unnamed protein product
Length=790

 Score = 30.0 bits (66),  Expect = 1.3, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query  22   QIKGIQTGNKLYPKKYSHTI--LRRINPNWDDIATENLIHDTRRVFNTKY  69
            Q+ G+   + L+ ++++     L +INP+WDD   E L  + RR+   +Y
Sbjct  450  QLLGLTMVHTLFMREHNRLAVGLSKINPHWDD---ERLYQEARRILIAEY  496


>PP11_DROME unnamed protein product
Length=327

 Score = 28.1 bits (61),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 14/36 (39%), Positives = 20/36 (56%), Gaps = 2/36 (6%)

Query  75   FDIKSPHRQKRFVIPNNSSTSTDVTWKPPKKTHAKN  110
            F I  P  ++RFV PN  S+   +T  PP+  + KN
Sbjct  291  FQILKPADKRRFVYPNFGSSGRPLT--PPRGANNKN  324



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584765.1 CCR4-NOT transcription complex subunit 11 [Cephus
cinctus]

Length=454
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W1C6_DROME  unnamed protein product                                 263     4e-86
Q8MLP8_DROME  unnamed protein product                                 253     8e-82
M9PDJ0_DROME  unnamed protein product                                 32.0    1.4  


>Q9W1C6_DROME unnamed protein product
Length=227

 Score = 263 bits (672),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 5/220 (2%)

Query  220  FLRLAPPLYHSANELTWMNVTEPSQFTVEYDTSMCVSNCAGAEARRLMGKAFKSVLSLQQ  279
            FL +APPL    +EL W+N +   +  + YD S    N      + L+ +AF   LSLQ 
Sbjct  2    FLSIAPPLMDFEDELLWINQSNSDKVEIIYDKS----NYITPNIKHLIEQAFLQPLSLQN  57

Query  280  QQHLVTEL-DRDPKLVYHIGLTPGKLPDLVENNPLIAIEVLLKLMQSSQITEYFSVLVNM  338
            Q  L  +L  ++  +    GLTP KLP LVE+NPLI+IE+LL+LM +S ITEYF+VLVNM
Sbjct  58   QHILFDDLLKQNTDIARQYGLTPDKLPLLVESNPLISIEILLRLMTTSDITEYFNVLVNM  117

Query  339  EMSLHSMEVVNRLTTTVDLPTEFVHLYISNCISTCETIKDRYMQNRLVRLVCVFLQSLIR  398
            +++LHSMEVVNRLTT+  LPTEF+HLYISNCISTCET+KD+YMQ+RLVRLVCVFLQSLIR
Sbjct  118  DITLHSMEVVNRLTTSGPLPTEFIHLYISNCISTCETVKDKYMQSRLVRLVCVFLQSLIR  177

Query  399  NKIINVQELFIEVQAFCIEFSRIREAAALFRLLKQLESGD  438
            NKI+NV+ELFIE++AFC+ FS+I+EAA L+RL+K LE+G+
Sbjct  178  NKIVNVRELFIEIEAFCVGFSKIKEAATLYRLIKHLETGE  217


>Q8MLP8_DROME unnamed protein product
Length=247

 Score = 253 bits (645),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 169/240 (70%), Gaps = 25/240 (10%)

Query  220  FLRLAPPLYHSANELTWMNVTEPSQFTVEYDTSMCVSNCAGAEARRLMGKAFKSVLSLQQ  279
            FL +APPL    +EL W+N +   +  + YD S    N      + L+ +AF   LSLQ 
Sbjct  2    FLSIAPPLMDFEDELLWINQSNSDKVEIIYDKS----NYITPNIKHLIEQAFLQPLSLQN  57

Query  280  QQHLVTEL-DRDPKLVYHIGLTPGKLPDLVENNPLIAIEVLLKLMQSSQITEYFSVLVNM  338
            Q  L  +L  ++  +    GLTP KLP LVE+NPLI+IE+LL+LM +S ITEYF+VLVNM
Sbjct  58   QHILFDDLLKQNTDIARQYGLTPDKLPLLVESNPLISIEILLRLMTTSDITEYFNVLVNM  117

Query  339  EMSLHSMEVVNRLTTTVDLPTEFVHLYISNCISTCETIKDRYMQNRLVRLVCVFLQSLIR  398
            +++LHSMEVVNRLTT+  LPTEF+HLYISNCISTCET+KD+YMQ+RLVRLVCVFLQSLIR
Sbjct  118  DITLHSMEVVNRLTTSGPLPTEFIHLYISNCISTCETVKDKYMQSRLVRLVCVFLQSLIR  177

Query  399  NKIINV--------------------QELFIEVQAFCIEFSRIREAAALFRLLKQLESGD  438
            NKI+NV                    QELFIE++AFC+ FS+I+EAA L+RL+K LE+G+
Sbjct  178  NKIVNVRVCATTISSTVLSDYSIVIFQELFIEIEAFCVGFSKIKEAATLYRLIKHLETGE  237


>M9PDJ0_DROME unnamed protein product
Length=1180

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 49/93 (53%), Gaps = 8/93 (9%)

Query  257  NCAGAEARRLMGKAFKSVLSLQQQQHLVTELDRDPKLV----YHIGLTPGKLPDLVENNP  312
            +CAG + + L+G A++ +LS  +      +L ++  ++      +G  P   P+L++  P
Sbjct  638  HCAG-QTKDLLG-AWEDLLSWSENASAARKLQQEMSVLKSSLQRLGDKP--TPELLDTEP  693

Query  313  LIAIEVLLKLMQSSQITEYFSVLVNMEMSLHSM  345
             I I V    ++ +Q+T Y + ++ +  S+HS 
Sbjct  694  AIQIAVEALKLEQTQLTSYRTNMLRLNASVHSW  726



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584766.1 CCR4-NOT transcription complex subunit 11 [Cephus
cinctus]

Length=454
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W1C6_DROME  unnamed protein product                                 263     4e-86
Q8MLP8_DROME  unnamed protein product                                 253     8e-82
M9PDJ0_DROME  unnamed protein product                                 32.0    1.4  


>Q9W1C6_DROME unnamed protein product
Length=227

 Score = 263 bits (672),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 169/220 (77%), Gaps = 5/220 (2%)

Query  220  FLRLAPPLYHSANELTWMNVTEPSQFTVEYDTSMCVSNCAGAEARRLMGKAFKSVLSLQQ  279
            FL +APPL    +EL W+N +   +  + YD S    N      + L+ +AF   LSLQ 
Sbjct  2    FLSIAPPLMDFEDELLWINQSNSDKVEIIYDKS----NYITPNIKHLIEQAFLQPLSLQN  57

Query  280  QQHLVTEL-DRDPKLVYHIGLTPGKLPDLVENNPLIAIEVLLKLMQSSQITEYFSVLVNM  338
            Q  L  +L  ++  +    GLTP KLP LVE+NPLI+IE+LL+LM +S ITEYF+VLVNM
Sbjct  58   QHILFDDLLKQNTDIARQYGLTPDKLPLLVESNPLISIEILLRLMTTSDITEYFNVLVNM  117

Query  339  EMSLHSMEVVNRLTTTVDLPTEFVHLYISNCISTCETIKDRYMQNRLVRLVCVFLQSLIR  398
            +++LHSMEVVNRLTT+  LPTEF+HLYISNCISTCET+KD+YMQ+RLVRLVCVFLQSLIR
Sbjct  118  DITLHSMEVVNRLTTSGPLPTEFIHLYISNCISTCETVKDKYMQSRLVRLVCVFLQSLIR  177

Query  399  NKIINVQELFIEVQAFCIEFSRIREAAALFRLLKQLESGD  438
            NKI+NV+ELFIE++AFC+ FS+I+EAA L+RL+K LE+G+
Sbjct  178  NKIVNVRELFIEIEAFCVGFSKIKEAATLYRLIKHLETGE  217


>Q8MLP8_DROME unnamed protein product
Length=247

 Score = 253 bits (645),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 169/240 (70%), Gaps = 25/240 (10%)

Query  220  FLRLAPPLYHSANELTWMNVTEPSQFTVEYDTSMCVSNCAGAEARRLMGKAFKSVLSLQQ  279
            FL +APPL    +EL W+N +   +  + YD S    N      + L+ +AF   LSLQ 
Sbjct  2    FLSIAPPLMDFEDELLWINQSNSDKVEIIYDKS----NYITPNIKHLIEQAFLQPLSLQN  57

Query  280  QQHLVTEL-DRDPKLVYHIGLTPGKLPDLVENNPLIAIEVLLKLMQSSQITEYFSVLVNM  338
            Q  L  +L  ++  +    GLTP KLP LVE+NPLI+IE+LL+LM +S ITEYF+VLVNM
Sbjct  58   QHILFDDLLKQNTDIARQYGLTPDKLPLLVESNPLISIEILLRLMTTSDITEYFNVLVNM  117

Query  339  EMSLHSMEVVNRLTTTVDLPTEFVHLYISNCISTCETIKDRYMQNRLVRLVCVFLQSLIR  398
            +++LHSMEVVNRLTT+  LPTEF+HLYISNCISTCET+KD+YMQ+RLVRLVCVFLQSLIR
Sbjct  118  DITLHSMEVVNRLTTSGPLPTEFIHLYISNCISTCETVKDKYMQSRLVRLVCVFLQSLIR  177

Query  399  NKIINV--------------------QELFIEVQAFCIEFSRIREAAALFRLLKQLESGD  438
            NKI+NV                    QELFIE++AFC+ FS+I+EAA L+RL+K LE+G+
Sbjct  178  NKIVNVRVCATTISSTVLSDYSIVIFQELFIEIEAFCVGFSKIKEAATLYRLIKHLETGE  237


>M9PDJ0_DROME unnamed protein product
Length=1180

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 23/93 (25%), Positives = 49/93 (53%), Gaps = 8/93 (9%)

Query  257  NCAGAEARRLMGKAFKSVLSLQQQQHLVTELDRDPKLV----YHIGLTPGKLPDLVENNP  312
            +CAG + + L+G A++ +LS  +      +L ++  ++      +G  P   P+L++  P
Sbjct  638  HCAG-QTKDLLG-AWEDLLSWSENASAARKLQQEMSVLKSSLQRLGDKP--TPELLDTEP  693

Query  313  LIAIEVLLKLMQSSQITEYFSVLVNMEMSLHSM  345
             I I V    ++ +Q+T Y + ++ +  S+HS 
Sbjct  694  AIQIAVEALKLEQTQLTSYRTNMLRLNASVHSW  726



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584767.1 membrane-associated guanylate kinase, WW and PDZ
domain-containing protein 1 isoform X1 [Cephus cinctus]

Length=1073
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2L2_DROME  unnamed protein product                                 672     0.0  
C6KRJ8_CAEEL  unnamed protein product                                 248     4e-69
D3YT29_CAEEL  unnamed protein product                                 248     5e-69


>Q9W2L2_DROME unnamed protein product
Length=1202

 Score = 672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/950 (45%), Positives = 529/950 (56%), Gaps = 189/950 (20%)

Query  46    GSEQGTGNSEQDRNGQNRSQATE--DQLGPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDP  103
             GSE G G+ +     QN     +  D LGPLPP WE AYT+ GE+YFIDHNTGTSHWLDP
Sbjct  268   GSECGVGDVQH----QNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDP  323

Query  104   RLSKFQKRSLEECLDDELPYGWEKIDDILYGTYFIDHVNRKTQYENPVLQAKRAQQGH--  161
             RLSK+QK+SLE+C +DELPYGWEKI+D +YG YFIDHVNR+TQYENPVL+AKR       
Sbjct  324   RLSKYQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQ  383

Query  162   -----------------------------------------SERKSP-NFTRNPDKLKGQ  179
                                                      S  K P  FTRNP +L+GQ
Sbjct  384   QQQQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHEQEEDESPMKLPYKFTRNPAELQGQ  443

Query  180   SIRTTLLKSSRGLGFTIVGGDDS----VEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
              I TTLLKSSRGLGFTIVG D S    VE+FLQIK+VVPNGPAWLDG+LQTGDVLVYVND
Sbjct  444   RINTTLLKSSRGLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVND  503

Query  236   TCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDPNDPNTEVVTTIAVSAPGEIEIG  295
             TCVLG+TH++MVN+F+SI  GE   LEVCRGYPLPFDPNDPNTEVVTT+AV        G
Sbjct  504   TCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVD-------G  556

Query  296   RDDENRHRGNSFLADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQNGENLATAS  355
             R+ + + R                      L  D  +NFLD +         GE     S
Sbjct  557   RESDKQRR----------------------LNMDGNYNFLDLS---------GEGAKKTS  585

Query  356   VNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIVKGSIGFGF  415
                                S +  +L +              KPE  + SI+KGS+GFGF
Sbjct  586   G------------------SGSGFILMK--------------KPEIYTFSIMKGSMGFGF  613

Query  416   TIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKDCPRNQEALI  475
             TIADSA GQ VKKILDR  C  LMEGD+L+ IN  NV N  H  VV++LK+C +     +
Sbjct  614   TIADSACGQIVKKILDRNCCTQLMEGDVLLEINGLNVRNKPHFYVVELLKECSQTTPTAV  673

Query  476   HVQRT--------TMK--------SKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPK  519
              +QRT        T+         +K +K       FRSKTPTAD+YSTQ K V+P RPK
Sbjct  674   KIQRTPPDPPANNTLAQLNQVGNVAKLRKNFVGSGLFRSKTPTADLYSTQVKEVLPMRPK  733

Query  520   TPLVDTRN---RPKTPNDSSSSNWNEIQNEN------EMNPLDNRYKYPDYNHT-----M  565
             TPLVDTR    + ++PN       NE+ +E       E  PL  + +    +       +
Sbjct  734   TPLVDTRRSRVQIQSPN-------NEVDDEGDGAAAAERKPLQLQTQGKSNSSLQELDDI  786

Query  566   YYTDPYKANIGNLSDNFVTMTNLDDDSVRNVTKRDWTTNDKLSLSSDMYSIDVSHHNNIL  625
              Y DPY   I  LS+    +T L  D+   +          +  S     + ++HH +  
Sbjct  787   PYMDPYP-KISRLSERLAEVT-LQGDANGGIY--------GMPPSMQPLPLPLAHHESCY  836

Query  626   KQNGSIHSDYYKDLYAVQSHSQYSEPDYNTYTIGQEQNVDTGEIWDKRKETTS------F  679
               +    +  Y+  Y VQ+           Y+  Q  ++    I  +  E  S      F
Sbjct  837   CYD--CQAQRYRPGYFVQAQQAAMSGTTGQYSPLQTAHLQNERIQRRVNELLSDRRRVGF  894

Query  680   EHEQPHSSSVTRYPQYSGELVCPTIPDIEWIE-TLVTLVRQDTGFGFRIVGGTEEGSQQV  738
              +  P    +   P +    +     D +  E T VTL RQ  GFGFRIVGGTEEGS QV
Sbjct  895   ANLDP-PQQMQHSPSWRNGALLDVSEDADQCELTEVTLERQALGFGFRIVGGTEEGS-QV  952

Query  739   SVGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRI  798
             +VGHIVPGGAAD D R+NTGD I+S+DG +V+NSSHH VV L+  +A  G+VT+ +RRR 
Sbjct  953   TVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRR-  1011

Query  799   NTQEHLQENLQSSYSRHMNIQYPYDVTVTRMENEGFGFVIISSVNK-AGSTIGRIIEGSP  857
                  LQ+   S+  R    +YPYDV V+R ENEGFGFVIISS N   GSTIG++I GSP
Sbjct  1012  -RTPLLQQAPVSTQLR----RYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSP  1066

Query  858   AERCGRLNVGDHILAVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYPLDD  907
             A+RCG L VGD I+AVN ++I  + H D+VNLIK+SG  V LTIG PL +
Sbjct  1067  ADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTIGVPLKE  1116


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 11/191 (6%)

Query  823   DVTVTRMENEGFGFVIISSVNKAGS-TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNV  881
             +VT+ R +  GFGF I+    +    T+G I+ G  A++  R+N GD IL+++ +++ N 
Sbjct  928   EVTLER-QALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNS  986

Query  882   CHKDIVNLIKDSGY--SVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTR  939
              H  +V+L+ +S     VT+ +          A +S +           Y  +       
Sbjct  987   SHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRY------PYDVIVSRHENE  1040

Query  940   GFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEII  999
             GFGF I            + ++    PA     L+VGD+I+ +N I    M+H + + +I
Sbjct  1041  GFGFVIISSSN-HYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLI  1099

Query  1000  RNGGPSVRLLV  1010
             +  G  VRL +
Sbjct  1100  KESGLHVRLTI  1110


 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (52%), Gaps = 1/77 (1%)

Query  923  DGDGGQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEI  982
            D D  +   V L R   GFGF I GG E +   + V  I   G A  D R+  GD+I+ I
Sbjct  920  DADQCELTEVTLERQALGFGFRIVGGTE-EGSQVTVGHIVPGGAADQDQRINTGDEILSI  978

Query  983  NGINTKNMTHTEAIEII  999
            +GIN  N +H + + ++
Sbjct  979  DGINVLNSSHHKVVSLV  995


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 87/216 (40%), Gaps = 55/216 (25%)

Query  833  GFGFVIISSVNKAGS------TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDI  886
            G GF I+ S   AG        I  ++   PA   G+L  GD ++ VN   +    H D+
Sbjct  455  GLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVNDTCVLGYTHHDM  514

Query  887  VNLIKD--SGYSVTLTI--GYPLD--------DCCSSASLSQKD----------------  918
            VN+ +    G    L +  GYPL         +  ++ ++  ++                
Sbjct  515  VNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVDGRESDKQRRLNMDGNYNFL  574

Query  919  --------EPTGDGDG------GQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAEN  964
                    + +G G G       + +   + +G+ GFGF+I      Q     V +I + 
Sbjct  575  DLSGEGAKKTSGSGSGFILMKKPEIYTFSIMKGSMGFGFTIADSACGQ----IVKKILDR  630

Query  965  GPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
               +   +L  GD ++EING+N +N  H   +E+++
Sbjct  631  ---NCCTQLMEGDVLLEINGLNVRNKPHFYVVELLK  663


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 8/98 (8%)

Query  927   GQYHAVELTRGTRGFGFSIRG-----GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIE  981
             GQ     L + +RG GF+I G     G + +   L +  +  NGPA +D +L+ GD ++ 
Sbjct  442   GQRINTTLLKSSRGLGFTIVGSDGSAGGDVEEF-LQIKTVVPNGPAWLDGQLQTGDVLVY  500

Query  982   INGINTKNMTHTEAIEIIRNGGPSVR--LLVRRGCQMP  1017
             +N       TH + + I ++  P  R  L V RG  +P
Sbjct  501   VNDTCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLP  538


>C6KRJ8_CAEEL unnamed protein product
Length=802

 Score = 248 bits (632),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 221/408 (54%), Gaps = 68/408 (17%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  457

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQQVSVGHIVPGGAADL  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  +  +SVG IV GGAA+ 
Sbjct  458  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTP-LSVGQIVIGGAAEE  504

Query  752  DSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSS  811
            D RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+
Sbjct  505  DGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA  564

Query  812  YSRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHIL  871
                      YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++
Sbjct  565  -----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVI  619

Query  872  AVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS--------------  911
            AVN +DI ++ H D ++LIKDSG SV LTI  P      L    ++              
Sbjct  620  AVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESN  679

Query  912  -------ASLSQKDEPTG----DGDG--------GQYHAVELTRGTRGFGFSIRGGREFQ  952
                    S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF 
Sbjct  680  YGLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFG  739

Query  953  NMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
            +MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  740  SMPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


 Score = 137 bits (345),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 126/258 (49%), Gaps = 56/258 (22%)

Query  72   GPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDPR-------------LSKFQKRSLEECLD  118
            G LPPNWE AYT+ G+ YFIDHNTGT+ W DPR                F    +     
Sbjct  8    GLLPPNWETAYTENGDKYFIDHNTGTTTWDDPRELPPGWEQVDDQNYGTFYVDHINRKTQ  67

Query  119  DELPYGW----EKIDD-ILYGTYFI----DHVNRKTQYENPVLQAKRA------------  157
             E PYG+      ID  + YGT       +H N  + Y +  L++  +            
Sbjct  68   YERPYGFGGSSATIDQPVKYGTLPSSTNHNHNNIYSHYNSGTLKSSSSPRDSGFDSSPTR  127

Query  158  --------------------QQGHSERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIV  197
                                 +  S   +P FT +P +L G+ I T ++K ++GLGFT++
Sbjct  128  YRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLI  187

Query  198  GGDDSV--EQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGS  255
            G D S   ++F+Q+KSV+  GPA  +G L++GD+LV VN   +LG T  E  +VF +I  
Sbjct  188  GNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPV  247

Query  256  GETVTLEVCRGYPLPFDP  273
             E V ++VCRGY L  DP
Sbjct  248  NEAVDIQVCRGYELFIDP  265


 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  286  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  345

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  346  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  398


 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 103/212 (49%), Gaps = 18/212 (8%)

Query  819   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  875
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  460   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  519

Query  876   VDITNVCHKDIVNLIKDSGYS--VTLTIGYP-LDDCCSSASLSQKDEPTGDGDGGQYHAV  932
              ++    H + V L++ +  +  V L +  P   D     SL+        G  G Y  +
Sbjct  520   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA------GPSGSYDVL  573

Query  933   ELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTH  992
                    GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H
Sbjct  574   LHRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSH  631

Query  993   TEAIEIIRNGGPSVRLLVR----RGCQMPSVS  1020
              + I +I++ G SVRL +      G  +P VS
Sbjct  632   PDTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  663


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  712  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  771

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  772  QSTKGMSHDDAIRIIK  787


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 96/196 (49%), Gaps = 21/196 (11%)

Query  716  LVRQDTGFGFRIVG--GTEEGSQQVSVGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSS  773
            +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+G  ++ ++
Sbjct  175  IVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGAT  234

Query  774  HHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQYPYDVTVT  827
                  + +A   N  V + + R            + EN+  ++ SR +     +++ + 
Sbjct  235  QKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL-----HEIDIF  289

Query  828  RMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDIV  887
            +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++  + H  +V
Sbjct  290  K-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVRPIPHTQLV  343

Query  888  NLIKDS--GYSVTLTI  901
            +++++   GY   L +
Sbjct  344  DMLRERPIGYRGKLVV  359


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  832   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  885
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  180   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  239

Query  886   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  943
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  240   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  297

Query  944   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1002
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  298   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  350

Query  1003  -GPSVRLLVRRGC  1014
              G   +L+V+RG 
Sbjct  351   IGYRGKLVVKRGS  363


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  466  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  524

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  525  ASHSEAVVLLEAAAQNKHVKLIVRR  549


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 124/327 (38%), Gaps = 79/327 (24%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  288  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  338

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  339  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  398

Query  290  GEIEIGRDDENRHRGNSFL--ADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  438

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  439  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  471

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  472  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  531

Query  462  QVLKDCPRNQEALIHVQRTTMKSKEKK  488
             +L+   +N+   + V+R +     ++
Sbjct  532  VLLEAAAQNKHVKLIVRRPSRTDPARR  558


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  891  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  935
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  117  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  176

Query  936  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  989
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  177  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  232

Query  990  MTHTEAIEII  999
             T  EA ++ 
Sbjct  233  ATQKEACDVF  242


 Score = 38.9 bits (89),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  169  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  228

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  229  LLLGATQKEACDVFVAIPVNEAVDIQVCR  257


 Score = 37.0 bits (84),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  581  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  640

Query  467  C  467
             
Sbjct  641  S  641


 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  581  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  638

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  639  KD--SGLSVRLTIA  650


 Score = 32.0 bits (71),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  705  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  757

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  758  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


>D3YT29_CAEEL unnamed protein product
Length=829

 Score = 248 bits (633),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 221/408 (54%), Gaps = 68/408 (17%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  484

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQQVSVGHIVPGGAADL  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  +  +SVG IV GGAA+ 
Sbjct  485  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTP-LSVGQIVIGGAAEE  531

Query  752  DSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSS  811
            D RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+
Sbjct  532  DGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA  591

Query  812  YSRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHIL  871
                      YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++
Sbjct  592  -----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVI  646

Query  872  AVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS--------------  911
            AVN +DI ++ H D ++LIKDSG SV LTI  P      L    ++              
Sbjct  647  AVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESN  706

Query  912  -------ASLSQKDEPTG----DGDG--------GQYHAVELTRGTRGFGFSIRGGREFQ  952
                    S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF 
Sbjct  707  YGLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFG  766

Query  953  NMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
            +MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  767  SMPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814


 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 2/114 (2%)

Query  162  SERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIVGGDDSV--EQFLQIKSVVPNGPAW  219
            S   +P FT +P +L G+ I T ++K ++GLGFT++G D S   ++F+Q+KSV+  GPA 
Sbjct  179  SRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAA  238

Query  220  LDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDP  273
             +G L++GD+LV VN   +LG T  E  +VF +I   E V ++VCRGY L  DP
Sbjct  239  ANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDP  292


 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  313  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  372

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  373  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  425


 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 103/211 (49%), Gaps = 16/211 (8%)

Query  819   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  875
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  487   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  546

Query  876   VDITNVCHKDIVNLIKDSGYS--VTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVE  933
              ++    H + V L++ +  +  V L +  P     S    +++      G  G Y  + 
Sbjct  547   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRP-----SRTDPARRGSLNSAGPSGSYDVLL  601

Query  934   LTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHT  993
                   GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H 
Sbjct  602   HRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHP  659

Query  994   EAIEIIRNGGPSVRLLVR----RGCQMPSVS  1020
             + I +I++ G SVRL +      G  +P VS
Sbjct  660   DTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  690


 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  739  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  798

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  799  QSTKGMSHDDAIRIIK  814


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 99/204 (49%), Gaps = 23/204 (11%)

Query  708  EWIETLVTLVRQDTGFGFRIVG--GTEEGSQQVSVGHIVPGGAADLDSRLNTGDLIMSVD  765
            E I T   +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+
Sbjct  196  ELIST--KIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVN  253

Query  766  GESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQ  819
            G  ++ ++      + +A   N  V + + R            + EN+  ++ SR +   
Sbjct  254  GRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL---  310

Query  820  YPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDIT  879
              +++ + +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++ 
Sbjct  311  --HEIDIFK-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVR  362

Query  880  NVCHKDIVNLIKDS--GYSVTLTI  901
             + H  +V+++++   GY   L +
Sbjct  363  PIPHTQLVDMLRERPIGYRGKLVV  386


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  832   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  885
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  207   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  266

Query  886   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  943
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  267   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  324

Query  944   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1002
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  325   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  377

Query  1003  -GPSVRLLVRRGC  1014
              G   +L+V+RG 
Sbjct  378   IGYRGKLVVKRGS  390


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  493  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  551

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  552  ASHSEAVVLLEAAAQNKHVKLIVRR  576


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 69/318 (22%), Positives = 121/318 (38%), Gaps = 79/318 (25%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  315  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  365

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  366  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  425

Query  290  GEIEIGRDDENRHRGNSFLAD--ILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  465

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  466  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  498

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  499  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  558

Query  462  QVLKDCPRNQEALIHVQR  479
             +L+   +N+   + V+R
Sbjct  559  VLLEAAAQNKHVKLIVRR  576


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  891  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  935
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  144  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  203

Query  936  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  989
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  204  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  259

Query  990  MTHTEAIEII  999
             T  EA ++ 
Sbjct  260  ATQKEACDVF  269


 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  196  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  255

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  256  LLLGATQKEACDVFVAIPVNEAVDIQVCR  284


 Score = 37.0 bits (84),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  608  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  667

Query  467  C  467
             
Sbjct  668  S  668


 Score = 32.7 bits (73),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  608  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  665

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  666  KD--SGLSVRLTIA  677


 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  732  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  784

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  785  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584768.1 membrane-associated guanylate kinase, WW and PDZ
domain-containing protein 1 isoform X1 [Cephus cinctus]

Length=1073
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2L2_DROME  unnamed protein product                                 672     0.0  
C6KRJ8_CAEEL  unnamed protein product                                 248     4e-69
D3YT29_CAEEL  unnamed protein product                                 248     5e-69


>Q9W2L2_DROME unnamed protein product
Length=1202

 Score = 672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/950 (45%), Positives = 529/950 (56%), Gaps = 189/950 (20%)

Query  46    GSEQGTGNSEQDRNGQNRSQATE--DQLGPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDP  103
             GSE G G+ +     QN     +  D LGPLPP WE AYT+ GE+YFIDHNTGTSHWLDP
Sbjct  268   GSECGVGDVQH----QNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDP  323

Query  104   RLSKFQKRSLEECLDDELPYGWEKIDDILYGTYFIDHVNRKTQYENPVLQAKRAQQGH--  161
             RLSK+QK+SLE+C +DELPYGWEKI+D +YG YFIDHVNR+TQYENPVL+AKR       
Sbjct  324   RLSKYQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQ  383

Query  162   -----------------------------------------SERKSP-NFTRNPDKLKGQ  179
                                                      S  K P  FTRNP +L+GQ
Sbjct  384   QQQQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHEQEEDESPMKLPYKFTRNPAELQGQ  443

Query  180   SIRTTLLKSSRGLGFTIVGGDDS----VEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
              I TTLLKSSRGLGFTIVG D S    VE+FLQIK+VVPNGPAWLDG+LQTGDVLVYVND
Sbjct  444   RINTTLLKSSRGLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVND  503

Query  236   TCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDPNDPNTEVVTTIAVSAPGEIEIG  295
             TCVLG+TH++MVN+F+SI  GE   LEVCRGYPLPFDPNDPNTEVVTT+AV        G
Sbjct  504   TCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVD-------G  556

Query  296   RDDENRHRGNSFLADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQNGENLATAS  355
             R+ + + R                      L  D  +NFLD +         GE     S
Sbjct  557   RESDKQRR----------------------LNMDGNYNFLDLS---------GEGAKKTS  585

Query  356   VNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIVKGSIGFGF  415
                                S +  +L +              KPE  + SI+KGS+GFGF
Sbjct  586   G------------------SGSGFILMK--------------KPEIYTFSIMKGSMGFGF  613

Query  416   TIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKDCPRNQEALI  475
             TIADSA GQ VKKILDR  C  LMEGD+L+ IN  NV N  H  VV++LK+C +     +
Sbjct  614   TIADSACGQIVKKILDRNCCTQLMEGDVLLEINGLNVRNKPHFYVVELLKECSQTTPTAV  673

Query  476   HVQRT--------TMK--------SKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPK  519
              +QRT        T+         +K +K       FRSKTPTAD+YSTQ K V+P RPK
Sbjct  674   KIQRTPPDPPANNTLAQLNQVGNVAKLRKNFVGSGLFRSKTPTADLYSTQVKEVLPMRPK  733

Query  520   TPLVDTRN---RPKTPNDSSSSNWNEIQNEN------EMNPLDNRYKYPDYNHT-----M  565
             TPLVDTR    + ++PN       NE+ +E       E  PL  + +    +       +
Sbjct  734   TPLVDTRRSRVQIQSPN-------NEVDDEGDGAAAAERKPLQLQTQGKSNSSLQELDDI  786

Query  566   YYTDPYKANIGNLSDNFVTMTNLDDDSVRNVTKRDWTTNDKLSLSSDMYSIDVSHHNNIL  625
              Y DPY   I  LS+    +T L  D+   +          +  S     + ++HH +  
Sbjct  787   PYMDPYP-KISRLSERLAEVT-LQGDANGGIY--------GMPPSMQPLPLPLAHHESCY  836

Query  626   KQNGSIHSDYYKDLYAVQSHSQYSEPDYNTYTIGQEQNVDTGEIWDKRKETTS------F  679
               +    +  Y+  Y VQ+           Y+  Q  ++    I  +  E  S      F
Sbjct  837   CYD--CQAQRYRPGYFVQAQQAAMSGTTGQYSPLQTAHLQNERIQRRVNELLSDRRRVGF  894

Query  680   EHEQPHSSSVTRYPQYSGELVCPTIPDIEWIE-TLVTLVRQDTGFGFRIVGGTEEGSQQV  738
              +  P    +   P +    +     D +  E T VTL RQ  GFGFRIVGGTEEGS QV
Sbjct  895   ANLDP-PQQMQHSPSWRNGALLDVSEDADQCELTEVTLERQALGFGFRIVGGTEEGS-QV  952

Query  739   SVGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRI  798
             +VGHIVPGGAAD D R+NTGD I+S+DG +V+NSSHH VV L+  +A  G+VT+ +RRR 
Sbjct  953   TVGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRR-  1011

Query  799   NTQEHLQENLQSSYSRHMNIQYPYDVTVTRMENEGFGFVIISSVNK-AGSTIGRIIEGSP  857
                  LQ+   S+  R    +YPYDV V+R ENEGFGFVIISS N   GSTIG++I GSP
Sbjct  1012  -RTPLLQQAPVSTQLR----RYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSP  1066

Query  858   AERCGRLNVGDHILAVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYPLDD  907
             A+RCG L VGD I+AVN ++I  + H D+VNLIK+SG  V LTIG PL +
Sbjct  1067  ADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTIGVPLKE  1116


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 11/191 (6%)

Query  823   DVTVTRMENEGFGFVIISSVNKAGS-TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNV  881
             +VT+ R +  GFGF I+    +    T+G I+ G  A++  R+N GD IL+++ +++ N 
Sbjct  928   EVTLER-QALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNS  986

Query  882   CHKDIVNLIKDSGY--SVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTR  939
              H  +V+L+ +S     VT+ +          A +S +           Y  +       
Sbjct  987   SHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRY------PYDVIVSRHENE  1040

Query  940   GFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEII  999
             GFGF I            + ++    PA     L+VGD+I+ +N I    M+H + + +I
Sbjct  1041  GFGFVIISSSN-HYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLI  1099

Query  1000  RNGGPSVRLLV  1010
             +  G  VRL +
Sbjct  1100  KESGLHVRLTI  1110


 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (52%), Gaps = 1/77 (1%)

Query  923  DGDGGQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEI  982
            D D  +   V L R   GFGF I GG E +   + V  I   G A  D R+  GD+I+ I
Sbjct  920  DADQCELTEVTLERQALGFGFRIVGGTE-EGSQVTVGHIVPGGAADQDQRINTGDEILSI  978

Query  983  NGINTKNMTHTEAIEII  999
            +GIN  N +H + + ++
Sbjct  979  DGINVLNSSHHKVVSLV  995


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 87/216 (40%), Gaps = 55/216 (25%)

Query  833  GFGFVIISSVNKAGS------TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDI  886
            G GF I+ S   AG        I  ++   PA   G+L  GD ++ VN   +    H D+
Sbjct  455  GLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVNDTCVLGYTHHDM  514

Query  887  VNLIKD--SGYSVTLTI--GYPLD--------DCCSSASLSQKD----------------  918
            VN+ +    G    L +  GYPL         +  ++ ++  ++                
Sbjct  515  VNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVDGRESDKQRRLNMDGNYNFL  574

Query  919  --------EPTGDGDG------GQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAEN  964
                    + +G G G       + +   + +G+ GFGF+I      Q     V +I + 
Sbjct  575  DLSGEGAKKTSGSGSGFILMKKPEIYTFSIMKGSMGFGFTIADSACGQ----IVKKILDR  630

Query  965  GPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
               +   +L  GD ++EING+N +N  H   +E+++
Sbjct  631  ---NCCTQLMEGDVLLEINGLNVRNKPHFYVVELLK  663


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 8/98 (8%)

Query  927   GQYHAVELTRGTRGFGFSIRG-----GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIE  981
             GQ     L + +RG GF+I G     G + +   L +  +  NGPA +D +L+ GD ++ 
Sbjct  442   GQRINTTLLKSSRGLGFTIVGSDGSAGGDVEEF-LQIKTVVPNGPAWLDGQLQTGDVLVY  500

Query  982   INGINTKNMTHTEAIEIIRNGGPSVR--LLVRRGCQMP  1017
             +N       TH + + I ++  P  R  L V RG  +P
Sbjct  501   VNDTCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLP  538


>C6KRJ8_CAEEL unnamed protein product
Length=802

 Score = 248 bits (632),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 221/408 (54%), Gaps = 68/408 (17%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  457

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQQVSVGHIVPGGAADL  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  +  +SVG IV GGAA+ 
Sbjct  458  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTP-LSVGQIVIGGAAEE  504

Query  752  DSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSS  811
            D RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+
Sbjct  505  DGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA  564

Query  812  YSRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHIL  871
                      YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++
Sbjct  565  -----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVI  619

Query  872  AVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS--------------  911
            AVN +DI ++ H D ++LIKDSG SV LTI  P      L    ++              
Sbjct  620  AVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESN  679

Query  912  -------ASLSQKDEPTG----DGDG--------GQYHAVELTRGTRGFGFSIRGGREFQ  952
                    S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF 
Sbjct  680  YGLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFG  739

Query  953  NMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
            +MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  740  SMPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


 Score = 137 bits (345),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 126/258 (49%), Gaps = 56/258 (22%)

Query  72   GPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDPR-------------LSKFQKRSLEECLD  118
            G LPPNWE AYT+ G+ YFIDHNTGT+ W DPR                F    +     
Sbjct  8    GLLPPNWETAYTENGDKYFIDHNTGTTTWDDPRELPPGWEQVDDQNYGTFYVDHINRKTQ  67

Query  119  DELPYGW----EKIDD-ILYGTYFI----DHVNRKTQYENPVLQAKRA------------  157
             E PYG+      ID  + YGT       +H N  + Y +  L++  +            
Sbjct  68   YERPYGFGGSSATIDQPVKYGTLPSSTNHNHNNIYSHYNSGTLKSSSSPRDSGFDSSPTR  127

Query  158  --------------------QQGHSERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIV  197
                                 +  S   +P FT +P +L G+ I T ++K ++GLGFT++
Sbjct  128  YRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLI  187

Query  198  GGDDSV--EQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGS  255
            G D S   ++F+Q+KSV+  GPA  +G L++GD+LV VN   +LG T  E  +VF +I  
Sbjct  188  GNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPV  247

Query  256  GETVTLEVCRGYPLPFDP  273
             E V ++VCRGY L  DP
Sbjct  248  NEAVDIQVCRGYELFIDP  265


 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  286  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  345

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  346  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  398


 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 103/212 (49%), Gaps = 18/212 (8%)

Query  819   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  875
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  460   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  519

Query  876   VDITNVCHKDIVNLIKDSGYS--VTLTIGYP-LDDCCSSASLSQKDEPTGDGDGGQYHAV  932
              ++    H + V L++ +  +  V L +  P   D     SL+        G  G Y  +
Sbjct  520   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA------GPSGSYDVL  573

Query  933   ELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTH  992
                    GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H
Sbjct  574   LHRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSH  631

Query  993   TEAIEIIRNGGPSVRLLVR----RGCQMPSVS  1020
              + I +I++ G SVRL +      G  +P VS
Sbjct  632   PDTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  663


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  712  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  771

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  772  QSTKGMSHDDAIRIIK  787


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 96/196 (49%), Gaps = 21/196 (11%)

Query  716  LVRQDTGFGFRIVG--GTEEGSQQVSVGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSS  773
            +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+G  ++ ++
Sbjct  175  IVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGAT  234

Query  774  HHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQYPYDVTVT  827
                  + +A   N  V + + R            + EN+  ++ SR +     +++ + 
Sbjct  235  QKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL-----HEIDIF  289

Query  828  RMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDIV  887
            +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++  + H  +V
Sbjct  290  K-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVRPIPHTQLV  343

Query  888  NLIKDS--GYSVTLTI  901
            +++++   GY   L +
Sbjct  344  DMLRERPIGYRGKLVV  359


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  832   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  885
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  180   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  239

Query  886   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  943
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  240   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  297

Query  944   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1002
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  298   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  350

Query  1003  -GPSVRLLVRRGC  1014
              G   +L+V+RG 
Sbjct  351   IGYRGKLVVKRGS  363


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  466  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  524

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  525  ASHSEAVVLLEAAAQNKHVKLIVRR  549


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 124/327 (38%), Gaps = 79/327 (24%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  288  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  338

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  339  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  398

Query  290  GEIEIGRDDENRHRGNSFL--ADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  438

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  439  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  471

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  472  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  531

Query  462  QVLKDCPRNQEALIHVQRTTMKSKEKK  488
             +L+   +N+   + V+R +     ++
Sbjct  532  VLLEAAAQNKHVKLIVRRPSRTDPARR  558


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  891  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  935
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  117  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  176

Query  936  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  989
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  177  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  232

Query  990  MTHTEAIEII  999
             T  EA ++ 
Sbjct  233  ATQKEACDVF  242


 Score = 38.9 bits (89),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  169  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  228

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  229  LLLGATQKEACDVFVAIPVNEAVDIQVCR  257


 Score = 37.0 bits (84),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  581  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  640

Query  467  C  467
             
Sbjct  641  S  641


 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  581  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  638

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  639  KD--SGLSVRLTIA  650


 Score = 32.0 bits (71),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  705  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  757

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  758  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


>D3YT29_CAEEL unnamed protein product
Length=829

 Score = 248 bits (633),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 221/408 (54%), Gaps = 68/408 (17%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  484

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQQVSVGHIVPGGAADL  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  +  +SVG IV GGAA+ 
Sbjct  485  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTP-LSVGQIVIGGAAEE  531

Query  752  DSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSS  811
            D RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+
Sbjct  532  DGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA  591

Query  812  YSRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHIL  871
                      YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++
Sbjct  592  -----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVI  646

Query  872  AVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS--------------  911
            AVN +DI ++ H D ++LIKDSG SV LTI  P      L    ++              
Sbjct  647  AVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESN  706

Query  912  -------ASLSQKDEPTG----DGDG--------GQYHAVELTRGTRGFGFSIRGGREFQ  952
                    S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF 
Sbjct  707  YGLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFG  766

Query  953  NMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
            +MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  767  SMPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814


 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 2/114 (2%)

Query  162  SERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIVGGDDSV--EQFLQIKSVVPNGPAW  219
            S   +P FT +P +L G+ I T ++K ++GLGFT++G D S   ++F+Q+KSV+  GPA 
Sbjct  179  SRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAA  238

Query  220  LDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDP  273
             +G L++GD+LV VN   +LG T  E  +VF +I   E V ++VCRGY L  DP
Sbjct  239  ANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDP  292


 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  313  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  372

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  373  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  425


 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 103/211 (49%), Gaps = 16/211 (8%)

Query  819   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  875
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  487   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  546

Query  876   VDITNVCHKDIVNLIKDSGYS--VTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVE  933
              ++    H + V L++ +  +  V L +  P     S    +++      G  G Y  + 
Sbjct  547   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRP-----SRTDPARRGSLNSAGPSGSYDVLL  601

Query  934   LTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHT  993
                   GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H 
Sbjct  602   HRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHP  659

Query  994   EAIEIIRNGGPSVRLLVR----RGCQMPSVS  1020
             + I +I++ G SVRL +      G  +P VS
Sbjct  660   DTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  690


 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  739  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  798

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  799  QSTKGMSHDDAIRIIK  814


 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 99/204 (49%), Gaps = 23/204 (11%)

Query  708  EWIETLVTLVRQDTGFGFRIVG--GTEEGSQQVSVGHIVPGGAADLDSRLNTGDLIMSVD  765
            E I T   +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+
Sbjct  196  ELIST--KIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVN  253

Query  766  GESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQ  819
            G  ++ ++      + +A   N  V + + R            + EN+  ++ SR +   
Sbjct  254  GRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL---  310

Query  820  YPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDIT  879
              +++ + +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++ 
Sbjct  311  --HEIDIFK-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVR  362

Query  880  NVCHKDIVNLIKDS--GYSVTLTI  901
             + H  +V+++++   GY   L +
Sbjct  363  PIPHTQLVDMLRERPIGYRGKLVV  386


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  832   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  885
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  207   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  266

Query  886   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  943
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  267   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  324

Query  944   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1002
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  325   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  377

Query  1003  -GPSVRLLVRRGC  1014
              G   +L+V+RG 
Sbjct  378   IGYRGKLVVKRGS  390


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  493  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  551

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  552  ASHSEAVVLLEAAAQNKHVKLIVRR  576


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 69/318 (22%), Positives = 121/318 (38%), Gaps = 79/318 (25%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  315  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  365

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  366  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  425

Query  290  GEIEIGRDDENRHRGNSFLAD--ILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  465

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  466  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  498

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  499  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  558

Query  462  QVLKDCPRNQEALIHVQR  479
             +L+   +N+   + V+R
Sbjct  559  VLLEAAAQNKHVKLIVRR  576


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  891  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  935
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  144  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  203

Query  936  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  989
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  204  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  259

Query  990  MTHTEAIEII  999
             T  EA ++ 
Sbjct  260  ATQKEACDVF  269


 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  196  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  255

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  256  LLLGATQKEACDVFVAIPVNEAVDIQVCR  284


 Score = 37.0 bits (84),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  608  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  667

Query  467  C  467
             
Sbjct  668  S  668


 Score = 32.7 bits (73),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  608  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  665

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  666  KD--SGLSVRLTIA  677


 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  732  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  784

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  785  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


Query= XP_015584769.1 membrane-associated guanylate kinase, WW and PDZ
domain-containing protein 1 isoform X2 [Cephus cinctus]

Length=1073
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2L2_DROME  unnamed protein product                                 671     0.0  
D3YT29_CAEEL  unnamed protein product                                 248     5e-69
C6KRJ8_CAEEL  unnamed protein product                                 247     7e-69


>Q9W2L2_DROME unnamed protein product
Length=1202

 Score = 671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/948 (45%), Positives = 530/948 (56%), Gaps = 185/948 (20%)

Query  46    GSEQGTGNSEQDRNGQNRSQATEDQLGPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDPRL  105
             GSE G G+  Q +N ++      D LGPLPP WE AYT+ GE+YFIDHNTGTSHWLDPRL
Sbjct  268   GSECGVGDV-QHQNHESHDDPG-DGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDPRL  325

Query  106   SKFQKRSLEECLDDELPYGWEKIDDILYGTYFIDHVNRKTQYENPVLQAKRAQQGH----  161
             SK+QK+SLE+C +DELPYGWEKI+D +YG YFIDHVNR+TQYENPVL+AKR         
Sbjct  326   SKYQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQQQ  385

Query  162   ---------------------------------------SERKSP-NFTRNPDKLKGQSI  181
                                                    S  K P  FTRNP +L+GQ I
Sbjct  386   QQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHEQEEDESPMKLPYKFTRNPAELQGQRI  445

Query  182   RTTLLKSSRGLGFTIVGGDDS----VEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTC  237
              TTLLKSSRGLGFTIVG D S    VE+FLQIK+VVPNGPAWLDG+LQTGDVLVYVNDTC
Sbjct  446   NTTLLKSSRGLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVNDTC  505

Query  238   VLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDPNDPNTEVVTTIAVSAPGEIEIGRD  297
             VLG+TH++MVN+F+SI  GE   LEVCRGYPLPFDPNDPNTEVVTT+AV        GR+
Sbjct  506   VLGYTHHDMVNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVD-------GRE  558

Query  298   DENRHRGNSFLADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQNGENLATASVN  357
              + + R                      L  D  +NFLD +         GE     S  
Sbjct  559   SDKQRR----------------------LNMDGNYNFLDLS---------GEGAKKTSG-  586

Query  358   SMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIVKGSIGFGFTI  417
                              S +  +L +              KPE  + SI+KGS+GFGFTI
Sbjct  587   -----------------SGSGFILMK--------------KPEIYTFSIMKGSMGFGFTI  615

Query  418   ADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKDCPRNQEALIHV  477
             ADSA GQ VKKILDR  C  LMEGD+L+ IN  NV N  H  VV++LK+C +     + +
Sbjct  616   ADSACGQIVKKILDRNCCTQLMEGDVLLEINGLNVRNKPHFYVVELLKECSQTTPTAVKI  675

Query  478   QRT--------TMK--------SKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
             QRT        T+         +K +K       FRSKTPTAD+YSTQ K V+P RPKTP
Sbjct  676   QRTPPDPPANNTLAQLNQVGNVAKLRKNFVGSGLFRSKTPTADLYSTQVKEVLPMRPKTP  735

Query  522   LVDTRN---RPKTPNDSSSSNWNEIQNEN------EMNPLDNRYKYPDYNHT-----MYY  567
             LVDTR    + ++PN       NE+ +E       E  PL  + +    +       + Y
Sbjct  736   LVDTRRSRVQIQSPN-------NEVDDEGDGAAAAERKPLQLQTQGKSNSSLQELDDIPY  788

Query  568   TDPYKANIGNLSDNFVTMTNLDDDSVRNVTKRDWTTNDKLSLSSDMYSIDVSHHNNILKQ  627
              DPY   I  LS+    +T L  D+   +          +  S     + ++HH +    
Sbjct  789   MDPY-PKISRLSERLAEVT-LQGDANGGIY--------GMPPSMQPLPLPLAHHESCYCY  838

Query  628   NGSIHSDYYKDLYAVQSHSQYSEPDYNTYTIGQEQNVDTGEIWDKRKETTS------FEH  681
             +    +  Y+  Y VQ+           Y+  Q  ++    I  +  E  S      F +
Sbjct  839   D--CQAQRYRPGYFVQAQQAAMSGTTGQYSPLQTAHLQNERIQRRVNELLSDRRRVGFAN  896

Query  682   EQPHSSSVTRYPQYSGELVCPTIPDIEWIE-TLVTLVRQDTGFGFRIVGGTEEGSQQVSV  740
               P    +   P +    +     D +  E T VTL RQ  GFGFRIVGGTEEGS QV+V
Sbjct  897   LDP-PQQMQHSPSWRNGALLDVSEDADQCELTEVTLERQALGFGFRIVGGTEEGS-QVTV  954

Query  741   GHIVPGGAADLDSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINT  800
             GHIVPGGAAD D R+NTGD I+S+DG +V+NSSHH VV L+  +A  G+VT+ +RRR   
Sbjct  955   GHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRR--R  1012

Query  801   QEHLQENLQSSYSRHMNIQYPYDVTVTRMENEGFGFVIISSVNK-AGSTIGRIIEGSPAE  859
                LQ+   S+  R    +YPYDV V+R ENEGFGFVIISS N   GSTIG++I GSPA+
Sbjct  1013  TPLLQQAPVSTQLR----RYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPAD  1068

Query  860   RCGRLNVGDHILAVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYPLDD  907
             RCG L VGD I+AVN ++I  + H D+VNLIK+SG  V LTIG PL +
Sbjct  1069  RCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTIGVPLKE  1116


 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 11/191 (6%)

Query  823   DVTVTRMENEGFGFVIISSVNKAGS-TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNV  881
             +VT+ R +  GFGF I+    +    T+G I+ G  A++  R+N GD IL+++ +++ N 
Sbjct  928   EVTLER-QALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNS  986

Query  882   CHKDIVNLIKDSGY--SVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTR  939
              H  +V+L+ +S     VT+ +          A +S +           Y  +       
Sbjct  987   SHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRY------PYDVIVSRHENE  1040

Query  940   GFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEII  999
             GFGF I            + ++    PA     L+VGD+I+ +N I    M+H + + +I
Sbjct  1041  GFGFVIISSSN-HYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLI  1099

Query  1000  RNGGPSVRLLV  1010
             +  G  VRL +
Sbjct  1100  KESGLHVRLTI  1110


 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 40/77 (52%), Gaps = 1/77 (1%)

Query  923  DGDGGQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEI  982
            D D  +   V L R   GFGF I GG E +   + V  I   G A  D R+  GD+I+ I
Sbjct  920  DADQCELTEVTLERQALGFGFRIVGGTE-EGSQVTVGHIVPGGAADQDQRINTGDEILSI  978

Query  983  NGINTKNMTHTEAIEII  999
            +GIN  N +H + + ++
Sbjct  979  DGINVLNSSHHKVVSLV  995


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 87/216 (40%), Gaps = 55/216 (25%)

Query  833  GFGFVIISSVNKAGS------TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDI  886
            G GF I+ S   AG        I  ++   PA   G+L  GD ++ VN   +    H D+
Sbjct  455  GLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVNDTCVLGYTHHDM  514

Query  887  VNLIKD--SGYSVTLTI--GYPLD--------DCCSSASLSQKD----------------  918
            VN+ +    G    L +  GYPL         +  ++ ++  ++                
Sbjct  515  VNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVDGRESDKQRRLNMDGNYNFL  574

Query  919  --------EPTGDGDG------GQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAEN  964
                    + +G G G       + +   + +G+ GFGF+I      Q     V +I + 
Sbjct  575  DLSGEGAKKTSGSGSGFILMKKPEIYTFSIMKGSMGFGFTIADSACGQ----IVKKILDR  630

Query  965  GPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
               +   +L  GD ++EING+N +N  H   +E+++
Sbjct  631  ---NCCTQLMEGDVLLEINGLNVRNKPHFYVVELLK  663


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 8/98 (8%)

Query  927   GQYHAVELTRGTRGFGFSIRG-----GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIE  981
             GQ     L + +RG GF+I G     G + +   L +  +  NGPA +D +L+ GD ++ 
Sbjct  442   GQRINTTLLKSSRGLGFTIVGSDGSAGGDVEEF-LQIKTVVPNGPAWLDGQLQTGDVLVY  500

Query  982   INGINTKNMTHTEAIEIIRNGGPSVR--LLVRRGCQMP  1017
             +N       TH + + I ++  P  R  L V RG  +P
Sbjct  501   VNDTCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLP  538


>D3YT29_CAEEL unnamed protein product
Length=829

 Score = 248 bits (633),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 221/408 (54%), Gaps = 68/408 (17%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  484

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQQVSVGHIVPGGAADL  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  +  +SVG IV GGAA+ 
Sbjct  485  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTP-LSVGQIVIGGAAEE  531

Query  752  DSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSS  811
            D RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+
Sbjct  532  DGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA  591

Query  812  YSRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHIL  871
                      YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++
Sbjct  592  -----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVI  646

Query  872  AVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS--------------  911
            AVN +DI ++ H D ++LIKDSG SV LTI  P      L    ++              
Sbjct  647  AVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESN  706

Query  912  -------ASLSQKDEPTG----DG--------DGGQYHAVELTRGTRGFGFSIRGGREFQ  952
                    S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF 
Sbjct  707  YGLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFG  766

Query  953  NMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
            +MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  767  SMPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814


 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 2/114 (2%)

Query  162  SERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIVGGDDSV--EQFLQIKSVVPNGPAW  219
            S   +P FT +P +L G+ I T ++K ++GLGFT++G D S   ++F+Q+KSV+  GPA 
Sbjct  179  SRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAA  238

Query  220  LDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDP  273
             +G L++GD+LV VN   +LG T  E  +VF +I   E V ++VCRGY L  DP
Sbjct  239  ANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDP  292


 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  313  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  372

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  373  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  425


 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 103/211 (49%), Gaps = 16/211 (8%)

Query  819   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  875
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  487   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  546

Query  876   VDITNVCHKDIVNLIKDSGYS--VTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVE  933
              ++    H + V L++ +  +  V L +  P     S    +++      G  G Y  + 
Sbjct  547   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRP-----SRTDPARRGSLNSAGPSGSYDVLL  601

Query  934   LTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHT  993
                   GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H 
Sbjct  602   HRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHP  659

Query  994   EAIEIIRNGGPSVRLLVR----RGCQMPSVS  1020
             + I +I++ G SVRL +      G  +P VS
Sbjct  660   DTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  690


 Score = 54.3 bits (129),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  739  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  798

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  799  QSTKGMSHDDAIRIIK  814


 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 99/204 (49%), Gaps = 23/204 (11%)

Query  708  EWIETLVTLVRQDTGFGFRIVG--GTEEGSQQVSVGHIVPGGAADLDSRLNTGDLIMSVD  765
            E I T   +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+
Sbjct  196  ELIST--KIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVN  253

Query  766  GESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQ  819
            G  ++ ++      + +A   N  V + + R            + EN+  ++ SR +   
Sbjct  254  GRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL---  310

Query  820  YPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDIT  879
              +++ + +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++ 
Sbjct  311  --HEIDIFK-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVR  362

Query  880  NVCHKDIVNLIKDS--GYSVTLTI  901
             + H  +V+++++   GY   L +
Sbjct  363  PIPHTQLVDMLRERPIGYRGKLVV  386


 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  832   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  885
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  207   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  266

Query  886   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  943
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  267   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  324

Query  944   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1002
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  325   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  377

Query  1003  -GPSVRLLVRRGC  1014
              G   +L+V+RG 
Sbjct  378   IGYRGKLVVKRGS  390


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  493  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  551

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  552  ASHSEAVVLLEAAAQNKHVKLIVRR  576


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 69/318 (22%), Positives = 121/318 (38%), Gaps = 79/318 (25%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  315  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  365

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  366  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  425

Query  290  GEIEIGRDDENRHRGNSFL--ADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  465

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  466  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  498

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  499  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  558

Query  462  QVLKDCPRNQEALIHVQR  479
             +L+   +N+   + V+R
Sbjct  559  VLLEAAAQNKHVKLIVRR  576


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  891  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  935
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  144  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  203

Query  936  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  989
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  204  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  259

Query  990  MTHTEAIEII  999
             T  EA ++ 
Sbjct  260  ATQKEACDVF  269


 Score = 38.5 bits (88),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  196  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  255

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  256  LLLGATQKEACDVFVAIPVNEAVDIQVCR  284


 Score = 37.0 bits (84),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  608  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  667

Query  467  C  467
             
Sbjct  668  S  668


 Score = 32.3 bits (72),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  608  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  665

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  666  KD--SGLSVRLTIA  677


 Score = 32.0 bits (71),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  732  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  784

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  785  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814


>C6KRJ8_CAEEL unnamed protein product
Length=802

 Score = 247 bits (630),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 161/408 (39%), Positives = 221/408 (54%), Gaps = 68/408 (17%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  457

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQQVSVGHIVPGGAADL  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  +  +SVG IV GGAA+ 
Sbjct  458  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTP-LSVGQIVIGGAAEE  504

Query  752  DSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSS  811
            D RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+
Sbjct  505  DGRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA  564

Query  812  YSRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHIL  871
                      YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++
Sbjct  565  -----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVI  619

Query  872  AVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS--------------  911
            AVN +DI ++ H D ++LIKDSG SV LTI  P      L    ++              
Sbjct  620  AVNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESN  679

Query  912  -------ASLSQKDEPTG----DG--------DGGQYHAVELTRGTRGFGFSIRGGREFQ  952
                    S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF 
Sbjct  680  YGLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFG  739

Query  953  NMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  1000
            +MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  740  SMPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


 Score = 137 bits (344),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 126/258 (49%), Gaps = 56/258 (22%)

Query  72   GPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDPR-------------LSKFQKRSLEECLD  118
            G LPPNWE AYT+ G+ YFIDHNTGT+ W DPR                F    +     
Sbjct  8    GLLPPNWETAYTENGDKYFIDHNTGTTTWDDPRELPPGWEQVDDQNYGTFYVDHINRKTQ  67

Query  119  DELPYGW----EKIDD-ILYGTYFI----DHVNRKTQYENPVLQAKRA------------  157
             E PYG+      ID  + YGT       +H N  + Y +  L++  +            
Sbjct  68   YERPYGFGGSSATIDQPVKYGTLPSSTNHNHNNIYSHYNSGTLKSSSSPRDSGFDSSPTR  127

Query  158  --------------------QQGHSERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIV  197
                                 +  S   +P FT +P +L G+ I T ++K ++GLGFT++
Sbjct  128  YRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLI  187

Query  198  GGDDSV--EQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGS  255
            G D S   ++F+Q+KSV+  GPA  +G L++GD+LV VN   +LG T  E  +VF +I  
Sbjct  188  GNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPV  247

Query  256  GETVTLEVCRGYPLPFDP  273
             E V ++VCRGY L  DP
Sbjct  248  NEAVDIQVCRGYELFIDP  265


 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  286  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  345

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  346  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  398


 Score = 76.3 bits (186),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 103/212 (49%), Gaps = 18/212 (8%)

Query  819   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  875
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  460   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  519

Query  876   VDITNVCHKDIVNLIKDSGYS--VTLTIGYP-LDDCCSSASLSQKDEPTGDGDGGQYHAV  932
              ++    H + V L++ +  +  V L +  P   D     SL+        G  G Y  +
Sbjct  520   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA------GPSGSYDVL  573

Query  933   ELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTH  992
                    GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H
Sbjct  574   LHRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSH  631

Query  993   TEAIEIIRNGGPSVRLLVR----RGCQMPSVS  1020
              + I +I++ G SVRL +      G  +P VS
Sbjct  632   PDTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  663


 Score = 53.9 bits (128),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  712  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  771

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  772  QSTKGMSHDDAIRIIK  787


 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 96/196 (49%), Gaps = 21/196 (11%)

Query  716  LVRQDTGFGFRIVG--GTEEGSQQVSVGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSS  773
            +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+G  ++ ++
Sbjct  175  IVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGAT  234

Query  774  HHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQYPYDVTVT  827
                  + +A   N  V + + R            + EN+  ++ SR +     +++ + 
Sbjct  235  QKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL-----HEIDIF  289

Query  828  RMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDIV  887
            +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++  + H  +V
Sbjct  290  K-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVRPIPHTQLV  343

Query  888  NLIKDS--GYSVTLTI  901
            +++++   GY   L +
Sbjct  344  DMLRERPIGYRGKLVV  359


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  832   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  885
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  180   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  239

Query  886   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  943
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  240   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  297

Query  944   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1002
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  298   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  350

Query  1003  -GPSVRLLVRRGC  1014
              G   +L+V+RG 
Sbjct  351   IGYRGKLVVKRGS  363


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  466  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  524

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  525  ASHSEAVVLLEAAAQNKHVKLIVRR  549


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 124/327 (38%), Gaps = 79/327 (24%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  288  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  338

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  339  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  398

Query  290  GEIEIGRDDENRHRGNSFL--ADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  438

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  439  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  471

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  472  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  531

Query  462  QVLKDCPRNQEALIHVQRTTMKSKEKK  488
             +L+   +N+   + V+R +     ++
Sbjct  532  VLLEAAAQNKHVKLIVRRPSRTDPARR  558


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  891  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  935
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  117  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  176

Query  936  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  989
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  177  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  232

Query  990  MTHTEAIEII  999
             T  EA ++ 
Sbjct  233  ATQKEACDVF  242


 Score = 38.9 bits (89),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  169  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  228

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  229  LLLGATQKEACDVFVAIPVNEAVDIQVCR  257


 Score = 37.0 bits (84),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  581  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  640

Query  467  C  467
             
Sbjct  641  S  641


 Score = 32.0 bits (71),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 29/56 (52%), Gaps = 2/56 (4%)

Query  209  IKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGSGETVTLEVC  264
            +  + P  PA   G+L  GD ++ VN   +L  +H + +++ K   SG +V L + 
Sbjct  597  VGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD--SGLSVRLTIA  650


 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  705  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  757

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  758  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787



Lambda      K        H
   0.321    0.138    0.416 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1765589280


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584770.1 membrane-associated guanylate kinase, WW and PDZ
domain-containing protein 1 isoform X3 [Cephus cinctus]

Length=1072
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2L2_DROME  unnamed protein product                                 677     0.0  
C6KRJ8_CAEEL  unnamed protein product                                 252     1e-70
D3YT29_CAEEL  unnamed protein product                                 252     1e-70


>Q9W2L2_DROME unnamed protein product
Length=1202

 Score = 677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/949 (45%), Positives = 529/949 (56%), Gaps = 188/949 (20%)

Query  46    GSEQGTGNSEQDRNGQNRSQATE--DQLGPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDP  103
             GSE G G+ +     QN     +  D LGPLPP WE AYT+ GE+YFIDHNTGTSHWLDP
Sbjct  268   GSECGVGDVQH----QNHESHDDPGDGLGPLPPKWETAYTERGELYFIDHNTGTSHWLDP  323

Query  104   RLSKFQKRSLEECLDDELPYGWEKIDDILYGTYFIDHVNRKTQYENPVLQAKRAQQGH--  161
             RLSK+QK+SLE+C +DELPYGWEKI+D +YG YFIDHVNR+TQYENPVL+AKR       
Sbjct  324   RLSKYQKKSLEDCCEDELPYGWEKIEDSMYGMYFIDHVNRRTQYENPVLEAKRRAAEQSQ  383

Query  162   -----------------------------------------SERKSP-NFTRNPDKLKGQ  179
                                                      S  K P  FTRNP +L+GQ
Sbjct  384   QQQQMQQQQQQMQEQRSKTPTALSETMPTEAAEAHEQEEDESPMKLPYKFTRNPAELQGQ  443

Query  180   SIRTTLLKSSRGLGFTIVGGDDS----VEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
              I TTLLKSSRGLGFTIVG D S    VE+FLQIK+VVPNGPAWLDG+LQTGDVLVYVND
Sbjct  444   RINTTLLKSSRGLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVND  503

Query  236   TCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDPNDPNTEVVTTIAVSAPGEIEIG  295
             TCVLG+TH++MVN+F+SI  GE   LEVCRGYPLPFDPNDPNTEVVTT+AV        G
Sbjct  504   TCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVD-------G  556

Query  296   RDDENRHRGNSFLADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQNGENLATAS  355
             R+ + + R                      L  D  +NFLD +         GE     S
Sbjct  557   RESDKQRR----------------------LNMDGNYNFLDLS---------GEGAKKTS  585

Query  356   VNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIVKGSIGFGF  415
                                S +  +L +              KPE  + SI+KGS+GFGF
Sbjct  586   G------------------SGSGFILMK--------------KPEIYTFSIMKGSMGFGF  613

Query  416   TIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKDCPRNQEALI  475
             TIADSA GQ VKKILDR  C  LMEGD+L+ IN  NV N  H  VV++LK+C +     +
Sbjct  614   TIADSACGQIVKKILDRNCCTQLMEGDVLLEINGLNVRNKPHFYVVELLKECSQTTPTAV  673

Query  476   HVQRT--------TMK--------SKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPK  519
              +QRT        T+         +K +K       FRSKTPTAD+YSTQ K V+P RPK
Sbjct  674   KIQRTPPDPPANNTLAQLNQVGNVAKLRKNFVGSGLFRSKTPTADLYSTQVKEVLPMRPK  733

Query  520   TPLVDTRN---RPKTPNDSSSSNWNEIQNEN------EMNPLDNRYKYPDYNHT-----M  565
             TPLVDTR    + ++PN       NE+ +E       E  PL  + +    +       +
Sbjct  734   TPLVDTRRSRVQIQSPN-------NEVDDEGDGAAAAERKPLQLQTQGKSNSSLQELDDI  786

Query  566   YYTDPYKANIGNLSDNFVTMTNLDDDSVRNVTKRDWTTNDKLSLSSDMYSIDVSHHNNIL  625
              Y DPY   I  LS+    +T L  D+   +          +  S     + ++HH +  
Sbjct  787   PYMDPYP-KISRLSERLAEVT-LQGDANGGIYG--------MPPSMQPLPLPLAHHESCY  836

Query  626   KQNGSIHSDYYKDLYAVQSHSQYSEPDYNTYTIGQEQNVDTGEIWDKRKETTS------F  679
               +    +  Y+  Y VQ+           Y+  Q  ++    I  +  E  S      F
Sbjct  837   CYD--CQAQRYRPGYFVQAQQAAMSGTTGQYSPLQTAHLQNERIQRRVNELLSDRRRVGF  894

Query  680   EHEQPHSSSVTRYPQYSGELVCPTIPDIEWIE-TLVTLVRQDTGFGFRIVGGTEEGSQVS  738
              +  P    +   P +    +     D +  E T VTL RQ  GFGFRIVGGTEEGSQV+
Sbjct  895   ANLDP-PQQMQHSPSWRNGALLDVSEDADQCELTEVTLERQALGFGFRIVGGTEEGSQVT  953

Query  739   VGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRIN  798
             VGHIVPGGAAD D R+NTGD I+S+DG +V+NSSHH VV L+  +A  G+VT+ +RRR  
Sbjct  954   VGHIVPGGAADQDQRINTGDEILSIDGINVLNSSHHKVVSLVGESALRGQVTMILRRR--  1011

Query  799   TQEHLQENLQSSYSRHMNIQYPYDVTVTRMENEGFGFVIISSVNK-AGSTIGRIIEGSPA  857
                 LQ+   S+  R    +YPYDV V+R ENEGFGFVIISS N   GSTIG++I GSPA
Sbjct  1012  RTPLLQQAPVSTQLR----RYPYDVIVSRHENEGFGFVIISSSNHYYGSTIGKLIPGSPA  1067

Query  858   ERCGRLNVGDHILAVNHVDITNVCHKDIVNLIKDSGYSVTLTIGYPLDD  906
             +RCG L VGD I+AVN ++I  + H D+VNLIK+SG  V LTIG PL +
Sbjct  1068  DRCGELKVGDRIVAVNRIEIAGMSHGDVVNLIKESGLHVRLTIGVPLKE  1116


 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 88/191 (46%), Gaps = 11/191 (6%)

Query  822   DVTVTRMENEGFGFVIISSVNKAGS-TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNV  880
             +VT+ R +  GFGF I+    +    T+G I+ G  A++  R+N GD IL+++ +++ N 
Sbjct  928   EVTLER-QALGFGFRIVGGTEEGSQVTVGHIVPGGAADQDQRINTGDEILSIDGINVLNS  986

Query  881   CHKDIVNLIKDSGY--SVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTR  938
              H  +V+L+ +S     VT+ +          A +S +           Y  +       
Sbjct  987   SHHKVVSLVGESALRGQVTMILRRRRTPLLQQAPVSTQLRRY------PYDVIVSRHENE  1040

Query  939   GFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEII  998
             GFGF I            + ++    PA     L+VGD+I+ +N I    M+H + + +I
Sbjct  1041  GFGFVIISSSN-HYYGSTIGKLIPGSPADRCGELKVGDRIVAVNRIEIAGMSHGDVVNLI  1099

Query  999   RNGGPSVRLLV  1009
             +  G  VRL +
Sbjct  1100  KESGLHVRLTI  1110


 Score = 50.4 bits (119),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query  922   DGDGGQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEI  981
             D D  +   V L R   GFGF I GG E +   + V  I   G A  D R+  GD+I+ I
Sbjct  920   DADQCELTEVTLERQALGFGFRIVGGTE-EGSQVTVGHIVPGGAADQDQRINTGDEILSI  978

Query  982   NGINTKNMTHTEAIEIIRNGG--PSVRLLVRR  1011
             +GIN  N +H + + ++        V +++RR
Sbjct  979   DGINVLNSSHHKVVSLVGESALRGQVTMILRR  1010


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 49/216 (23%), Positives = 87/216 (40%), Gaps = 55/216 (25%)

Query  832  GFGFVIISSVNKAGS------TIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDI  885
            G GF I+ S   AG        I  ++   PA   G+L  GD ++ VN   +    H D+
Sbjct  455  GLGFTIVGSDGSAGGDVEEFLQIKTVVPNGPAWLDGQLQTGDVLVYVNDTCVLGYTHHDM  514

Query  886  VNLIKD--SGYSVTLTI--GYPLD--------DCCSSASLSQKD----------------  917
            VN+ +    G    L +  GYPL         +  ++ ++  ++                
Sbjct  515  VNIFQSILPGERAALEVCRGYPLPFDPNDPNTEVVTTMAVDGRESDKQRRLNMDGNYNFL  574

Query  918  --------EPTGDGDG------GQYHAVELTRGTRGFGFSIRGGREFQNMPLFVLQIAEN  963
                    + +G G G       + +   + +G+ GFGF+I      Q     V +I + 
Sbjct  575  DLSGEGAKKTSGSGSGFILMKKPEIYTFSIMKGSMGFGFTIADSACGQ----IVKKILDR  630

Query  964  GPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  999
               +   +L  GD ++EING+N +N  H   +E+++
Sbjct  631  ---NCCTQLMEGDVLLEINGLNVRNKPHFYVVELLK  663


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/98 (31%), Positives = 48/98 (49%), Gaps = 8/98 (8%)

Query  926   GQYHAVELTRGTRGFGFSIRG-----GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIE  980
             GQ     L + +RG GF+I G     G + +   L +  +  NGPA +D +L+ GD ++ 
Sbjct  442   GQRINTTLLKSSRGLGFTIVGSDGSAGGDVEEF-LQIKTVVPNGPAWLDGQLQTGDVLVY  500

Query  981   INGINTKNMTHTEAIEIIRNGGPSVR--LLVRRGCQMP  1016
             +N       TH + + I ++  P  R  L V RG  +P
Sbjct  501   VNDTCVLGYTHHDMVNIFQSILPGERAALEVCRGYPLP  538


>C6KRJ8_CAEEL unnamed protein product
Length=802

 Score = 252 bits (644),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/407 (40%), Positives = 221/407 (54%), Gaps = 67/407 (16%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  457

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQVSVGHIVPGGAADLD  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  + +SVG IV GGAA+ D
Sbjct  458  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEED  505

Query  752  SRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSSY  811
             RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+ 
Sbjct  506  GRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA-  564

Query  812  SRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILA  871
                     YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++A
Sbjct  565  ----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIA  620

Query  872  VNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS---------------  910
            VN +DI ++ H D ++LIKDSG SV LTI  P      L    ++               
Sbjct  621  VNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESNY  680

Query  911  ------ASLSQKDEPTG----DG--------DGGQYHAVELTRGTRGFGFSIRGGREFQN  952
                   S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF +
Sbjct  681  GLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFGS  740

Query  953  MPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  999
            MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  741  MPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


 Score = 137 bits (344),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 126/258 (49%), Gaps = 56/258 (22%)

Query  72   GPLPPNWEKAYTDTGEVYFIDHNTGTSHWLDPR-------------LSKFQKRSLEECLD  118
            G LPPNWE AYT+ G+ YFIDHNTGT+ W DPR                F    +     
Sbjct  8    GLLPPNWETAYTENGDKYFIDHNTGTTTWDDPRELPPGWEQVDDQNYGTFYVDHINRKTQ  67

Query  119  DELPYGW----EKIDD-ILYGTYFI----DHVNRKTQYENPVLQAKRA------------  157
             E PYG+      ID  + YGT       +H N  + Y +  L++  +            
Sbjct  68   YERPYGFGGSSATIDQPVKYGTLPSSTNHNHNNIYSHYNSGTLKSSSSPRDSGFDSSPTR  127

Query  158  --------------------QQGHSERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIV  197
                                 +  S   +P FT +P +L G+ I T ++K ++GLGFT++
Sbjct  128  YRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLI  187

Query  198  GGDDSV--EQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGS  255
            G D S   ++F+Q+KSV+  GPA  +G L++GD+LV VN   +LG T  E  +VF +I  
Sbjct  188  GNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPV  247

Query  256  GETVTLEVCRGYPLPFDP  273
             E V ++VCRGY L  DP
Sbjct  248  NEAVDIQVCRGYELFIDP  265


 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  286  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  345

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  346  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  398


 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 103/212 (49%), Gaps = 18/212 (8%)

Query  818   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  874
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  460   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  519

Query  875   VDITNVCHKDIVNLIKDSGYS--VTLTIGYP-LDDCCSSASLSQKDEPTGDGDGGQYHAV  931
              ++    H + V L++ +  +  V L +  P   D     SL+        G  G Y  +
Sbjct  520   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA------GPSGSYDVL  573

Query  932   ELTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTH  991
                    GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H
Sbjct  574   LHRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSH  631

Query  992   TEAIEIIRNGGPSVRLLVR----RGCQMPSVS  1019
              + I +I++ G SVRL +      G  +P VS
Sbjct  632   PDTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  663


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  712  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  771

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  772  QSTKGMSHDDAIRIIK  787


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 96/196 (49%), Gaps = 22/196 (11%)

Query  716  LVRQDTGFGFRIVG--GTEEGSQ-VSVGHIVPGGAADLDSRLNTGDLIMSVDGESVMNSS  772
            +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+G  ++ ++
Sbjct  175  IVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGAT  234

Query  773  HHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQYPYDVTVT  826
                  + +A   N  V + + R            + EN+  ++ SR +     +++ + 
Sbjct  235  QKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL-----HEIDIF  289

Query  827  RMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKDIV  886
            +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++  + H  +V
Sbjct  290  K-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVRPIPHTQLV  343

Query  887  NLIKDS--GYSVTLTI  900
            +++++   GY   L +
Sbjct  344  DMLRERPIGYRGKLVV  359


 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  831   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  884
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  180   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  239

Query  885   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  942
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  240   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  297

Query  943   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1001
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  298   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  350

Query  1002  -GPSVRLLVRRGC  1013
              G   +L+V+RG 
Sbjct  351   IGYRGKLVVKRGS  363


 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  466  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  524

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  525  ASHSEAVVLLEAAAQNKHVKLIVRR  549


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 69/327 (21%), Positives = 124/327 (38%), Gaps = 79/327 (24%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  288  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  338

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  339  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  398

Query  290  GEIEIGRDDENRHRGNSFL--ADILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  399  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  438

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  439  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  471

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  472  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  531

Query  462  QVLKDCPRNQEALIHVQRTTMKSKEKK  488
             +L+   +N+   + V+R +     ++
Sbjct  532  VLLEAAAQNKHVKLIVRRPSRTDPARR  558


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  890  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  934
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  117  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  176

Query  935  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  988
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  177  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  232

Query  989  MTHTEAIEII  998
             T  EA ++ 
Sbjct  233  ATQKEACDVF  242


 Score = 38.9 bits (89),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  169  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  228

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  229  LLLGATQKEACDVFVAIPVNEAVDIQVCR  257


 Score = 37.0 bits (84),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  581  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  640

Query  467  C  467
             
Sbjct  641  S  641


 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  581  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  638

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  639  KD--SGLSVRLTIA  650


 Score = 32.0 bits (71),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  705  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  757

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  758  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  787


>D3YT29_CAEEL unnamed protein product
Length=829

 Score = 252 bits (644),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 161/407 (40%), Positives = 221/407 (54%), Gaps = 67/407 (16%)

Query  642  VQSHSQYSEPDYNTYTIGQEQNVDTGEIWD----------KRKETTSFEHEQPHSSSVTR  691
             +  +  +E D N     Q Q   T E W+           R  +T+     P+   +++
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSE-WEGMSSAIPASRMRPSSTTLGFATPNYIPLSQ  484

Query  692  YPQYSGELVCPTIPDIEWIETLVTLVRQDTGFGFRIVGGTEEGSQVSVGHIVPGGAADLD  751
            Y Q   +L+             V+L+R+  GFGFR++GG E  + +SVG IV GGAA+ D
Sbjct  485  YNQKPSDLIT------------VSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEED  532

Query  752  SRLNTGDLIMSVDGESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRINTQEHLQENLQSSY  811
             RL  GD I+ +DG +V  +SH   V L+ AAAQN  V L +RR   T    + +L S+ 
Sbjct  533  GRLQEGDEIVEIDGHNVEGASHSEAVVLLEAAAQNKHVKLIVRRPSRTDPARRGSLNSA-  591

Query  812  SRHMNIQYPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILA  871
                     YDV + R EN+GFGFV++SS +K GST+G+I  GSPA RCGRL+VGD ++A
Sbjct  592  ----GPSGSYDVLLHRNENDGFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIA  647

Query  872  VNHVDITNVCHKDIVNLIKDSGYSVTLTIGYP------LDDCCSS---------------  910
            VN +DI ++ H D ++LIKDSG SV LTI  P      L    ++               
Sbjct  648  VNGIDILSLSHPDTISLIKDSGLSVRLTIAPPNTAGPVLPMVSATLGRNFTMNGHYESNY  707

Query  911  ------ASLSQKDEPTG----DG--------DGGQYHAVELTRGTRGFGFSIRGGREFQN  952
                   S+ +K  P      DG          G    V L RGT+GFGFSIRGG+EF +
Sbjct  708  GLPPPPPSVYEKHPPPSYLAFDGLSINDRMSMNGNLIDVTLERGTKGFGFSIRGGQEFGS  767

Query  953  MPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIR  999
            MPLFVL+IA++GPA  D RL+VGDQ+  ING +TK M+H +AI II+
Sbjct  768  MPLFVLRIADDGPAKADGRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814


 Score = 103 bits (258),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 75/114 (66%), Gaps = 2/114 (2%)

Query  162  SERKSPNFTRNPDKLKGQSIRTTLLKSSRGLGFTIVGGDDSV--EQFLQIKSVVPNGPAW  219
            S   +P FT +P +L G+ I T ++K ++GLGFT++G D S   ++F+Q+KSV+  GPA 
Sbjct  179  SRSSNPLFTTDPARLGGELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAA  238

Query  220  LDGKLQTGDVLVYVNDTCVLGFTHNEMVNVFKSIGSGETVTLEVCRGYPLPFDP  273
             +G L++GD+LV VN   +LG T  E  +VF +I   E V ++VCRGY L  DP
Sbjct  239  ANGVLRSGDILVRVNGRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDP  292


 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 71/118 (60%), Gaps = 5/118 (4%)

Query  404  ISIVKGSIGFGFTIADSAHGQKVKKILDRQRCKNLMEGDILVNINDTNVCNMCHSEVVQV  463
            I I KGS GFGFTIAD+ +GQ++KKIL   +C NLMEGD +V ++  NV  + H+++V +
Sbjct  313  IDIFKGSEGFGFTIADNLNGQRIKKILFPSQCPNLMEGDTIVELDGRNVRPIPHTQLVDM  372

Query  464  LKDCPRNQEALIHVQRTTMKSKEKKEKSSQDFFRSKTPTADIYSTQSKTVVPSRPKTP  521
            L++ P      + V+R + K++ +   ++   FR   P  ++    S   +P R KTP
Sbjct  373  LRERPIGYRGKLVVKRGSPKTRSRTPSAA---FRYGEPQTNMM--DSAAPLPVRSKTP  425


 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 103/211 (49%), Gaps = 16/211 (8%)

Query  818   QYPYD-VTVTRMENE-GFGFVIISSV-NKAGSTIGRIIEGSPAERCGRLNVGDHILAVNH  874
             Q P D +TV+ +    GFGF ++  V +K   ++G+I+ G  AE  GRL  GD I+ ++ 
Sbjct  487   QKPSDLITVSLIRKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDG  546

Query  875   VDITNVCHKDIVNLIKDSGYS--VTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVE  932
              ++    H + V L++ +  +  V L +  P     S    +++      G  G Y  + 
Sbjct  547   HNVEGASHSEAVVLLEAAAQNKHVKLIVRRP-----SRTDPARRGSLNSAGPSGSYDVLL  601

Query  933   LTRGTRGFGFSIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHT  992
                   GFGF +   +        V QI    PA+   RL VGD++I +NGI+  +++H 
Sbjct  602   HRNENDGFGFVLMSSQHKNGS--TVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHP  659

Query  993   EAIEIIRNGGPSVRLLVR----RGCQMPSVS  1019
             + I +I++ G SVRL +      G  +P VS
Sbjct  660   DTISLIKDSGLSVRLTIAPPNTAGPVLPMVS  690


 Score = 53.9 bits (128),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 41/76 (54%), Gaps = 0/76 (0%)

Query  176  LKGQSIRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVND  235
            + G  I  TL + ++G GF+I GG +     L +  +  +GPA  DG+LQ GD L  +N 
Sbjct  739  MNGNLIDVTLERGTKGFGFSIRGGQEFGSMPLFVLRIADDGPAKADGRLQVGDQLTTING  798

Query  236  TCVLGFTHNEMVNVFK  251
                G +H++ + + K
Sbjct  799  QSTKGMSHDDAIRIIK  814


 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 99/204 (49%), Gaps = 24/204 (12%)

Query  708  EWIETLVTLVRQDTGFGFRIVG--GTEEGSQ-VSVGHIVPGGAADLDSRLNTGDLIMSVD  764
            E I T   +V+   G GF ++G   +  G + + V  ++ GG A  +  L +GD+++ V+
Sbjct  196  ELIST--KIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVN  253

Query  765  GESVMNSSHHHVVQLMIAAAQNGRVTLGIRRRIN-----TQEHLQENL-QSSYSRHMNIQ  818
            G  ++ ++      + +A   N  V + + R            + EN+  ++ SR +   
Sbjct  254  GRLLLGATQKEACDVFVAIPVNEAVDIQVCRGYELFIDPANRIVTENVYAAAKSRDL---  310

Query  819  YPYDVTVTRMENEGFGFVIISSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDIT  878
              +++ + +  +EGFGF I  ++N  G  I +I+  S   +C  L  GD I+ ++  ++ 
Sbjct  311  --HEIDIFK-GSEGFGFTIADNLN--GQRIKKILFPS---QCPNLMEGDTIVELDGRNVR  362

Query  879  NVCHKDIVNLIKDS--GYSVTLTI  900
             + H  +V+++++   GY   L +
Sbjct  363  PIPHTQLVDMLRERPIGYRGKLVV  386


 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/193 (24%), Positives = 83/193 (43%), Gaps = 19/193 (10%)

Query  831   EGFGFVII----SSVNKAGSTIGRIIEGSPAERCGRLNVGDHILAVNHVDITNVCHKD--  884
             +G GF +I    SS       +  ++ G PA   G L  GD ++ VN   +     K+  
Sbjct  207   KGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLGATQKEAC  266

Query  885   --IVNLIKDSGYSVTLTIGYPLDDCCSSASLSQKDEPTGDGDGGQYHAVELTRGTRGFGF  942
                V +  +    + +  GY L      A+    +           H +++ +G+ GFGF
Sbjct  267   DVFVAIPVNEAVDIQVCRGYEL--FIDPANRIVTENVYAAAKSRDLHEIDIFKGSEGFGF  324

Query  943   SIRGGREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKNMTHTEAIEIIRNG-  1001
             +I      Q +   +       P+   N L  GD I+E++G N + + HT+ ++++R   
Sbjct  325   TIADNLNGQRIKKILF------PSQCPN-LMEGDTIVELDGRNVRPIPHTQLVDMLRERP  377

Query  1002  -GPSVRLLVRRGC  1013
              G   +L+V+RG 
Sbjct  378   IGYRGKLVVKRGS  390


 Score = 47.0 bits (110),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query  181  IRTTLLKSSRGLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLG  240
            I  +L++   G GF ++GG +S +  L +  +V  G A  DG+LQ GD +V ++   V G
Sbjct  493  ITVSLIRKPVGFGFRLLGGVES-KTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEG  551

Query  241  FTHNEMVNVFKSIGSGETVTLEVCR  265
             +H+E V + ++    + V L V R
Sbjct  552  ASHSEAVVLLEAAAQNKHVKLIVRR  576


 Score = 42.7 bits (99),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 69/318 (22%), Positives = 121/318 (38%), Gaps = 79/318 (25%)

Query  185  LLKSSRGLGFTIVGG--DDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFT  242
            + K S G GFTI        +++ L   S  PN        L  GD +V ++   V    
Sbjct  315  IFKGSEGFGFTIADNLNGQRIKKIL-FPSQCPN--------LMEGDTIVELDGRNVRPIP  365

Query  243  HNEMVNVFKSIGSGETVTLEVCRGYP--------LPFDPNDPNTEVVTTIA-----VSAP  289
            H ++V++ +    G    L V RG P          F   +P T ++ + A        P
Sbjct  366  HTQLVDMLRERPIGYRGKLVVKRGSPKTRSRTPSAAFRYGEPQTNMMDSAAPLPVRSKTP  425

Query  290  GEIEIGRDDENRHRGNSFLAD--ILTEEPGMYMDLDPSLQNDARFNFLDSTFLPVHSLQN  347
             E +  R +E+++  N+      + +E  GM                  S+ +P   +  
Sbjct  426  AERQTSRTEEDQNVRNTLQRQPAVTSEWEGM------------------SSAIPASRM--  465

Query  348  GENLATASVNSMPDLCISDKINTIKRPSSTDILLTESGNMNDRKDSPMPSKPEFLSISIV  407
                                     RPSST +       +   + +  PS  + +++S++
Sbjct  466  -------------------------RPSSTTLGFATPNYIPLSQYNQKPS--DLITVSLI  498

Query  408  KGSIGFGFTI---ADSAHGQKVKKIL---DRQRCKNLMEGDILVNINDTNVCNMCHSEVV  461
            +  +GFGF +    +S     V +I+     +    L EGD +V I+  NV    HSE V
Sbjct  499  RKPVGFGFRLLGGVESKTPLSVGQIVIGGAAEEDGRLQEGDEIVEIDGHNVEGASHSEAV  558

Query  462  QVLKDCPRNQEALIHVQR  479
             +L+   +N+   + V+R
Sbjct  559  VLLEAAAQNKHVKLIVRR  576


 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 57/130 (44%), Gaps = 25/130 (19%)

Query  890  KDSGYSVTLT----IGYPLDDCCSSAS-------LSQKDEPTGDGD----GGQYHAVELT  934
            +DSG+  + T     G P +   SSA         S+   P    D    GG+  + ++ 
Sbjct  144  RDSGFDSSPTRYRKFGDPPETATSSADYDHHSKMFSRSSNPLFTTDPARLGGELISTKIV  203

Query  935  RGTRGFGFSIRG------GREFQNMPLFVLQIAENGPASVDNRLRVGDQIIEINGINTKN  988
            +G +G GF++ G      G EF    + V  +   GPA+ +  LR GD ++ +NG     
Sbjct  204  KGAKGLGFTLIGNDSSSRGDEF----IQVKSVLSGGPAAANGVLRSGDILVRVNGRLLLG  259

Query  989  MTHTEAIEII  998
             T  EA ++ 
Sbjct  260  ATQKEACDVF  269


 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 9/89 (10%)

Query  400  EFLSISIVKGSIGFGFTIA---DSAHGQ---KVKKILDRQRCKN---LMEGDILVNINDT  450
            E +S  IVKG+ G GFT+     S+ G    +VK +L          L  GDILV +N  
Sbjct  196  ELISTKIVKGAKGLGFTLIGNDSSSRGDEFIQVKSVLSGGPAAANGVLRSGDILVRVNGR  255

Query  451  NVCNMCHSEVVQVLKDCPRNQEALIHVQR  479
             +      E   V    P N+   I V R
Sbjct  256  LLLGATQKEACDVFVAIPVNEAVDIQVCR  284


 Score = 37.0 bits (84),  Expect = 0.100, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 5/61 (8%)

Query  412  GFGFTIADSAH--GQKVKKILD---RQRCKNLMEGDILVNINDTNVCNMCHSEVVQVLKD  466
            GFGF +  S H  G  V +I       RC  L  GD ++ +N  ++ ++ H + + ++KD
Sbjct  608  GFGFVLMSSQHKNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLIKD  667

Query  467  C  467
             
Sbjct  668  S  668


 Score = 32.7 bits (73),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 19/74 (26%), Positives = 35/74 (47%), Gaps = 4/74 (5%)

Query  191  GLGFTIVGGDDSVEQFLQIKSVVPNGPAWLDGKLQTGDVLVYVNDTCVLGFTHNEMVNVF  250
            G GF ++      +    +  + P  PA   G+L  GD ++ VN   +L  +H + +++ 
Sbjct  608  GFGFVLMSSQH--KNGSTVGQIQPGSPAARCGRLSVGDRVIAVNGIDILSLSHPDTISLI  665

Query  251  KSIGSGETVTLEVC  264
            K   SG +V L + 
Sbjct  666  KD--SGLSVRLTIA  677


 Score = 31.6 bits (70),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 25/90 (28%), Positives = 42/90 (47%), Gaps = 17/90 (19%)

Query  386  NMNDRKDSPMPSKPEFLSISIVKGSIGFGFTIADSAHGQK-------VKKILDRQRCK--  436
            ++NDR    M      + +++ +G+ GFGF+I     GQ+       V +I D    K  
Sbjct  732  SINDR----MSMNGNLIDVTLERGTKGFGFSIRG---GQEFGSMPLFVLRIADDGPAKAD  784

Query  437  -NLMEGDILVNINDTNVCNMCHSEVVQVLK  465
              L  GD L  IN  +   M H + ++++K
Sbjct  785  GRLQVGDQLTTINGQSTKGMSHDDAIRIIK  814



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584774.1 diacylglycerol O-acyltransferase 1 isoform X1 [Cephus
cinctus]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8ST50_DROME  unnamed protein product                                 656     0.0  
Q960U8_DROME  unnamed protein product                                 655     0.0  
DGAT1_DICDI  unnamed protein product                                  244     2e-73


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/493 (63%), Positives = 383/493 (78%), Gaps = 14/493 (3%)

Query  6    NEAPVRNRRAKSVTRAEEIQKAELRVRKSQPDKPCHQPRDSLFSWSSGFDNFTGFVNWGF  65
            +E  +R RR +SVTRAEEI   E + R++QP +P H+PRDSLFSWSSGF NF+G VNWGF
Sbjct  85   SEKKLRYRRTQSVTRAEEISNKEEKQRRAQPGRPIHRPRDSLFSWSSGFTNFSGLVNWGF  144

Query  66   LLLGIGGIRLLLENFIKYGIRVDPRQWFLFLSGKNDGGEEHPSILLIFYSTVPVVLCLLI  125
            LLL IGG+RL LEN +KYGIR++P  WF F+SG N+G E H +++L  YS V + LCL +
Sbjct  145  LLLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEG-EGHNALILSIYSLVHISLCLAV  203

Query  126  EKGLAVEIIAHGPGMVFHVVNLIVMVLMPMVVIHVKDSGFSLIGAMYVCMLYAILFLKLW  185
            EKGLA+EIIA G G+   +VN++V+V +P+V IH+K   FSL+GA  VC  Y++LFLKLW
Sbjct  204  EKGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFFYSVLFLKLW  263

Query  186  SYVQVNMWCRLSSRRKSTSQGRMRRQSLSCNNLQSSEVKQNGNATADARDEKEGRSPALV  245
            SYVQ NMWCR +  +K+    R RR S++   L+       G       DE   +   LV
Sbjct  264  SYVQTNMWCRQTYYQKNP---RERRPSITLAELKK------GVLNGGEEDEDVSK---LV  311

Query  246  QYPDNLTLGDLYYYILAPTLCYELNFPRTQRIRKRFLIKRILEVLVGCQVVMSLFQQWMV  305
            QYPDNLT  DL Y++ APTLCYELNFPRT R+RKRFL+KR+LEV++G  VVM+LFQQW++
Sbjct  312  QYPDNLTYNDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWII  371

Query  306  PSVKNSLIPFSNMDVAKASERLLKLAIPNHLMWLCFFYLVFHSYLNLMGELLHFADRNFY  365
            PSV+NSLIPFSNMDVA A+ERLLKLA+PNHL WLCFFYL+FHS+LN +GELL+FADRNFY
Sbjct  372  PSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFY  431

Query  366  GDWWNSNNIDTFWRSWNIPVHRWAIRHLYIPIVGMGYGKSTASITVFFISAFFHEYLVSV  425
             DWWN+NNIDTFWR+WN+PVHRW +RHLYIP+V MGY    AS  VF  SA FHEYLVSV
Sbjct  432  CDWWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSV  491

Query  426  PLKTFKIWAFMGMMGQIPLSALSKIVEKRCGARWGNIVVWSSLIIGQPLCIMMYYHDYVV  485
            PL+ +KIWAFMGMMGQIPLSA+SK +EK+ G R GNI+VW+S+I+GQPLCIM YYHDYVV
Sbjct  492  PLQIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVV  551

Query  486  THFGETLL-EDYS  497
             HF  +L   DYS
Sbjct  552  QHFKNSLNGTDYS  564


>Q960U8_DROME unnamed protein product
Length=565

 Score = 655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/493 (63%), Positives = 383/493 (78%), Gaps = 14/493 (3%)

Query  6    NEAPVRNRRAKSVTRAEEIQKAELRVRKSQPDKPCHQPRDSLFSWSSGFDNFTGFVNWGF  65
            +E  +R RR +SVTRAEEI   E + R++QP +P H+PRDSLFSWSSGF NF+G VNWGF
Sbjct  85   SEKKLRYRRTQSVTRAEEISNKEEKQRRAQPGRPIHRPRDSLFSWSSGFTNFSGLVNWGF  144

Query  66   LLLGIGGIRLLLENFIKYGIRVDPRQWFLFLSGKNDGGEEHPSILLIFYSTVPVVLCLLI  125
            LLL IGG+RL LEN +KYGIR++P  WF F+SG N+G E H +++L  YS V + LCL +
Sbjct  145  LLLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEG-EGHNALILSIYSLVHISLCLAV  203

Query  126  EKGLAVEIIAHGPGMVFHVVNLIVMVLMPMVVIHVKDSGFSLIGAMYVCMLYAILFLKLW  185
            EKGLA+EIIA G G+   +VN++V+V +P+V IH+K   FSL+GA  VC  Y++LFLKLW
Sbjct  204  EKGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFFYSVLFLKLW  263

Query  186  SYVQVNMWCRLSSRRKSTSQGRMRRQSLSCNNLQSSEVKQNGNATADARDEKEGRSPALV  245
            SYVQ NMWCR +  +K+    R RR S++   L+       G       DE   +   LV
Sbjct  264  SYVQTNMWCRQTYYQKNP---RERRPSITLAELKK------GVLNGGEEDEDVSK---LV  311

Query  246  QYPDNLTLGDLYYYILAPTLCYELNFPRTQRIRKRFLIKRILEVLVGCQVVMSLFQQWMV  305
            QYPDNLT  DL Y++ APTLCYELNFPRT R+RKRFL+KR+LEV++G  VVM+LFQQW++
Sbjct  312  QYPDNLTYKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWII  371

Query  306  PSVKNSLIPFSNMDVAKASERLLKLAIPNHLMWLCFFYLVFHSYLNLMGELLHFADRNFY  365
            PSV+NSLIPFSNMDVA A+ERLLKLA+PNHL WLCFFYL+FHS+LN +GELL+FADRNFY
Sbjct  372  PSVRNSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFY  431

Query  366  GDWWNSNNIDTFWRSWNIPVHRWAIRHLYIPIVGMGYGKSTASITVFFISAFFHEYLVSV  425
             DWWN+NNIDTFWR+WN+PVHRW +RHLYIP+V MGY    AS  VF  SA FHEYLVSV
Sbjct  432  CDWWNANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSV  491

Query  426  PLKTFKIWAFMGMMGQIPLSALSKIVEKRCGARWGNIVVWSSLIIGQPLCIMMYYHDYVV  485
            PL+ +KIWAFMGMMGQIPLSA+SK +EK+ G R GNI+VW+S+I+GQPLCIM YYHDYVV
Sbjct  492  PLQIYKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVV  551

Query  486  THFGETLL-EDYS  497
             HF  +L   DYS
Sbjct  552  QHFKNSLNGTDYS  564


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 138/448 (31%), Positives = 239/448 (53%), Gaps = 51/448 (11%)

Query  44   RDSLFSWSSGFDNFTGFVNWGFLLLGIGGIRLLLENFIKYGIRVDPRQWFLFLSGKNDGG  103
            R S+ S  S   ++ GF+N   +LL     RL++ N + YGIR++   + +         
Sbjct  198  RPSILSSESNGSSYRGFLNLLLILLITASFRLVILNHLLYGIRINLDLYKI--------S  249

Query  104  EEH--PSILLIFYSTVPVVLCLLIEKGLAVEIIAHGPGMVFHVVNLIVMVLMPM--VVIH  159
            E H  P +++     + ++   LIEK  A +++      +  ++N   ++++P   ++  
Sbjct  250  EYHRWPGVMISLMINLFIIAAYLIEKAAAKQLLPDRICYLLRIINCAAVIIVPSGSIIAF  309

Query  160  VKDSGFSLIGAMYVCMLYAILFLKLWSYVQVNMWCRLSSRRKSTSQGRMRRQSLSCNNLQ  219
              +    +I  + +C       +K+ SY   N     S +RK                  
Sbjct  310  SPNPASGIIVMILICTFS----MKIISYAYEN-----SKQRKLNPD--------------  346

Query  220  SSEVKQNGNATADARDEKEGRSPALVQYPDNLTLGDLYYYILAPTLCYELNFPRTQRIRK  279
                  N     D  +           YP+NL+L   Y+++L PTL Y+L++PR+ +IRK
Sbjct  347  ------NKKFVIDPTNTS--------IYPNNLSLRSTYWFMLVPTLVYQLSYPRSPKIRK  392

Query  280  RFLIKRILEVLVGCQVVMSLFQQWMVPSVKNSLIPFSNMDVAKASERLLKLAIPNHLMWL  339
             +L++RI+E L    +++ +  Q+M+P V+NS+ P   +D+    ER++KL++PN  +WL
Sbjct  393  GYLLRRIVEALSLSLLILWMVNQYMLPLVQNSIEPLEKIDIVLIVERIMKLSLPNLYVWL  452

Query  340  CFFYLVFHSYLNLMGELLHFADRNFYGDWWNSNNIDTFWRSWNIPVHRWAIRHLYIPIVG  399
              FY+ FH YLN++ E+  F DR FY DWWNS  +D FWR+WN+PVH W +  +Y P+  
Sbjct  453  LGFYVFFHLYLNIVAEITRFGDREFYRDWWNSTGLDYFWRTWNMPVHHWMVVLIYTPMRR  512

Query  400  MGYGKSTASITVFFISAFFHEYLVSVPLKTFKIWAFMGMMGQIPLSALSKIVEKRCGARW  459
             G+ K+      FF+SA FHE ++S+P  + K+W F G+M Q+ L AL+K +    G   
Sbjct  513  RGFSKNMGYFMCFFVSAIFHELVISIPFHSLKLWGFFGIMSQMVLIALTKNLMN--GRNL  570

Query  460  GNIVVWSSLIIGQPLCIMMYYHDYVVTH  487
            GN++ W S+++GQPL +++YY ++V+ +
Sbjct  571  GNVIFWISIVLGQPLVVLLYYRNFVLEN  598



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584775.1 uncharacterized protein LOC107262760 isoform X1
[Cephus cinctus]

Length=1159


***** No hits found *****



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584776.1 uncharacterized protein LOC107262760 isoform X1
[Cephus cinctus]

Length=1159


***** No hits found *****



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584777.1 uncharacterized protein LOC107262760 isoform X2
[Cephus cinctus]

Length=937


***** No hits found *****



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584778.1 40S ribosomal protein S11 isoform X1 [Cephus cinctus]

Length=155
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS11_DROME  unnamed protein product                                   250     1e-86
Q20206_CAEEL  unnamed protein product                                 217     1e-73
Q4GYQ5_TRYB2  unnamed protein product                                 178     6e-58


>RS11_DROME unnamed protein product
Length=155

 Score = 250 bits (639),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)

Query  1    MADQNERSFQKQPTIFLNRKKGLGPKRRKPMRYSRNVGLGFKTPREAIEGTYIDKKCPFT  60
            MADQNER+FQKQ  + LNRK   G  ++K +R SR+VGLGFKTPREAI+GTYIDKKCP+T
Sbjct  1    MADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWT  60

Query  61   GNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIRKYNRFEKRHRNMSVHLSPCFRDVEIG  120
            G+V IRGRILTGVV+K KMQRTIVIRRDYLH++RKY+RFEKRHRNMSVH SP FRDVE G
Sbjct  61   GDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHG  120

Query  121  DVVTIGECRPLSKTVRFNVLKVSKGTGSKKSFKKF  155
            D+VTIGECRPLSKTVRFNVLKVSKG G+KKSFKK+
Sbjct  121  DIVTIGECRPLSKTVRFNVLKVSKGQGAKKSFKKY  155


>Q20206_CAEEL unnamed protein product
Length=155

 Score = 217 bits (553),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 0/155 (0%)

Query  1    MADQNERSFQKQPTIFLNRKKGLGPKRRKPMRYSRNVGLGFKTPREAIEGTYIDKKCPFT  60
            M++Q ER+F KQPT+ LN K  +    +K  RY R VGLGFK PR+A+EGTYIDKKCP+ 
Sbjct  1    MSEQTERAFLKQPTVNLNNKARILAGSKKTPRYIREVGLGFKAPRDAVEGTYIDKKCPWA  60

Query  61   GNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIRKYNRFEKRHRNMSVHLSPCFRDVEIG  120
            GNV IRG ILTGVV K KM RTIV+RRDYLHYI+KY R+EKRH+N+  H SP FRD+  G
Sbjct  61   GNVPIRGMILTGVVLKNKMTRTIVVRRDYLHYIKKYRRYEKRHKNVPAHCSPAFRDIHPG  120

Query  121  DVVTIGECRPLSKTVRFNVLKVSKGTGSKKSFKKF  155
            D+VTIGECRPLSKTVRFNVLKV+K   SKK F KF
Sbjct  121  DLVTIGECRPLSKTVRFNVLKVNKSGTSKKGFSKF  155


>Q4GYQ5_TRYB2 unnamed protein product
Length=174

 Score = 178 bits (452),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 116/156 (74%), Gaps = 7/156 (4%)

Query  4    QNERSFQKQPTIFLN----RKKGLGPKRRKPMRYSRNVGLGFKTPREAIEGTYIDKKCPF  59
            Q+E+++Q+Q  +  N     KK +   R   +RYS+ +GLGF TP+ AI G YID+KCPF
Sbjct  19   QHEKAYQRQTAVNENIRTASKKHVN--RSGHIRYSKKIGLGFATPKAAINGKYIDRKCPF  76

Query  60   TGNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIRKYNRFEKRHRNMSVHLSPCFRDVEI  119
            T NVSIRGRIL GVV   KM+R+IVIRR+YLH+IRKY R++KRHRN++VH SPCF D + 
Sbjct  77   TSNVSIRGRILRGVVHSTKMRRSIVIRRNYLHFIRKYQRYQKRHRNITVHCSPCF-DPKP  135

Query  120  GDVVTIGECRPLSKTVRFNVLKVSKGTGSKKSFKKF  155
            GD V +G+CRPLSKT+R+NVL+V   + + K  KKF
Sbjct  136  GDEVVVGQCRPLSKTIRYNVLQVVSKSAADKMGKKF  171



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584779.1 uncharacterized protein LOC107262761 [Cephus cinctus]

Length=967
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HPS5_DROME  unnamed protein product                                   212     3e-57
Q9NHF0_DROME  unnamed protein product                                 35.4    0.30 
Q0KHS0_DROME  unnamed protein product                                 35.0    0.32 


>HPS5_DROME unnamed protein product
Length=826

 Score = 212 bits (540),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 134/385 (35%), Positives = 196/385 (51%), Gaps = 38/385 (10%)

Query  8    LTEHPEINVLLHKPIHSTHRIKYTCFGVSPNYIILGSSSGSLYLFSREECIFQQLIPLSE  67
            LT   + ++ L  P+   +RIKYTCF +S +YII G+SSGSLYLF+R    F  LIP   
Sbjct  7    LTNFIDFSLSLSLPLKHHNRIKYTCFDISDSYIIFGASSGSLYLFNRNG-KFLLLIPNKH  65

Query  68   GLICHVLISPDEKLVALATMGGSVCFVSL---KPVVKQIALSTEHVGKCVTCLCWDDNSS  124
            G I  + IS + K VA AT    +C  ++        Q+  +       VTC+ W  +  
Sbjct  66   GAITSLSISANSKYVAFATQRSLICVYAVNLSAQATPQVIFTHLDQSVQVTCIHWTQDEK  125

Query  125  ALYIGDSTGKISVMVQSIFTVNGI-FQVPASTLMNLDSKIIQMDFNSSLLLISTLTRSYL  183
              Y GDS G++S+++ S F  + + F +    L+ LDS I+Q+D    LLL+S  T+  L
Sbjct  126  QFYYGDSRGQVSLVLLSSFIGHSLLFNMTVHPLLYLDSPIVQIDDFEYLLLVSNCTKCIL  185

Query  184  CDTVQEQYKQIGNKTRIGEFGACFYKIYNEHNADGFVKLQEQKNADPSRHINLKENLYVN  243
            C+T  E YKQIGN+ R G FGACF+             +  Q++  PS            
Sbjct  186  CNTEYEDYKQIGNRPRDGAFGACFF-------------VSPQESLQPS------------  220

Query  244  EANDIRIYCARPGSRLWEVTKSGTVTKTHQFKEALVAPPNTIYKINDSEVMQIGETAEAC  303
                 RIYCARPGSR+WEV   G V +THQFK AL   P  I +   S   ++   AE  
Sbjct  221  -----RIYCARPGSRVWEVDFEGEVIQTHQFKTALATAPARIQRPG-SGTDELDANAELL  274

Query  304  N--PQSVNFTRLLMFGWKYLFSWTSSGIYIIDPNNSSILLWSNELTDIIMADVIKDNIYL  361
            +  PQ++ F ++      +L ++T  G+YI D   S+++LWSN+   I         I++
Sbjct  275  DYQPQNLQFAKVQRLNDDFLLAFTELGLYIFDIRRSAVVLWSNQFERIADCRSSGSEIFV  334

Query  362  MLQSGEFRCLTLTTFDNLILQLYEK  386
              QSG    + L T  +  + L ++
Sbjct  335  FTQSGALYSVQLQTLQSHAVSLIQQ  359


>Q9NHF0_DROME unnamed protein product
Length=823

 Score = 35.4 bits (80),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (7%)

Query  64   PLSEGLICHVLISPDEKLVALATMGGSVCFVSLKPVVKQIALSTEHV-GKCVTCLCWDDN  122
            P    + C V   P E L+A   + G+V    L+   +Q+   T H  G+ + C+ + DN
Sbjct  187  PPVTAITC-VQFHPFEFLLAAGRVDGTVSIYDLE--HQQLVSQTTHFYGQAIRCITFSDN  243

Query  123  SSALYIGDSTGKISVM  138
               L++G S+G ISV+
Sbjct  244  GECLFVGSSSG-ISVI  258


>Q0KHS0_DROME unnamed protein product
Length=819

 Score = 35.0 bits (79),  Expect = 0.32, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 39/76 (51%), Gaps = 5/76 (7%)

Query  64   PLSEGLICHVLISPDEKLVALATMGGSVCFVSLKPVVKQIALSTEHV-GKCVTCLCWDDN  122
            P    + C V   P E L+A   + G+V    L+   +Q+   T H  G+ + C+ + DN
Sbjct  187  PPVTAITC-VQFHPFEFLLAAGRVDGTVSIYDLEH--QQLVSQTTHFYGQAIRCITFSDN  243

Query  123  SSALYIGDSTGKISVM  138
               L++G S+G ISV+
Sbjct  244  GECLFVGSSSG-ISVI  258



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584780.1 phosphate carrier protein, mitochondrial [Cephus
cinctus]

Length=354
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8E8_DROME  unnamed protein product                                 467     8e-166
Q9XZE4_DROME  unnamed protein product                                 466     2e-165
Q38DX9_TRYB2  unnamed protein product                                 289     2e-96 


>Q0E8E8_DROME unnamed protein product
Length=356

 Score = 467 bits (1201),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 249/354 (70%), Positives = 282/354 (80%), Gaps = 4/354 (1%)

Query  1    MWSSMLETAKKNPFGTPFVTAECQQQRDDNQAL-VKNHTIAAASTASG---DSCEFGSNH  56
            M+SS  ETA+ +PF TP   A C       +   V+   IAAA+T      DSCEFGS  
Sbjct  1    MFSSFFETARNSPFRTPMSMARCDAAAPVVEPQPVEGRQIAAAATPVANQQDSCEFGSTK  60

Query  57   YFLLCGFGGILSCGLTHTMVTPLDLVKCRIQVDPAKYKSVFNGFRVTLAEDGSRGLVRGW  116
            YF LCG GGILSCG THT V PLDLVKCR+QVD AKYK++ +GF+VT+AE+G+RGL +GW
Sbjct  61   YFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGW  120

Query  117  APTFFGYSIQGMFKFGLYEVFKVYYSALAGEELSYEYRTTLYLVSSASAEFFADIGLAPL  176
             PT  GYS QG+ KFGLYE+FKV Y+ + GEE +Y YRT+LYL +SASAEFFADI LAP 
Sbjct  121  FPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIALAPF  180

Query  177  EAAKVRIQTMPGYANTLREAFPKMYADEGLGGFYKGLVPLWLRQIPYTMMKFACFERTVE  236
            EAAKV+IQT+PGYAN  REA PKM  +EG+  FYKGLVPLW+RQIPYTMMKFACFERTVE
Sbjct  181  EAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVE  240

Query  237  LLYKYVVPKPRQDCTKGEQLIVTFAAGYIAGVFCAVVSHPADSVVSKLNQEKGATAGDVL  296
            LLYKYVVPKPR DCTKGEQLIVTFAAGYIAGVFCAVVSHPAD VVSKLNQ KGA+A  V 
Sbjct  241  LLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVA  300

Query  297  RKLGFAGVWKGLAPRIVMIGTLTAAQWFIYDAVKVWLRMPRPPPPEMPESLKKK  350
            + LGF+G+W GL PRI+MIGTLTA QWFIYD VKV L +PRPPPPEMP SLK K
Sbjct  301  KSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGIPRPPPPEMPASLKAK  354


>Q9XZE4_DROME unnamed protein product
Length=356

 Score = 466 bits (1198),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/354 (70%), Positives = 282/354 (80%), Gaps = 4/354 (1%)

Query  1    MWSSMLETAKKNPFGTPFVTAECQQQRDDNQAL-VKNHTIAAASTASG---DSCEFGSNH  56
            M+SS  ETA+ +PF TP   A C       +   V+   IAAA+T      DSCEFGS  
Sbjct  1    MFSSFFETARNSPFRTPMSMARCDAAAPVVEPQPVEGRQIAAAATPVANQQDSCEFGSTK  60

Query  57   YFLLCGFGGILSCGLTHTMVTPLDLVKCRIQVDPAKYKSVFNGFRVTLAEDGSRGLVRGW  116
            YF LCG GGILSCG THT V PLDLVKCR+QVD AKYK++ +GF+VT+AE+G+RGL +GW
Sbjct  61   YFALCGIGGILSCGTTHTFVVPLDLVKCRLQVDQAKYKNLVHGFKVTVAEEGARGLAKGW  120

Query  117  APTFFGYSIQGMFKFGLYEVFKVYYSALAGEELSYEYRTTLYLVSSASAEFFADIGLAPL  176
             PT  GYS QG+ KFGLYE+FKV Y+ + GEE +Y YRT+LYL +SASAEFFADI LAP 
Sbjct  121  FPTLLGYSAQGLCKFGLYELFKVKYAEIIGEENAYLYRTSLYLAASASAEFFADIVLAPF  180

Query  177  EAAKVRIQTMPGYANTLREAFPKMYADEGLGGFYKGLVPLWLRQIPYTMMKFACFERTVE  236
            EAAKV+IQT+PGYAN  REA PKM  +EG+  FYKGLVPLW+RQIPYTMMKFACFERTVE
Sbjct  181  EAAKVKIQTIPGYANNFREAVPKMLKEEGVNAFYKGLVPLWMRQIPYTMMKFACFERTVE  240

Query  237  LLYKYVVPKPRQDCTKGEQLIVTFAAGYIAGVFCAVVSHPADSVVSKLNQEKGATAGDVL  296
            LLYKYVVPKPR DCTKGEQLIVTFAAGYIAGVFCAVVSHPAD VVSKLNQ KGA+A  V 
Sbjct  241  LLYKYVVPKPRADCTKGEQLIVTFAAGYIAGVFCAVVSHPADVVVSKLNQAKGASAISVA  300

Query  297  RKLGFAGVWKGLAPRIVMIGTLTAAQWFIYDAVKVWLRMPRPPPPEMPESLKKK  350
            + LGF+G+W GL PRI+MIGTLTA QWFIYD VKV L +PRPPPPEMP SLK K
Sbjct  301  KSLGFSGMWNGLTPRIIMIGTLTALQWFIYDGVKVALGIPRPPPPEMPASLKAK  354


>Q38DX9_TRYB2 unnamed protein product
Length=317

 Score = 289 bits (739),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/284 (51%), Positives = 194/284 (68%), Gaps = 7/284 (2%)

Query  54   SNHYFLLCGFGGILSCGLTHTMVTPLDLVKCRIQVDPAKYKSVFNGFRVTLAEDG--SRG  111
            +N Y+L C  GG+LSCGLTHT V PLD+VKC +QV+P K++ + +GF+V  AEDG  ++G
Sbjct  20   NNSYYLKCIGGGVLSCGLTHTAVCPLDVVKCNMQVNPEKFRGIGSGFKVLAAEDGFGAKG  79

Query  112  LVRGWAPTFFGYSIQGMFKFGLYEVFKVYYSALAGEELSYEYRTTLYLVSSASAEFFADI  171
            + +GW PT  GYS+QG  KFGLYEVFK +Y+ LAG++ + EY   ++L  SASAEFFAD+
Sbjct  80   IWKGWLPTLIGYSMQGACKFGLYEVFKDFYANLAGQKAAKEYEGLIWLAGSASAEFFADV  139

Query  172  GLAPLEAAKVRIQTMPG--YANTLREAFPKMYADEGLGGFYKGLVPLWLRQIPYTMMKFA  229
             L P+E  KV++QT P   +  +L  A   M AD   G  +K LVPLW RQIPYTM KF 
Sbjct  140  ALCPMEMVKVKVQTSPSGTFPTSLGAAVATMRADPAAGFPFKSLVPLWSRQIPYTMAKFF  199

Query  230  CFERTVELLYKYVVPKPRQDCTKGEQLIVTFAAGYIAGVFCAVVSHPADSVVSKLNQEK-  288
             FE+ V   Y  V  KP+++ +KG QL +TFA+GYIAG+ CA+VSHPAD +VS   +   
Sbjct  200  FFEKVVRFFYSNVFTKPKEEYSKGTQLSITFASGYIAGIVCAIVSHPADMLVSARGKASN  259

Query  289  -GATAGDVLRKLGFAGVW-KGLAPRIVMIGTLTAAQWFIYDAVK  330
             G + G +  ++G+  +  KGL  RI+MIGTLT  QW+IYD  K
Sbjct  260  VGKSYGQIANEIGYGNLCTKGLMARIIMIGTLTGLQWWIYDTYK  303



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584783.1 F-box only protein 28 [Cephus cinctus]

Length=366
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VT01_DROME  unnamed protein product                                 189     2e-57
Q95RF4_DROME  unnamed protein product                                 151     3e-43
Q7K2J4_DROME  unnamed protein product                                 134     1e-34


>Q9VT01_DROME unnamed protein product
Length=314

 Score = 189 bits (480),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 120/159 (75%), Gaps = 0/159 (0%)

Query  2    LQLINLPDVVLETILSNLTYDEIARNRIVCKQFDRTCKMLLNRGFNLMEKYHGQCLRAVK  61
            + L++LP  +++ IL  L YDE+A+ R VC  F+   + +LN+GFN +   H +  + +K
Sbjct  1    MNLLDLPQTLIQDILELLPYDEVAKKREVCTLFNYLGQQILNKGFNKIIMAHAKNFKRIK  60

Query  62   SQLPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGKVIDEIFRVL  121
            S LPRRESERR+H L+RH DILT+IETRISML+MT+ K++DLN+CCFIPG+V+DEI  +L
Sbjct  61   SMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGRVLDEINSIL  120

Query  122  RLIRDSKTPPRAHEILQELRDISSMAMEHFDEKILPDLK  160
            R++  S    R HE+LQELRDISSMA+EHFDEKI  + K
Sbjct  121  RILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFK  159


>Q95RF4_DROME unnamed protein product
Length=265

 Score = 151 bits (381),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 88/108 (81%), Gaps = 0/108 (0%)

Query  53   HGQCLRAVKSQLPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGK  112
            H +  + +KS LPRRESERR+H L+RH DILT+IETRISML+MT+ K++DLN+CCFIPG+
Sbjct  3    HAKNFKRIKSMLPRRESERRNHILSRHSDILTSIETRISMLTMTYSKFIDLNICCFIPGR  62

Query  113  VIDEIFRVLRLIRDSKTPPRAHEILQELRDISSMAMEHFDEKILPDLK  160
            V+DEI  +LR++  S    R HE+LQELRDISSMA+EHFDEKI  + K
Sbjct  63   VLDEINSILRILSTSTKQLRPHEVLQELRDISSMAIEHFDEKIAVNFK  110


>Q7K2J4_DROME unnamed protein product
Length=603

 Score = 134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 156/299 (52%), Gaps = 20/299 (7%)

Query  4    LINLPDVVLETILSNLTYDEIARNRIVCKQFDRTCKMLLNRGFNLMEKYHGQCLRAVKSQ  63
            L +LP+ ++E ILS + Y +++  R+V  + +  C  +LN  F    K      +A+K+ 
Sbjct  122  LYDLPNELIEKILSYVDYKKVSNLRLVSHRMNDICMAMLNTAFTKQIKTTLSRFQAIKAS  181

Query  64   LPRRESERRSHPLARHCDILTAIETRISMLSMTFIKYVDLNLCCFIPGKVIDEIFRVLRL  123
            +PRRES RR+HPLA  CDI+     R+S+L M+  K+++   CCF PG ++DE+  +L  
Sbjct  182  MPRRESHRRNHPLACECDIIETCYMRLSLLQMSMGKHIERGHCCFFPGAILDEVQAILNY  241

Query  124  IRDSKTPPRAHEILQELRDISSMAMEHFDEKI---LPDLKHNICTSVVSNVTSYELPSG-  179
            I  +    R + +  EL D+S+MAME+F ++I   LP L +        N   Y LP+  
Sbjct  242  ISITPRLQRPYRVTDELFDLSTMAMEYFKDRIEATLPGLAY-------FNKDFYTLPTTT  294

Query  180  ---SLMISHHTANANTSSLPHSFSSEKLNQTFKKI--YCKTRKNRLSVLSVKGQISKLKL  234
               +L IS    ++ ++S P +     L +  +KI    K   N+LSVL  + ++   K 
Sbjct  295  KRPTLAISSDLEDSASNSPPQNHMV--LRKGIRKIKQGMKMYNNQLSVL--RTELRTCKR  350

Query  235  RMKRQGFQMRLQSLKLQEQAKKIHDQDTQLAEMRKHLEEWEQKIGDLTAELSRAREETQ  293
            +   Q  Q+  QS  + EQ K+  +   +L E  K  EE  +K   L  EL++ + E Q
Sbjct  351  KAAEQSKQLAEQSNLISEQQKQTLEYANRLDENDKKNEEMSRKFSTLLQELNKCKTELQ  409



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584785.1 40S ribosomal protein S11 isoform X2 [Cephus cinctus]

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS11_DROME  unnamed protein product                                   251     6e-87
Q20206_CAEEL  unnamed protein product                                 219     1e-74
Q4GYQ5_TRYB2  unnamed protein product                                 180     1e-58


>RS11_DROME unnamed protein product
Length=155

 Score = 251 bits (640),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 138/155 (89%), Gaps = 3/155 (2%)

Query  1    MADQTERAFQKQPTVFLNRKLN---QKKKPLRHSRNVGLGFKTPREAIEGTYIDKKCPFT  57
            MADQ ERAFQKQ  V LNRK+     KKK LR SR+VGLGFKTPREAI+GTYIDKKCP+T
Sbjct  1    MADQNERAFQKQFGVNLNRKVKPGITKKKLLRRSRDVGLGFKTPREAIDGTYIDKKCPWT  60

Query  58   GNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIRKYNRFEKRHRNMSVHLSPCFRDVEIG  117
            G+V IRGRILTGVV+K KMQRTIVIRRDYLH++RKY+RFEKRHRNMSVH SP FRDVE G
Sbjct  61   GDVRIRGRILTGVVRKAKMQRTIVIRRDYLHFVRKYSRFEKRHRNMSVHCSPVFRDVEHG  120

Query  118  DVVTIGECRPLSKTVRFNVLKVSKGTGSKKSFKKF  152
            D+VTIGECRPLSKTVRFNVLKVSKG G+KKSFKK+
Sbjct  121  DIVTIGECRPLSKTVRFNVLKVSKGQGAKKSFKKY  155


>Q20206_CAEEL unnamed protein product
Length=155

 Score = 219 bits (559),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 123/155 (79%), Gaps = 3/155 (2%)

Query  1    MADQTERAFQKQPTVFLNRK---LNQKKKPLRHSRNVGLGFKTPREAIEGTYIDKKCPFT  57
            M++QTERAF KQPTV LN K   L   KK  R+ R VGLGFK PR+A+EGTYIDKKCP+ 
Sbjct  1    MSEQTERAFLKQPTVNLNNKARILAGSKKTPRYIREVGLGFKAPRDAVEGTYIDKKCPWA  60

Query  58   GNVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIRKYNRFEKRHRNMSVHLSPCFRDVEIG  117
            GNV IRG ILTGVV K KM RTIV+RRDYLHYI+KY R+EKRH+N+  H SP FRD+  G
Sbjct  61   GNVPIRGMILTGVVLKNKMTRTIVVRRDYLHYIKKYRRYEKRHKNVPAHCSPAFRDIHPG  120

Query  118  DVVTIGECRPLSKTVRFNVLKVSKGTGSKKSFKKF  152
            D+VTIGECRPLSKTVRFNVLKV+K   SKK F KF
Sbjct  121  DLVTIGECRPLSKTVRFNVLKVNKSGTSKKGFSKF  155


>Q4GYQ5_TRYB2 unnamed protein product
Length=174

 Score = 180 bits (456),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 114/154 (74%), Gaps = 6/154 (4%)

Query  4    QTERAFQKQPTVFLNRKLNQKKK-----PLRHSRNVGLGFKTPREAIEGTYIDKKCPFTG  58
            Q E+A+Q+Q  V  N +   KK       +R+S+ +GLGF TP+ AI G YID+KCPFT 
Sbjct  19   QHEKAYQRQTAVNENIRTASKKHVNRSGHIRYSKKIGLGFATPKAAINGKYIDRKCPFTS  78

Query  59   NVSIRGRILTGVVQKMKMQRTIVIRRDYLHYIRKYNRFEKRHRNMSVHLSPCFRDVEIGD  118
            NVSIRGRIL GVV   KM+R+IVIRR+YLH+IRKY R++KRHRN++VH SPCF D + GD
Sbjct  79   NVSIRGRILRGVVHSTKMRRSIVIRRNYLHFIRKYQRYQKRHRNITVHCSPCF-DPKPGD  137

Query  119  VVTIGECRPLSKTVRFNVLKVSKGTGSKKSFKKF  152
             V +G+CRPLSKT+R+NVL+V   + + K  KKF
Sbjct  138  EVVVGQCRPLSKTIRYNVLQVVSKSAADKMGKKF  171



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584787.1 mitochondrial tRNA-specific 2-thiouridylase 1 isoform
X1 [Cephus cinctus]

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DLPC_DICDI  unnamed protein product                                   34.3    0.20 
Q9U3W7_DROME  unnamed protein product                                 31.6    1.3  
Q384C0_TRYB2  unnamed protein product                                 31.6    1.6  


>DLPC_DICDI unnamed protein product
Length=904

 Score = 34.3 bits (77),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 81/183 (44%), Gaps = 28/183 (15%)

Query  165  QKALCYSMFPIGSCLKK---DVKKIAQEAGLNLIVQKKESMGICFIGSRRFKDFITEYVQ  221
            Q+ L  SM  + S  KK   D+ ++ +E   N IV  KE               +  +V 
Sbjct  436  QQNLLPSMLQLESICKKTEADIVRVKKELSDNNIVTLKEK--------------VMRFVS  481

Query  222  NKSGNFVDIDTGVIVGTHEGIHQWTLGQRCKIGGKPQPYFVYKKDLKSNDIFVVAGTNHP  281
            N +G    +  G +VG  +   Q  L ++     +P P + +  D+++++  +  G  + 
Sbjct  482  NFNGQIERLLEGSVVGDPDEFGQTLLQEKENCSVQPWPGYNFDFDIQNSNYSLYGGAQYE  541

Query  282  ALFA--EFIIASEIYWIDKEPVELQNSHGILRCYFRFQHLKP---LVPCNIYKTQNNQLL  336
             L    EF+I S+  + +    E+ ++ G+ +      H  P   L   NI++T++ ++L
Sbjct  542  RLLNEFEFVIHSK-EFPETSINEVASAIGVSKS-----HNSPIYELAATNIFQTKSKKVL  595

Query  337  IKL  339
            + L
Sbjct  596  LPL  598


>Q9U3W7_DROME unnamed protein product
Length=809

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 55/142 (39%), Gaps = 19/142 (13%)

Query  66   LLNVNFVKEYWNTVFSELVKEYESGYTPNPDIQCNKCIKFDMFYNFARNELKADAIATGH  125
            L  V  V  + N V      +  +GYT NPD+ CN     +   +F R ++    +A G 
Sbjct  385  LTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCN---HTNFRTDFPRPDMVVSCLADGV  441

Query  126  YVRTNFGPYLENFQPNINVKLL-----KASDSRKDQTFFLSQVPQKALCYSMFPIGSCLK  180
             V  +        +P  N  L      K  + R+        VP+  +    F  GSC  
Sbjct  442  QVEIHI------TEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHF--GSCGM  493

Query  181  KDVKKIAQEAGLNLIVQKKESM  202
            + VK +A      L++QK   +
Sbjct  494  QAVKDVAS---FVLVIQKHPKL  512


>Q384C0_TRYB2 unnamed protein product
Length=1216

 Score = 31.6 bits (70),  Expect = 1.6, Method: Composition-based stats.
 Identities = 16/58 (28%), Positives = 26/58 (45%), Gaps = 10/58 (17%)

Query  11    GGVDSAVSTLLLTKKG----------FNVTAVFMKNWDITDETGYCTAEKDYEDAKWV  58
              G+   V T+L  K G          F    VF + W + +   YC+ +++  DA+WV
Sbjct  1001  AGIRGIVKTVLKGKNGLIRATFEDKIFPSDIVFCRAWKMVEPPKYCSIQRNLVDAEWV  1058



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584788.1 mitochondrial tRNA-specific 2-thiouridylase 1 isoform
X2 [Cephus cinctus]

Length=382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DLPC_DICDI  unnamed protein product                                   34.7    0.14 
Q9U3W7_DROME  unnamed protein product                                 32.3    0.85 
I2HAA7_CAEEL  unnamed protein product                                 30.8    2.4  


>DLPC_DICDI unnamed protein product
Length=904

 Score = 34.7 bits (78),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 41/183 (22%), Positives = 81/183 (44%), Gaps = 28/183 (15%)

Query  149  QKALCYSMFPIGSCLKK---DVKKIAQEAGLNLIVQKKESMGICFIGSRRFKDFITEYVQ  205
            Q+ L  SM  + S  KK   D+ ++ +E   N IV  KE               +  +V 
Sbjct  436  QQNLLPSMLQLESICKKTEADIVRVKKELSDNNIVTLKEK--------------VMRFVS  481

Query  206  NKSGNFVDIDTGVIVGTHEGIHQWTLGQRCKIGGKPQPYFVYKKDLKSNDIFVVAGTNHP  265
            N +G    +  G +VG  +   Q  L ++     +P P + +  D+++++  +  G  + 
Sbjct  482  NFNGQIERLLEGSVVGDPDEFGQTLLQEKENCSVQPWPGYNFDFDIQNSNYSLYGGAQYE  541

Query  266  ALFA--EFIIASEIYWIDKEPVELQNSHGILRCYFRFQHLKP---LVPCNIYKTQNNQLL  320
             L    EF+I S+  + +    E+ ++ G+ +      H  P   L   NI++T++ ++L
Sbjct  542  RLLNEFEFVIHSK-EFPETSINEVASAIGVSKS-----HNSPIYELAATNIFQTKSKKVL  595

Query  321  IKL  323
            + L
Sbjct  596  LPL  598


>Q9U3W7_DROME unnamed protein product
Length=809

 Score = 32.3 bits (72),  Expect = 0.85, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 55/142 (39%), Gaps = 19/142 (13%)

Query  50   LLNVNFVKEYWNTVFSELVKEYESGYTPNPDIQCNKCIKFDMFYNFARNELKADAIATGH  109
            L  V  V  + N V      +  +GYT NPD+ CN     +   +F R ++    +A G 
Sbjct  385  LTKVCGVNAFCNAVNHRAQCQCITGYTGNPDLHCN---HTNFRTDFPRPDMVVSCLADGV  441

Query  110  YVRTNFGPYLENFQPNINVKLL-----KASDSRKDQTFFLSQVPQKALCYSMFPIGSCLK  164
             V  +        +P  N  L      K  + R+        VP+  +    F  GSC  
Sbjct  442  QVEIHI------TEPGFNGVLYVKGHSKDEECRRVVNLAGETVPRTEIFRVHF--GSCGM  493

Query  165  KDVKKIAQEAGLNLIVQKKESM  186
            + VK +A      L++QK   +
Sbjct  494  QAVKDVAS---FVLVIQKHPKL  512


>I2HAA7_CAEEL unnamed protein product
Length=5071

 Score = 30.8 bits (68),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query  67    LVKEYESGYTPNPDIQCNKCIKFDMFYNFARNELKADAIATGHYVRTNFGPYLENFQP  124
             L+K++E  +      +C++C+K  M +N++   +  DA       RT  G  + NF P
Sbjct  2898  LLKDFEKSFYKE---RCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISNFAP  2952



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584790.1 uncharacterized protein C14orf119 homolog [Cephus
cinctus]

Length=117
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBCD6_DROME  unnamed protein product                                  28.1    1.3  
Q7K6U7_DROME  unnamed protein product                                 28.1    2.0  
E1JJB8_DROME  unnamed protein product                                 26.9    4.7  


>UBCD6_DROME unnamed protein product
Length=151

 Score = 28.1 bits (61),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 15/52 (29%), Positives = 26/52 (50%), Gaps = 0/52 (0%)

Query  11   IRYVVQWFQEWSEMQRGDFLSVLLERCSPTGLVNGLVSGMESLGCKEDSNRP  62
            +R+V + F        G  L +L  R SPT  V+ +++ ++SL    + N P
Sbjct  70   VRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSP  121


>Q7K6U7_DROME unnamed protein product
Length=632

 Score = 28.1 bits (61),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query  73   FQEWSQNWSQQEKDALLSSIKNMDPKFGEKYEQRLTVGSEEERE  116
              E+  +W   E D  L  + N+DP +    E+ + +G EE+RE
Sbjct  552  LAEFGGSWDLLELDLQLHEV-NLDPSYDTDVEECIFLGDEEDRE  594


>E1JJB8_DROME unnamed protein product
Length=1493

 Score = 26.9 bits (58),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query  73    FQEWSQNWSQQEKDALLSSIKNMDPKFGEKYEQRLTVGSEEERE  116
               E+  +W   E D  L  + N+DP +    E+ + +G EE+RE
Sbjct  1413  LAEFGGSWDLLELDLQLHEV-NLDPSYDTDVEECIFLGDEEDRE  1455



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584791.1 uncharacterized protein LOC107262770 [Cephus cinctus]

Length=213
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MIC13_DROME  unnamed protein product                                  43.9    9e-06
Q381K0_TRYB2  unnamed protein product                                 32.7    0.20 
Q86NY1_DROME  unnamed protein product                                 31.6    0.51 


>MIC13_DROME unnamed protein product
Length=122

 Score = 43.9 bits (102),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 37/73 (51%), Gaps = 3/73 (4%)

Query  95   LLKSAVAAGLVYWTSAEGVWGDSKDTENLYYRMMATVAPAISDMPD---VDNIKLPQVGN  151
            L++  + A  VY+T   G+WGDS  T+ LY  + + + P +  +      +  +LP+ G 
Sbjct  6    LVRGGLVAATVYYTQKVGIWGDSDQTDKLYNDIKSELRPHVQKLEKQLPFEVPQLPKTGE  65

Query  152  FKYCIYNAYNRAV  164
             ++   + YN  V
Sbjct  66   MRFLAKHYYNEGV  78


>Q381K0_TRYB2 unnamed protein product
Length=462

 Score = 32.7 bits (73),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 29/56 (52%), Gaps = 3/56 (5%)

Query  127  MMATVAPAISDMPDVDNIKLPQVGNFKYCIYNAYNRAVLGLMGILVGVPMTIQDKV  182
             +A + PA+  M    N  L +VG F Y +   Y   ++G+  ++ G  +TI D+V
Sbjct  408  FLAFILPALYYMY-AGNFSLKEVGWFNYAV--TYQLLIVGVFAVVFGTALTIYDEV  460


>Q86NY1_DROME unnamed protein product
Length=946

 Score = 31.6 bits (70),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 21/29 (72%), Gaps = 0/29 (0%)

Query  81   PETRLQKFGKLVQTLLKSAVAAGLVYWTS  109
            PET+ Q  G+LVQTL +SA++  +V  TS
Sbjct  340  PETQPQDLGELVQTLSRSAISPIVVINTS  368



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584795.1 uncharacterized protein LOC107262775 [Cephus cinctus]

Length=71
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMS1_DROME  unnamed protein product                                 38.5    2e-05
FEN1_TRYB2  unnamed protein product                                   26.2    2.3  
PKRA_DROME  unnamed protein product                                   26.2    2.7  


>Q9VMS1_DROME unnamed protein product
Length=77

 Score = 38.5 bits (88),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 0/60 (0%)

Query  4   AAPRLRGLLVAQTRRNIIAASVCSVAAALAFHLFYVRPKHKRIRDYYLDFDAEASLESMK  63
           A P LRGL  A  +RN+  +   +    +A+ +    PK     D+Y  +DA  S E MK
Sbjct  10  AGPVLRGLHNATIKRNLAVSLGLTAVVTIAYKILVNDPKKAAYADFYSKYDANKSFERMK  69


>FEN1_TRYB2 unnamed protein product
Length=393

 Score = 26.2 bits (56),  Expect = 2.3, Method: Composition-based stats.
 Identities = 17/43 (40%), Positives = 24/43 (56%), Gaps = 7/43 (16%)

Query  31   ALAF-------HLFYVRPKHKRIRDYYLDFDAEASLESMKEYM  66
            ALAF       HL Y   K + I +Y+LD   EAS  SM++++
Sbjct  186  ALAFGSRVMLRHLTYGEAKKRPIAEYHLDEILEASGFSMQQFI  228


>PKRA_DROME unnamed protein product
Length=422

 Score = 26.2 bits (56),  Expect = 2.7, Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 17/28 (61%), Gaps = 0/28 (0%)

Query  44   KRIRDYYLDFDAEASLESMKEYMQSYTK  71
            ++ R  Y  FDA  S+ESM+ + Q + K
Sbjct  90   EKPRTSYCIFDAPESMESMRNHEQVFVK  117



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584796.1 cytochrome c oxidase assembly factor 5 isoform X1
[Cephus cinctus]

Length=83
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38AH4_TRYB2  unnamed protein product                                 25.8    4.5  
GNBP1_DROME  unnamed protein product                                  25.0    8.0  
Q9VSJ6_DROME  unnamed protein product                                 25.0    8.6  


>Q38AH4_TRYB2 unnamed protein product
Length=385

 Score = 25.8 bits (55),  Expect = 4.5, Method: Composition-based stats.
 Identities = 9/20 (45%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  22   ADLKMCLLKSDCCKVHKRTP  41
            A L++C+L S CC +   TP
Sbjct  326  ASLELCVLSSLCCMIEPLTP  345


>GNBP1_DROME unnamed protein product
Length=494

 Score = 25.0 bits (53),  Expect = 8.0, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  8    NERLKDTSRCAGVRADLKMCLLKS  31
            N RL  + RC G    +K C+L S
Sbjct  236  NSRLDLSERCTGTHNRIKECILHS  259


>Q9VSJ6_DROME unnamed protein product
Length=1169

 Score = 25.0 bits (53),  Expect = 8.6, Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 0/38 (0%)

Query  8     NERLKDTSRCAGVRADLKMCLLKSDCCKVHKRTPRECL  45
             N+RL+     AGV+  + +  L S  CK     P E L
Sbjct  976   NKRLQSLKPPAGVQEQIDLNFLNSKACKSGFNDPEELL  1013



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584800.1 chitotriosidase-1 [Cephus cinctus]

Length=458
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W2M7_DROME  unnamed protein product                                 355     2e-118
Q7YXW0_DROME  unnamed protein product                                 309     3e-102
Q9W2M5_DROME  unnamed protein product                                 309     4e-102


>Q9W2M7_DROME unnamed protein product
Length=476

 Score = 355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/398 (45%), Positives = 240/398 (60%), Gaps = 4/398 (1%)

Query  3    LSVIICIMTTLLGPALGKVMMCYFGSWATNRPGKGNFQVSDIEPNLCTHYIYAFVGLTAN  62
            L VI+   ++       K ++CY G+W+  RPG G F + DI+P LCTH IYAF+G+   
Sbjct  12   LGVILMAASSSAQGNSSKNVVCYQGTWSVYRPGLGKFGMEDIDPFLCTHLIYAFLGIEET  71

Query  63   GDIRVLDERNDLPTRGGKNNIGKFVALKKTKTAPKILVSMGGWNAASTNFTRVVNHANLR  122
            G +RV+D   DL    G+ NI  F ALK      K LV++GGWN  S  F+ V    + R
Sbjct  72   GQLRVIDAYLDLEENSGRGNIKSFNALKLKNPVLKTLVAVGGWNEGSKRFSLVARDPSKR  131

Query  123  TAFAKNAVAFLKKHHFDGLEMDWEYPCQRGGV-KADKKGFIALLKELKAAFVKEGLLLTA  181
              F  + V FL++H FDGL++DWEYP QR  +   D+  +I  LKELK      G +L+A
Sbjct  132  EKFVDDVVRFLQRHGFDGLDLDWEYPGQRHSLDNEDRSNYITFLKELKEGLEPFGFILSA  191

Query  182  AVGATKHLATPSYNIPELANIVDYINVMTYDLTTASSSKVVGHHAPMVAASYQEHNATLL  241
            AVG+ +  A  SY+IP +   +D INVM YDL      +VVG +AP+ AA     +++  
Sbjct  192  AVGSAQFSAEISYDIPAMVPYLDLINVMAYDLH-GPWDQVVGINAPLYAAEKDASDSSGR  250

Query  242  QN--NIEASIKFWLKSGAPASKLVLGLPLYGRTFTLAHVTLTKPGSPSAGPGHAGRYTRE  299
            Q   N++A +K+WLK+GAPA KL+LG+P YGR+FTLA     +PG+P  G G AG Y+RE
Sbjct  251  QQQLNVDAVVKYWLKAGAPAEKLILGVPFYGRSFTLATAEGNQPGAPHIGKGIAGNYSRE  310

Query  300  AGYIGYNEFCEKQFDANWTRVWDKKQKVPYAYKGNQWIGYDNERSLAVKIHYAKKLGLAG  359
             G +GYNE CE      WT+ W+  Q+VPYAY+  QW+GY++ RSLA+K  Y     L G
Sbjct  311  PGVLGYNELCEMMEREEWTQKWEATQQVPYAYRQRQWVGYEDPRSLALKAQYVMDNHLGG  370

Query  360  IMFWSIETDDFRGNCGCGPYPLLKASRTALHSKKTLRG  397
            IM WS+E+DDFRG CG  PYPLL      L    T  G
Sbjct  371  IMIWSLESDDFRGTCGQQPYPLLHEINRVLFGGNTPSG  408


>Q7YXW0_DROME unnamed protein product
Length=366

 Score = 309 bits (792),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 214/364 (59%), Gaps = 24/364 (7%)

Query  20   KVMMCYFGSWATNRPGKGNFQVSDIEPNLCTHYIYAFVGLTANGDIRVLDERNDLPTRGG  79
            +++ CY+G+WA  R G G F VS+I+  LCTH  Y+F G+  NG+I+ LD   D      
Sbjct  19   RIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDYDL---  75

Query  80   KNNIGKFVALKKTKTAPKILVSMGGWNAASTNFTRVVNHANLRTAFAKNAVAFLKKHHFD  139
               I + ++LK   +  K+L  +GGWN  ST ++ +      R  F  +A+  L+ H FD
Sbjct  76   -GFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFD  134

Query  140  GLEMDWEYPCQRGGVKADKKGFIALLKELKAAFVKEGLLLTAAVGATKHLATPSYNIPEL  199
            GL++DWEYP QRGG   D+  F+ LL+E+K AF   G  L  AVGA + LA+ SY I  +
Sbjct  135  GLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYELGIAVGAGESLASASYEIANI  194

Query  200  ANIVDYINVMTYDLTTASSSKVVGHHAPMVAASYQEHNATLLQNNIEASIKFWLKSGAPA  259
            A  VD+INVMTYD   AS  +  G +AP  A              +E +I FWL  GAPA
Sbjct  195  AQQVDFINVMTYDFAMASDGQ-TGFNAPQWA--------------VENAINFWLSQGAPA  239

Query  260  SKLVLGLPLYGRTFTLAHVTLTKPGSPSAGPGHAGRYTREAGYIGYNEFCEKQFDANWTR  319
            +KLVLG+  YGR+F L+  +   PG+P  G G AG YT   GY+GYNE C+     NW  
Sbjct  240  NKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQN----NWHT  295

Query  320  VWDKKQKVPYAYKGNQWIGYDNERSLAVKIHYAKKLGLAGIMFWSIETDDFRGNCGCGPY  379
            V+D     PYAY G+QW+ +DN  S+  K+ +A   GLAG M WS+ETDD+RG CG   Y
Sbjct  296  VFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQCG-ETY  354

Query  380  PLLK  383
            PLLK
Sbjct  355  PLLK  358


>Q9W2M5_DROME unnamed protein product
Length=368

 Score = 309 bits (792),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 160/364 (44%), Positives = 214/364 (59%), Gaps = 24/364 (7%)

Query  20   KVMMCYFGSWATNRPGKGNFQVSDIEPNLCTHYIYAFVGLTANGDIRVLDERNDLPTRGG  79
            +++ CY+G+WA  R G G F VS+I+  LCTH  Y+F G+  NG+I+ LD   D      
Sbjct  21   RIVNCYWGTWANYRSGNGKFDVSNIDAGLCTHLSYSFFGINDNGEIQSLDTWLDYDL---  77

Query  80   KNNIGKFVALKKTKTAPKILVSMGGWNAASTNFTRVVNHANLRTAFAKNAVAFLKKHHFD  139
               I + ++LK   +  K+L  +GGWN  ST ++ +      R  F  +A+  L+ H FD
Sbjct  78   -GFINQAISLKNQNSNLKVLAVVGGWNEGSTKYSSMSGDWYKRQNFINSALNLLRNHGFD  136

Query  140  GLEMDWEYPCQRGGVKADKKGFIALLKELKAAFVKEGLLLTAAVGATKHLATPSYNIPEL  199
            GL++DWEYP QRGG   D+  F+ LL+E+K AF   G  L  AVGA + LA+ SY I  +
Sbjct  137  GLDLDWEYPNQRGGNWNDRANFVTLLREIKEAFAPYGYELGIAVGAGESLASASYEIANI  196

Query  200  ANIVDYINVMTYDLTTASSSKVVGHHAPMVAASYQEHNATLLQNNIEASIKFWLKSGAPA  259
            A  VD+INVMTYD   AS  +  G +AP  A              +E +I FWL  GAPA
Sbjct  197  AQQVDFINVMTYDFAMASDGQ-TGFNAPQWA--------------VENAINFWLSQGAPA  241

Query  260  SKLVLGLPLYGRTFTLAHVTLTKPGSPSAGPGHAGRYTREAGYIGYNEFCEKQFDANWTR  319
            +KLVLG+  YGR+F L+  +   PG+P  G G AG YT   GY+GYNE C+     NW  
Sbjct  242  NKLVLGVGTYGRSFQLSDSSQNWPGAPCRGEGSAGSYTGSTGYLGYNEICQN----NWHT  297

Query  320  VWDKKQKVPYAYKGNQWIGYDNERSLAVKIHYAKKLGLAGIMFWSIETDDFRGNCGCGPY  379
            V+D     PYAY G+QW+ +DN  S+  K+ +A   GLAG M WS+ETDD+RG CG   Y
Sbjct  298  VFDYDNAAPYAYSGDQWVSFDNVLSVQYKMDFALSKGLAGAMIWSLETDDYRGQCG-ETY  356

Query  380  PLLK  383
            PLLK
Sbjct  357  PLLK  360



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


Query= XP_015584802.1 zinc finger FYVE domain-containing protein 26 homolog
isoform X1 [Cephus cinctus]

Length=2672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YOTB_CAEEL  unnamed protein product                                   68.2    1e-11
Q8IKN0_PLAF7  unnamed protein product                                 67.0    5e-11
Q960V6_DROME  unnamed protein product                                 65.9    5e-10


>YOTB_CAEEL unnamed protein product
Length=266

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 36/60 (60%), Gaps = 1/60 (2%)

Query  1873  WVPNDKARECSCCQTVIFSMFNRRHHCRRCGRVVCAMCSQQRMRVSGYPNSVLVRVCDDC  1932
             WVP+ +A +C  C    F++  RRHHCR CGRVVC  CS +  R+    +   VRVCD C
Sbjct  149   WVPDGEAVKCMVCGKTQFNLVQRRHHCRNCGRVVCGACSSRTFRIDNV-HKKPVRVCDHC  207


>Q8IKN0_PLAF7 unnamed protein product
Length=325

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 7/79 (9%)

Query  1873  WVPNDKARECSCCQTVIFSMFNRRHHCRRCGRVVCAMCSQQRMRVSGYPNSVLVRVCDDC  1932
             WVP+++   C  C  V+F++  R+HHCR CG V C+ CS  ++++S Y  S  VRVCD C
Sbjct  33    WVPDEEVTNCYSC-NVVFNVRVRKHHCRACGNVFCSNCSDNKIKISEYSYSEKVRVCDRC  91

Query  1933  -----KRQTVLQLQAAQGA  1946
                    QT+L LQ   GA
Sbjct  92    FMERSSPQTLL-LQEDLGA  109


>Q960V6_DROME unnamed protein product
Length=1343

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 10/86 (12%)

Query  1873  WVPNDKARECSCCQTVIFSMFNRRHHCRRCGRVVCAMCSQQRMRVSGYPNSVLVRVCDDC  1932
             WVP++ A +C  CQ   F+M  RRHHCR CG+V+C++C  QR R+  +      RVC  C
Sbjct  528   WVPDNMAGQCMQCQQK-FTMIKRRHHCRACGKVLCSVCCSQRFRLE-FATEPESRVCVQC  585

Query  1933  ------KRQTVLQLQAAQGA--PSTP  1950
                   ++   L  ++A G+  P TP
Sbjct  586   YMILSERQANGLNSESAPGSALPPTP  611



Lambda      K        H
   0.314    0.132    0.387 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13747527766


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584803.1 cytochrome c oxidase assembly factor 5 isoform X2
[Cephus cinctus]

Length=66
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389G9_TRYB2  unnamed protein product                                 25.8    2.8  
GNBP1_DROME  unnamed protein product                                  25.4    3.4  
RIC8_DROME  unnamed protein product                                   24.6    8.0  


>Q389G9_TRYB2 unnamed protein product
Length=780

 Score = 25.8 bits (55),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 24/48 (50%), Gaps = 3/48 (6%)

Query  5    ENENERLKDTSRCAGHK---RTPRECLRITDGSVPEECQALRVSFFEC  49
            +N      + S+ +GHK   RT R C ++ + S  E+ +   V+ + C
Sbjct  674  DNRGAATANRSQASGHKASRRTDRNCSKVEEASTSEDEEGYEVTHWVC  721


>GNBP1_DROME unnamed protein product
Length=494

 Score = 25.4 bits (54),  Expect = 3.4, Method: Composition-based stats.
 Identities = 11/29 (38%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  8    NERLKDTSRCAGHKRTPRECLRITDGSVP  36
            N RL  + RC G     +EC+  + GS P
Sbjct  236  NSRLDLSERCTGTHNRIKECILHSTGSGP  264


>RIC8_DROME unnamed protein product
Length=573

 Score = 24.6 bits (52),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 16/25 (64%), Gaps = 2/25 (8%)

Query  3    EYENENERLKDTSRCAGHKRTPREC  27
            E E +NE+ KDT   AG K  PREC
Sbjct  312  EREQDNEKEKDTEAGAGAK--PREC  334



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584805.1 receptor-interacting serine/threonine-protein kinase
1 [Cephus cinctus]

Length=267
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IMD_DROME  unnamed protein product                                    79.7    2e-17
Q38BJ2_TRYB2  unnamed protein product                                 33.9    0.14 
FADD_DROME  unnamed protein product                                   30.0    1.5  


>IMD_DROME unnamed protein product
Length=273

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 101/222 (45%), Gaps = 33/222 (15%)

Query  71   EPTTSDSEFPKSPKIGHSSTAGFEFRSKSPRGKTKPKYK---------IP------QSAN  115
            EP  ++S     P    + TA  +      R  + P Y          IP      Q+ N
Sbjct  38   EPDNNNSGALALPSTAGTPTASSDLTESVLRELSDPNYNSMDVVHSANIPGTLSNVQTNN  97

Query  116  VVNYNIVNSKGV-TIGSRTSITYNNLNQFNKN---------TTVTPKSSTMKAKTKPMP-  164
             +N +    + V    +  ++ + ++  FN+N         +T T + S      KP   
Sbjct  98   TMNVHSAQQQVVMNFSNANNLHFGSVYNFNQNLSACSSRKGSTSTAEESVASPDGKPRAS  157

Query  165  ---ESVEELSMCKEQINLDDMFL--IKTHIGHGWRDVARRLGYSEGQIDQFEENHMVKG-  218
               ++V  ++M + Q   D   L  + TH+G GW+ V R LG SEGQIDQ   +H + G 
Sbjct  158  ATRKTVSIVAMMQSQEEPDVRLLDVVSTHLGEGWKQVMRDLGMSEGQIDQAIIDHQMHGN  217

Query  219  IDQVIYQVLLDWKQTNTKD-ARLGDLICIIWSCQEYDCVERL  259
            I +VIYQ+LL W +++    A +G L  ++W  Q  DCV+R+
Sbjct  218  IREVIYQLLLQWIRSSADGVATVGRLTTLLWESQHRDCVQRM  259


>Q38BJ2_TRYB2 unnamed protein product
Length=1183

 Score = 33.9 bits (76),  Expect = 0.14, Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 8/91 (9%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  88   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  143

Query  93   FEFRSKSPRG----KTKPKYKIPQSANVVNY  119
             E +  +P      K  P     Q A  VN+
Sbjct  144  PELQKAAPAAPELQKAAPAAPELQKAAPVNF  174


 Score = 33.1 bits (74),  Expect = 0.25, Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++   
Sbjct  118  KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPVN  173

Query  93   FEFRSKSPRGK  103
            F   ++  RG+
Sbjct  174  FMTSTRRSRGR  184


 Score = 32.7 bits (73),  Expect = 0.37, Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  58   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  113

Query  93   FEFRSKSP  100
             E +  +P
Sbjct  114  PELQKAAP  121


 Score = 31.2 bits (69),  Expect = 0.93, Method: Composition-based stats.
 Identities = 15/56 (27%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  45  SAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAGFEFRSKSP  100
           +AP  P+++  A   PE+   QK+AP         P +P++  ++ A  E +  +P
Sbjct  39  AAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAP  91


>FADD_DROME unnamed protein product
Length=239

 Score = 30.0 bits (66),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  185  IKTHIGHGWRDVARRLGYSEGQIDQFEENH  214
            I   +G  WR + R  G  EGQ+D  EE +
Sbjct  158  ISEELGRYWRRLGRSAGIGEGQMDTIEERY  187



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584806.1 receptor-interacting serine/threonine-protein kinase
1 [Cephus cinctus]

Length=267
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IMD_DROME  unnamed protein product                                    79.7    2e-17
Q38BJ2_TRYB2  unnamed protein product                                 33.9    0.14 
FADD_DROME  unnamed protein product                                   30.0    1.5  


>IMD_DROME unnamed protein product
Length=273

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 101/222 (45%), Gaps = 33/222 (15%)

Query  71   EPTTSDSEFPKSPKIGHSSTAGFEFRSKSPRGKTKPKYK---------IP------QSAN  115
            EP  ++S     P    + TA  +      R  + P Y          IP      Q+ N
Sbjct  38   EPDNNNSGALALPSTAGTPTASSDLTESVLRELSDPNYNSMDVVHSANIPGTLSNVQTNN  97

Query  116  VVNYNIVNSKGV-TIGSRTSITYNNLNQFNKN---------TTVTPKSSTMKAKTKPMP-  164
             +N +    + V    +  ++ + ++  FN+N         +T T + S      KP   
Sbjct  98   TMNVHSAQQQVVMNFSNANNLHFGSVYNFNQNLSACSSRKGSTSTAEESVASPDGKPRAS  157

Query  165  ---ESVEELSMCKEQINLDDMFL--IKTHIGHGWRDVARRLGYSEGQIDQFEENHMVKG-  218
               ++V  ++M + Q   D   L  + TH+G GW+ V R LG SEGQIDQ   +H + G 
Sbjct  158  ATRKTVSIVAMMQSQEEPDVRLLDVVSTHLGEGWKQVMRDLGMSEGQIDQAIIDHQMHGN  217

Query  219  IDQVIYQVLLDWKQTNTKD-ARLGDLICIIWSCQEYDCVERL  259
            I +VIYQ+LL W +++    A +G L  ++W  Q  DCV+R+
Sbjct  218  IREVIYQLLLQWIRSSADGVATVGRLTTLLWESQHRDCVQRM  259


>Q38BJ2_TRYB2 unnamed protein product
Length=1183

 Score = 33.9 bits (76),  Expect = 0.14, Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 8/91 (9%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  88   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  143

Query  93   FEFRSKSPRG----KTKPKYKIPQSANVVNY  119
             E +  +P      K  P     Q A  VN+
Sbjct  144  PELQKAAPAAPELQKAAPAAPELQKAAPVNF  174


 Score = 33.1 bits (74),  Expect = 0.25, Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++   
Sbjct  118  KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPVN  173

Query  93   FEFRSKSPRGK  103
            F   ++  RG+
Sbjct  174  FMTSTRRSRGR  184


 Score = 32.7 bits (73),  Expect = 0.37, Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  58   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  113

Query  93   FEFRSKSP  100
             E +  +P
Sbjct  114  PELQKAAP  121


 Score = 31.2 bits (69),  Expect = 0.93, Method: Composition-based stats.
 Identities = 15/56 (27%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  45  SAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAGFEFRSKSP  100
           +AP  P+++  A   PE+   QK+AP         P +P++  ++ A  E +  +P
Sbjct  39  AAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAP  91


>FADD_DROME unnamed protein product
Length=239

 Score = 30.0 bits (66),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  185  IKTHIGHGWRDVARRLGYSEGQIDQFEENH  214
            I   +G  WR + R  G  EGQ+D  EE +
Sbjct  158  ISEELGRYWRRLGRSAGIGEGQMDTIEERY  187



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584807.1 receptor-interacting serine/threonine-protein kinase
1 [Cephus cinctus]

Length=267
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IMD_DROME  unnamed protein product                                    79.7    2e-17
Q38BJ2_TRYB2  unnamed protein product                                 33.9    0.14 
FADD_DROME  unnamed protein product                                   30.0    1.5  


>IMD_DROME unnamed protein product
Length=273

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 101/222 (45%), Gaps = 33/222 (15%)

Query  71   EPTTSDSEFPKSPKIGHSSTAGFEFRSKSPRGKTKPKYK---------IP------QSAN  115
            EP  ++S     P    + TA  +      R  + P Y          IP      Q+ N
Sbjct  38   EPDNNNSGALALPSTAGTPTASSDLTESVLRELSDPNYNSMDVVHSANIPGTLSNVQTNN  97

Query  116  VVNYNIVNSKGV-TIGSRTSITYNNLNQFNKN---------TTVTPKSSTMKAKTKPMP-  164
             +N +    + V    +  ++ + ++  FN+N         +T T + S      KP   
Sbjct  98   TMNVHSAQQQVVMNFSNANNLHFGSVYNFNQNLSACSSRKGSTSTAEESVASPDGKPRAS  157

Query  165  ---ESVEELSMCKEQINLDDMFL--IKTHIGHGWRDVARRLGYSEGQIDQFEENHMVKG-  218
               ++V  ++M + Q   D   L  + TH+G GW+ V R LG SEGQIDQ   +H + G 
Sbjct  158  ATRKTVSIVAMMQSQEEPDVRLLDVVSTHLGEGWKQVMRDLGMSEGQIDQAIIDHQMHGN  217

Query  219  IDQVIYQVLLDWKQTNTKD-ARLGDLICIIWSCQEYDCVERL  259
            I +VIYQ+LL W +++    A +G L  ++W  Q  DCV+R+
Sbjct  218  IREVIYQLLLQWIRSSADGVATVGRLTTLLWESQHRDCVQRM  259


>Q38BJ2_TRYB2 unnamed protein product
Length=1183

 Score = 33.9 bits (76),  Expect = 0.14, Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 8/91 (9%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  88   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  143

Query  93   FEFRSKSPRG----KTKPKYKIPQSANVVNY  119
             E +  +P      K  P     Q A  VN+
Sbjct  144  PELQKAAPAAPELQKAAPAAPELQKAAPVNF  174


 Score = 33.1 bits (74),  Expect = 0.25, Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++   
Sbjct  118  KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPVN  173

Query  93   FEFRSKSPRGK  103
            F   ++  RG+
Sbjct  174  FMTSTRRSRGR  184


 Score = 32.7 bits (73),  Expect = 0.37, Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  58   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  113

Query  93   FEFRSKSP  100
             E +  +P
Sbjct  114  PELQKAAP  121


 Score = 31.2 bits (69),  Expect = 0.93, Method: Composition-based stats.
 Identities = 15/56 (27%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  45  SAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAGFEFRSKSP  100
           +AP  P+++  A   PE+   QK+AP         P +P++  ++ A  E +  +P
Sbjct  39  AAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAP  91


>FADD_DROME unnamed protein product
Length=239

 Score = 30.0 bits (66),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  185  IKTHIGHGWRDVARRLGYSEGQIDQFEENH  214
            I   +G  WR + R  G  EGQ+D  EE +
Sbjct  158  ISEELGRYWRRLGRSAGIGEGQMDTIEERY  187



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584808.1 receptor-interacting serine/threonine-protein kinase
1 [Cephus cinctus]

Length=267
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IMD_DROME  unnamed protein product                                    79.7    2e-17
Q38BJ2_TRYB2  unnamed protein product                                 33.9    0.14 
FADD_DROME  unnamed protein product                                   30.0    1.5  


>IMD_DROME unnamed protein product
Length=273

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/222 (28%), Positives = 101/222 (45%), Gaps = 33/222 (15%)

Query  71   EPTTSDSEFPKSPKIGHSSTAGFEFRSKSPRGKTKPKYK---------IP------QSAN  115
            EP  ++S     P    + TA  +      R  + P Y          IP      Q+ N
Sbjct  38   EPDNNNSGALALPSTAGTPTASSDLTESVLRELSDPNYNSMDVVHSANIPGTLSNVQTNN  97

Query  116  VVNYNIVNSKGV-TIGSRTSITYNNLNQFNKN---------TTVTPKSSTMKAKTKPMP-  164
             +N +    + V    +  ++ + ++  FN+N         +T T + S      KP   
Sbjct  98   TMNVHSAQQQVVMNFSNANNLHFGSVYNFNQNLSACSSRKGSTSTAEESVASPDGKPRAS  157

Query  165  ---ESVEELSMCKEQINLDDMFL--IKTHIGHGWRDVARRLGYSEGQIDQFEENHMVKG-  218
               ++V  ++M + Q   D   L  + TH+G GW+ V R LG SEGQIDQ   +H + G 
Sbjct  158  ATRKTVSIVAMMQSQEEPDVRLLDVVSTHLGEGWKQVMRDLGMSEGQIDQAIIDHQMHGN  217

Query  219  IDQVIYQVLLDWKQTNTKD-ARLGDLICIIWSCQEYDCVERL  259
            I +VIYQ+LL W +++    A +G L  ++W  Q  DCV+R+
Sbjct  218  IREVIYQLLLQWIRSSADGVATVGRLTTLLWESQHRDCVQRM  259


>Q38BJ2_TRYB2 unnamed protein product
Length=1183

 Score = 33.9 bits (76),  Expect = 0.14, Method: Composition-based stats.
 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 8/91 (9%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  88   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  143

Query  93   FEFRSKSPRG----KTKPKYKIPQSANVVNY  119
             E +  +P      K  P     Q A  VN+
Sbjct  144  PELQKAAPAAPELQKAAPAAPELQKAAPVNF  174


 Score = 33.1 bits (74),  Expect = 0.25, Method: Composition-based stats.
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 4/71 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++   
Sbjct  118  KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPVN  173

Query  93   FEFRSKSPRGK  103
            F   ++  RG+
Sbjct  174  FMTSTRRSRGR  184


 Score = 32.7 bits (73),  Expect = 0.37, Method: Composition-based stats.
 Identities = 18/68 (26%), Positives = 34/68 (50%), Gaps = 4/68 (6%)

Query  33   KLGLSSPETKINSAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAG  92
            K   ++PE +  +AP  P+++  A   PE+   QK+AP         P +P++  ++ A 
Sbjct  58   KAAPAAPELQ-KAAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAA  113

Query  93   FEFRSKSP  100
             E +  +P
Sbjct  114  PELQKAAP  121


 Score = 31.2 bits (69),  Expect = 0.93, Method: Composition-based stats.
 Identities = 15/56 (27%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  45  SAPVTPDIENGAKDIPEVIRRQKSAPEPTTSDSEFPKSPKIGHSSTAGFEFRSKSP  100
           +AP  P+++  A   PE+   QK+AP         P +P++  ++ A  E +  +P
Sbjct  39  AAPAAPELQKAAPAAPEL---QKAAPAAPELQKAAPAAPELQKAAPAAPELQKAAP  91


>FADD_DROME unnamed protein product
Length=239

 Score = 30.0 bits (66),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  185  IKTHIGHGWRDVARRLGYSEGQIDQFEENH  214
            I   +G  WR + R  G  EGQ+D  EE +
Sbjct  158  ISEELGRYWRRLGRSAGIGEGQMDTIEERY  187



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584809.1 deoxynucleoside kinase isoform X1 [Cephus cinctus]

Length=266
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DNK_DROME  unnamed protein product                                    228     1e-74
DAK_DICDI  unnamed protein product                                    58.9    3e-10
DGK_DICDI  unnamed protein product                                    50.4    4e-07


>DNK_DROME unnamed protein product
Length=250

 Score = 228 bits (581),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 161/239 (67%), Gaps = 13/239 (5%)

Query  25   RPFTVCIEGNIGSGKTTFINEFKQY-NDTTVLQEPVELWRNVSGTNLLELMYKDPGQYAC  83
            +PFTV IEGNIGSGKTT++N F++Y ND  +L EPVE WRNV+G NLLELMYKDP ++A 
Sbjct  19   QPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAM  78

Query  84   LFQSYVQLTMLQLHTIETPTPYKIMERSVFSAR-CFIENMKRTKMLRPVESVVLEEWYNW  142
             FQSYV LTMLQ HT  T    KIMERS+FSAR CF+ENM+R   L       LEEWY +
Sbjct  79   PFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKF  138

Query  143  CITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEYLQQVHQIHDDWLYHRTLFS  202
               ++ ++ DLIIYLRT+PEV Y+R+R+RAR EE  V L+YLQ++H++H+DWL H+    
Sbjct  139  IEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRR-P  197

Query  203  LPAPVITLNGDKSIEEMFAEVRKCKEGFFTKADEIMLENGTRCRSEESSPVHITPKKLQ  261
                V+ L+ D ++E +  E ++ +   F   D I         +++ SPV ++P K Q
Sbjct  198  QSCKVLVLDADLNLENIGTEYQRSESSIF---DAI-------SSNQQPSPVLVSPSKRQ  246


>DAK_DICDI unnamed protein product
Length=245

 Score = 58.9 bits (141),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 105/225 (47%), Gaps = 31/225 (14%)

Query  16   SIIPSAVYKRPFT---VCIEGNIGSGKTTF-INEFKQYNDTTVLQEPVELWRNVSGTNL-  70
            S +P  + K+      + I G IG+GKTT  +   K  N  T  +E ++        NL 
Sbjct  8    SSVPGNIQKKSLEGTHIAISGLIGAGKTTLAVALGKVLNLPTYFEEVID--------NLY  59

Query  71   LELMYKDPGQYACLFQSYVQLTMLQLHTIETPTPYKIMERSVFSARCFIENMKRTKMLRP  130
            L+  YKDP +Y    Q Y+  +  Q              R     R   E+    KML  
Sbjct  60   LQDFYKDPKKYGFQLQIYLLNSRFQQQQQII-----WQARGGVQDRTIYEDSVFAKMLN-  113

Query  131  VESVVLEE--WYNWC-----ITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEY  183
             ES +L++  +  +C     ++N   + DLII+L  +PE   +R++ R R+ E  VSLEY
Sbjct  114  -ESGLLDDRDYNTYCKLFQNLSNFMRRPDLIIHLDVSPEKSLERIKLRNRDCEKDVSLEY  172

Query  184  LQQVHQIHDDWLYHRTLFSLPAPVITLNGDKSIE-EMFAEVRKCK  227
            LQ ++  + ++L   + +    PVI +N  + ++ E  A++ K +
Sbjct  173  LQNLYNAYHEFLQDISRY---IPVIRINWSEFVDPEQLAQMIKAE  214


>DGK_DICDI unnamed protein product
Length=285

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 82/175 (47%), Gaps = 18/175 (10%)

Query  29   VCIEGNIGSGKTTFINEFKQYNDTTVLQEPVELWRNVSGTN-LLELMYKDPGQYACLFQS  87
            + +EGNI +GKT   ++        V  EP       + TN  L L YK+P +YA + Q 
Sbjct  35   IILEGNISAGKTYLSSKLGDLLGYKVFLEP-------TATNPYLSLFYKEPSKYALIMQK  87

Query  88   YVQ-------LTMLQLHTIETPTPYKIMERSVFSARCFIENMKRTKMLRPVESVVLEEWY  140
            ++        L  LQ +++E      I++RSV+S   F EN +   ++            
Sbjct  88   WLLNQRYNTFLNALQ-YSLENEQGV-ILDRSVYSDWVFAENCRSEGLISAEGFKEYNSIR  145

Query  141  NWCITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEYLQQVHQIHDDWL  195
            +  ++N+ +  ++ ++L   P+   +R++ R R+ E S+ L YL  +   +  +L
Sbjct  146  DRFLSNIPI-PNVTLFLDVDPKQCLQRIQNRKRDCEQSIPLSYLSGLDNCYKKFL  199



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584810.1 deoxynucleoside kinase isoform X2 [Cephus cinctus]

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DNK_DROME  unnamed protein product                                    228     6e-75
DAK_DICDI  unnamed protein product                                    58.9    3e-10
DGK_DICDI  unnamed protein product                                    50.4    4e-07


>DNK_DROME unnamed protein product
Length=250

 Score = 228 bits (581),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 161/239 (67%), Gaps = 13/239 (5%)

Query  11   RPFTVCIEGNIGSGKTTFINEFKQY-NDTTVLQEPVELWRNVSGTNLLELMYKDPGQYAC  69
            +PFTV IEGNIGSGKTT++N F++Y ND  +L EPVE WRNV+G NLLELMYKDP ++A 
Sbjct  19   QPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAM  78

Query  70   LFQSYVQLTMLQLHTIETPTPYKIMERSVFSAR-CFIENMKRTKMLRPVESVVLEEWYNW  128
             FQSYV LTMLQ HT  T    KIMERS+FSAR CF+ENM+R   L       LEEWY +
Sbjct  79   PFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKF  138

Query  129  CITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEYLQQVHQIHDDWLYHRTLFS  188
               ++ ++ DLIIYLRT+PEV Y+R+R+RAR EE  V L+YLQ++H++H+DWL H+    
Sbjct  139  IEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRR-P  197

Query  189  LPAPVITLNGDKSIEEMFAEVRKCKEGFFTKADEIMLENGTRCRSEESSPVHITPKKLQ  247
                V+ L+ D ++E +  E ++ +   F   D I         +++ SPV ++P K Q
Sbjct  198  QSCKVLVLDADLNLENIGTEYQRSESSIF---DAI-------SSNQQPSPVLVSPSKRQ  246


>DAK_DICDI unnamed protein product
Length=245

 Score = 58.9 bits (141),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 108/226 (48%), Gaps = 33/226 (15%)

Query  2    SIIPSAVYKRPFT---VCIEGNIGSGKTTF-INEFKQYNDTTVLQEPVELWRNVSGTNL-  56
            S +P  + K+      + I G IG+GKTT  +   K  N  T  +E ++        NL 
Sbjct  8    SSVPGNIQKKSLEGTHIAISGLIGAGKTTLAVALGKVLNLPTYFEEVID--------NLY  59

Query  57   LELMYKDPGQYACLFQSYVQLTMLQLHTIETPTPYK-IMERSVFSARCFIENMKRTKMLR  115
            L+  YKDP +Y    Q Y+  +  Q            + +R+++    F       KML 
Sbjct  60   LQDFYKDPKKYGFQLQIYLLNSRFQQQQQIIWQARGGVQDRTIYEDSVF------AKMLN  113

Query  116  PVESVVLEE--WYNWC-----ITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLE  168
              ES +L++  +  +C     ++N   + DLII+L  +PE   +R++ R R+ E  VSLE
Sbjct  114  --ESGLLDDRDYNTYCKLFQNLSNFMRRPDLIIHLDVSPEKSLERIKLRNRDCEKDVSLE  171

Query  169  YLQQVHQIHDDWLYHRTLFSLPAPVITLNGDKSIE-EMFAEVRKCK  213
            YLQ ++  + ++L   + +    PVI +N  + ++ E  A++ K +
Sbjct  172  YLQNLYNAYHEFLQDISRY---IPVIRINWSEFVDPEQLAQMIKAE  214


>DGK_DICDI unnamed protein product
Length=285

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 82/175 (47%), Gaps = 18/175 (10%)

Query  15   VCIEGNIGSGKTTFINEFKQYNDTTVLQEPVELWRNVSGTN-LLELMYKDPGQYACLFQS  73
            + +EGNI +GKT   ++        V  EP       + TN  L L YK+P +YA + Q 
Sbjct  35   IILEGNISAGKTYLSSKLGDLLGYKVFLEP-------TATNPYLSLFYKEPSKYALIMQK  87

Query  74   YVQ-------LTMLQLHTIETPTPYKIMERSVFSARCFIENMKRTKMLRPVESVVLEEWY  126
            ++        L  LQ +++E      I++RSV+S   F EN +   ++            
Sbjct  88   WLLNQRYNTFLNALQ-YSLENEQGV-ILDRSVYSDWVFAENCRSEGLISAEGFKEYNSIR  145

Query  127  NWCITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEYLQQVHQIHDDWL  181
            +  ++N+ +  ++ ++L   P+   +R++ R R+ E S+ L YL  +   +  +L
Sbjct  146  DRFLSNIPI-PNVTLFLDVDPKQCLQRIQNRKRDCEQSIPLSYLSGLDNCYKKFL  199



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584811.1 deoxynucleoside kinase isoform X2 [Cephus cinctus]

Length=252
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DNK_DROME  unnamed protein product                                    228     6e-75
DAK_DICDI  unnamed protein product                                    58.9    3e-10
DGK_DICDI  unnamed protein product                                    50.4    4e-07


>DNK_DROME unnamed protein product
Length=250

 Score = 228 bits (581),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/239 (50%), Positives = 161/239 (67%), Gaps = 13/239 (5%)

Query  11   RPFTVCIEGNIGSGKTTFINEFKQY-NDTTVLQEPVELWRNVSGTNLLELMYKDPGQYAC  69
            +PFTV IEGNIGSGKTT++N F++Y ND  +L EPVE WRNV+G NLLELMYKDP ++A 
Sbjct  19   QPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAM  78

Query  70   LFQSYVQLTMLQLHTIETPTPYKIMERSVFSAR-CFIENMKRTKMLRPVESVVLEEWYNW  128
             FQSYV LTMLQ HT  T    KIMERS+FSAR CF+ENM+R   L       LEEWY +
Sbjct  79   PFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKF  138

Query  129  CITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEYLQQVHQIHDDWLYHRTLFS  188
               ++ ++ DLIIYLRT+PEV Y+R+R+RAR EE  V L+YLQ++H++H+DWL H+    
Sbjct  139  IEESIHVQADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRR-P  197

Query  189  LPAPVITLNGDKSIEEMFAEVRKCKEGFFTKADEIMLENGTRCRSEESSPVHITPKKLQ  247
                V+ L+ D ++E +  E ++ +   F   D I         +++ SPV ++P K Q
Sbjct  198  QSCKVLVLDADLNLENIGTEYQRSESSIF---DAI-------SSNQQPSPVLVSPSKRQ  246


>DAK_DICDI unnamed protein product
Length=245

 Score = 58.9 bits (141),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 108/226 (48%), Gaps = 33/226 (15%)

Query  2    SIIPSAVYKRPFT---VCIEGNIGSGKTTF-INEFKQYNDTTVLQEPVELWRNVSGTNL-  56
            S +P  + K+      + I G IG+GKTT  +   K  N  T  +E ++        NL 
Sbjct  8    SSVPGNIQKKSLEGTHIAISGLIGAGKTTLAVALGKVLNLPTYFEEVID--------NLY  59

Query  57   LELMYKDPGQYACLFQSYVQLTMLQLHTIETPTPYK-IMERSVFSARCFIENMKRTKMLR  115
            L+  YKDP +Y    Q Y+  +  Q            + +R+++    F       KML 
Sbjct  60   LQDFYKDPKKYGFQLQIYLLNSRFQQQQQIIWQARGGVQDRTIYEDSVF------AKMLN  113

Query  116  PVESVVLEE--WYNWC-----ITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLE  168
              ES +L++  +  +C     ++N   + DLII+L  +PE   +R++ R R+ E  VSLE
Sbjct  114  --ESGLLDDRDYNTYCKLFQNLSNFMRRPDLIIHLDVSPEKSLERIKLRNRDCEKDVSLE  171

Query  169  YLQQVHQIHDDWLYHRTLFSLPAPVITLNGDKSIE-EMFAEVRKCK  213
            YLQ ++  + ++L   + +    PVI +N  + ++ E  A++ K +
Sbjct  172  YLQNLYNAYHEFLQDISRY---IPVIRINWSEFVDPEQLAQMIKAE  214


>DGK_DICDI unnamed protein product
Length=285

 Score = 50.4 bits (119),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/175 (25%), Positives = 82/175 (47%), Gaps = 18/175 (10%)

Query  15   VCIEGNIGSGKTTFINEFKQYNDTTVLQEPVELWRNVSGTN-LLELMYKDPGQYACLFQS  73
            + +EGNI +GKT   ++        V  EP       + TN  L L YK+P +YA + Q 
Sbjct  35   IILEGNISAGKTYLSSKLGDLLGYKVFLEP-------TATNPYLSLFYKEPSKYALIMQK  87

Query  74   YVQ-------LTMLQLHTIETPTPYKIMERSVFSARCFIENMKRTKMLRPVESVVLEEWY  126
            ++        L  LQ +++E      I++RSV+S   F EN +   ++            
Sbjct  88   WLLNQRYNTFLNALQ-YSLENEQGV-ILDRSVYSDWVFAENCRSEGLISAEGFKEYNSIR  145

Query  127  NWCITNVKLKTDLIIYLRTTPEVVYKRMRERAREEECSVSLEYLQQVHQIHDDWL  181
            +  ++N+ +  ++ ++L   P+   +R++ R R+ E S+ L YL  +   +  +L
Sbjct  146  DRFLSNIPI-PNVTLFLDVDPKQCLQRIQNRKRDCEQSIPLSYLSGLDNCYKKFL  199



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584813.1 eIF-2-alpha kinase GCN2 [Cephus cinctus]

Length=1620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O61651_DROME  unnamed protein product                                 976     0.0  
Q9V9X8_DROME  unnamed protein product                                 976     0.0  
O01712_DROME  unnamed protein product                                 975     0.0  


>O61651_DROME unnamed protein product
Length=1589

 Score = 976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/1710 (37%), Positives = 958/1710 (56%), Gaps = 222/1710 (13%)

Query  5     ESCRDRQENELEVLKSIFGDELYDLRKNKQRKKWQPLDVSVTLMPQQGMSGPAQVYAQID  64
             ES R+RQ  ELEV+KSIFG ++ DLR       W+P D+ + L P +  S   + Y    
Sbjct  8     ESFRERQAQELEVIKSIFGCDVEDLRPQANPSLWKPTDIRIQLTPLRDSSNGLETYVCTK  67

Query  65    LHVICGEKYPEEVPRMQLQNSRGLSDQQIAMLFSELEHLAERLRGEVMIFELAQHIQKFL  124
             LHV C  KYP+  P++ L+ S+G+SDQ +  L ++L+  ++ LRGEVMI+ELAQ +Q FL
Sbjct  68    LHVTCPSKYPKLPPKISLEESKGMSDQLLEALRNQLQAQSQELRGEVMIYELAQTVQAFL  127

Query  125   HKHNKPGYSSFYEEMVSRRQERMQYEMQEKQL-KEDKERQVLQDEIQKRQEALKAEMRNR  183
              +HNKP   SFY++M+  +Q+R Q E+Q+ Q  +E  +RQ L DE+++R+E  K E + R
Sbjct  128   LEHNKPPKGSFYDQMLQDKQKRDQ-ELQDIQRQRESLQRQTLIDEVERRKEMFKTEAKRR  186

Query  184   RETARLSIESDTMSQSIP-----------SSPHERVRTYSRRRCMSTSESSEGPLCEHRG  232
              E  R      +MS+S P           SSP+ R   Y  + C+           +HR 
Sbjct  187   GEPRR------SMSESNPRHPSSSESSENSSPYYRGHIYPSK-CL-----------DHRN  228

Query  233   TKLLHFDNSRGERQVHRGKCLGHSTKGSVVYAGVDMTTGELLAVTEWTLK-------CGS  285
             T+ L+F   +  RQ+ RG C+GHS +G + Y G+DM  G+LL +TEW +K       C  
Sbjct  229   TETLYF--HKMGRQIQRGCCVGHSQRGCIAYTGIDMHCGQLLYITEWNIKYSQLEQPCIG  286

Query  286   TGEARVTSEASNL-QHSMKQI-ASIEQELNHLHKLHHPNLVHYLNMKYIQDKDNILIYIL  343
              G+   +SE+  +  H + ++ ASIE++++ L +L H NLV Y  +  I+ K+ +L+Y++
Sbjct  287   GGKCHWSSESKCMGSHRVDEVMASIEKQVSSLSQLQHKNLVSYECVLCIKRKEGLLVYLV  346

Query  344   QEFVVGTTCSFYLMENIPVDIDMLRHLATGILSALQYLHENNVVHKDLRDTSVHIDRTGA  403
             Q+F++GT+  F +  ++   +D  R +A G+L AL +LH   V H  L DT+V +D TG 
Sbjct  347   QDFLLGTSV-FSISSSLGWCMDGARMVARGVLDALVFLHNKGVSHSHLLDTTVFMDNTGN  405

Query  404   IRLSDYSLDKRLSDIYRASCLAKAEHDFPTIQARSGKKADIYRFGVLLLSLFRGSIVSEK  463
             +R+SD+SL   L ++   +  + +  D P +             G L+ SL   +     
Sbjct  406   VRVSDFSLVPNLLELLSGAGQSSSCGDLPAL-------------GALVESLMPTNSY---  449

Query  464   EIDWSGAPQPDLRDFLSKCLTGDERVRWSAEQLQQHGFIRVPLERGISPPRLDRNKEQDS  523
                       ++RDF+ KC    +R   SA +L +H F+R  ++ G     +   ++Q  
Sbjct  450   ----------EMRDFVDKC--NSDRT-LSASELLEHPFLRFYVDNG-QQQVMPLPQQQHP  495

Query  524   SEPEEPASDIHFYLPALG-GQSRIQNEFEVLKWLGKGAFGDVLKVRNKLDGGVYAIKRIE  582
             +  +   S + + +P L   QSR++ EFEVL +LGKGAFGDVLKVRN LD   YAIKRI 
Sbjct  496   NTVQRTGSAMPYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYAIKRIP  555

Query  583   LNPKNKQLNRKITREVKLLSRLNHENVVRYYNSWIESATLDDPTRHSRLTPAATPSTKTT  642
             L  +++QL +K+TREV+LLSRLNHENVVRY+NSWIES    D     +L           
Sbjct  556   LPARSRQLYKKMTREVELLSRLNHENVVRYFNSWIESVDDADAAEMDKLLGG--------  607

Query  643   NFHHILKETTLSEDIERLAPAVHDVEWNISYESRASAVMSSDSEEDNSVSSSDSDS----  698
                                      EW             S S++D SV  + S      
Sbjct  608   -------------------------EW-------------SQSQQDLSVKPAKSPQLGPT  629

Query  699   -----------DEDWAFLMRTTVDS-SDSIEF-EKDGTSQMSDSVQGSQENLSKGDTSTD  745
                           W   +    DS SD IEF + +G   + D  +  QE+ ++G T++ 
Sbjct  630   LEEDEDEEDSSSSMWNGYIPNMEDSDSDGIEFVDSNGKVAVYDDEE--QEDSTRGKTNSP  687

Query  746   VSTMGKEIQFMYIQMEFCEKSTLRTAIDNGLYEDEERVWRLFREMVEGLAHIHQQGMIHR  805
                M    Q MYIQMEFCEK TLRTAID+ L+ D +R+WRLFRE+ EGLAHIHQQG+IHR
Sbjct  688   KPLM----QVMYIQMEFCEKCTLRTAIDDNLFNDTDRLWRLFREIAEGLAHIHQQGIIHR  743

Query  806   DLKPVNIFLDSNDHVKIGDFGLATTNILSTLVHTMDTDRELQLIEKGTSFDLDELGSLTG  865
             DLKPVNIFLDS+D +KIGDFGLATT+ L+   H    D     + + TS    E G+ TG
Sbjct  744   DLKPVNIFLDSHDQIKIGDFGLATTSFLALQAH----DAAPAPVNQITS---AEDGTGTG  796

Query  866   QVGTALYVAPELSSKAAKAIYNQKVDIYSLGIILFEMCYKPLTTGMERVKVLLNLRSKEI  925
             +VGT LYVAPEL+  A+K++YNQKVD+Y+LGIILFEMC  P  T MER + ++ LR+  I
Sbjct  797   KVGTTLYVAPELTGNASKSVYNQKVDMYTLGIILFEMCQPPFDTSMERAQTIMALRNVSI  856

Query  926   VLPPE-LTEADTPHQVHLLRWLLNHDPSQRPTSQELLASEYLPPPQLEEAELQEMVRHTL  984
              +P   L +      V +L+WLLNHDP+QRPT++ELL S+ +PP QLE  ELQEM+RH L
Sbjct  857   NIPDAMLKDPKYEKTVKMLQWLLNHDPAQRPTAEELLISDLVPPAQLEANELQEMLRHAL  916

Query  985   SNSQSKAYKYLVACCFAQEVTAAEDITYDMNLPSRGIAN-----------SLVPKTQFLH  1033
             +N QSKAYK LVA C  QE     + TY +   SR + +           SL P  +F  
Sbjct  917   ANPQSKAYKNLVARCLQQESDEVLEHTYHLG-SSRAMKSWNSAIIIDDIVSLNPVIEF--  973

Query  1034  ENVKAKVVEVFRRHGGVYLATPLLMPKSGK--FYNLTDSCAKLMTRTGSIVSIPHDLRAP  1091
               VKAKVV +FR+HG + + +PLL P S +    N   +   LMT +G +V +P DLR  
Sbjct  974   --VKAKVVNLFRKHGAIEVDSPLLSPLSARNSTANANANAVHLMTHSGCVVVLPCDLRTQ  1031

Query  1092  FARYVAWNNILHIRRYAIERVYREKKVHGFHPRELYECAFDIISPTANNLMAEAELITIV  1151
             FAR+V  N++  IRRY ++RVYRE++V  FHP++ Y+C+FDII+PT  + + +AEL+++ 
Sbjct  1032  FARHVTMNSVNLIRRYCVDRVYREERVFNFHPKQSYDCSFDIIAPTTGSHLVDAELLSLA  1091

Query  1152  WEIVNEIPLLRERNFTVRLNHTSLLQAVLMYCGIEPEKYQDIYSILCDARDGKFSKFQVQ  1211
             +EI +E+P LRE+N  +R+NHT+LL+A+L++C +   +Y  ++    D  + + S+FQ  
Sbjct  1092  FEITSELPRLREKNLAIRMNHTNLLRAILIFCNVPKAQYGALFEGTMDFIESRISRFQFH  1151

Query  1212  THLISLCLTDQA-----METLF-NLFETESSVAKIASVLRTITRRKGDAAALAKEGLREM  1265
             + +  +    +      M+ L  N   T S      S L+++ R KG+AA+LA+  LRE+
Sbjct  1152  SSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDDSALKSLMRGKGEAASLARGALREL  1211

Query  1266  EIVIANAEALGVKWPIVIVPLLVHNVQQHS--GVIYQITCELKRRRRRGGQDVIAAGGRY  1323
             E V+  A +LGVK PI I   L  +  + S  G+++Q+T +LK   R G   V+A G RY
Sbjct  1212  ETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMTADLK-PNRSGHPSVLAIGERY  1270

Query  1324  DKMIMSFRKVLER--TGMASKEVKQYGVGISVSLDKLVCAVAELSDDHCGENKFGIDVAV  1381
             D M+  F+K  ++    M ++ V   G G++ SLDKLV AV       C      IDV +
Sbjct  1271  DSMLHEFQKQAQKFNPAMPARGVLS-GAGLTFSLDKLVAAVGVEYAKDCR----AIDVGI  1325

Query  1382  CCVDGLPKREKEMADVLRELWSLGLSVTSLDLCT--VEEIREYCQENLINHIVMLKSGEK  1439
             C     P   K++  ++R LWS+G+    ++  +   +E ++  +   + H++++   E 
Sbjct  1326  CVCGTRPPL-KDVTYIMRLLWSVGIRCGIVEAASELGDEAQDLARLGAL-HVILV--AEN  1381

Query  1440  GSLRVQSWERDRFQERKISIQEIGDYLQRQTENP------------LPILNRSESKVSA-  1486
             GSLRV+S+ER+RFQER ++  E+ +++Q+   +             L  L   +++ S  
Sbjct  1382  GSLRVRSFERERFQERHLTRTELVEFIQKMLRSDGLNGTTVDNFSHLSALGSGDNRSSGG  1441

Query  1487  -------NNDAPASSNNPVN------VNINFVFSERDKLSASGKRSFKNTMLAQMTSCLQ  1533
                    N  + ++SN  +        N+   F   DK +A+ KR  +N +  QM+S L 
Sbjct  1442  KERERGENGLSTSASNATIKNNYSQLPNLQVTFLTHDKPTANYKRRLENQVAQQMSSTLS  1501

Query  1534  RISYKVPIEVFAFFLEMTVLRTMVSLL---EIDEEELNFQKSIQLIIEKHPRHKKYIEKI  1590
             +   K    V    L   V+  +V  +   EI + E   +  I  +IE+  ++K+YI +I
Sbjct  1502  QFLKKETFVVLVVELPPAVVNAIVGAINPREIRKRET--EPEINYVIERFSKYKRYISEI  1559

Query  1591  CEELREVRNEKQRPVLVLYSLTESRYKILM  1620
              EE+ +  ++ + P++ LYS+++S Y++++
Sbjct  1560  NEEVVDYLSDAKTPIVALYSISDSYYRVII  1589


>Q9V9X8_DROME unnamed protein product
Length=1589

 Score = 976 bits (2522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/1710 (37%), Positives = 958/1710 (56%), Gaps = 222/1710 (13%)

Query  5     ESCRDRQENELEVLKSIFGDELYDLRKNKQRKKWQPLDVSVTLMPQQGMSGPAQVYAQID  64
             ES R+RQ  ELEV+KSIFG ++ DLR       W+P D+ + L P +  S   + Y    
Sbjct  8     ESFRERQAQELEVIKSIFGCDVEDLRPQANPSLWKPTDIRIQLTPLRDSSNGLETYVCTK  67

Query  65    LHVICGEKYPEEVPRMQLQNSRGLSDQQIAMLFSELEHLAERLRGEVMIFELAQHIQKFL  124
             LHV C  KYP+  P++ L+ S+G+SDQ +  L ++L+  ++ LRGEVMI+ELAQ +Q FL
Sbjct  68    LHVTCPSKYPKLPPKISLEESKGMSDQLLEALRNQLQAQSQELRGEVMIYELAQTVQAFL  127

Query  125   HKHNKPGYSSFYEEMVSRRQERMQYEMQEKQL-KEDKERQVLQDEIQKRQEALKAEMRNR  183
              +HNKP   SFY++M+  +Q+R Q E+Q+ Q  +E  +RQ L DE+++R+E  K E + R
Sbjct  128   LEHNKPPKGSFYDQMLQDKQKRDQ-ELQDIQRQRESLQRQTLIDEVERRKEMFKTEAKRR  186

Query  184   RETARLSIESDTMSQSIP-----------SSPHERVRTYSRRRCMSTSESSEGPLCEHRG  232
              E  R      +MS+S P           SSP+ R   Y  + C+           +HR 
Sbjct  187   GEPRR------SMSESNPRHPSSSESSENSSPYYRGHIYPSK-CL-----------DHRN  228

Query  233   TKLLHFDNSRGERQVHRGKCLGHSTKGSVVYAGVDMTTGELLAVTEWTLK-------CGS  285
             T+ L+F   +  RQ+ RG C+GHS +G + Y G+DM  G+LL +TEW +K       C  
Sbjct  229   TETLYF--HKMGRQIQRGCCVGHSQRGCIAYTGIDMHCGQLLYITEWNIKYSQLEQPCIG  286

Query  286   TGEARVTSEASNL-QHSMKQI-ASIEQELNHLHKLHHPNLVHYLNMKYIQDKDNILIYIL  343
              G+   +SE+  +  H + ++ ASIE++++ L +L H NLV Y  +  I+ K+ +L+Y++
Sbjct  287   GGKCHWSSESKCMGSHRVDEVMASIEKQVSSLSQLQHKNLVSYECVLCIKRKEGLLVYLV  346

Query  344   QEFVVGTTCSFYLMENIPVDIDMLRHLATGILSALQYLHENNVVHKDLRDTSVHIDRTGA  403
             Q+F++GT+  F +  ++   +D  R +A G+L AL +LH   V H  L DT+V +D TG 
Sbjct  347   QDFLLGTSV-FSISSSLGWCMDGARMVARGVLDALVFLHNKGVSHSHLLDTTVFMDNTGN  405

Query  404   IRLSDYSLDKRLSDIYRASCLAKAEHDFPTIQARSGKKADIYRFGVLLLSLFRGSIVSEK  463
             +R+SD+SL   L ++   +  + +  D P +             G L+ SL   +     
Sbjct  406   VRVSDFSLVPNLLELLSGAGQSSSCGDLPAL-------------GALVESLMPTNSY---  449

Query  464   EIDWSGAPQPDLRDFLSKCLTGDERVRWSAEQLQQHGFIRVPLERGISPPRLDRNKEQDS  523
                       ++RDF+ KC    +R   SA +L +H F+R  ++ G     +   ++Q  
Sbjct  450   ----------EMRDFVDKC--NSDRT-LSASELLEHPFLRFYVDNG-QQQVMPLPQQQHP  495

Query  524   SEPEEPASDIHFYLPALG-GQSRIQNEFEVLKWLGKGAFGDVLKVRNKLDGGVYAIKRIE  582
             +  +   S + + +P L   QSR++ EFEVL +LGKGAFGDVLKVRN LD   YAIKRI 
Sbjct  496   NTVQRTGSAMPYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYAIKRIP  555

Query  583   LNPKNKQLNRKITREVKLLSRLNHENVVRYYNSWIESATLDDPTRHSRLTPAATPSTKTT  642
             L  +++QL +K+TREV+LLSRLNHENVVRY+NSWIES    D     +L           
Sbjct  556   LPARSRQLYKKMTREVELLSRLNHENVVRYFNSWIESVDDADAAEMDKLLGG--------  607

Query  643   NFHHILKETTLSEDIERLAPAVHDVEWNISYESRASAVMSSDSEEDNSVSSSDSDS----  698
                                      EW             S S++D SV  + S      
Sbjct  608   -------------------------EW-------------SQSQQDLSVKPAKSPQLGPT  629

Query  699   -----------DEDWAFLMRTTVDS-SDSIEF-EKDGTSQMSDSVQGSQENLSKGDTSTD  745
                           W   +    DS SD IEF + +G   + D  +  QE+ ++G T++ 
Sbjct  630   LEEDEDEEDSSSSMWNGYIPNMEDSDSDGIEFVDSNGKVAVYDDEE--QEDSTRGKTNSP  687

Query  746   VSTMGKEIQFMYIQMEFCEKSTLRTAIDNGLYEDEERVWRLFREMVEGLAHIHQQGMIHR  805
                M    Q MYIQMEFCEK TLRTAID+ L+ D +R+WRLFRE+ EGLAHIHQQG+IHR
Sbjct  688   KPLM----QVMYIQMEFCEKCTLRTAIDDNLFNDTDRLWRLFREIAEGLAHIHQQGIIHR  743

Query  806   DLKPVNIFLDSNDHVKIGDFGLATTNILSTLVHTMDTDRELQLIEKGTSFDLDELGSLTG  865
             DLKPVNIFLDS+D +KIGDFGLATT+ L+   H    D     + + TS    E G+ TG
Sbjct  744   DLKPVNIFLDSHDQIKIGDFGLATTSFLALQAH----DAAPAPVNQITS---AEDGTGTG  796

Query  866   QVGTALYVAPELSSKAAKAIYNQKVDIYSLGIILFEMCYKPLTTGMERVKVLLNLRSKEI  925
             +VGT LYVAPEL+  A+K++YNQKVD+Y+LGIILFEMC  P  T MER + ++ LR+  I
Sbjct  797   KVGTTLYVAPELTGNASKSVYNQKVDMYTLGIILFEMCQPPFDTSMERAQTIMALRNVSI  856

Query  926   VLPPE-LTEADTPHQVHLLRWLLNHDPSQRPTSQELLASEYLPPPQLEEAELQEMVRHTL  984
              +P   L +      V +L+WLLNHDP+QRPT++ELL S+ +PP QLE  ELQEM+RH L
Sbjct  857   NIPDAMLKDPKYEKTVKMLQWLLNHDPAQRPTAEELLISDLVPPAQLEANELQEMLRHAL  916

Query  985   SNSQSKAYKYLVACCFAQEVTAAEDITYDMNLPSRGIAN-----------SLVPKTQFLH  1033
             +N QSKAYK LVA C  QE     + TY +   SR + +           SL P  +F  
Sbjct  917   ANPQSKAYKNLVARCLQQESDEVLEHTYHLG-SSRAMKSWNSAIIIDDIVSLNPVIEF--  973

Query  1034  ENVKAKVVEVFRRHGGVYLATPLLMPKSGK--FYNLTDSCAKLMTRTGSIVSIPHDLRAP  1091
               VKAKVV +FR+HG + + +PLL P S +    N   +   LMT +G +V +P DLR  
Sbjct  974   --VKAKVVNLFRKHGAIEVDSPLLSPLSARNSTANANANAVHLMTHSGCVVVLPCDLRTQ  1031

Query  1092  FARYVAWNNILHIRRYAIERVYREKKVHGFHPRELYECAFDIISPTANNLMAEAELITIV  1151
             FAR+V  N++  IRRY ++RVYRE++V  FHP++ Y+C+FDII+PT  + + +AEL+++ 
Sbjct  1032  FARHVTMNSVNLIRRYCVDRVYREERVFNFHPKQSYDCSFDIIAPTTGSHLVDAELLSLA  1091

Query  1152  WEIVNEIPLLRERNFTVRLNHTSLLQAVLMYCGIEPEKYQDIYSILCDARDGKFSKFQVQ  1211
             +EI +E+P LRE+N  +R+NHT+LL+A+L++C +   +Y  ++    D  + + S+FQ  
Sbjct  1092  FEITSELPRLREKNLAIRMNHTNLLRAILIFCNVPKAQYGALFEGTMDFIESRISRFQFH  1151

Query  1212  THLISLCLTDQA-----METLF-NLFETESSVAKIASVLRTITRRKGDAAALAKEGLREM  1265
             + +  +    +      M+ L  N   T S      S L+++ R KG+AA+LA+  LRE+
Sbjct  1152  SSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDDSALKSLMRGKGEAASLARGALREL  1211

Query  1266  EIVIANAEALGVKWPIVIVPLLVHNVQQHS--GVIYQITCELKRRRRRGGQDVIAAGGRY  1323
             E V+  A +LGVK PI I   L  +  + S  G+++Q+T +LK   R G   V+A G RY
Sbjct  1212  ETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMTADLK-PNRSGHPSVLAIGERY  1270

Query  1324  DKMIMSFRKVLER--TGMASKEVKQYGVGISVSLDKLVCAVAELSDDHCGENKFGIDVAV  1381
             D M+  F+K  ++    M ++ V   G G++ SLDKLV AV       C      IDV +
Sbjct  1271  DSMLHEFQKQAQKFNPAMPARGVLS-GAGLTFSLDKLVAAVGVEYAKDCR----AIDVGI  1325

Query  1382  CCVDGLPKREKEMADVLRELWSLGLSVTSLDLCT--VEEIREYCQENLINHIVMLKSGEK  1439
             C     P   K++  ++R LWS+G+    ++  +   +E ++  +   + H++++   E 
Sbjct  1326  CVCGTRPPL-KDVTYIMRLLWSVGIRCGIVEAASELGDEAQDLARLGAL-HVILV--AEN  1381

Query  1440  GSLRVQSWERDRFQERKISIQEIGDYLQRQTENP------------LPILNRSESKVSA-  1486
             GSLRV+S+ER+RFQER ++  E+ +++Q+   +             L  L   +++ S  
Sbjct  1382  GSLRVRSFERERFQERHLTRTELVEFIQKMLRSDGLNGTTVDNFSQLSALGSGDNRSSGG  1441

Query  1487  -------NNDAPASSNNPVN------VNINFVFSERDKLSASGKRSFKNTMLAQMTSCLQ  1533
                    N  + ++SN  +        N+   F   DK +A+ KR  +N +  QM+S L 
Sbjct  1442  KERERGENGLSTSASNATIKNNYSQLPNLQVTFLTHDKPTANYKRRLENQVAQQMSSTLS  1501

Query  1534  RISYKVPIEVFAFFLEMTVLRTMVSLL---EIDEEELNFQKSIQLIIEKHPRHKKYIEKI  1590
             +   K    V    L   V+  +V  +   EI + E   +  I  +IE+  ++K+YI +I
Sbjct  1502  QFLKKETFVVLVVELPPAVVNAIVGAINPREIRKRET--EPEINYVIERFSKYKRYISEI  1559

Query  1591  CEELREVRNEKQRPVLVLYSLTESRYKILM  1620
              EE+ +  ++ + P++ LYS+++S Y++++
Sbjct  1560  NEEVVDYLSDAKTPIVALYSISDSYYRVII  1589


>O01712_DROME unnamed protein product
Length=1589

 Score = 975 bits (2521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/1710 (37%), Positives = 958/1710 (56%), Gaps = 222/1710 (13%)

Query  5     ESCRDRQENELEVLKSIFGDELYDLRKNKQRKKWQPLDVSVTLMPQQGMSGPAQVYAQID  64
             ES R+RQ  ELEV+KSIFG ++ DLR       W+P D+ + L P +  S   + Y    
Sbjct  8     ESFRERQAQELEVIKSIFGCDVEDLRPQANPSLWKPTDIRIQLTPLRDSSNGLETYVCTK  67

Query  65    LHVICGEKYPEEVPRMQLQNSRGLSDQQIAMLFSELEHLAERLRGEVMIFELAQHIQKFL  124
             LHV C  KYP+  P++ L+ S+G+SDQ +  L ++L+  ++ LRGEVMI+ELAQ +Q FL
Sbjct  68    LHVTCPSKYPKLPPKISLEESKGMSDQLLEALRNQLQAQSQELRGEVMIYELAQTVQAFL  127

Query  125   HKHNKPGYSSFYEEMVSRRQERMQYEMQEKQL-KEDKERQVLQDEIQKRQEALKAEMRNR  183
              +HNKP   SFY++M+  +Q+R Q E+Q+ Q  +E  +RQ L DE+++R+E  K E + R
Sbjct  128   LEHNKPPKGSFYDQMLQDKQKRDQ-ELQDIQRQRESLQRQTLIDEVERRKEMFKTEAKRR  186

Query  184   RETARLSIESDTMSQSIP-----------SSPHERVRTYSRRRCMSTSESSEGPLCEHRG  232
              E  R      +MS+S P           SSP+ R   Y  + C+           +HR 
Sbjct  187   GEPRR------SMSESNPRHPSSSESSENSSPYYRGHIYPSK-CL-----------DHRN  228

Query  233   TKLLHFDNSRGERQVHRGKCLGHSTKGSVVYAGVDMTTGELLAVTEWTLK-------CGS  285
             T+ L+F   +  RQ+ RG C+GHS +G + Y G+DM  G+LL +TEW +K       C  
Sbjct  229   TETLYF--HKMGRQIQRGCCVGHSQRGCIAYTGIDMHCGQLLYITEWNIKYSQLEQPCIG  286

Query  286   TGEARVTSEASNL-QHSMKQI-ASIEQELNHLHKLHHPNLVHYLNMKYIQDKDNILIYIL  343
              G+   +SE+  +  H + ++ ASIE++++ L +L H NLV Y  +  I+ K+ +L+Y++
Sbjct  287   GGKCHWSSESKCMGSHRVDEVMASIEKQVSSLSQLQHKNLVSYECVLCIKRKEGLLVYLV  346

Query  344   QEFVVGTTCSFYLMENIPVDIDMLRHLATGILSALQYLHENNVVHKDLRDTSVHIDRTGA  403
             Q+F++GT+  F +  ++   +D  R +A G+L AL +LH   V H  L DT+V +D TG 
Sbjct  347   QDFLLGTSV-FSISSSLGWCMDGARMVARGVLDALVFLHNKGVSHSHLLDTTVFMDNTGN  405

Query  404   IRLSDYSLDKRLSDIYRASCLAKAEHDFPTIQARSGKKADIYRFGVLLLSLFRGSIVSEK  463
             +R+SD+SL   L ++   +  + +  D P +             G L+ SL   +     
Sbjct  406   VRVSDFSLVPNLLELLSGAGQSSSCGDLPAL-------------GALVESLMPTNSY---  449

Query  464   EIDWSGAPQPDLRDFLSKCLTGDERVRWSAEQLQQHGFIRVPLERGISPPRLDRNKEQDS  523
                       ++RDF+ KC    +R   SA +L +H F+R  ++ G     +   ++Q  
Sbjct  450   ----------EMRDFVDKC--NSDRT-LSASELLEHPFLRFYVDNG-QQQVMPLPQQQHP  495

Query  524   SEPEEPASDIHFYLPALG-GQSRIQNEFEVLKWLGKGAFGDVLKVRNKLDGGVYAIKRIE  582
             +  +   S + + +P L   QSR++ EFEVL +LGKGAFGDVLKVRN LD   YAIKRI 
Sbjct  496   NTVQRTGSAMPYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYAIKRIP  555

Query  583   LNPKNKQLNRKITREVKLLSRLNHENVVRYYNSWIESATLDDPTRHSRLTPAATPSTKTT  642
             L  +++QL +K+TREV+LLSRLNHENVVRY+NSWIES    D     +L           
Sbjct  556   LPARSRQLYKKMTREVELLSRLNHENVVRYFNSWIESVDDADAAEMDKLLGG--------  607

Query  643   NFHHILKETTLSEDIERLAPAVHDVEWNISYESRASAVMSSDSEEDNSVSSSDSDS----  698
                                      EW             S S++D SV  + S      
Sbjct  608   -------------------------EW-------------SQSQQDLSVKPAKSPQLGPT  629

Query  699   -----------DEDWAFLMRTTVDS-SDSIEF-EKDGTSQMSDSVQGSQENLSKGDTSTD  745
                           W   +    DS SD IEF + +G   + D  +  QE+ ++G T++ 
Sbjct  630   LEEDEDEEDSSSSMWNGYIPNMEDSDSDGIEFVDSNGKVAVYDDEE--QEDSTRGKTNSP  687

Query  746   VSTMGKEIQFMYIQMEFCEKSTLRTAIDNGLYEDEERVWRLFREMVEGLAHIHQQGMIHR  805
                M    Q MYIQMEFCEK TLRTAID+ L+ D +R+WRLFRE+ EGLAHIHQQG+IHR
Sbjct  688   RPLM----QVMYIQMEFCEKCTLRTAIDDNLFNDTDRLWRLFREIAEGLAHIHQQGIIHR  743

Query  806   DLKPVNIFLDSNDHVKIGDFGLATTNILSTLVHTMDTDRELQLIEKGTSFDLDELGSLTG  865
             DLKPVNIFLDS+D +KIGDFGLATT+ L+   H    D     + + TS    E G+ TG
Sbjct  744   DLKPVNIFLDSHDQIKIGDFGLATTSFLALQAH----DAAPAPVNQITS---AEDGTGTG  796

Query  866   QVGTALYVAPELSSKAAKAIYNQKVDIYSLGIILFEMCYKPLTTGMERVKVLLNLRSKEI  925
             +VGT LYVAPEL+  A+K++YNQKVD+Y+LGIILFEMC  P  T MER + ++ LR+  I
Sbjct  797   KVGTTLYVAPELTGNASKSVYNQKVDMYTLGIILFEMCQPPFDTSMERAQTIMALRNVSI  856

Query  926   VLPPE-LTEADTPHQVHLLRWLLNHDPSQRPTSQELLASEYLPPPQLEEAELQEMVRHTL  984
              +P   L +      V +L+WLLNHDP+QRPT++ELL S+ +PP QLE  ELQEM+RH L
Sbjct  857   NIPDAMLKDPKYEKTVKMLQWLLNHDPAQRPTAEELLISDLVPPAQLEANELQEMLRHAL  916

Query  985   SNSQSKAYKYLVACCFAQEVTAAEDITYDMNLPSRGIAN-----------SLVPKTQFLH  1033
             +N QSKAYK LVA C  QE     + TY +   SR + +           SL P  +F  
Sbjct  917   ANPQSKAYKNLVARCLQQESDEVLEHTYHLG-SSRAMKSWNSAIIIDDIVSLNPVIEF--  973

Query  1034  ENVKAKVVEVFRRHGGVYLATPLLMPKSGK--FYNLTDSCAKLMTRTGSIVSIPHDLRAP  1091
               VKAKVV +FR+HG + + +PLL P S +    N   +   LMT +G +V +P DLR  
Sbjct  974   --VKAKVVNLFRKHGAIEVDSPLLSPLSARNSTANANANAVHLMTHSGCVVVLPCDLRTQ  1031

Query  1092  FARYVAWNNILHIRRYAIERVYREKKVHGFHPRELYECAFDIISPTANNLMAEAELITIV  1151
             FAR+V  N++  IRRY ++RVYRE++V  FHP++ Y+C+FDII+PT  + + +AEL+++ 
Sbjct  1032  FARHVTMNSVNLIRRYCVDRVYREERVFNFHPKQSYDCSFDIIAPTTGSHLVDAELLSLA  1091

Query  1152  WEIVNEIPLLRERNFTVRLNHTSLLQAVLMYCGIEPEKYQDIYSILCDARDGKFSKFQVQ  1211
             +EI +E+P LRE+N  +R+NHT+LL+A+L++C +   +Y  ++    D  + + S+FQ  
Sbjct  1092  FEITSELPRLREKNLAIRMNHTNLLRAILIFCNVPKAQYGALFEGTMDFIESRISRFQFH  1151

Query  1212  THLISLCLTDQA-----METLF-NLFETESSVAKIASVLRTITRRKGDAAALAKEGLREM  1265
             + +  +    +      M+ L  N   T S      S L+++ R KG+AA+LA+  LRE+
Sbjct  1152  SSITGIMEKSRTSAQTLMDMLLANFLLTGSRSTVDDSALKSLMRGKGEAASLARGALREL  1211

Query  1266  EIVIANAEALGVKWPIVIVPLLVHNVQQHS--GVIYQITCELKRRRRRGGQDVIAAGGRY  1323
             E V+  A +LGVK PI I   L  +  + S  G+++Q+T +LK   R G   V+A G RY
Sbjct  1212  ETVVGLAYSLGVKCPIHIWAGLPISFDRASNGGIVWQMTADLK-PNRSGHPSVLAIGERY  1270

Query  1324  DKMIMSFRKVLER--TGMASKEVKQYGVGISVSLDKLVCAVAELSDDHCGENKFGIDVAV  1381
             D M+  F+K  ++    M ++ V   G G++ SLDKLV AV       C      IDV +
Sbjct  1271  DSMLHEFQKQAQKFNPAMPARGVLS-GAGLTFSLDKLVAAVGVEYAKDCR----AIDVGI  1325

Query  1382  CCVDGLPKREKEMADVLRELWSLGLSVTSLDLCT--VEEIREYCQENLINHIVMLKSGEK  1439
             C     P   K++  ++R LWS+G+    ++  +   +E ++  +   + H++++   E 
Sbjct  1326  CVCGTRPPL-KDVTYIMRLLWSVGIRCGIVEAASELGDEAQDLARLGAL-HVILV--AEN  1381

Query  1440  GSLRVQSWERDRFQERKISIQEIGDYLQRQTENP------------LPILNRSESKVSA-  1486
             GSLRV+S+ER+RFQER ++  E+ +++Q+   +             L  L   +++ S  
Sbjct  1382  GSLRVRSFERERFQERHLTRTELVEFIQKMLRSDGLNGTTVDNFSQLSALGSGDNRSSGG  1441

Query  1487  -------NNDAPASSNNPVN------VNINFVFSERDKLSASGKRSFKNTMLAQMTSCLQ  1533
                    N  + ++SN  +        N+   F   DK +A+ KR  +N +  QM+S L 
Sbjct  1442  KERERGENGLSTSASNATIKNNYSQLPNLQVTFLTHDKPTANYKRRLENQVAQQMSSTLS  1501

Query  1534  RISYKVPIEVFAFFLEMTVLRTMVSLL---EIDEEELNFQKSIQLIIEKHPRHKKYIEKI  1590
             +   K    V    L   V+  +V  +   EI + E   +  I  +IE+  ++K+YI +I
Sbjct  1502  QFLKKETFVVLVVELPPAVVNAIVGAINPREIRKRET--EPEINYVIERFSKYKRYISEI  1559

Query  1591  CEELREVRNEKQRPVLVLYSLTESRYKILM  1620
              EE+ +  ++ + P++ LYS+++S Y++++
Sbjct  1560  NEEVVDYLSDAKTPIVALYSISDSYYRVII  1589



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584814.1 bromodomain adjacent to zinc finger domain protein 1A
[Cephus cinctus]

Length=1512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5BI37_DROME  unnamed protein product                                 463     9e-141
Q9Y0W1_DROME  unnamed protein product                                 465     9e-139
Q9V9T4_DROME  unnamed protein product                                 464     1e-138


>Q5BI37_DROME unnamed protein product
Length=1151

 Score = 463 bits (1191),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 349/1189 (29%), Positives = 568/1189 (48%), Gaps = 146/1189 (12%)

Query  1     MPLLRKKPF---QRLHVSSDFKDDDEVFHCEVTNEIFKDYNEYCERIILCNSLVWSCSIT  57
             MP+ +++ F   Q+   +  F D+D+VF C +T  IF+DY  Y   +++ NS VW C  T
Sbjct  1     MPICKREGFDLNQKEGKNETFHDNDQVFCCYITKRIFRDYEHYFRHVMVINSTVWQCEAT  60

Query  58    GRSNLTYEEALQCEENAKKSLKDFPMELRIPILYLATKTSRSSFNEMMEDVYQFARDRYF  117
             G+ NLTYEEA++ E  A+K ++ F   LR P+L +     +S+ N +   V +F R RYF
Sbjct  61    GKENLTYEEAVKSERAARKKMEQFKQSLRAPVLLVVEHAQQSAVNTLNMIVAKFLRKRYF  120

Query  118   VGEMVEASFTEDSWCECYVLQVIEPTEQEIKTFFKENSRSPQERQYHPPARLFRYEVEQL  177
             +GE V     +++            T   +     +N   P    Y     L    V +L
Sbjct  121   IGEEVSVQAKKNA------------TYTVLGVKLDKNMPEPLNGIYEDTDNL----VYRL  164

Query  178   DCGESGVSQLMIVEAAQIRRRKQHFSRERNRIFLRQLCEQNTNGIWVVKENVLQKYSLS-  236
                +   S  + +   Q+RR +  F+ E   +F++    +  +G+   K    ++Y    
Sbjct  165   RPNKGDPSAELDLPFRQLRRSRMEFNLENLSMFIKSNVSR-VDGLLRPKPEAYKQYVTDP  223

Query  237   KTRFDTIFAGPMPNFTP-RIKKPVKQKQESIEKFLTGNMAKHRAFEKPDPLRKVNDTGGV  295
                F TIF G MP ++P +IKKP  +KQ ++ K++    A                    
Sbjct  224   GVNFSTIFIGKMPRYSPAKIKKPDGKKQSTLNKYIVAGEATAAK----------------  267

Query  296   IKKFRKPSKLNGKFKEELKAKALERKAKRQEEKLEERERKREQRAKSAAFASYIRG----  351
                    SK   K   +  A+ LER  + +E KL E E+++ +  K A     +      
Sbjct  268   -------SKAKAKSDAKSLAEELERVKREKEAKLIELEKQKAE--KKAQLIERVENECNL  318

Query  352   WNKPREDLECEDLCPLLEPTPVKCNLPNEKFGDFAMILEFLQFFHEELDVGTYFPNGLNL  411
               +  +DLE  D   L     +   LP    GD  M+ EF+  +   L     F   L+ 
Sbjct  319   LLQKTDDLERTDQKVLPRYRQIVTLLPEHLLGDAFMMREFMHTYTGLLSGIEVFRQNLSF  378

Query  412   DLLEKAMLEKEVSGPWSDLLQLLLANIFIYQAEEEDEIHADGANLTDDTSIDQGVSSMAE  471
               + +A+  +E++GP SD+L +LL  +F  Q EEE+E      +    T   +   SMA+
Sbjct  379   YEMTRALTAREIAGPLSDILLVLLGTVFDLQKEEEEECAVTYLDRAAQTQ--EPYWSMAQ  436

Query  472   AVKLATIASTWCQTHQGCQLSKLTLDHATLSEILRQHLLSSGGRISELASKWRYSQRGGY  531
             A K    +  + + H   ++++L LD  TLSE+LR HLL SG  ++E A +WR   R GY
Sbjct  437   AAK----SHLYAKRHFSFKVNELPLDALTLSEVLRLHLLGSGAFVNEKAERWRVMYRNGY  492

Query  532   TNHDDPALFLRINEPRILRALGHRSVCEFDMDDRLKVVICLINQLLTFASIRDVIEERHE  591
             ++ +DP L LR+    ILR L + SV +    D + ++ CL++Q++T++   ++IEER E
Sbjct  493   SSKEDPGLELRLEHSHILRILKNHSVYQLKFKDIMLLIRCLMSQIMTYSGTINLIEERME  552

Query  592   KVHQVKRELKSFLIAEQKMKKEERDRMKELRKEGKLDSDEPKPKK-----------VTRN  640
             +  + +++L++ ++ E K         K+L +   L+ +  +P+K           +   
Sbjct  553   QTAKARQDLRALVVGENKRLAAVEINRKKLTQMHHLEVNGVEPEKREALVEKLKKSIAEL  612

Query  641   NCEEEKRKEEYESKLKELQEATNNDQMMLYLGSDRAYRRYYRFLSIPGLFVEDDERWGGN  700
             + + +++  ++E ++ +L     N   ++YLG DR YR+YY   S+PG+FVE        
Sbjct  613   HAQSDQQHRKHELQMLKLHSQLFN--FLVYLGMDRCYRKYYVLESMPGIFVEHSPDSLDT  670

Query  701   CLPGGTPYNPELQDGESAY---------AYLMNKFEDE-----------FCDKENSVKKN  740
             CL        +++  + +           YL+  + D+             +KEN   + 
Sbjct  671   CLEQPITNKSQIEIRQQSALPKNRKDLRVYLLKLYGDDEKKTKKKAKHSLENKENQEHRL  730

Query  741   KKSPKKVTFADKNGVKSGRKDANVKEETKLELNEIRKNLRACTGDK-SCPVHCKKSGPT-  798
               S      A+   V+S   +A    E           L  C+GDK SC VH  ++G   
Sbjct  731   NGS------AEPMDVESDSPEAPTHFE-----------LLMCSGDKRSCIVHDSRNGQRQ  773

Query  799   -WNFYGRVEDVEAVINALSTRGIRESELRNNLIHEKASLISVIEE----CSRQKL---NP  850
              W +  + E+++ +I AL+  G+RE EL    + E + L S+IE+    C    L   N 
Sbjct  774   RWAYIYKAEEIDELIKALNPNGLREYEL----LQELSVLRSLIEQHAKTCPVDLLSLENE  829

Query  851   EVFKEPIKEFTSKTNKKNKYENANWGYSPDMPTDSVMELSLRDFILDLEDKIKVGCLGSL  910
              + K+ +    S+TN+K  Y  AN+G       + VM L L D I+  E+ I  G LG L
Sbjct  830   TMRKKFMAAMESETNRK--YGEANFGLPNGTDLNEVMRLHLVDRIIQFENDIYTGDLGRL  887

Query  911   KVISRETWRNAISKGSYDKQCDKLMYGANEIEVDVAPNVIVDKIKSETKHSRPGTPDSEV  970
             KV   E WR+ +  G+YD QC KL +G      D A +   D    ET     G   + +
Sbjct  888   KVKDMEKWRSDLLGGNYDAQC-KLQWGPGGKLEDEAGS---DNESHETHEEDDG---ALL  940

Query  971   GSVTMKVYRDPGKYLGPPGENEPLPDPVQQ-----------TSIRQMACAILQLSRAIEP  1019
             G    K YRDPG YL    + +PLPD   +            ++  MA A+LQ+ +AI  
Sbjct  941   GKYARKPYRDPGMYLAASADTKPLPDSDDEEDQHTNAVSIPIAVHNMASALLQVEQAIGK  1000

Query  1020  KYMKRPLGVDEKDKK-----WSSEEARERWEQSLMASTSWSQLFVHLNTLENSVAWSKSA  1074
             +++K P G+ + D K      + +    +WE SLM STS++Q+F+HLN L + + W +S 
Sbjct  1001  RFLKEPYGMKKWDPKQEALKLACDSRLHQWEVSLMESTSFAQVFLHLNILHDCIQWRRST  1060

Query  1075  LNAQCRICRKRRDAENMLLCDGCNKGHHLYCLKPKLNAIPDGDWFCTTC  1123
               + C++CR+  D E MLLCD CN G H++CLKPKL ++P G+W+C  C
Sbjct  1061  NKSLCKVCRRGSDPEKMLLCDECNAGTHMFCLKPKLRSVPPGNWYCNDC  1109


 Score = 37.7 bits (86),  Expect = 0.083, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  1188  SSSKLMAPCSSRCGSGKREVICEGCPGRYHLECVVPPISRVPRGKWFCPMC  1238
             S++K +     R    ++ ++C+ C    H+ C+ P +  VP G W+C  C
Sbjct  1059  STNKSLCKVCRRGSDPEKMLLCDECNAGTHMFCLKPKLRSVPPGNWYCNDC  1109


>Q9Y0W1_DROME unnamed protein product
Length=1476

 Score = 465 bits (1196),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 371/1264 (29%), Positives = 604/1264 (48%), Gaps = 154/1264 (12%)

Query  1     MPLLRKKPF---QRLHVSSDFKDDDEVFHCEVTNEIFKDYNEYCERIILCNSLVWSCSIT  57
             MP+ +++ F   Q+   +  F D+D+VF C +T  IF+DY  Y   +++ NS VW C  T
Sbjct  1     MPICKREGFDLNQKEGKNETFHDNDQVFCCYITKRIFRDYEHYFRHVMVINSTVWQCEAT  60

Query  58    GRSNLTYEEALQCEENAKKSLKDFPMELRIPILYLATKTSRSSFNEMMEDVYQFARDRYF  117
             G+ NLTYEEA++ E  A+K ++ F   LR P+L +     +S+ N +   V +F R RYF
Sbjct  61    GKENLTYEEAVKSERAARKKMEQFKQSLRAPVLLVVEHAQQSAVNTLNMIVAKFLRKRYF  120

Query  118   VGEMVEASFTEDSWCECYVLQVIEPTEQEIKTFFKENSRSPQERQYHPPARLFRYEVEQL  177
             +GE V     +++            T   +     +N   P    Y     L    V +L
Sbjct  121   IGEEVSVQAKKNA------------TYTVLGVKLDKNMPEPLNGIYEDTDNL----VYRL  164

Query  178   DCGESGVSQLMIVEAAQIRRRKQHFSRERNRIFLRQLCEQNTNGIWVVKENVLQKYSLS-  236
                +   S  + +   Q+RR +  F+ E   +F++    +  +G+   K    ++Y  + 
Sbjct  165   RPNKGDPSAELDLPFRQLRRSRMEFNLENLSMFIKSNVSR-VDGLLRPKPEAYKQYVTNP  223

Query  237   KTRFDTIFAGPMPNFTP-RIKKPVKQKQESIEKFLTGNMAKHRAFEKPDPLRKVNDTGGV  295
                F TIF G MP ++P +IKKP  +KQ ++ K++    A                    
Sbjct  224   GVNFSTIFIGKMPRYSPAKIKKPDGKKQSTLNKYIVAGEATAAK----------------  267

Query  296   IKKFRKPSKLNGKFKEELKAKALERKAKRQEEKLEERERKREQRAKSAAFASYIRG----  351
                    SK   K   +  A+ LER  + +E KL E E+++ +  K A     +      
Sbjct  268   -------SKAKAKSDAKSLAEELERVKREKEAKLIELEKQKAE--KKAQLIERVENECNL  318

Query  352   WNKPREDLECEDLCPLLEPTPVKCNLPNEKFGDFAMILEFLQFFHEELDVGTYFPNGLNL  411
               +  +DLE  D   L     +   LP    GD  M+ EF+  +   L     F   L+ 
Sbjct  319   LLQKTDDLERTDQKVLPRYRQIVTLLPEHLLGDAFMMREFMHTYTGLLSGIEVFRQNLSF  378

Query  412   DLLEKAMLEKEVSGPWSDLLQLLLANIFIYQAEEEDEIHADGANLTDDTSIDQGVSSMAE  471
               + +A+  +E++GP SD+L +LL  +F  Q EEE+E      +    T   +   SMA+
Sbjct  379   YEMTRALTAREIAGPLSDILLVLLGTVFDLQKEEEEECAVTYLDRAAQTQ--EPYWSMAQ  436

Query  472   AVKLATIASTWCQTHQGCQLSKLTLDHATLSEILRQHLLSSGGRISELASKWRYSQRGGY  531
             A K    +  + + H   ++++L LD  TLSE+LR HLL SG  ++E A +WR   R GY
Sbjct  437   AAK----SHLYAKRHFSFKVNELPLDALTLSEVLRLHLLGSGAFVNEKAERWRVMYRNGY  492

Query  532   TNHDDPALFLRINEPRILRALGHRSVCEFDMDDRLKVVICLINQLLTFASIRDVIEERHE  591
             ++ +DP L LR+    ILR L + SV +    D + ++ CL++Q++T++   ++IEER E
Sbjct  493   SSKEDPGLELRLEHSHILRILKNHSVYQLKFKDIMLLIRCLMSQIMTYSGTINLIEERME  552

Query  592   KVHQVKRELKSFLIAEQKMKKEERDRMKELRKEGKLDSDEPKPKK-----------VTRN  640
             +  + +++L++ ++ E K         K+L +   L+ +  +P+K           +   
Sbjct  553   QTAKARQDLRALVVGENKRLAAVEINRKKLTQMHHLEVNGVEPEKREALVEKLKKSIAEL  612

Query  641   NCEEEKRKEEYESKLKELQEATNNDQMMLYLGSDRAYRRYYRFLSIPGLFVEDDERWGGN  700
             + + +++  ++E ++ +L     N   ++YLG DR YR+YY   S+PG+FVE        
Sbjct  613   HAQSDQQHRKHELQMLKLHSQLFN--FLVYLGMDRCYRKYYVLESMPGIFVEHSPDSLDT  670

Query  701   CLPGGTPYNPELQDGESAY---------AYLMNKFEDE-----------FCDKENSVKKN  740
             CL        +++  + +           YL+  + D+             +KEN   + 
Sbjct  671   CLEQPITNKSQIEIRQQSALPKNRKDLRVYLLKLYGDDEKKTKKKAKHSLENKENQEHRL  730

Query  741   KKSPKKVTFADKNGVKSGRKDANVKEETKLELNEIRKNLRACTGDK-SCPVHCKKSGPT-  798
               S      A+   V+S   +A    E           L  C+GDK SC VH  ++G   
Sbjct  731   NGS------AEPMDVESNSPEAPTHFE-----------LLMCSGDKRSCIVHDSRNGQRQ  773

Query  799   -WNFYGRVEDVEAVINALSTRGIRESELRNNLIHEKASLISVIEE----CSRQKL---NP  850
              W +  + E+++ +I AL+  G+RE EL    + E + L S+IE+    C    L   N 
Sbjct  774   RWAYIYKAEEIDELIKALNPNGLREYEL----LQELSVLRSLIEQHAKTCPVDLLSLENE  829

Query  851   EVFKEPIKEFTSKTNKKNKYENANWGYSPDMPTDSVMELSLRDFILDLEDKIKVGCLGSL  910
              + K+ +    S+TN+K  Y  AN+G       + VM L L D I+  E+ I  G LG L
Sbjct  830   TMRKKFMAAMESETNRK--YGEANFGLPNGTDLNEVMRLHLVDRIIQFENDIYTGDLGRL  887

Query  911   KVISRETWRNAISKGSYDKQCDKLMYGANEIEVDVAPNVIVDKIKSETKHSRPGTPDSEV  970
             KV   E WR+ +  G+YD QC KL +G      D A +   D    ET     G   + +
Sbjct  888   KVKDMEKWRSDLLGGNYDAQC-KLQWGPGGKLEDEAGS---DNESHETHEEDDG---ALL  940

Query  971   GSVTMKVYRDPGKYLGPPGENEPLPDP-----------VQQTSIRQMACAILQLSRAIEP  1019
             G    K YRDPG YL    + +PLPD            +   ++  MA A+LQ+ +AI  
Sbjct  941   GKYARKPYRDPGMYLAASADTKPLPDSDDEEDQHTNAVLIPIAVHNMASALLQVEQAIGK  1000

Query  1020  KYMKRPLGVDEKDKK-----WSSEEARERWEQSLMASTSWSQLFVHLNTLENSVAWSKSA  1074
             +++K P G+ + D K      + +    +WE SLM STS++Q+F+HLN L + + W +S 
Sbjct  1001  RFLKEPYGMKKWDPKQEALKLACDSRLHQWEVSLMESTSFAQVFLHLNILHDCIQWRRST  1060

Query  1075  LNAQCRICRKRRDAENMLLCDGCNKGHHLYCLKPKLNAIPDGDWFCTTC--------KPR  1126
               + C++CR+  D E MLLCD CN G H++CLKPKL ++P G+W+C  C           
Sbjct  1061  NKSLCKVCRRGSDPEKMLLCDECNAGTHMFCLKPKLRSVPPGNWYCNDCVKSLGLSHGQN  1120

Query  1127  EATPKEKIKKRKKFEDEPEDEAALTKETRRNRAKRVAESDEEEEEEEEEEEDEEDEGESS  1186
             E   K+  KK++KF  E ED+ A  +E    +   + + D E E E+ +E+ E+DE  +S
Sbjct  1121  EKDKKQATKKKRKFIVEEEDDEATDEEEEEKKDDDMTDEDAEHENEKHDEDVEDDESVTS  1180

Query  1187  ESSS  1190
               SS
Sbjct  1181  TPSS  1184


 Score = 117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 114/235 (49%), Gaps = 22/235 (9%)

Query  1199  RCGSGKREVICEGCPGRYHLECVVPPISRVPRGKWFCPMC-----REKSRTRNVRGRERE  1253
             +C     E+ C  C   +HLECV   + R PR  + C  C     R + R  N+ G + +
Sbjct  1247  KCFYDGGEIKCVQCRLFFHLECV--HLKRPPRTDFVCKTCKPMPQRPRRRHSNMNG-DHD  1303

Query  1254  RDSERLCAAAARSRIHGFAKSLLTTESTDWDDFSTSDEAEPRQTRRATKRAAEVEEEVKE  1313
             RD E   A   R+ +           + + ++ + +        RR+ +R  E       
Sbjct  1304  RDEEEPKAKRPRNSLRLSIDKTARPSNGNNNNNNNNSSVNNNNHRRSGRRTNE-------  1356

Query  1314  DKTTVKGSMATLHELLADITHHRDSWPFLSPVTKEEVPDYHEIIKCPMDFGTIKYKLGNG  1373
                 +  + A L++LL  I  H+ +WPFL PV   EVPDYH+IIK PMD   IK KL  G
Sbjct  1357  ---HMPLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMG  1413

Query  1374  DYKTLQEFYKDCLLVFENCEMYNKENSSVYNYVYRAGMRLLKFFEKRCRELGLNY  1428
              Y+  +E   D  LVF NC++YN E + +Y+    AG +L +F   RCR++ L +
Sbjct  1414  AYQLNEELLSDIQLVFRNCDLYNVEGNEIYD----AGCQLERFVIDRCRDMQLPF  1464


 Score = 37.7 bits (86),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  1188  SSSKLMAPCSSRCGSGKREVICEGCPGRYHLECVVPPISRVPRGKWFCPMC  1238
             S++K +     R    ++ ++C+ C    H+ C+ P +  VP G W+C  C
Sbjct  1059  STNKSLCKVCRRGSDPEKMLLCDECNAGTHMFCLKPKLRSVPPGNWYCNDC  1109


>Q9V9T4_DROME unnamed protein product
Length=1476

 Score = 464 bits (1194),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 371/1264 (29%), Positives = 603/1264 (48%), Gaps = 154/1264 (12%)

Query  1     MPLLRKKPF---QRLHVSSDFKDDDEVFHCEVTNEIFKDYNEYCERIILCNSLVWSCSIT  57
             MP+ +++ F   Q+   +  F D+D+VF C +T  IF+DY  Y   +++ NS VW C  T
Sbjct  1     MPICKREGFDLNQKEGKNETFHDNDQVFCCYITKRIFRDYEHYFRHVMVINSTVWQCEAT  60

Query  58    GRSNLTYEEALQCEENAKKSLKDFPMELRIPILYLATKTSRSSFNEMMEDVYQFARDRYF  117
             G+ NLTYEEA++ E  A+K ++ F   LR P+L +     +S+ N +   V +F R RYF
Sbjct  61    GKENLTYEEAVKSERAARKKMEQFKQSLRAPVLLVVEHAQQSAVNTLNMIVAKFLRKRYF  120

Query  118   VGEMVEASFTEDSWCECYVLQVIEPTEQEIKTFFKENSRSPQERQYHPPARLFRYEVEQL  177
             +GE V     +++            T   +     +N   P    Y     L    V +L
Sbjct  121   IGEEVSVQAKKNA------------TYTVLGVKLDKNMPEPLNGIYEDTDNL----VYRL  164

Query  178   DCGESGVSQLMIVEAAQIRRRKQHFSRERNRIFLRQLCEQNTNGIWVVKENVLQKYSLS-  236
                +   S  + +   Q+RR +  F+ E   +F++    +  +G+   K    ++Y    
Sbjct  165   RPNKGDPSAELDLPFRQLRRSRMEFNLENLSMFIKSNVSR-VDGLLRPKPEAYKQYVTDP  223

Query  237   KTRFDTIFAGPMPNFTP-RIKKPVKQKQESIEKFLTGNMAKHRAFEKPDPLRKVNDTGGV  295
                F TIF G MP ++P +IKKP  +KQ ++ K++    A                    
Sbjct  224   GVNFSTIFIGKMPRYSPAKIKKPDGKKQSTLNKYIVAGEATAAK----------------  267

Query  296   IKKFRKPSKLNGKFKEELKAKALERKAKRQEEKLEERERKREQRAKSAAFASYIRG----  351
                    SK   K   +  A+ LER  + +E KL E E+++ +  K A     +      
Sbjct  268   -------SKAKAKSDAKSLAEELERVKREKEAKLIELEKQKAE--KKAQLIERVENECNL  318

Query  352   WNKPREDLECEDLCPLLEPTPVKCNLPNEKFGDFAMILEFLQFFHEELDVGTYFPNGLNL  411
               +  +DLE  D   L     +   LP    GD  M+ EF+  +   L     F   L+ 
Sbjct  319   LLQKTDDLERTDQKVLPRYRQIVTLLPEHLLGDAFMMREFMHTYTGLLSGIEVFRQNLSF  378

Query  412   DLLEKAMLEKEVSGPWSDLLQLLLANIFIYQAEEEDEIHADGANLTDDTSIDQGVSSMAE  471
               + +A+  +E++GP SD+L +LL  +F  Q EEE+E      +    T   +   SMA+
Sbjct  379   YEMTRALTAREIAGPLSDILLVLLGTVFDLQKEEEEECAVTYLDRAAQTQ--EPYWSMAQ  436

Query  472   AVKLATIASTWCQTHQGCQLSKLTLDHATLSEILRQHLLSSGGRISELASKWRYSQRGGY  531
             A K    +  + + H   ++++L LD  TLSE+LR HLL SG  ++E A +WR   R GY
Sbjct  437   AAK----SHLYAKRHFSFKVNELPLDALTLSEVLRLHLLGSGAFVNEKAERWRVMYRNGY  492

Query  532   TNHDDPALFLRINEPRILRALGHRSVCEFDMDDRLKVVICLINQLLTFASIRDVIEERHE  591
             ++ +DP L LR+    ILR L + SV +    D + ++ CL++Q++T++   ++IEER E
Sbjct  493   SSKEDPGLELRLEHSHILRILKNHSVYQLKFKDIMLLIRCLMSQIMTYSGTINLIEERME  552

Query  592   KVHQVKRELKSFLIAEQKMKKEERDRMKELRKEGKLDSDEPKPKK-----------VTRN  640
             +  + +++L++ ++ E K         K+L +   L+ +  +P+K           +   
Sbjct  553   QTAKARQDLRALVVGENKRLAAVEINRKKLTQMHHLEVNGVEPEKREALVEKLKKSIAEL  612

Query  641   NCEEEKRKEEYESKLKELQEATNNDQMMLYLGSDRAYRRYYRFLSIPGLFVEDDERWGGN  700
             + + +++  ++E ++ +L     N   ++YLG DR YR+YY   S+PG+FVE        
Sbjct  613   HAQSDQQHRKHELQMLKLHSQLFN--FLVYLGMDRCYRKYYVLESMPGIFVEHSPDSLDT  670

Query  701   CLPGGTPYNPELQDGESAY---------AYLMNKFEDE-----------FCDKENSVKKN  740
             CL        +++  + +           YL+  + D+             +KEN   + 
Sbjct  671   CLEQPITNKSQIEIRQQSALPKNRKDLRVYLLKLYGDDEKKTKKKAKHSLENKENQEHRL  730

Query  741   KKSPKKVTFADKNGVKSGRKDANVKEETKLELNEIRKNLRACTGDK-SCPVHCKKSGPT-  798
               S      A+   V+S   +A    E           L  C+GDK SC VH  ++G   
Sbjct  731   NGS------AEPMDVESDSPEAPTHFE-----------LLMCSGDKRSCIVHDSRNGQRQ  773

Query  799   -WNFYGRVEDVEAVINALSTRGIRESELRNNLIHEKASLISVIEE----CSRQKL---NP  850
              W +  + E+++ +I AL+  G+RE EL    + E + L S+IE+    C    L   N 
Sbjct  774   RWAYIYKAEEIDELIKALNPNGLREYEL----LQELSVLRSLIEQHAKTCPVDLLSLENE  829

Query  851   EVFKEPIKEFTSKTNKKNKYENANWGYSPDMPTDSVMELSLRDFILDLEDKIKVGCLGSL  910
              + K+ +    S+TN+K  Y  AN+G       + VM L L D I+  E+ I  G LG L
Sbjct  830   TMRKKFMAAMESETNRK--YGEANFGLPNGTDLNEVMRLHLVDRIIQFENDIYTGDLGRL  887

Query  911   KVISRETWRNAISKGSYDKQCDKLMYGANEIEVDVAPNVIVDKIKSETKHSRPGTPDSEV  970
             KV   E WR+ +  G+YD QC KL +G      D A +   D    ET     G   + +
Sbjct  888   KVKDMEKWRSDLLGGNYDAQC-KLQWGPGGKLEDEAGS---DNESHETHEEDDG---ALL  940

Query  971   GSVTMKVYRDPGKYLGPPGENEPLPDPVQQ-----------TSIRQMACAILQLSRAIEP  1019
             G    K YRDPG YL    + +PLPD   +            ++  MA A+LQ+ +AI  
Sbjct  941   GKYARKPYRDPGMYLAASADTKPLPDSDDEEDQHTNAVSIPIAVHNMASALLQVEQAIGK  1000

Query  1020  KYMKRPLGVDEKDKK-----WSSEEARERWEQSLMASTSWSQLFVHLNTLENSVAWSKSA  1074
             +++K P G+ + D K      + +    +WE SLM STS++Q+F+HLN L + + W +S 
Sbjct  1001  RFLKEPYGMKKWDPKQEALKLACDSRLHQWEVSLMESTSFAQVFLHLNILHDCIQWRRST  1060

Query  1075  LNAQCRICRKRRDAENMLLCDGCNKGHHLYCLKPKLNAIPDGDWFCTTC--------KPR  1126
               + C++CR+  D E MLLCD CN G H++CLKPKL ++P G+W+C  C           
Sbjct  1061  NKSLCKVCRRGSDPEKMLLCDECNAGTHMFCLKPKLRSVPPGNWYCNDCVKSLGLSNGQN  1120

Query  1127  EATPKEKIKKRKKFEDEPEDEAALTKETRRNRAKRVAESDEEEEEEEEEEEDEEDEGESS  1186
             E   K+  KK++KF  E ED+ A  +E    +   + + D E E E+ +E+ E+DE  +S
Sbjct  1121  EKDKKQATKKKRKFIVEEEDDEATDEEEEEKKDDDMTDEDAEHENEKHDEDVEDDESVTS  1180

Query  1187  ESSS  1190
               SS
Sbjct  1181  TPSS  1184


 Score = 117 bits (294),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/235 (33%), Positives = 113/235 (48%), Gaps = 22/235 (9%)

Query  1199  RCGSGKREVICEGCPGRYHLECVVPPISRVPRGKWFCPMC-----REKSRTRNVRGRERE  1253
             +C     E+ C  C   +HLECV   + R PR  + C  C     R + R  N+ G + +
Sbjct  1247  KCFYDGGEIKCVQCRLFFHLECV--HLKRPPRTDFVCKTCKPMPQRPRRRHSNMNG-DHD  1303

Query  1254  RDSERLCAAAARSRIHGFAKSLLTTESTDWDDFSTSDEAEPRQTRRATKRAAEVEEEVKE  1313
             RD E   A   R+ +           + + ++ + +        RR+ +R  E       
Sbjct  1304  RDEEEPKAKRPRNSLRLSIDKTARPSNGNNNNNNNNSSVNNNNHRRSGRRTNE-------  1356

Query  1314  DKTTVKGSMATLHELLADITHHRDSWPFLSPVTKEEVPDYHEIIKCPMDFGTIKYKLGNG  1373
                 +  + A L++LL  I  H+ +WPFL PV   EVPDYH+IIK PMD   IK KL  G
Sbjct  1357  ---HMPLNSAALYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMG  1413

Query  1374  DYKTLQEFYKDCLLVFENCEMYNKENSSVYNYVYRAGMRLLKFFEKRCRELGLNY  1428
              Y+  +E   D  LVF NC++YN E     N +Y AG +L +F   RCR++ L +
Sbjct  1414  AYQLNEELLSDIQLVFRNCDLYNVEG----NEIYDAGCQLERFVIDRCRDMQLPF  1464


 Score = 37.7 bits (86),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  1188  SSSKLMAPCSSRCGSGKREVICEGCPGRYHLECVVPPISRVPRGKWFCPMC  1238
             S++K +     R    ++ ++C+ C    H+ C+ P +  VP G W+C  C
Sbjct  1059  STNKSLCKVCRRGSDPEKMLLCDECNAGTHMFCLKPKLRSVPPGNWYCNDC  1109



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584817.1 uncharacterized protein LOC107262789 [Cephus cinctus]

Length=1203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CPR1_DROME  unnamed protein product                                   427     6e-136
CYSP1_DICDI  unnamed protein product                                  278     2e-84 
Q54F16_DICDI  unnamed protein product                                 246     8e-73 


>CPR1_DROME unnamed protein product
Length=614

 Score = 427 bits (1098),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 240/590 (41%), Positives = 337/590 (57%), Gaps = 67/590 (11%)

Query  652   VNAISVSDPEVLKYAS---MGLETFSANFEGPNEPILVEIQEASVQVVAGNLYKIKVKLG  708
             +  + V +P   +Y S   +G++  +  F  P     V I +A  ++ AG  Y+I +   
Sbjct  54    ITLVHVLNPGEREYLSPNLIGVQNIAMTFL-PLSMNFVNIIDAFREITAGVRYEILLN--  110

Query  709   TSNCPKGTKNNCALKPDSETKICLIKVWSQPWL-----DEGSPDVKVNCDQ---------  754
                      +  A++P     +C + +  +PWL     D+    V  NC           
Sbjct  111   -------ALDTKAIQPAEADIVCRLVILEKPWLRTQWGDKHRELVTSNCTDPAVNSVAGD  163

Query  755   -------------TRKKREIPGGVNSISVSDPEVVKYA-SMGLQKFSANSEGPNEPILVE  800
                           R +R     +      D E  K      L K +A  EGP+  I V+
Sbjct  164   PAEKARLLNEKYVHRSRRSANDILGRHKPYDEEAAKAQLQKSLDKLTA-GEGPHYKI-VK  221

Query  801   IQEASVQVVAGNLYKIKVKLGTSNCPKGTKNNCALKPDSETKICLIKVWSQPWLDKGSPD  860
             +  AS QV +G L +I   L              +    E   C++ +W++ W+ K   +
Sbjct  222   VYSASRQVDSGILTRIDADL--------------IDGSEEQHRCIVDIWTKVWVRKDEHE  267

Query  861   VKVNC-NQTPRRKRSLRGVNYSLKMMNQAKYFKYEK---MFQQFTQDFNKTYSSSKERKN  916
             +   C NQ   + R  R V ++ K  ++    +++K   +F +F   F + Y S+ ER+ 
Sbjct  268   ITFKCRNQPVVQARHTRSVEWAEKKTHKKHSHRFDKVDHLFYKFQVRFGRRYVSTAERQM  327

Query  917   RFEIFKKNLNVIEELQKNEQGTAKYGITMFADLSTKEFRKKY-LGLRPDLKLENHIPMPM  975
             R  IF++NL  IEEL  NE G+AKYGIT FAD+++ E++++  L  R + K         
Sbjct  328   RLRIFRQNLKTIEELNANEMGSAKYGITEFADMTSSEYKERTGLWQRDEAKATGG---SA  384

Query  976   AEIPD-NIELPTEFDWRDRHVVTEVKDQGQCGSCWAFSVTGNIESLYAIKYKKLLSLSEQ  1034
             A +P  + ELP EFDWR +  VT+VK+QG CGSCWAFSVTGNIE LYA+K  +L   SEQ
Sbjct  385   AVVPAYHGELPKEFDWRQKDAVTQVKNQGSCGSCWAFSVTGNIEGLYAVKTGELKEFSEQ  444

Query  1035  ELVDCDTLDQGCGGGLPDNAYRAIENLGGLELEKDYPYEAENEKCHFNKSKAKVVITSAV  1094
             EL+DCDT D  C GGL DNAY+AI+++GGLE E +YPY+A+  +CHFN++ + V +   V
Sbjct  445   ELLDCDTTDSACNGGLMDNAYKAIKDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAGFV  504

Query  1095  NI-TSNETLMAKWLVSNGPISIGINANAMQFYMGGVSHPYKFLCSPDNLDHGVLIVGYGI  1153
             ++   NET M +WL++NGPISIGINANAMQFY GGVSHP+K LCS  NLDHGVL+VGYG+
Sbjct  505   DLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCSKKNLDHGVLVVGYGV  564

Query  1154  HTYPLFNKKLPYWTIKNSWGPRWGEQGYYRVYRGDGTCGVNQMASSAIVA  1203
               YP F+K LPYW +KNSWGPRWGEQGYYRVYRGD TCGV++MA+SA++A
Sbjct  565   SDYPNFHKTLPYWIVKNSWGPRWGEQGYYRVYRGDNTCGVSEMATSAVLA  614


>CYSP1_DICDI unnamed protein product
Length=343

 Score = 278 bits (712),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 198/326 (61%), Gaps = 25/326 (8%)

Query  894   EKMFQQFTQDFNKTYSSSKERKNRFEIFKKNLNVIEELQK---NEQGTAKYGITMFADLS  950
             +  F +F   FNK YS  +E   RFEIFK NL  IEEL     N +   K+G+  FADLS
Sbjct  26    QSQFLEFQDKFNKKYSH-EEYLERFEIFKSNLGKIEELNLIAINHKADTKFGVNKFADLS  84

Query  951   TKEFRKKYLGLRPDLKLENHIPMPMAEIPDNI---ELPTEFDWRDRHVVTEVKDQGQCGS  1007
             + EF+  YL  +  +  ++   +P+A+  D+     +PT FDWR R  VT VK+QGQCGS
Sbjct  85    SDEFKNYYLNNKEAIFTDD---LPVADYLDDEFINSIPTAFDWRTRGAVTPVKNQGQCGS  141

Query  1008  CWAFSVTGNIESLYAIKYKKLLSLSEQELVDCD----------TLDQGCGGGLPDNAYRA  1057
             CW+FS TGN+E  + I   KL+SLSEQ LVDCD            D+GC GGL  NAY  
Sbjct  142   CWSFSTTGNVEGQHFISQNKLVSLSEQNLVDCDHECMEYEGEQACDEGCNGGLQPNAYNY  201

Query  1058  IENLGGLELEKDYPYEAE-NEKCHFNKSKAKVVITSAVNITSNETLMAKWLVSNGPISIG  1116
             I   GG++ E  YPY AE   +C+FN +     I++   I  NET+MA ++VS GP++I 
Sbjct  202   IIKNGGIQTESSYPYTAETGTQCNFNSANIGAKISNFTMIPKNETVMAGYIVSTGPLAIA  261

Query  1117  INANAMQFYMGGVSHPYKFLCSPDNLDHGVLIVGYGIHTYPLFNKKLPYWTIKNSWGPRW  1176
              +A   QFY+GGV   +   C+P++LDHG+LIVGY      +F K +PYW +KNSWG  W
Sbjct  262   ADAVEWQFYIGGV---FDIPCNPNSLDHGILIVGYSAKN-TIFRKNMPYWIVKNSWGADW  317

Query  1177  GEQGYYRVYRGDGTCGVNQMASSAIV  1202
             GEQGY  + RG  TCGV+   S++I+
Sbjct  318   GEQGYIYLRRGKNTCGVSNFVSTSII  343


>Q54F16_DICDI unnamed protein product
Length=352

 Score = 246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 143/336 (43%), Positives = 188/336 (56%), Gaps = 36/336 (11%)

Query  894   EKMFQQFTQDFNKTYSSSKERKNRFEIFKKNLNVIEELQKNEQGTA-----KYGITMFAD  948
             E  F  F   +NK YS+ +E   +FE FK NL  I+ L  N+Q T      K+G+  FAD
Sbjct  24    ESQFIAFQNKYNKIYSA-EEYLVKFETFKSNLLNIDAL--NKQATTIGSDTKFGVNKFAD  80

Query  949   LSTKEFRKKYLGLRPDLKLENHIPMPMAEIPDNI--ELPTEFDWRDRHV---------VT  997
             LS +EF+K YL  + + +L + +PM +  + D+I    P  FDWR+            VT
Sbjct  81    LSKEEFKKYYLSSK-EARLTDDLPM-LPNLSDDIISATPAAFDWRNTGGSTKFPQGTPVT  138

Query  998   EVKDQGQCGSCWAFSVTGNIESLYAIKYKKLLSLSEQELVDCD----------TLDQGCG  1047
              VK+QGQCGSCW+FS TGN+E  + +    L+ LSEQ LVDCD            + GC 
Sbjct  139   AVKNQGQCGSCWSFSTTGNVEGQHYLSTGTLVGLSEQNLVDCDHTCMTYENENVCNAGCD  198

Query  1048  GGLPDNAYRAIENLGGLELEKDYPYEAENEKCHFNKSKAKVVITSAVNITSNETLMAKWL  1107
             GGL  NAY  I   GG++ E  YPY A + +C FN ++    I+S   +  NET +A +L
Sbjct  199   GGLQPNAYNYIIKNGGIQTEATYPYTAVDGECKFNSAQVGAKISSFTMVPQNETQIASYL  258

Query  1108  VSNGPISIGINANAMQFYMGGVSHPYKFLCSPDNLDHGVLIVGYGIHTYPLFNKKLPYWT  1167
              +NGP++I  +A   QFYMGGV   + F C    LDHG+LIVGYG     +  K  PYW 
Sbjct  259   FNNGPLAIAADAEEWQFYMGGV---FDFPCG-QTLDHGILIVGYGAQD-TIVGKNTPYWI  313

Query  1168  IKNSWGPRWGEQGYYRVYRGDGTCGVNQMASSAIVA  1203
             IKNSWG  WGE GY +V R    CGV    SS+IV 
Sbjct  314   IKNSWGADWGEAGYLKVERNTDKCGVANFVSSSIVG  349



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584818.1 pre-mRNA-processing factor 39 isoform X1 [Cephus
cinctus]

Length=1049
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRP39_DROME  unnamed protein product                                  410     4e-126
SUF_DROME  unnamed protein product                                    63.5    6e-10 
CRN_DROME  unnamed protein product                                    41.6    0.004 


>PRP39_DROME unnamed protein product
Length=1066

 Score = 410 bits (1055),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 278/423 (66%), Gaps = 21/423 (5%)

Query  637   DEETRAIREKIISSRRKMHKVNVNAVAARWSYEEGIKRPYFHVKPLERCQLKNWKEYLDF  696
             DEE  +IR++ IS+RRK+HK+ V+AV ARWS+EEGIKRPYFHVKPLER QLKNWK+YLDF
Sbjct  655   DEEVVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDF  714

Query  697   EIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDN--VDKIRDVYSRACTVHH  754
             EIE+ D+ R+++LFERCLIACALYDEFW++ +RYLES +  +  VD +RDVY RAC +HH
Sbjct  715   EIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHH  774

Query  755   LKKPNLHLQWATFEEGQGNFEKAAAILENIDNALPNMLQIAYRRVNLERRRGDLEKACTL  814
               KP+LHL WA FEE Q NF+ AA IL+ ID   PN+LQ++YRR+N+ERRRG L+K   L
Sbjct  775   PDKPSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCREL  834

Query  815   YESYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLG  874
             Y+ YI ++KN+ IA ++A+KYARFL K+ +D+D  +  LQ+A E+D  N R+ LQ+IDL 
Sbjct  835   YKHYIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLC  894

Query  875   MQRNPVDTQEVVSYMDMFIEREHADLEQRVLFAQRKVEFLEDFSPDIRQVLKAHEQFQRC  934
             +QR  VD QEVV  MD F+ R   + +Q+VLFAQRKVEFLEDF    R +  A    Q+ 
Sbjct  895   LQRPKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQA  954

Query  935   IKQAKE-RKKAKSDDVKGDSSPPKKGKAGEQSSVPPPPSVGSQSSYQ-YSSGPSGPYQSQ  992
             + +AKE +KK+     + +SS  K+G     S+     + GS ++   Y+ G + PY  Q
Sbjct  955   LTKAKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQ  1014

Query  993   QQFQSGQYGGQGGYQQGYQQYPPPSDPNYANYQNWQYSQGGPQAYGP-----YNQWGSY-  1046
             Q   +  Y  Q   Q  Y  Y          Y  W Y  GG  A        Y QW  Y 
Sbjct  1015  QN-TAAAYPSQTPQQASYDSY----------YNQWGYGSGGASANSGGSGYNYGQWSGYG  1063

Query  1047  NYY  1049
             NYY
Sbjct  1064  NYY  1066


 Score = 311 bits (798),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 231/376 (61%), Gaps = 32/376 (9%)

Query  253  KQNEDDDAAAGVEIVE-FDDSENSNGKIMKKTEPDTEAVSEDELPTEATAKDPETEAVSD  311
            K N  +D+++   I E   D++ SN  I+     +TE VSEDELP  +  +  + E VSD
Sbjct  179  KMNSSEDSSSQHAIAEDLADADTSNATIV-----NTEIVSEDELPLPSKPEINDAEEVSD  233

Query  312  EELPAAAPADLGE-TESVSEDELP----------PDGDKKKKGTKSANKTLEKKVKGDDG  360
            EELPA   A+L E  E +SEDELP          P    K+K    + K+ E K      
Sbjct  234  EELPAPQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHE  293

Query  361  SKRKLNADGEYDPSSPTSENNDETPAKK---------------VALATDSDTADSKVDAK  405
            S  K  +  +Y+P SPTSE+ND  P++K                    D +    K + K
Sbjct  294  SSTKDKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNK  353

Query  406  PASPKKKTLPELEKYWKAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCY  465
                ++K LP+L+KYW+AV ED +DFTGWTYLLQYVD E+DAEAAREAY  FL  YPYCY
Sbjct  354  DKEKERKKLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCY  413

Query  466  GYWRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDEEKLREQYE  525
            GYWRKYADYEK+KG   N   VF++GL+AI LSVDLW+HY+ H K+ +  DE  +R QYE
Sbjct  414  GYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYE  473

Query  526  RAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLLSTPTLGYISHFEAFQEFVSS  585
            RA++ACGLEFRSD+LW++YI+WE E KR  RV  +YDRLL+ PT GY  HF+ FQ+ ++ 
Sbjct  474  RAVKACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQ  533

Query  586  NLPNRILSVDDFLTLR  601
            +     L+ ++ + LR
Sbjct  534  HDVTITLANEEVIRLR  549


 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  690  WKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDNVDKIRDVYSRA  749
            W++Y D+E  +  +     +FER L A  L  + W+ ++ +++S  GD+   +R  Y RA
Sbjct  416  WRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERA  475

Query  750  CTVHHLK  756
                 L+
Sbjct  476  VKACGLE  482


 Score = 38.1 bits (87),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 37/63 (59%), Gaps = 2/63 (3%)

Query  468  WRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDE--EKLREQYE  525
            W+ Y D+E +KG+ E V  +F++ L A +L  + WL  + + +++ ++    + +R+ Y 
Sbjct  708  WKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYR  767

Query  526  RAI  528
            RA 
Sbjct  768  RAC  770


>SUF_DROME unnamed protein product
Length=765

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 75/162 (46%), Gaps = 14/162 (9%)

Query  422  KAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNP  481
            + V   P D   W+ +++   Q       R  Y   +  +P    YW+ Y + E +    
Sbjct  24   QVVELRPYDIESWSVMIREA-QTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYY  82

Query  482  ENVQTVFDQGLKAISLSVDLW---LHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSD  538
            E V+ +F + L  I L++DLW   L Y+   K+     +EK+ + Y+ A+E  G++  S 
Sbjct  83   ERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSF  141

Query  539  RLWESYIKW---------ELEGKRLSRVTALYDRLLSTPTLG  571
             +W+ YI +           E ++++ V  +Y + + TP +G
Sbjct  142  SIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVG  183


 Score = 32.3 bits (72),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  688  KNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKG  736
            + WK Y++ E+  +   R+  LF+RCL+   L  + W  ++ Y++  K 
Sbjct  67   RYWKLYIEMEMRSRYYERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKS  114


 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query  760  LHLQWATFEEGQGNFEKAAAI---LENIDNALPNMLQIAYRRVNLERRRGDLEKACTLYE  816
            L+  +A FEEG+  +EK   +   L  + +  P ++ + Y  +   RR   ++ A ++++
Sbjct  375  LYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQY--MKFARRAEGIKSARSIFK  432

Query  817  SYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLGMQ  876
                + ++R         Y  F+         A  +++    KDK+   +  ++ +LG++
Sbjct  433  KAREDVRSR---------YHIFV---------AAALMEYYCSKDKE---IAFRIFELGLK  471

Query  877  RNPVDTQEVVSYMDMFIEREHADLEQRVLF  906
            R     + V+ Y+D ++   + D   RVLF
Sbjct  472  RFGGSPEYVMCYID-YLSHLNEDNNTRVLF  500


>CRN_DROME unnamed protein product
Length=702

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (43%), Gaps = 34/168 (20%)

Query  419  KYWKAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTK------------FLERYPYCYG  466
            +Y + V  +P+++  W   L+ ++ E D +  RE Y +            F  RY Y   
Sbjct  313  QYEQEVAANPTNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYIYL--  370

Query  467  YWRKYADYEKKKG-NPENVQTVFDQGLKAI-----SLSVDLWLHYIN---HCKTVYEKDE  517
             W  YA YE+ +  + E  + ++   L+ I     + S  LWL Y      CK +     
Sbjct  371  -WINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFS-KLWLLYAQFEIRCKEL-----  423

Query  518  EKLREQYERAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLL  565
            ++ R+    AI  C      D+L+  YI  E++ +   R   LY++ L
Sbjct  424  QRARKALGLAIGMCP----RDKLFRGYIDLEIQLREFERCRMLYEKFL  467


 Score = 37.4 bits (85),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 55/115 (48%), Gaps = 11/115 (10%)

Query  440  YVDQE---NDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNPENVQTVFDQGLKAIS  496
            Y+D E    + E  R  Y KFLE  P     W K+A+ E   G+ +  + +F+  ++   
Sbjct  446  YIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPR  505

Query  497  LSVD--LWLHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSDRLWESYIKWEL  549
            L +   LW  YI+    V   + E  R+ YER +E      +  ++W S+ K+E+
Sbjct  506  LDMPELLWKAYIDF--EVALGETELARQLYERLLERT----QHVKVWMSFAKFEM  554


 Score = 35.8 bits (81),  Expect = 0.20, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 5/102 (5%)

Query  690  WKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDNVDKIRDVYSRA  749
            W+ Y++FE+  K+ +R   ++ER +         W++F R+ ES     +   R V+ RA
Sbjct  180  WQTYVNFELRYKEIDRAREIYERFVYVHPDVKN-WIKFARFEESH--GFIHGSRRVFERA  236

Query  750  CTVH--HLKKPNLHLQWATFEEGQGNFEKAAAILENIDNALP  789
                     +  L + +A FEEGQ   ++A  I +   + LP
Sbjct  237  VEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLP  278


 Score = 34.7 bits (78),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 92/435 (21%), Positives = 170/435 (39%), Gaps = 77/435 (18%)

Query  468  WRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDEEKL---REQY  524
            W KYA+ E K     + + ++D+ +  +      W  Y     T  E+  E +   R+ +
Sbjct  113  WLKYAEMEMKNKQVNHARNLWDRAVTIMPRVNQFWYKY-----TYMEEMLENVAGARQVF  167

Query  525  ERAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLLST-PTLGYISHFEAFQE--  581
            ER +E        ++ W++Y+ +EL  K + R   +Y+R +   P +     F  F+E  
Sbjct  168  ERWMEWQP----EEQAWQTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESH  223

Query  582  -FV--SSNLPNRILSV--DDFLTLRAEVKALLKSDDA---------IAASATDDAPPGEE  627
             F+  S  +  R +    DD++  R  + A  + ++          I   A D  P    
Sbjct  224  GFIHGSRRVFERAVEFFGDDYIEERLFI-AFARFEEGQKEHDRARIIYKYALDHLPKDRT  282

Query  628  PPPHEVPPTDEET---RAIREKIISSRRKMHKVNVNAVAARWSYEEGIKRPYFHVKPLER  684
                +     E+    RA  E +I S+RK            + YE+ +        P   
Sbjct  283  QELFKAYTKHEKKYGDRAGIEDVIVSKRK------------YQYEQEVA-----ANP---  322

Query  685  CQLKNWKEYLDFEIEQKDQNRIVILFERCL--IACALYDEFWMRFVRYL-------ESQK  735
                 W +YL     + D+++I   +ER +  +  A    FW R++ YL       E  +
Sbjct  323  TNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYI-YLWINYALYEELE  381

Query  736  GDNVDKIRDVYSRACTV---HHLKKPNLHLQWATFEEGQGNFEKAAAILENIDNALP-NM  791
             ++ ++ R +Y     +          L L +A FE      ++A   L       P + 
Sbjct  382  AEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPRDK  441

Query  792  LQIAYRRVNLERRRGDLEKACTLYESYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVK  851
            L   Y  ++LE +  + E+   LYE ++       +     +K+A  L  +  D D+A  
Sbjct  442  LFRGY--IDLEIQLREFERCRMLYEKFLEFGPENCVT---WMKFAE-LENLLGDTDRARA  495

Query  852  VLQKATEKDKDNPRL  866
            + + A ++    PRL
Sbjct  496  IFELAVQQ----PRL  506


 Score = 31.6 bits (70),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 47/105 (45%), Gaps = 17/105 (16%)

Query  688  KNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEF-------WMRFVRYLESQKGDNVD  740
            K ++ Y+D EI+ ++       FERC +    + EF       WM+F   LE+  GD  D
Sbjct  441  KLFRGYIDLEIQLRE-------FERCRMLYEKFLEFGPENCVTWMKFAE-LENLLGDT-D  491

Query  741  KIRDVYSRACTVHHLKKPNLHLQ-WATFEEGQGNFEKAAAILENI  784
            + R ++  A     L  P L  + +  FE   G  E A  + E +
Sbjct  492  RARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERL  536



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584819.1 pre-mRNA-processing factor 39 isoform X2 [Cephus
cinctus]

Length=1045
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRP39_DROME  unnamed protein product                                  410     5e-126
SUF_DROME  unnamed protein product                                    63.5    6e-10 


>PRP39_DROME unnamed protein product
Length=1066

 Score = 410 bits (1055),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 278/423 (66%), Gaps = 21/423 (5%)

Query  633   DEETRAIREKIISSRRKMHKVNVNAVAARWSYEEGIKRPYFHVKPLERCQLKNWKEYLDF  692
             DEE  +IR++ IS+RRK+HK+ V+AV ARWS+EEGIKRPYFHVKPLER QLKNWK+YLDF
Sbjct  655   DEEVVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDF  714

Query  693   EIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDN--VDKIRDVYSRACTVHH  750
             EIE+ D+ R+++LFERCLIACALYDEFW++ +RYLES +  +  VD +RDVY RAC +HH
Sbjct  715   EIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHH  774

Query  751   LKKPNLHLQWATFEEGQGNFEKAAAILENIDNALPNMLQIAYRRVNLERRRGDLEKACTL  810
               KP+LHL WA FEE Q NF+ AA IL+ ID   PN+LQ++YRR+N+ERRRG L+K   L
Sbjct  775   PDKPSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCREL  834

Query  811   YESYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLG  870
             Y+ YI ++KN+ IA ++A+KYARFL K+ +D+D  +  LQ+A E+D  N R+ LQ+IDL 
Sbjct  835   YKHYIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLC  894

Query  871   MQRNPVDTQEVVSYMDMFIEREHADLEQRVLFAQRKVEFLEDFSPDIRQVLKAHEQFQRC  930
             +QR  VD QEVV  MD F+ R   + +Q+VLFAQRKVEFLEDF    R +  A    Q+ 
Sbjct  895   LQRPKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQA  954

Query  931   IKQAKE-RKKAKSDDVKGDSSPPKKGKAGEQSSVPPPPSVGSQSSYQ-YSSGPSGPYQSQ  988
             + +AKE +KK+     + +SS  K+G     S+     + GS ++   Y+ G + PY  Q
Sbjct  955   LTKAKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQ  1014

Query  989   QQFQSGQYGGQGGYQQGYQQYPPPSDPNYANYQNWQYSQGGPQAYGP-----YNQWGSY-  1042
             Q   +  Y  Q   Q  Y  Y          Y  W Y  GG  A        Y QW  Y 
Sbjct  1015  QN-TAAAYPSQTPQQASYDSY----------YNQWGYGSGGASANSGGSGYNYGQWSGYG  1063

Query  1043  NYY  1045
             NYY
Sbjct  1064  NYY  1066


 Score = 306 bits (785),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 173/376 (46%), Positives = 231/376 (61%), Gaps = 36/376 (10%)

Query  253  KQNEDDDAAAGVEIVE-FDDSENSNGKIMKKTEPDTEAVSEDELPTEATAKDPETEAVSD  311
            K N  +D+++   I E   D++ SN  I+     +TE VSEDELP  +  +  + E VSD
Sbjct  179  KMNSSEDSSSQHAIAEDLADADTSNATIV-----NTEIVSEDELPLPSKPEINDAEEVSD  233

Query  312  EELPAAAPADLGE-TESVSEDELP----------PDGDKKKKGTKSANKTLEKK----VK  356
            EELPA   A+L E  E +SEDELP          P    K+K    + K+ E K     +
Sbjct  234  EELPAPQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHE  293

Query  357  GKRKLNADGEYDPSSPTSENNDETPAKK---------------VALATDSDTADSKVDAK  401
               K  +  +Y+P SPTSE+ND  P++K                    D +    K + K
Sbjct  294  SSTKDKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNK  353

Query  402  PASPKKKTLPELEKYWKAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCY  461
                ++K LP+L+KYW+AV ED +DFTGWTYLLQYVD E+DAEAAREAY  FL  YPYCY
Sbjct  354  DKEKERKKLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCY  413

Query  462  GYWRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDEEKLREQYE  521
            GYWRKYADYEK+KG   N   VF++GL+AI LSVDLW+HY+ H K+ +  DE  +R QYE
Sbjct  414  GYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYE  473

Query  522  RAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLLSTPTLGYISHFEAFQEFVSS  581
            RA++ACGLEFRSD+LW++YI+WE E KR  RV  +YDRLL+ PT GY  HF+ FQ+ ++ 
Sbjct  474  RAVKACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQ  533

Query  582  NLPNRILSVDDFLTLR  597
            +     L+ ++ + LR
Sbjct  534  HDVTITLANEEVIRLR  549


 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  686  WKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDNVDKIRDVYSRA  745
            W++Y D+E  +  +     +FER L A  L  + W+ ++ +++S  GD+   +R  Y RA
Sbjct  416  WRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERA  475

Query  746  CTVHHLK  752
                 L+
Sbjct  476  VKACGLE  482


 Score = 37.7 bits (86),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 37/63 (59%), Gaps = 2/63 (3%)

Query  464  WRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDE--EKLREQYE  521
            W+ Y D+E +KG+ E V  +F++ L A +L  + WL  + + +++ ++    + +R+ Y 
Sbjct  708  WKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYR  767

Query  522  RAI  524
            RA 
Sbjct  768  RAC  770


>SUF_DROME unnamed protein product
Length=765

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 75/162 (46%), Gaps = 14/162 (9%)

Query  418  KAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNP  477
            + V   P D   W+ +++   Q       R  Y   +  +P    YW+ Y + E +    
Sbjct  24   QVVELRPYDIESWSVMIREA-QTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYY  82

Query  478  ENVQTVFDQGLKAISLSVDLW---LHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSD  534
            E V+ +F + L  I L++DLW   L Y+   K+     +EK+ + Y+ A+E  G++  S 
Sbjct  83   ERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSF  141

Query  535  RLWESYIKW---------ELEGKRLSRVTALYDRLLSTPTLG  567
             +W+ YI +           E ++++ V  +Y + + TP +G
Sbjct  142  SIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVG  183


 Score = 32.3 bits (72),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  684  KNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKG  732
            + WK Y++ E+  +   R+  LF+RCL+   L  + W  ++ Y++  K 
Sbjct  67   RYWKLYIEMEMRSRYYERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKS  114


 Score = 32.0 bits (71),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query  756  LHLQWATFEEGQGNFEKAAAI---LENIDNALPNMLQIAYRRVNLERRRGDLEKACTLYE  812
            L+  +A FEEG+  +EK   +   L  + +  P ++ + Y  +   RR   ++ A ++++
Sbjct  375  LYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQY--MKFARRAEGIKSARSIFK  432

Query  813  SYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLGMQ  872
                + ++R         Y  F+         A  +++    KDK+   +  ++ +LG++
Sbjct  433  KAREDVRSR---------YHIFV---------AAALMEYYCSKDKE---IAFRIFELGLK  471

Query  873  RNPVDTQEVVSYMDMFIEREHADLEQRVLF  902
            R     + V+ Y+D ++   + D   RVLF
Sbjct  472  RFGGSPEYVMCYID-YLSHLNEDNNTRVLF  500



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584820.1 pre-mRNA-processing factor 39 isoform X3 [Cephus
cinctus]

Length=1041
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRP39_DROME  unnamed protein product                                  410     5e-126
SUF_DROME  unnamed protein product                                    63.5    6e-10 
CRN_DROME  unnamed protein product                                    41.6    0.004 


>PRP39_DROME unnamed protein product
Length=1066

 Score = 410 bits (1054),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 278/423 (66%), Gaps = 21/423 (5%)

Query  629   DEETRAIREKIISSRRKMHKVNVNAVAARWSYEEGIKRPYFHVKPLERCQLKNWKEYLDF  688
             DEE  +IR++ IS+RRK+HK+ V+AV ARWS+EEGIKRPYFHVKPLER QLKNWK+YLDF
Sbjct  655   DEEVVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDF  714

Query  689   EIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDN--VDKIRDVYSRACTVHH  746
             EIE+ D+ R+++LFERCLIACALYDEFW++ +RYLES +  +  VD +RDVY RAC +HH
Sbjct  715   EIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHH  774

Query  747   LKKPNLHLQWATFEEGQGNFEKAAAILENIDNALPNMLQIAYRRVNLERRRGDLEKACTL  806
               KP+LHL WA FEE Q NF+ AA IL+ ID   PN+LQ++YRR+N+ERRRG L+K   L
Sbjct  775   PDKPSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCREL  834

Query  807   YESYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLG  866
             Y+ YI ++KN+ IA ++A+KYARFL K+ +D+D  +  LQ+A E+D  N R+ LQ+IDL 
Sbjct  835   YKHYIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLC  894

Query  867   MQRNPVDTQEVVSYMDMFIEREHADLEQRVLFAQRKVEFLEDFSPDIRQVLKAHEQFQRC  926
             +QR  VD QEVV  MD F+ R   + +Q+VLFAQRKVEFLEDF    R +  A    Q+ 
Sbjct  895   LQRPKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQA  954

Query  927   IKQAKE-RKKAKSDDVKGDSSPPKKGKAGEQSSVPPPPSVGSQSSYQ-YSSGPSGPYQSQ  984
             + +AKE +KK+     + +SS  K+G     S+     + GS ++   Y+ G + PY  Q
Sbjct  955   LTKAKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQ  1014

Query  985   QQFQSGQYGGQGGYQQGYQQYPPPSDPNYANYQNWQYSQGGPQAYGP-----YNQWGSY-  1038
             Q   +  Y  Q   Q  Y  Y          Y  W Y  GG  A        Y QW  Y 
Sbjct  1015  QN-TAAAYPSQTPQQASYDSY----------YNQWGYGSGGASANSGGSGYNYGQWSGYG  1063

Query  1039  NYY  1041
             NYY
Sbjct  1064  NYY  1066


 Score = 311 bits (797),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 174/376 (46%), Positives = 231/376 (61%), Gaps = 32/376 (9%)

Query  245  KQNEDDDAAAGVEIVE-FDDSENSNGKIMKKTEPDTEAVSEDELPTEATAKDPETEAVSD  303
            K N  +D+++   I E   D++ SN  I+     +TE VSEDELP  +  +  + E VSD
Sbjct  179  KMNSSEDSSSQHAIAEDLADADTSNATIV-----NTEIVSEDELPLPSKPEINDAEEVSD  233

Query  304  EELPAAAPADLGE-TESVSEDELP----------PDGDKKKKGTKSANKTLEKKVKGDDG  352
            EELPA   A+L E  E +SEDELP          P    K+K    + K+ E K      
Sbjct  234  EELPAPQRAELPEDAEVISEDELPASNNNNTATEPKAPLKRKAENESVKSTEDKDASSHE  293

Query  353  SKRKLNADGEYDPSSPTSENNDETPAKK---------------VALATDSDTADSKVDAK  397
            S  K  +  +Y+P SPTSE+ND  P++K                    D +    K + K
Sbjct  294  SSTKDKSSEQYNPGSPTSESNDAQPSEKKLKVEESEPKEKKKEKERDKDKEKDKDKDNNK  353

Query  398  PASPKKKTLPELEKYWKAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCY  457
                ++K LP+L+KYW+AV ED +DFTGWTYLLQYVD E+DAEAAREAY  FL  YPYCY
Sbjct  354  DKEKERKKLPDLDKYWRAVKEDSTDFTGWTYLLQYVDNESDAEAAREAYDTFLSHYPYCY  413

Query  458  GYWRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDEEKLREQYE  517
            GYWRKYADYEK+KG   N   VF++GL+AI LSVDLW+HY+ H K+ +  DE  +R QYE
Sbjct  414  GYWRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYE  473

Query  518  RAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLLSTPTLGYISHFEAFQEFVSS  577
            RA++ACGLEFRSD+LW++YI+WE E KR  RV  +YDRLL+ PT GY  HF+ FQ+ ++ 
Sbjct  474  RAVKACGLEFRSDKLWDAYIRWENESKRYHRVVQIYDRLLAIPTQGYNGHFDNFQDLINQ  533

Query  578  NLPNRILSVDDFLTLR  593
            +     L+ ++ + LR
Sbjct  534  HDVTITLANEEVIRLR  549


 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  682  WKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDNVDKIRDVYSRA  741
            W++Y D+E  +  +     +FER L A  L  + W+ ++ +++S  GD+   +R  Y RA
Sbjct  416  WRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERA  475

Query  742  CTVHHLK  748
                 L+
Sbjct  476  VKACGLE  482


 Score = 37.7 bits (86),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 37/63 (59%), Gaps = 2/63 (3%)

Query  460  WRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDE--EKLREQYE  517
            W+ Y D+E +KG+ E V  +F++ L A +L  + WL  + + +++ ++    + +R+ Y 
Sbjct  708  WKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYR  767

Query  518  RAI  520
            RA 
Sbjct  768  RAC  770


>SUF_DROME unnamed protein product
Length=765

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 75/162 (46%), Gaps = 14/162 (9%)

Query  414  KAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNP  473
            + V   P D   W+ +++   Q       R  Y   +  +P    YW+ Y + E +    
Sbjct  24   QVVELRPYDIESWSVMIREA-QTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYY  82

Query  474  ENVQTVFDQGLKAISLSVDLW---LHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSD  530
            E V+ +F + L  I L++DLW   L Y+   K+     +EK+ + Y+ A+E  G++  S 
Sbjct  83   ERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSF  141

Query  531  RLWESYIKW---------ELEGKRLSRVTALYDRLLSTPTLG  563
             +W+ YI +           E ++++ V  +Y + + TP +G
Sbjct  142  SIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVG  183


 Score = 32.3 bits (72),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  680  KNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKG  728
            + WK Y++ E+  +   R+  LF+RCL+   L  + W  ++ Y++  K 
Sbjct  67   RYWKLYIEMEMRSRYYERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKS  114


 Score = 32.0 bits (71),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query  752  LHLQWATFEEGQGNFEKAAAI---LENIDNALPNMLQIAYRRVNLERRRGDLEKACTLYE  808
            L+  +A FEEG+  +EK   +   L  + +  P ++ + Y  +   RR   ++ A ++++
Sbjct  375  LYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQY--MKFARRAEGIKSARSIFK  432

Query  809  SYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLGMQ  868
                + ++R         Y  F+         A  +++    KDK+   +  ++ +LG++
Sbjct  433  KAREDVRSR---------YHIFV---------AAALMEYYCSKDKE---IAFRIFELGLK  471

Query  869  RNPVDTQEVVSYMDMFIEREHADLEQRVLF  898
            R     + V+ Y+D ++   + D   RVLF
Sbjct  472  RFGGSPEYVMCYID-YLSHLNEDNNTRVLF  500


>CRN_DROME unnamed protein product
Length=702

 Score = 41.6 bits (96),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 72/168 (43%), Gaps = 34/168 (20%)

Query  411  KYWKAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTK------------FLERYPYCYG  458
            +Y + V  +P+++  W   L+ ++ E D +  RE Y +            F  RY Y   
Sbjct  313  QYEQEVAANPTNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYIYL--  370

Query  459  YWRKYADYEKKKG-NPENVQTVFDQGLKAI-----SLSVDLWLHYIN---HCKTVYEKDE  509
             W  YA YE+ +  + E  + ++   L+ I     + S  LWL Y      CK +     
Sbjct  371  -WINYALYEELEAEDAERTRQIYKTCLELIPHKQFTFS-KLWLLYAQFEIRCKEL-----  423

Query  510  EKLREQYERAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLL  557
            ++ R+    AI  C      D+L+  YI  E++ +   R   LY++ L
Sbjct  424  QRARKALGLAIGMCP----RDKLFRGYIDLEIQLREFERCRMLYEKFL  467


 Score = 37.4 bits (85),  Expect = 0.077, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 55/115 (48%), Gaps = 11/115 (10%)

Query  432  YVDQE---NDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNPENVQTVFDQGLKAIS  488
            Y+D E    + E  R  Y KFLE  P     W K+A+ E   G+ +  + +F+  ++   
Sbjct  446  YIDLEIQLREFERCRMLYEKFLEFGPENCVTWMKFAELENLLGDTDRARAIFELAVQQPR  505

Query  489  LSVD--LWLHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSDRLWESYIKWEL  541
            L +   LW  YI+    V   + E  R+ YER +E      +  ++W S+ K+E+
Sbjct  506  LDMPELLWKAYIDF--EVALGETELARQLYERLLERT----QHVKVWMSFAKFEM  554


 Score = 35.8 bits (81),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 5/102 (5%)

Query  682  WKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDNVDKIRDVYSRA  741
            W+ Y++FE+  K+ +R   ++ER +         W++F R+ ES     +   R V+ RA
Sbjct  180  WQTYVNFELRYKEIDRAREIYERFVYVHPDVKN-WIKFARFEESH--GFIHGSRRVFERA  236

Query  742  CTVH--HLKKPNLHLQWATFEEGQGNFEKAAAILENIDNALP  781
                     +  L + +A FEEGQ   ++A  I +   + LP
Sbjct  237  VEFFGDDYIEERLFIAFARFEEGQKEHDRARIIYKYALDHLP  278


 Score = 34.7 bits (78),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 92/435 (21%), Positives = 170/435 (39%), Gaps = 77/435 (18%)

Query  460  WRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDEEKL---REQY  516
            W KYA+ E K     + + ++D+ +  +      W  Y     T  E+  E +   R+ +
Sbjct  113  WLKYAEMEMKNKQVNHARNLWDRAVTIMPRVNQFWYKY-----TYMEEMLENVAGARQVF  167

Query  517  ERAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLLST-PTLGYISHFEAFQE--  573
            ER +E        ++ W++Y+ +EL  K + R   +Y+R +   P +     F  F+E  
Sbjct  168  ERWMEWQP----EEQAWQTYVNFELRYKEIDRAREIYERFVYVHPDVKNWIKFARFEESH  223

Query  574  -FV--SSNLPNRILSV--DDFLTLRAEVKALLKSDDA---------IAASATDDAPPGEE  619
             F+  S  +  R +    DD++  R  + A  + ++          I   A D  P    
Sbjct  224  GFIHGSRRVFERAVEFFGDDYIEERLFI-AFARFEEGQKEHDRARIIYKYALDHLPKDRT  282

Query  620  PPPHEVPPTDEET---RAIREKIISSRRKMHKVNVNAVAARWSYEEGIKRPYFHVKPLER  676
                +     E+    RA  E +I S+RK            + YE+ +        P   
Sbjct  283  QELFKAYTKHEKKYGDRAGIEDVIVSKRK------------YQYEQEVA-----ANP---  322

Query  677  CQLKNWKEYLDFEIEQKDQNRIVILFERCL--IACALYDEFWMRFVRYL-------ESQK  727
                 W +YL     + D+++I   +ER +  +  A    FW R++ YL       E  +
Sbjct  323  TNYDAWFDYLRLIEAEGDRDQIRETYERAISNVPPANEKNFWRRYI-YLWINYALYEELE  381

Query  728  GDNVDKIRDVYSRACTV---HHLKKPNLHLQWATFEEGQGNFEKAAAILENIDNALP-NM  783
             ++ ++ R +Y     +          L L +A FE      ++A   L       P + 
Sbjct  382  AEDAERTRQIYKTCLELIPHKQFTFSKLWLLYAQFEIRCKELQRARKALGLAIGMCPRDK  441

Query  784  LQIAYRRVNLERRRGDLEKACTLYESYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVK  843
            L   Y  ++LE +  + E+   LYE ++       +     +K+A  L  +  D D+A  
Sbjct  442  LFRGY--IDLEIQLREFERCRMLYEKFLEFGPENCVT---WMKFAE-LENLLGDTDRARA  495

Query  844  VLQKATEKDKDNPRL  858
            + + A ++    PRL
Sbjct  496  IFELAVQQ----PRL  506


 Score = 31.6 bits (70),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 47/105 (45%), Gaps = 17/105 (16%)

Query  680  KNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEF-------WMRFVRYLESQKGDNVD  732
            K ++ Y+D EI+ ++       FERC +    + EF       WM+F   LE+  GD  D
Sbjct  441  KLFRGYIDLEIQLRE-------FERCRMLYEKFLEFGPENCVTWMKFAE-LENLLGDT-D  491

Query  733  KIRDVYSRACTVHHLKKPNLHLQ-WATFEEGQGNFEKAAAILENI  776
            + R ++  A     L  P L  + +  FE   G  E A  + E +
Sbjct  492  RARAIFELAVQQPRLDMPELLWKAYIDFEVALGETELARQLYERL  536



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


Query= XP_015584821.1 pre-mRNA-processing factor 39 isoform X4 [Cephus
cinctus]

Length=1011
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRP39_DROME  unnamed protein product                                  410     3e-126
SUF_DROME  unnamed protein product                                    63.5    6e-10 
Q38A09_TRYB2  unnamed protein product                                 43.1    0.001 


>PRP39_DROME unnamed protein product
Length=1066

 Score = 410 bits (1054),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 212/423 (50%), Positives = 278/423 (66%), Gaps = 21/423 (5%)

Query  599   DEETRAIREKIISSRRKMHKVNVNAVAARWSYEEGIKRPYFHVKPLERCQLKNWKEYLDF  658
             DEE  +IR++ IS+RRK+HK+ V+AV ARWS+EEGIKRPYFHVKPLER QLKNWK+YLDF
Sbjct  655   DEEVVSIRDRAISARRKVHKLTVSAVTARWSFEEGIKRPYFHVKPLERAQLKNWKDYLDF  714

Query  659   EIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDN--VDKIRDVYSRACTVHH  716
             EIE+ D+ R+++LFERCLIACALYDEFW++ +RYLES +  +  VD +RDVY RAC +HH
Sbjct  715   EIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYRRACRIHH  774

Query  717   LKKPNLHLQWATFEEGQGNFEKAAAILENIDNALPNMLQIAYRRVNLERRRGDLEKACTL  776
               KP+LHL WA FEE Q NF+ AA IL+ ID   PN+LQ++YRR+N+ERRRG L+K   L
Sbjct  775   PDKPSLHLMWAAFEECQMNFDDAAEILQRIDQRCPNLLQLSYRRINVERRRGALDKCREL  834

Query  777   YESYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLG  836
             Y+ YI ++KN+ IA ++A+KYARFL K+ +D+D  +  LQ+A E+D  N R+ LQ+IDL 
Sbjct  835   YKHYIESTKNKGIAGSLAIKYARFLNKICHDLDAGLAALQQALERDPANTRVALQMIDLC  894

Query  837   MQRNPVDTQEVVSYMDMFIEREHADLEQRVLFAQRKVEFLEDFSPDIRQVLKAHEQFQRC  896
             +QR  VD QEVV  MD F+ R   + +Q+VLFAQRKVEFLEDF    R +  A    Q+ 
Sbjct  895   LQRPKVDEQEVVEIMDKFMARADIEPDQKVLFAQRKVEFLEDFGSTARGLQDAQRALQQA  954

Query  897   IKQAKE-RKKAKSDDVKGDSSPPKKGKAGEQSSVPPPPSVGSQSSYQ-YSSGPSGPYQSQ  954
             + +AKE +KK+     + +SS  K+G     S+     + GS ++   Y+ G + PY  Q
Sbjct  955   LTKAKEAQKKSDGSPSRKNSSSSKEGPVPTGSAAAAYNNGGSAAAVAGYNYGAANPYYGQ  1014

Query  955   QQFQSGQYGGQGGYQQGYQQYPPPSDPNYANYQNWQYSQGGPQAYGP-----YNQWGSY-  1008
             Q   +  Y  Q   Q  Y  Y          Y  W Y  GG  A        Y QW  Y 
Sbjct  1015  QN-TAAAYPSQTPQQASYDSY----------YNQWGYGSGGASANSGGSGYNYGQWSGYG  1063

Query  1009  NYY  1011
             NYY
Sbjct  1064  NYY  1066


 Score = 304 bits (778),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 221/587 (38%), Positives = 308/587 (52%), Gaps = 74/587 (13%)

Query  8    ENEILQSEPVRRTRSGRALKTTVVAKKSPTKKLLARATR--SQKKIQEVEENEGGEVSLG  65
            EN +++S P RRTRSGR          SP   L  R+TR  S++ +Q  +  E  E    
Sbjct  6    ENVVMES-PGRRTRSGRK-------AASPAASLPTRSTRRTSKRNVQLSDHEEEAE----  53

Query  66   EEEAVSEMEDTPENGIQRYSDIIIEHHEENTPGLHLIDDFGGTIVHDIEISQNIQIEQEP  125
            E+  + + E+ P  G        +E   E T   H I+D       D+E+     +  E 
Sbjct  54   EQVVMVQEEEEPFRGTNTAEAPALEPQFEETQ--HQIED-------DVEM-----LPAEA  99

Query  126  QDVPELEAPPPPVVSSITTSAPILSTLK--VKEPAQLMEGLDRTEAVITLEE-NSMEKLD  182
              V E  +  P       T A + S     +KE  +   G+D   A +  +  NS+  + 
Sbjct  100  AGVDEKSSSFP-----FGTVAELHSETSDDIKE-TRGQAGVDTLLASLAGDNANSLPSV-  152

Query  183  MIQRGKHIEYTMEVYADEEENIGHMTEVLDTEEVESSNTNTDLGMERMQVDEMEQEISHV  242
                G + E      AD E N+  +       ++E  N++ D   +    +++    +  
Sbjct  153  ----GGNDESDNVKKADFEYNVDSLQP-----QMEKMNSSEDSSSQHAIAEDLADADTSN  203

Query  243  GQTSNVAEDVSEDELPTEATAKDPETEAVSDEELPAAAPADLGE-TESVSEDELP-----  296
                N  E VSEDELP  +  +  + E VSDEELPA   A+L E  E +SEDELP     
Sbjct  204  ATIVNT-EIVSEDELPLPSKPEINDAEEVSDEELPAPQRAELPEDAEVISEDELPASNNN  262

Query  297  -----PDGDKKKKGTKSANKTLEKKVKGDDGSKRKLNADGEYDPSSPTSENNDETPAKK-  350
                 P    K+K    + K+ E K      S  K  +  +Y+P SPTSE+ND  P++K 
Sbjct  263  NTATEPKAPLKRKAENESVKSTEDKDASSHESSTKDKSSEQYNPGSPTSESNDAQPSEKK  322

Query  351  --------------VALATDSDTADSKVDAKPASPKKKTLPELEKYWKAVNEDPSDFTGW  396
                               D +    K + K    ++K LP+L+KYW+AV ED +DFTGW
Sbjct  323  LKVEESEPKEKKKEKERDKDKEKDKDKDNNKDKEKERKKLPDLDKYWRAVKEDSTDFTGW  382

Query  397  TYLLQYVDQENDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNPENVQTVFDQGLKA  456
            TYLLQYVD E+DAEAAREAY  FL  YPYCYGYWRKYADYEK+KG   N   VF++GL+A
Sbjct  383  TYLLQYVDNESDAEAAREAYDTFLSHYPYCYGYWRKYADYEKRKGIKANCYKVFERGLEA  442

Query  457  ISLSVDLWLHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSDRLWESYIKWELEGKRL  516
            I LSVDLW+HY+ H K+ +  DE  +R QYERA++ACGLEFRSD+LW++YI+WE E KR 
Sbjct  443  IPLSVDLWIHYLMHVKSNHGDDETFVRSQYERAVKACGLEFRSDKLWDAYIRWENESKRY  502

Query  517  SRVTALYDRLLSTPTLGYISHFEAFQEFVSSNLPNRILSVDDFLTLR  563
             RV  +YDRLL+ PT GY  HF+ FQ+ ++ +     L+ ++ + LR
Sbjct  503  HRVVQIYDRLLAIPTQGYNGHFDNFQDLINQHDVTITLANEEVIRLR  549


 Score = 40.8 bits (94),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  652  WKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKGDNVDKIRDVYSRA  711
            W++Y D+E  +  +     +FER L A  L  + W+ ++ +++S  GD+   +R  Y RA
Sbjct  416  WRKYADYEKRKGIKANCYKVFERGLEAIPLSVDLWIHYLMHVKSNHGDDETFVRSQYERA  475

Query  712  CTVHHLK  718
                 L+
Sbjct  476  VKACGLE  482


 Score = 37.7 bits (86),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 18/63 (29%), Positives = 37/63 (59%), Gaps = 2/63 (3%)

Query  430  WRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYINHCKTVYEKDE--EKLREQYE  487
            W+ Y D+E +KG+ E V  +F++ L A +L  + WL  + + +++ ++    + +R+ Y 
Sbjct  708  WKDYLDFEIEKGDRERVLVLFERCLIACALYDEFWLKMLRYLESLEDQSGVVDLVRDVYR  767

Query  488  RAI  490
            RA 
Sbjct  768  RAC  770


>SUF_DROME unnamed protein product
Length=765

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/162 (25%), Positives = 75/162 (46%), Gaps = 14/162 (9%)

Query  384  KAVNEDPSDFTGWTYLLQYVDQENDAEAAREAYTKFLERYPYCYGYWRKYADYEKKKGNP  443
            + V   P D   W+ +++   Q       R  Y   +  +P    YW+ Y + E +    
Sbjct  24   QVVELRPYDIESWSVMIREA-QTRPIHEVRSLYESLVNVFPTTARYWKLYIEMEMRSRYY  82

Query  444  ENVQTVFDQGLKAISLSVDLW---LHYINHCKTVYEKDEEKLREQYERAIEACGLEFRSD  500
            E V+ +F + L  I L++DLW   L Y+   K+     +EK+ + Y+ A+E  G++  S 
Sbjct  83   ERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKSGLSTHKEKMAQAYDFALEKIGMDLHSF  141

Query  501  RLWESYIKW---------ELEGKRLSRVTALYDRLLSTPTLG  533
             +W+ YI +           E ++++ V  +Y + + TP +G
Sbjct  142  SIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTPIVG  183


 Score = 32.3 bits (72),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query  650  KNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFVRYLESQKG  698
            + WK Y++ E+  +   R+  LF+RCL+   L  + W  ++ Y++  K 
Sbjct  67   RYWKLYIEMEMRSRYYERVEKLFQRCLVKI-LNIDLWKLYLTYVKETKS  114


 Score = 32.3 bits (72),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 69/150 (46%), Gaps = 27/150 (18%)

Query  722  LHLQWATFEEGQGNFEKAAAI---LENIDNALPNMLQIAYRRVNLERRRGDLEKACTLYE  778
            L+  +A FEEG+  +EK   +   L  + +  P ++ + Y  +   RR   ++ A ++++
Sbjct  375  LYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQY--MKFARRAEGIKSARSIFK  432

Query  779  SYISNSKNRTIANNIAVKYARFLCKVKNDVDKAVKVLQKATEKDKDNPRLYLQLIDLGMQ  838
                + ++R         Y  F+         A  +++    KDK+   +  ++ +LG++
Sbjct  433  KAREDVRSR---------YHIFV---------AAALMEYYCSKDKE---IAFRIFELGLK  471

Query  839  RNPVDTQEVVSYMDMFIEREHADLEQRVLF  868
            R     + V+ Y+D ++   + D   RVLF
Sbjct  472  RFGGSPEYVMCYID-YLSHLNEDNNTRVLF  500


>Q38A09_TRYB2 unnamed protein product
Length=776

 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (48%), Gaps = 14/119 (12%)

Query  357  SDTADSKVDAKP---ASPKKKTLPELEKYWKAVNEDPSDFTGWTYLLQYVDQENDAEAAR  413
            S+T+ + V   P   A  ++KT  ELE+    V    +    W    ++  Q+ D E  R
Sbjct  53   SNTSTTVVINSPEELALYRQKTRAELEER---VKRGYTFLGNWVKYARWEAQQKDYERMR  109

Query  414  EAYTKFLERYPYCYG----YWRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHYI  468
                  LER    +G     WR YA+ E++ G   + + V+++G+ A+  + DLWL YI
Sbjct  110  ----SILERAVKFHGANPVLWRDYAELEEEGGFINHARAVWERGVTALPSATDLWLKYI  164


 Score = 38.1 bits (87),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 28/113 (25%), Positives = 49/113 (43%), Gaps = 23/113 (20%)

Query  428  GYWRKYADYEKKKGNPENVQTVFDQGLKAISLSVDLWLHY---------INHCKTVYEKD  478
            G W KYA +E ++ + E ++++ ++ +K    +  LW  Y         INH + V+E+ 
Sbjct  90   GNWVKYARWEAQQKDYERMRSILERAVKFHGANPVLWRDYAELEEEGGFINHARAVWERG  149

Query  479  EEKLREQYERAIEACGLEFRSDRLWESYIKWELEGKRLSRVTALYDRLLSTPT  531
               L    +              LW  YI  E    +  +V  L++R +S PT
Sbjct  150  VTALPSATD--------------LWLKYIVLEQAAGQDGKVRDLFNRWVSGPT  188


 Score = 30.8 bits (68),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 36/153 (24%), Positives = 54/153 (35%), Gaps = 45/153 (29%)

Query  631  EEGIKRPYFHVKPLERCQLKNWKEYLDFEIEQKDQNRIVILFERCLIACALYDEFWMRFV  690
            EE +KR Y          L NW +Y  +E +QKD  R+  + ER            ++F 
Sbjct  79   EERVKRGYTF--------LGNWVKYARWEAQQKDYERMRSILERA-----------VKF-  118

Query  691  RYLESQKGDNVDKIRDVYSRACTVHHLKKPNLHLQWATFEEGQGNFEKAAAILENIDNAL  750
                                     H   P L   +A  EE  G    A A+ E    AL
Sbjct  119  -------------------------HGANPVLWRDYAELEEEGGFINHARAVWERGVTAL  153

Query  751  PNMLQIAYRRVNLERRRGDLEKACTLYESYISN  783
            P+   +  + + LE+  G   K   L+  ++S 
Sbjct  154  PSATDLWLKYIVLEQAAGQDGKVRDLFNRWVSG  186


 Score = 30.8 bits (68),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 59/137 (43%), Gaps = 23/137 (17%)

Query  401  QYVDQENDAEAAREAYTKFLERYPY----CYGYWRKYADYEKKKGNPENVQTVFDQGLKA  456
            + V++  D  AAR A  K +  +P+    C   W + A  E++ G  E VQ    Q L A
Sbjct  417  RLVEERGDVAAARSALAKCIRHFPFKTACCPRLWIEAAALEERHG--EFVQA---QKLLA  471

Query  457  ISLSV-------DLWLHY-INHC---KTVYEKDEEKLREQYERAIEACGLEFRSDRLWES  505
             SL++       D  L    N C   +   E   ++ R  YE AI+     F    LWE 
Sbjct  472  ASLNISPCPEVFDAALRLESNACAAGEVSAESCVQRSRAIYESAIKQFPQNF---ALWEG  528

Query  506  YIKWELEGKRLSRVTAL  522
            Y K E + ++  R  AL
Sbjct  529  YAKLEEKERQFHRSDAL  545



Lambda      K        H
   0.322    0.139    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 420542928


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584822.1 condensin complex subunit 3 [Cephus cinctus]

Length=924
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B3DN53_DROME  unnamed protein product                                 304     4e-87
A1Z987_DROME  unnamed protein product                                 302     2e-86
Q57ZK1_TRYB2  unnamed protein product                                 40.0    0.011


>B3DN53_DROME unnamed protein product
Length=1299

 Score = 304 bits (778),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 259/917 (28%), Positives = 439/917 (48%), Gaps = 77/917 (8%)

Query  15   IFYNVQFNKTCHQNYLKKLKAYYLKVDPDVFIEYFILCLMVPLTRSEIHPHVENTLGFAA  74
            I    +  ++ H+ Y K+++  Y K+  + F + FI  L   L   E + +    L F A
Sbjct  58   IMRQAELKESLHKRYSKEMQQLYAKMGHESFRKAFINVLKAVLGAEEGNENANMALNFCA  117

Query  75   KFAVNLQSSKGDESDEDMCPFLLKLFDFLLDHHNSKDTAVRYRVCYFVNMLLNGMGENAF  134
             F V    S G E      P L + F +LL  ++S +  +RYR+CYFVN++L  +G NA 
Sbjct  118  TF-VTSSDSDGTE------PMLAETFHWLLTTYSS-NPHIRYRICYFVNLILKELGPNAA  169

Query  135  LEDVLCDKISANMMERLLDKSPKVRAQAVFALHRLQDPADEQCPIIKMFIFHLSKDPHAE  194
            L+D  CD I   M++R+ D S  VR QAV A+ RLQ+P +    ++  +++HL+ DP   
Sbjct  170  LDDHQCDDILEAMLDRVKDVSASVRKQAVLAMQRLQNPDNPSDVVVGAYMYHLTSDPSPN  229

Query  195  VRKAVLTNMGKSQKTLQAALKRTRDINDTVRKIAYIFISKITVRSLTIKQREQLLSDGLK  254
            VR+ ++T MG++  T+   L+R  D+++ VR+  Y+ +    VRS  + QR  LL  GL 
Sbjct  230  VRQCIITCMGRNYITIPHILERLWDVDEKVRRHTYVNMCNYPVRSYKVAQRLTLLEQGLN  289

Query  255  DRSEIVRDSVKKVLLPSWLQHFQGDYVNLLRALDAENAME-------TGILVLNTLFQAD  307
            D S  VR +V   +L +W++ +Q +YV L+ AL  ++  E           +L  +FQ  
Sbjct  290  DTSATVRKTVINFMLKTWIESYQQNYVALIAALKLDSNEEELLRFRRVAKQMLRVIFQQT  349

Query  308  QLRNLMAQIPIDPDTKL---IPHEKLQSEIVLYWRCLVDYLRRSSYTDELEEFLPELSIF  364
             ++ L+ Q+P+  D +L   IPH+ +  E++LYW+CL +YL   +   E+E  LPELS+F
Sbjct  350  DIKQLIDQLPLSEDCELHRCIPHDSVTVELLLYWQCLSEYL--ETEAPEIESLLPELSVF  407

Query  365  CTYIREYLALLSSKEYQPWEQLTQKIILNQLFEIAKIYDLSDESGRANLKQLIFDALMTE  424
            CTY+ ++       +   + Q+  + +L  L EI + YDL DE GR N++ LI + L   
Sbjct  408  CTYMDKFCQ-FQKPDMDKFAQVEFQNMLLSLVEILETYDLGDEIGRGNMRLLITNLLKDC  466

Query  425  HCSQQVTESIVKYLEVIIPDVDSRLNSLTHIISEL-RMPLKQ-------QVTTQISEEEL  476
                ++   +V+ +E +I D + R+     II EL  +  KQ        +  ++ ++  
Sbjct  467  LLDHKIVRVLVRCMEQLITDTNDRIQYFIEIIYELCELNTKQNDLIHDRSLINKLLDDLD  526

Query  477  HTINMKRAKLKVKLIEVNEEEYEAIHEKDYMRAAALKEQIEDINRQINEL------PTGA  530
              + MK + LKVK++E+ E E   + +++Y+RA ++ ++   +  +  EL        G 
Sbjct  527  TPLKMKISSLKVKILELEELEGNYVRQREYIRAQSVNDEKIAVTEEYTELIRPLLEKHGV  586

Query  531  IETTNEPVCEEKNDRETMIMCLGIMCAMMEVPSVTTLTPNLRTLMTDMALPSFDHADDTV  590
            IE    P   + + +E ++  L I   M   P V  LTP+L  L  D        A+  +
Sbjct  587  IEMPTRP---KLSKQERVLKGLYISYYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDI  643

Query  591  HLLALKAVAICCLLDKELAKKHIMMFFLQFSIEQDNQDIWIMALKSIFDLLLFYGMEYFD  650
               ++K      +   E   + +    +    + +N  +   +   I +LL  YG++YF 
Sbjct  644  FEWSIKCGTTFSIF-YEAYSREVFEVVVVQFCKNNNVRLCEASANCILELLDRYGVDYF-  701

Query  651  IMQNEEENVSSNKSKNRTVKLYSNTDDTLIPESTVSETENNYLN--IIKILTGLLDNANQ  708
               N+      + SK +  +LY  T   L  +   S+++NN  N  I+ +L   L+    
Sbjct  702  ---NDLNQTGGSLSKTKRRQLY--TMQELYDDDDGSQSQNNEQNSDILVVLGHYLERVQH  756

Query  709  DLRTIA-TEGLCKLLLNRRISSAT-LLSRLIILWHNPITEGDIYLRQCLCSFFNSFVVHI  766
                +A   GLC+L+L   +   T +L  L+  + NP TE  I   Q L  FF       
Sbjct  757  RGVGMAIVRGLCRLVLRGHVDDRTDVLELLLKRYFNPNTEPII--NQVLGLFFEEL--RR  812

Query  767  PDCQEMLEQAFLPTLQTLANAPDTSPLQEINPHAVAKLILSWTKPGIQKISTQTYYPHKN  826
             +   +L+  FLPT+ T       SPL  + P  + K  L  T   +Q++ST     H  
Sbjct  813  LNKHSLLQPCFLPTVWTCNY---DSPLHGVQPEHLTKFFLEMT---VQEMSTPQTNIHNK  866

Query  827  LTYAILAEILKLDSDIDQDVLIKSLKYLELSAEERTDKDIR---------EAVDNVMKMI  877
            +  + L  I        Q+   +      L A+E T+  I          E +     +I
Sbjct  867  IAISFLQYI--------QNYFTERKDMCRLLAKELTNLSINVLNGPEVKAELLALAENLI  918

Query  878  Q-QTDKRLMKFVQQFRM  893
            Q + D R++K +Q F++
Sbjct  919  QSELDPRMIKCIQNFKL  935


>A1Z987_DROME unnamed protein product
Length=1351

 Score = 302 bits (774),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 259/917 (28%), Positives = 438/917 (48%), Gaps = 77/917 (8%)

Query  15   IFYNVQFNKTCHQNYLKKLKAYYLKVDPDVFIEYFILCLMVPLTRSEIHPHVENTLGFAA  74
            I    +  ++ H+ Y K+++  Y K+  + F + FI  L   L   E + +    L F A
Sbjct  58   IMRQAELKESLHKRYSKEMQQLYAKMGHESFRKAFINVLKAVLGAEEGNENANMALNFCA  117

Query  75   KFAVNLQSSKGDESDEDMCPFLLKLFDFLLDHHNSKDTAVRYRVCYFVNMLLNGMGENAF  134
             F V    S G E      P L + F +LL  ++S +  +RYR+CYFVN++L  +G NA 
Sbjct  118  TF-VTSSDSDGTE------PMLAETFHWLLTTYSS-NPHIRYRICYFVNLILKELGPNAA  169

Query  135  LEDVLCDKISANMMERLLDKSPKVRAQAVFALHRLQDPADEQCPIIKMFIFHLSKDPHAE  194
            L+D  CD I   M++R+ D S  VR QAV A+ RLQ+P +    ++  +++HL+ DP   
Sbjct  170  LDDHQCDDILEAMLDRVKDVSASVRKQAVLAMQRLQNPDNPSDVVVGAYMYHLTSDPSPN  229

Query  195  VRKAVLTNMGKSQKTLQAALKRTRDINDTVRKIAYIFISKITVRSLTIKQREQLLSDGLK  254
            VR+ ++T MG++  T+   L+R  D+++ VR+  Y+ +    VRS  + QR  LL  GL 
Sbjct  230  VRQCIITCMGRNYITIPHILERLWDVDEKVRRHTYVNMCNYPVRSYKVAQRLTLLEQGLN  289

Query  255  DRSEIVRDSVKKVLLPSWLQHFQGDYVNLLRALDAENAME-------TGILVLNTLFQAD  307
            D S  VR +V   +L +W++ +Q +YV L+ AL  ++  E           +L  +FQ  
Sbjct  290  DTSATVRKTVINFMLKTWIESYQQNYVALIAALKLDSNEEELLRFRRVAKQMLRVIFQQT  349

Query  308  QLRNLMAQIPIDPDTKL---IPHEKLQSEIVLYWRCLVDYLRRSSYTDELEEFLPELSIF  364
             ++ L+ Q+P+  D +L   IPH+ +  E++LYW+CL +YL   +   E+E  LPELS+F
Sbjct  350  DIKQLIDQLPLSEDCELHRCIPHDSVTVELLLYWQCLSEYL--ETEAPEIESLLPELSVF  407

Query  365  CTYIREYLALLSSKEYQPWEQLTQKIILNQLFEIAKIYDLSDESGRANLKQLIFDALMTE  424
            CTY+ ++       +   + Q+  + +L  L EI + YDL DE GR N++ LI + L   
Sbjct  408  CTYMDKFCQ-FQKPDMDKFAQVEFQNMLLSLVEILETYDLGDEIGRGNMRLLITNLLKDC  466

Query  425  HCSQQVTESIVKYLEVIIPDVDSRLNSLTHIISEL-RMPLKQ-------QVTTQISEEEL  476
                ++   +V+ +E +I D + R+     II EL  +  KQ        +  ++ ++  
Sbjct  467  LLDHKIVRVLVRCMEQLITDTNDRIQYFIEIIYELCELNTKQNDLIHDRSLINKLLDDLD  526

Query  477  HTINMKRAKLKVKLIEVNEEEYEAIHEKDYMRAAALKEQIEDINRQINEL------PTGA  530
              + MK + LKVK++E+ E E   + +++Y+RA ++ ++   +  +  EL        G 
Sbjct  527  TPLKMKISSLKVKILELEELEGNYVRQREYIRAQSVNDEKIAVTEEYTELIRPLLEKHGV  586

Query  531  IETTNEPVCEEKNDRETMIMCLGIMCAMMEVPSVTTLTPNLRTLMTDMALPSFDHADDTV  590
            IE    P   ++   E ++  L I   M   P V  LTP+L  L  D        A+  +
Sbjct  587  IEMPTRPKLSKQ---ERVLKGLYISYYMTASPHVHKLTPSLCQLYKDFICRYLPCAEVDI  643

Query  591  HLLALKAVAICCLLDKELAKKHIMMFFLQFSIEQDNQDIWIMALKSIFDLLLFYGMEYFD  650
               ++K      +   E   + +    +    + +N  +   +   I +LL  YG++YF 
Sbjct  644  FEWSIKCGTTFSIF-YEAYSREVFEVVVVQFCKNNNVRLCEASANCILELLDRYGVDYF-  701

Query  651  IMQNEEENVSSNKSKNRTVKLYSNTDDTLIPESTVSETENNYLN--IIKILTGLLDNANQ  708
               N+      + SK +  +LY  T   L  +   S+++NN  N  I+ +L   L+    
Sbjct  702  ---NDLNQTGGSLSKTKRRQLY--TMQELYDDDDGSQSQNNEQNSDILVVLGHYLERVQH  756

Query  709  DLRTIA-TEGLCKLLLNRRISSAT-LLSRLIILWHNPITEGDIYLRQCLCSFFNSFVVHI  766
                +A   GLC+L+L   +   T +L  L+  + NP TE  I   Q L  FF       
Sbjct  757  RGVGMAIVRGLCRLVLRGHVDDRTDVLELLLKRYFNPNTEPII--NQVLGLFFEEL--RR  812

Query  767  PDCQEMLEQAFLPTLQTLANAPDTSPLQEINPHAVAKLILSWTKPGIQKISTQTYYPHKN  826
             +   +L+  FLPT+ T       SPL  + P  + K  L  T   +Q++ST     H  
Sbjct  813  LNKHSLLQPCFLPTVWTCNY---DSPLHGVQPEHLTKFFLEMT---VQEMSTPQTNIHNK  866

Query  827  LTYAILAEILKLDSDIDQDVLIKSLKYLELSAEERTDKDIR---------EAVDNVMKMI  877
            +  + L  I        Q+   +      L A+E T+  I          E +     +I
Sbjct  867  IAISFLQYI--------QNYFTERKDMCRLLAKELTNLSINVLNGPEVKAELLALAENLI  918

Query  878  Q-QTDKRLMKFVQQFRM  893
            Q + D R++K +Q F++
Sbjct  919  QSELDPRMIKCIQNFKL  935


>Q57ZK1_TRYB2 unnamed protein product
Length=1061

 Score = 40.0 bits (92),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 46/195 (24%), Positives = 81/195 (42%), Gaps = 13/195 (7%)

Query  97   LKLFDFLLDHHNSKDTAVRYRVCYFVNMLLNGMGE--NAFLEDVLCDKISANMMERLLDK  154
            L +   ++  HN+ D  VR  V    + LL  +    +      L + ++  +  RL DK
Sbjct  97   LTILKTVMGLHNANDKMVRLGVVSLFDALLRTVDSKNDTVARQNLYEDLAEVVKLRLHDK  156

Query  155  SPKVRAQAVFALHRLQDPADEQCPIIKMFIFHLSKDPHAEVRKAVLTNMGK----SQKTL  210
             P VR +AV      Q    + C + +  +  L  D  A+VR+ +L N+      +    
Sbjct  157  FPAVRERAVSCASYFQ-IGKKTCDMTQQLLALLCTDTSADVRRQILLNVRDRTEFTNGYF  215

Query  211  QAALKRTRDINDTVRKIAYIFISKITVRSLTIKQR------EQLLSDGLKDRSEIVRDSV  264
             + ++  RD    VR  A+  +S+     +T            L+ +GL D ++ V ++ 
Sbjct  216  SSMIRCLRDAVARVRAAAWDALSRSRWEIVTACAHMRGVNLPSLIKEGLADGNKTVANAC  275

Query  265  KKVLLPSWLQHFQGD  279
            +  L  SWL    GD
Sbjct  276  RAALTDSWLHRDNGD  290


 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 46/220 (21%), Positives = 82/220 (37%), Gaps = 33/220 (15%)

Query  590  VHLLALKAVAICCLLDKELAKKHIMMFFLQFS-IEQDNQD-IWIMALKSIFDLLLFYGME  647
            V +++ K++ + CL++ +     + +     + +  +  D + + AL  +FDL++ YG+ 
Sbjct  582  VKIVSTKSLGLQCLVNPDTVHTFMPLIMSDATDVTTEKGDCVSLAALGVVFDLVMEYGLR  641

Query  648  YFDI-MQNEEENVSSNKSKNRTVKLYS-NTDDTLIPESTVSETENNYL------------  693
            +FD   +       SN+S++   +  S   DD     S  S    + L            
Sbjct  642  FFDCPTETRASGTYSNRSRSVAGEEVSYREDDDATAHSPASAGGESALEARLRHEKALSR  701

Query  694  ---------NIIKILTGLLDNANQDLRTIATEGLCKLLLNRRISS-------ATLLSRLI  737
                     N++  L   +   N    T+A  G  KLL   R+         A LL+ L+
Sbjct  702  EDEHKVGGGNLLNSLRAFVWTNNAVRSTMAVVGFSKLLSCSRVHPRYVPEIIADLLTHLV  761

Query  738  ILWHNPIT-EGDIYLRQCLCSFFNSFVVHIPDCQEMLEQA  776
                   T     Y+   L  FF S+       Q M  Q 
Sbjct  762  AHRKGEKTNNSSAYMVDYLSKFFQSYASSHDQRQSMFAQG  801



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584824.1 spastin isoform X2 [Cephus cinctus]

Length=620
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPAST_DROME  unnamed protein product                                  639     0.0  
FIGL1_CAEEL  unnamed protein product                                  310     2e-97
SPAST_CAEEL  unnamed protein product                                  304     5e-96


>SPAST_DROME unnamed protein product
Length=758

 Score = 639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/672 (54%), Positives = 449/672 (67%), Gaps = 98/672 (15%)

Query  37   SYNHHNHHGHRFTDNPQPSVHKRNLYIVSFPLILLFNVLRTLLYQLFVIFKYLYASTSHL  96
            S +HH++ G+        SVHK+NLY+VSFP+I LFNVLR+L+YQLF IF+YLY +++ +
Sbjct  97   SGHHHSYGGY------SSSVHKQNLYVVSFPIIFLFNVLRSLIYQLFCIFRYLYGASTKV  150

Query  97   LQRRQVVRNTCQLEIVVGQESSEGLLSVSTGLRSTEE----MSQTSRRPAGPGPGDPL--  150
            + R    R  C +EIVV   S E   S++       E      Q S +P    P  PL  
Sbjct  151  IYRPH--RRDCNIEIVVQNSSKEQQQSLNHPSELNREGDGQEQQLSNQPQRFRPIQPLEM  208

Query  151  -----------------LAKQKHHHRRAFEFISKALKIDEENEGQKEMAIELYKKGIGEL  193
                             LAKQKHHHRRAFE+ISKALKIDEENEG KE+AIELY+KGI EL
Sbjct  209  AANRPGGGYSPGPGDPLLAKQKHHHRRAFEYISKALKIDEENEGHKELAIELYRKGIKEL  268

Query  194  EKGIAVECKGGRGEVWERAQRLQEKMRTNLSMAKDRLDFLASGRKLAVPGKRIAGSVMSK  253
            E GIAV+C  GRG+VW+RAQRL +KM+TNLSMA+DRL FLA  R+  +  +R++     K
Sbjct  269  EDGIAVDCWSGRGDVWDRAQRLHDKMQTNLSMARDRLHFLAL-REQDLQMQRLSLKEKQK  327

Query  254  SQTLPRSMGRSTPTLPCHRTTPIK-------------PSSTPPSVKRQLSVPGNGSPV--  298
             +   +      P L      P+K              S+ P +  R+L++ G+  PV  
Sbjct  328  EEAQSKPQKTREPMLAGMTNEPMKLRVRSSGYGPKATTSAQPTASGRKLTI-GSKRPVNL  386

Query  299  -----------------------RRPGTPSGT--------SSNKGTPTRKAPT-------  320
                                   R+P   + T        SS + TP +++ T       
Sbjct  387  AVANKSQTLPRNLGSKTSVGAVQRQPAKTAATPPAVRRQFSSGRNTPPQRSRTPINNNGP  446

Query  321  -----------LKGVDPKLAQVILDEILEGGTAVHWEDIAGQETAKQALQEMVILPSLRP  369
                       +KGV+ KL Q+ILDEI+EGG  V W DIAGQ+ AKQALQEMVILPS+RP
Sbjct  447  SGSGASTPVVSVKGVEQKLVQLILDEIVEGGAKVEWTDIAGQDVAKQALQEMVILPSVRP  506

Query  370  ELFTGLRTPSRGLLLFGPPGNGKTLLARAVATQCNATFFSISAASLTSKYVGEGEKLVRA  429
            ELFTGLR P++GLLLFGPPGNGKTLLARAVAT+C+ATF +ISAASLTSKYVG+GEKLVRA
Sbjct  507  ELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATFLNISAASLTSKYVGDGEKLVRA  566

Query  430  LFAIARQLQPSVIFIDEVDSLLSERKDNEHEASRRLKTEFLVEFDGLPCSPE-ERILVMA  488
            LFA+AR +QPS+IFIDEVDSLLSER  +EHEASRRLKTEFLVEFDGLP +P+ +RI+V+A
Sbjct  567  LFAVARHMQPSIIFIDEVDSLLSERSSSEHEASRRLKTEFLVEFDGLPGNPDGDRIVVLA  626

Query  489  ATNRPQELDEAALRRFSKRVYVTLPNLQTRILLLRRLLSKHNYNLTHEELNQMAVLTEGY  548
            ATNRPQELDEAALRRF+KRVYV+LP+ QTR LLL RLL K    L  E L ++A +T+GY
Sbjct  627  ATNRPQELDEAALRRFTKRVYVSLPDEQTRELLLNRLLQKQGSPLDTEALRRLAKITDGY  686

Query  549  SGSDLTGLAKDAALGPIRELNPEQVKEMDANLVRSITMQDFLDSLKRIRRSVSPASLAAY  608
            SGSDLT LAKDAAL PIRELN EQVK +D + +R+IT QDF  SLKRIRRSV+P SL +Y
Sbjct  687  SGSDLTALAKDAALEPIRELNVEQVKCLDISAMRAITEQDFHSSLKRIRRSVAPQSLNSY  746

Query  609  EKWSLEYGDVSL  620
            EKWS +YGD+++
Sbjct  747  EKWSQDYGDITI  758


>FIGL1_CAEEL unnamed protein product
Length=594

 Score = 310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/362 (46%), Positives = 245/362 (68%), Gaps = 11/362 (3%)

Query  255  QTLPRSMGRSTPTLPCHRTTPIKPSSTPPSVKRQLSVPGNGSPVRRPGTPSGTSSNKGTP  314
            Q+  +S+G      P  R   I    + P +++ + +   G          G    K + 
Sbjct  235  QSSSQSIGSLAGIPPARRAPDIPKRCSNPLIRKAMGMDTEG----------GGKDEKMSG  284

Query  315  TRKAPTLKGVDPKLAQVILDEILEGGTAVHWEDIAGQETAKQALQEMVILPSLRPELFTG  374
             R  PTLK  D  +  +I  EI+     + W D+AG E AK+AL+E+V+LP  RP++FTG
Sbjct  285  LRAEPTLKHFDENIISLIESEIMSVNNEIGWADVAGLEGAKKALREIVVLPFKRPDVFTG  344

Query  375  LRTPSRGLLLFGPPGNGKTLLARAVATQCNATFFSISAASLTSKYVGEGEKLVRALFAIA  434
            +R P +G+LLFGPPG GKT++ R VA+QC ATFF+ISA+SLTSK+VGEGEKLVRALF++A
Sbjct  345  IRAPPKGVLLFGPPGTGKTMIGRCVASQCKATFFNISASSLTSKWVGEGEKLVRALFSVA  404

Query  435  RQLQPSVIFIDEVDSLLSERKDNEHEASRRLKTEFLVEFDGLPCSPEERILVMAATNRPQ  494
            R   PSVIFIDE+DSLLS R ++EHE+SRR+KTEFLV+ DG+  +P+ER+LV+ ATNRPQ
Sbjct  405  RLKLPSVIFIDEIDSLLSSRSESEHESSRRIKTEFLVQLDGVNTAPDERLLVLGATNRPQ  464

Query  495  ELDEAALRRFSKRVYVTLPNLQTRILLLRRLLSKHNYNLTHEELNQMAVLTEGYSGSDLT  554
            ELDEAA RRF KR+Y+ LP  ++R  +++ LL    +++T+  L ++  LT+GYSG+D+ 
Sbjct  465  ELDEAARRRFQKRLYIALPEPESRTQIVQNLLVGTRHDITNHNLERIRELTDGYSGADMR  524

Query  555  GLAKDAALGPIRELNPEQVKEMDANLVRSITMQDFLDSLKRIRRSVSPASLAAYEKWSLE  614
             L  +AA+GPIR++  + ++ +D + +R++T+ DF ++ + +R +V  + L AY  W  +
Sbjct  525  QLCTEAAMGPIRDIG-DDIETIDKDDIRAVTVMDFAEAARVVRPTVDDSQLDAYAAWDKK  583

Query  615  YG  616
            +G
Sbjct  584  FG  585


>SPAST_CAEEL unnamed protein product
Length=512

 Score = 304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/306 (50%), Positives = 206/306 (67%), Gaps = 3/306 (1%)

Query  313  TPTRKAPTLKGVDPKLAQVILDEILEGGTAVHWEDIAGQETAKQALQEMVILPSLRPELF  372
             P  +A  L GVD  + + +LDE+L+  T V  +D+AG  +AK AL+E VILP+L P LF
Sbjct  207  NPVNRAALLNGVDKVIGERLLDEVLDN-TGVRMDDVAGCHSAKAALEEAVILPALNPNLF  265

Query  373  TGLRTPSRGLLLFGPPGNGKTLLARAVATQCNATFFSISAASLTSKYVGEGEKLVRALFA  432
             GLR P +G+LLFGPPGNGKTLLA+AVA +    FF+ISA+SLTSK+VG+ EK +R LF 
Sbjct  266  KGLRQPVKGILLFGPPGNGKTLLAKAVAGESKQMFFNISASSLTSKWVGDSEKTIRGLFQ  325

Query  433  IARQLQPSVIFIDEVDSLLSERKDNEHEASRRLKTEFLVEFDGLPCSPEERILVMAATNR  492
            IAR  QPS+IFIDE+DS+L ER + + E SRR+KTEFLV+FDG   S ++RILV+ ATNR
Sbjct  326  IARNAQPSIIFIDEIDSILCERSEKDAEVSRRMKTEFLVQFDGATSSADDRILVIGATNR  385

Query  493  PQELDEAALRRFSKRVYVTLPNLQTRILLLRRLLSKHNY--NLTHEELNQMAVLTEGYSG  550
            P ELD+A LRRF KR+ + LP+ + R  L+ + L KHN    L   ++  +A  T G+S 
Sbjct  386  PHELDDAVLRRFPKRIMLNLPDEEARKELITKTLKKHNMMDGLISSDIRYIASNTSGFSN  445

Query  551  SDLTGLAKDAALGPIRELNPEQVKEMDANLVRSITMQDFLDSLKRIRRSVSPASLAAYEK  610
            SDL  L K+AA+ PIRE++  ++   D   +R I   DF  +L+ IR S S   ++    
Sbjct  446  SDLVALCKEAAMVPIREIDRSKLSMTDGEKIRKIRASDFDTALRTIRPSTSQKIMSKLSD  505

Query  611  WSLEYG  616
            +S  +G
Sbjct  506  FSRSFG  511



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584825.1 dihydrolipoyllysine-residue succinyltransferase
component of 2-oxoglutarate dehydrogenase complex, mitochondrial
[Cephus cinctus]

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGQ1_DROME  unnamed protein product                                 416     3e-142
Q8IEA6_PLAF7  unnamed protein product                                 332     9e-110
Q383B2_TRYB2  unnamed protein product                                 316     3e-104


>Q9VGQ1_DROME unnamed protein product
Length=468

 Score = 416 bits (1070),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/249 (78%), Positives = 226/249 (91%), Gaps = 0/249 (0%)

Query  233  AKVQLPPQDYSREIIGTRTEQRVKMNRMRLRIAERLKEAQNTNAMLTTFNEIDMSRIIEF  292
            A+V++PP D SR+I+GTR+EQRVKMNRMRL+IA RLK+AQNT AMLTTFNE+DMS  ++F
Sbjct  220  AQVKVPPADGSRQILGTRSEQRVKMNRMRLKIAARLKDAQNTCAMLTTFNEVDMSYAMDF  279

Query  293  RKTNQEAFTKKYGLKLGFMSPFIAASAYALKDQPVVNAVIDGGDIVYRDYVDVSVAVATP  352
            RK N +AFTKKYG+K GFMS F  ASAYAL+DQPVVNAVIDG DIVYRDYVD+SVAVATP
Sbjct  280  RKQNLDAFTKKYGIKFGFMSIFAKASAYALQDQPVVNAVIDGTDIVYRDYVDISVAVATP  339

Query  353  KGLVVPVLRSVENKNYAEIEIALAAMGDKARKGKISVEDMDGGTFTISNGGVFGSLFGTP  412
            +GLVVPV+R+VE  NYA+IEIALA + DKAR+  I+VEDMDGGTFTISNGGVFGSL GTP
Sbjct  340  RGLVVPVIRNVEGMNYADIEIALAGLADKARRDAITVEDMDGGTFTISNGGVFGSLMGTP  399

Query  413  IINPPQSAILGMHGVFDRPIAVKGQVVIRPMMYVALTYDHRLIDGREAVMFLRKIKEAVE  472
            IINPPQSAILGMHG+F+RPIAVKG+V IRPMMY+ALTYDHR+IDGREAV+FLRKIK AVE
Sbjct  400  IINPPQSAILGMHGIFERPIAVKGEVKIRPMMYIALTYDHRIIDGREAVLFLRKIKAAVE  459

Query  473  DPRVILAGL  481
            +P +I+AGL
Sbjct  460  NPAIIVAGL  468


>Q8IEA6_PLAF7 unnamed protein product
Length=421

 Score = 332 bits (850),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 179/405 (44%), Positives = 242/405 (60%), Gaps = 30/405 (7%)

Query  75   WEIREVVVPPFAESVSEGDVR-WEKKVGDQVKEDDVLCEIETDKTSVPVPSPGTGVIKEL  133
            + I  + VP   +S++EG +  W+KKVGD VK D+ +  I+TDK SV + S  +G + ++
Sbjct  43   FSIETIKVPRLGDSITEGTINEWKKKVGDYVKADETITIIDTDKVSVDINSKVSGGLSKI  102

Query  134  FAKDGDTVKPGQKLCTIDIGASGGAAPAAKAEAPTAAAPKPTPPPPPSPSAKPATAARPP  193
            FA  GD V     LC ID                       T   PP    K        
Sbjct  103  FADVGDVVLVDAPLCEID-----------------------TSVEPPEDICKTKEEV-GE  138

Query  194  PPPPPPPPPPPPASRPPAPQAPVTSMPVAAIKHAQSLESAKVQLPPQDYSREIIGTRTEQ  253
                         +R    +A +        K+ + +          DY  E I  RTE+
Sbjct  139  SKNNENNYTFNQLNRDIKDEAHIKD---EVSKNEKDIFVKDPICFGNDY--ESINERTER  193

Query  254  RVKMNRMRLRIAERLKEAQNTNAMLTTFNEIDMSRIIEFRKTNQEAFTKKYGLKLGFMSP  313
            RV+M  +R RIAERLKE+QNT A+LTTFNE DMS+ +  R    + F KKY  KLGF+S 
Sbjct  194  RVRMLPIRKRIAERLKESQNTCALLTTFNECDMSKAMLLRSELNDIFQKKYSCKLGFVSL  253

Query  314  FIAASAYALKDQPVVNAVIDGGDIVYRDYVDVSVAVATPKGLVVPVLRSVENKNYAEIEI  373
            F+ AS  ALK  P VNA I+  +IVY++Y+D+SVAVATP GL VPV+R+ +NKN  ++E+
Sbjct  254  FMYASTLALKKMPNVNAYIENDEIVYKNYIDISVAVATPNGLTVPVIRNCQNKNLPQLEL  313

Query  374  ALAAMGDKARKGKISVEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGVFDRPIA  433
            AL+ +  KAR  K+S++D  GGTFTISNGGVFGS+  TPIIN PQSAILGMH + +RP+ 
Sbjct  314  ALSDLATKARSNKLSIDDFSGGTFTISNGGVFGSMLSTPIINMPQSAILGMHTIKNRPVV  373

Query  434  VKGQVVIRPMMYVALTYDHRLIDGREAVMFLRKIKEAVEDPRVIL  478
            V  ++VIRP+MY+ALTYDHRL+DGREAV FL  I++ +E+P ++L
Sbjct  374  VNNEIVIRPIMYLALTYDHRLLDGREAVQFLCAIRDYIENPNLML  418


>Q383B2_TRYB2 unnamed protein product
Length=383

 Score = 316 bits (809),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 186/401 (46%), Positives = 241/401 (60%), Gaps = 50/401 (12%)

Query  80   VVVPPFAESVSEGDV-RWEKKVGDQVKEDDVLCEIETDKTSVPVPSPGTGVIKELFAKDG  138
            + VP  AES+S G V  W KKVGD V ED+++C+IE+DK +V V +P  GVI ++  ++G
Sbjct  28   ICVPTIAESISSGKVVGWTKKVGDAVAEDEIICQIESDKLNVDVRAPAAGVITKINFEEG  87

Query  139  DTVKPGQKLCTIDIGASGGAAPAAKAEAPTAAAPKPTPPPPPSPSAKPATAARPPPPPPP  198
              V         D+GA                    T     +P+AK  TA +P    P 
Sbjct  88   TVV---------DVGAE-----------------LSTMKEGEAPAAKAETADKPKQNAPA  121

Query  199  PPPPPPPASRPPAPQAPVTSMPVAAIKHAQSLESAKVQLPPQDYSREIIGTRTEQRVKMN  258
               PP  +    AP+    + PV +      + S                      V+++
Sbjct  122  AAAPPKASPTEAAPKPAPAAAPVTSRGADPRVRS----------------------VRIS  159

Query  259  RMRLRIAERLKEAQNTNAMLTTFNEIDMSRIIEFRKTNQEAFTKKYGLKLGFMSPFIAAS  318
             MR RIA+RLK +QNT AMLTTFNEIDM+ +IE R   ++ F KK G+KLGFMSPF+ A 
Sbjct  160  SMRQRIADRLKASQNTCAMLTTFNEIDMTPLIELRNRYKDDFFKKNGVKLGFMSPFVKAC  219

Query  319  AYALKDQPVVNAVIDGGDIVYRDYVDVSVAVATPKGLVVPVLRSVENKNYAEIEIALAAM  378
            A AL+D P+VNA      I Y DYVD+SVAV+TPKGLVVPVLR V+N N+A+IE  +A  
Sbjct  220  AIALQDVPIVNASFGTDCIEYHDYVDISVAVSTPKGLVVPVLRDVQNSNFAQIEKQIADF  279

Query  379  GDKARKGKISVEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGVFDRPIAVKGQV  438
            G++AR  K+++ +M GGTFTISNGGVFGS  GTPI+NPPQSAILGMH    +P  V   V
Sbjct  280  GERARSNKLTMAEMTGGTFTISNGGVFGSWMGTPIVNPPQSAILGMHATKKKPWVVGNSV  339

Query  439  VIRPMMYVALTYDHRLIDGREAVMFLRKIKEAVEDP-RVIL  478
            V R +M VALTYDHRLIDG +AV FL K+K  +EDP R++L
Sbjct  340  VPRDIMAVALTYDHRLIDGSDAVTFLVKVKNLIEDPARIVL  380



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584826.1 26S proteasome regulatory subunit 4 [Cephus cinctus]

Length=440
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRS4_DROME  unnamed protein product                                   837     0.0  
PRS4_CAEEL  unnamed protein product                                   735     0.0  
PRS4_DICDI  unnamed protein product                                   646     0.0  


>PRS4_DROME unnamed protein product
Length=439

 Score = 837 bits (2161),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/440 (96%), Positives = 432/440 (98%), Gaps = 1/440 (0%)

Query  1    MGQNQSGAGGTGGDKKDDKDKKKKYEPPIPTRVGKKKRRTKGPDAALKLPQVTPHTRCRL  60
            MGQNQS  GG  G+KKDDKDKKKKYEPPIPTRVGKKKRR KGPDAA+KLPQVTPHTRCRL
Sbjct  1    MGQNQSAQGG-AGEKKDDKDKKKKYEPPIPTRVGKKKRRAKGPDAAMKLPQVTPHTRCRL  59

Query  61   KLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIIDDNH  120
            KLLKLERIKDYL+ME+EFIRNQERLKPQ+EKNEEERSKVDDLRGTPMSVG LEEIIDDNH
Sbjct  60   KLLKLERIKDYLMMEDEFIRNQERLKPQDEKNEEERSKVDDLRGTPMSVGNLEEIIDDNH  119

Query  121  AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLEKAP  180
            AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVL DDTDPMVTVMKLEKAP
Sbjct  120  AIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAP  179

Query  181  QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA  240
            QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA
Sbjct  180  QETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVA  239

Query  241  NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSG  300
            NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSG
Sbjct  240  NQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSG  299

Query  301  GEREIQRTMLELLNQLDGFDSRGDVKVVMATNRIETLDPALIRPGRIDRKIEFPLPDEKT  360
            GEREIQRTMLELLNQLDGFDSRGDVKV+MATNRIETLDPALIRPGRIDRKIEFPLPDEKT
Sbjct  300  GEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKT  359

Query  361  KRRIFSIHTSRMTLAPDVNLAELIMAKDDLSGADIKAICTEAGLMALRERRMKVTSEDFK  420
            KRRIF+IHTSRMTLA DVNL+ELIMAKDDLSGADIKAICTEAGLMALRERRMKVT+EDFK
Sbjct  360  KRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFK  419

Query  421  KSKESVLYRKKEGSPEGLYL  440
            KSKESVLYRKKEG+PEGLYL
Sbjct  420  KSKESVLYRKKEGTPEGLYL  439


>PRS4_CAEEL unnamed protein product
Length=443

 Score = 735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/443 (85%), Positives = 413/443 (93%), Gaps = 3/443 (1%)

Query  1    MGQNQSGAGGTGGDK---KDDKDKKKKYEPPIPTRVGKKKRRTKGPDAALKLPQVTPHTR  57
            MGQ QSG GG G D+     +K +KKKYE PIP+R+GKKK+ +KGPDAA KLP VTPH R
Sbjct  1    MGQQQSGFGGRGNDRGAGDGEKKEKKKYEAPIPSRIGKKKKGSKGPDAASKLPAVTPHAR  60

Query  58   CRLKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSKVDDLRGTPMSVGTLEEIID  117
            CRLKLLK ERIKDYLLME+EFI+NQERLKPQEE+ EEER+KVD+LRGTPM+VG+LEEIID
Sbjct  61   CRLKLLKSERIKDYLLMEQEFIQNQERLKPQEERQEEERAKVDELRGTPMAVGSLEEIID  120

Query  118  DNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKLE  177
            D HAIVST+VGSEHYV+I+SFVDK+QLEPGCSVLLNHK HAV+GVL DDTDPMV+VMKLE
Sbjct  121  DQHAIVSTNVGSEHYVNIMSFVDKEQLEPGCSVLLNHKNHAVIGVLSDDTDPMVSVMKLE  180

Query  178  KAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAK  237
            KAPQETYAD+GGLD QIQEIKE+VELPLTHPEYYEEMGI+PPKGVILYG PGTGKTLLAK
Sbjct  181  KAPQETYADVGGLDQQIQEIKEAVELPLTHPEYYEEMGIRPPKGVILYGCPGTGKTLLAK  240

Query  238  AVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDS  297
            AVANQTSATFLR+VGSELIQKYLGDGPK+VRELFRVAEE+APSIVFIDEIDAVGTKRYDS
Sbjct  241  AVANQTSATFLRIVGSELIQKYLGDGPKMVRELFRVAEENAPSIVFIDEIDAVGTKRYDS  300

Query  298  NSGGEREIQRTMLELLNQLDGFDSRGDVKVVMATNRIETLDPALIRPGRIDRKIEFPLPD  357
            NSGGEREIQRTMLELLNQLDGFDSRGDVKV+MATNRIE+LDPALIRPGRIDRKIEFPLPD
Sbjct  301  NSGGEREIQRTMLELLNQLDGFDSRGDVKVLMATNRIESLDPALIRPGRIDRKIEFPLPD  360

Query  358  EKTKRRIFSIHTSRMTLAPDVNLAELIMAKDDLSGADIKAICTEAGLMALRERRMKVTSE  417
            EKTKRRIF IHTSRMTL  +VNL E I AKD+LSGADIKA+CTEAGL+ALRERRM+VT E
Sbjct  361  EKTKRRIFQIHTSRMTLGKEVNLEEFITAKDELSGADIKAMCTEAGLLALRERRMRVTME  420

Query  418  DFKKSKESVLYRKKEGSPEGLYL  440
            DF+KSKE+VLYRKKEG+PE LYL
Sbjct  421  DFQKSKENVLYRKKEGAPEELYL  443


>PRS4_DICDI unnamed protein product
Length=439

 Score = 646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/444 (73%), Positives = 383/444 (86%), Gaps = 9/444 (2%)

Query  1    MGQNQSGAGGTGGDKKDDKDKKKKYEPPIP-TRVGKKKRRTKGPDAALKLPQVTPHTRCR  59
            MG NQS   G  G+KKD    + KY+PP P T+ GKKK+R +G + + KLP +TPH++C+
Sbjct  1    MGNNQSQGQGDKGEKKD----QPKYQPPPPPTQFGKKKKR-RGAETSTKLPVITPHSKCK  55

Query  60   LKLLKLERIKDYLLMEEEFIRNQERLKPQEEKNEEERSK---VDDLRGTPMSVGTLEEII  116
            LK LKLERIKDYLLME+EF++N +  +P+ ++N +E++    +++LRG P++VG LEEII
Sbjct  56   LKQLKLERIKDYLLMEQEFLQNYDLNQPKVDENSKEQADEKIIEELRGDPLTVGNLEEII  115

Query  117  DDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLGDDTDPMVTVMKL  176
            DDNHAIVS++VG EHYV I+SFVDK +L  G +VLLN+K  +VVGV+  + DPMV VMK+
Sbjct  116  DDNHAIVSSTVGPEHYVRIMSFVDKSKLYLGATVLLNNKTLSVVGVIDGEVDPMVNVMKV  175

Query  177  EKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLA  236
            EKAP E+Y+DIGGL+ Q+QE+KE++ELPLTHPE YEE+GIKPPKGVILYG PGTGKTLLA
Sbjct  176  EKAPTESYSDIGGLEAQVQEMKEAIELPLTHPELYEEIGIKPPKGVILYGEPGTGKTLLA  235

Query  237  KAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYD  296
            KAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E APSIVFIDEIDAVGTKRYD
Sbjct  236  KAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADECAPSIVFIDEIDAVGTKRYD  295

Query  297  SNSGGEREIQRTMLELLNQLDGFDSRGDVKVVMATNRIETLDPALIRPGRIDRKIEFPLP  356
            S SGGEREIQRTMLELLNQLDGFD+R DVKV+MATNRIETLDPALIRPGRIDRKIEFPLP
Sbjct  296  SQSGGEREIQRTMLELLNQLDGFDARTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLP  355

Query  357  DEKTKRRIFSIHTSRMTLAPDVNLAELIMAKDDLSGADIKAICTEAGLMALRERRMKVTS  416
            D KTKR+IF IHT++M L+ DVNL E +M+KDDLSGADIKAICTE+GL+ALRERRM+VT 
Sbjct  356  DIKTKRKIFEIHTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTH  415

Query  417  EDFKKSKESVLYRKKEGSPEGLYL  440
             DFKK+KE VLYRK  G+PEGLY+
Sbjct  416  TDFKKAKEKVLYRKTAGAPEGLYM  439



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584827.1 nucleolysin TIAR [Cephus cinctus]

Length=392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCE3_DROME  unnamed protein product                                 449     2e-156
Q8IMX4_DROME  unnamed protein product                                 448     4e-156
Q8SZP5_DROME  unnamed protein product                                 448     5e-156


>Q9VCE3_DROME unnamed protein product
Length=464

 Score = 449 bits (1154),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 260/377 (69%), Gaps = 64/377 (17%)

Query  3    EESNPRTLYVGNLDASVSEDLLCALFSQIGAVKGCKIIREPGNDPYAFVEFTNHQCAATA  62
            +ES P+TLYVGNLD+SVSEDLL ALFS +G VK CKIIREPGNDPYAF+E++N+Q A TA
Sbjct  2    DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTA  61

Query  63   LAAMNKRSFLDKEMKVNWATSPGNQPKLDTSNHHHIFVGDLSPEIETQTLKEAFAPFGEI  122
            L AMNKR FL+KE+KVNWATSPGNQPK D S+HHHIFVGDLSPEIET+TL+EAFAPFGEI
Sbjct  62   LTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEI  121

Query  123  SNCRIVRDPQTLKSKGYAFVSFVKKSEAEAAIAAMNGQWIGSRCIRTNWSTRKPPPPRSE  182
            SNCRIVRDP T+KSKGYAFVSFVKK+EAE AI AMNGQWIGSR IRTNWSTRK PPPR  
Sbjct  122  SNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREP  181

Query  183  RPRHA----------------NNSKPNYEEVYNQSSPTNCTVYCGGF-TNGITDDLITKT  225
                                  + +  +EEVYNQSSPTN TVYCGGF  N I+DDL+ K 
Sbjct  182  SKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKH  241

Query  226  FSPFGTIQDIRVFKDKGYAFIKFTTKEAATHAIESTHNTEINGSIVKCFWGKENGDPNSV  285
            F  FG IQD+RVFKDKG++FIKF TKEAA HAIE THN+E++G++VKCFWGKENG  NS 
Sbjct  242  FVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNSA  301

Query  286  G-------------------------------PNANQQAQQVTAGAG-------------  301
                                            P      QQ+ A  G             
Sbjct  302  NNLNAAAAAAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAAIPGQMMTPQQI  361

Query  302  --QYAYGYGQQMGYWYP  316
              QY Y Y QQMGYWYP
Sbjct  362  AAQYPYAY-QQMGYWYP  377


 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 28/199 (14%)

Query  90   LDTSNHHHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKSE  149
            +D S    ++VG+L   +    L   F+  G + +C+I+R+P    +  YAF+ +     
Sbjct  1    MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREP---GNDPYAFIEYSNYQA  57

Query  150  AEAAIAAMNGQWIGSRCIRTNWSTRKPPPPRSERPRHANNSKPNYEEVYNQSSPTNCTVY  209
            A  A+ AMN +    + I+ NW+T     P+++   H +                   ++
Sbjct  58   ATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHH-------------------IF  98

Query  210  CGGFTNGITDDLITKTFSPFGTIQDIRVFKD------KGYAFIKFTTKEAATHAIESTHN  263
             G  +  I  + + + F+PFG I + R+ +D      KGYAF+ F  K  A +AI++ + 
Sbjct  99   VGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG  158

Query  264  TEINGSIVKCFWGKENGDP  282
              I    ++  W      P
Sbjct  159  QWIGSRSIRTNWSTRKLPP  177


>Q8IMX4_DROME unnamed protein product
Length=470

 Score = 448 bits (1152),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 260/377 (69%), Gaps = 64/377 (17%)

Query  3    EESNPRTLYVGNLDASVSEDLLCALFSQIGAVKGCKIIREPGNDPYAFVEFTNHQCAATA  62
            +ES P+TLYVGNLD+SVSEDLL ALFS +G VK CKIIREPGNDPYAF+E++N+Q A TA
Sbjct  2    DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTA  61

Query  63   LAAMNKRSFLDKEMKVNWATSPGNQPKLDTSNHHHIFVGDLSPEIETQTLKEAFAPFGEI  122
            L AMNKR FL+KE+KVNWATSPGNQPK D S+HHHIFVGDLSPEIET+TL+EAFAPFGEI
Sbjct  62   LTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEI  121

Query  123  SNCRIVRDPQTLKSKGYAFVSFVKKSEAEAAIAAMNGQWIGSRCIRTNWSTRKPPPPRSE  182
            SNCRIVRDP T+KSKGYAFVSFVKK+EAE AI AMNGQWIGSR IRTNWSTRK PPPR  
Sbjct  122  SNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREP  181

Query  183  RPRHA----------------NNSKPNYEEVYNQSSPTNCTVYCGGF-TNGITDDLITKT  225
                                  + +  +EEVYNQSSPTN TVYCGGF  N I+DDL+ K 
Sbjct  182  SKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKH  241

Query  226  FSPFGTIQDIRVFKDKGYAFIKFTTKEAATHAIESTHNTEINGSIVKCFWGKENGDPNSV  285
            F  FG IQD+RVFKDKG++FIKF TKEAA HAIE THN+E++G++VKCFWGKENG  NS 
Sbjct  242  FVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNSA  301

Query  286  G-------------------------------PNANQQAQQVTAGAG-------------  301
                                            P      QQ+ A  G             
Sbjct  302  NNLNAAAAAAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAAIPGQMMTPQQI  361

Query  302  --QYAYGYGQQMGYWYP  316
              QY Y Y QQMGYWYP
Sbjct  362  AAQYPYAY-QQMGYWYP  377


 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 28/199 (14%)

Query  90   LDTSNHHHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKSE  149
            +D S    ++VG+L   +    L   F+  G + +C+I+R+P    +  YAF+ +     
Sbjct  1    MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREP---GNDPYAFIEYSNYQA  57

Query  150  AEAAIAAMNGQWIGSRCIRTNWSTRKPPPPRSERPRHANNSKPNYEEVYNQSSPTNCTVY  209
            A  A+ AMN +    + I+ NW+T     P+++   H +                   ++
Sbjct  58   ATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHH-------------------IF  98

Query  210  CGGFTNGITDDLITKTFSPFGTIQDIRVFKD------KGYAFIKFTTKEAATHAIESTHN  263
             G  +  I  + + + F+PFG I + R+ +D      KGYAF+ F  K  A +AI++ + 
Sbjct  99   VGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG  158

Query  264  TEINGSIVKCFWGKENGDP  282
              I    ++  W      P
Sbjct  159  QWIGSRSIRTNWSTRKLPP  177


>Q8SZP5_DROME unnamed protein product
Length=470

 Score = 448 bits (1152),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 231/377 (61%), Positives = 260/377 (69%), Gaps = 64/377 (17%)

Query  3    EESNPRTLYVGNLDASVSEDLLCALFSQIGAVKGCKIIREPGNDPYAFVEFTNHQCAATA  62
            +ES P+TLYVGNLD+SVSEDLL ALFS +G VK CKIIREPGNDPYAF+E++N+Q A TA
Sbjct  2    DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTA  61

Query  63   LAAMNKRSFLDKEMKVNWATSPGNQPKLDTSNHHHIFVGDLSPEIETQTLKEAFAPFGEI  122
            L AMNKR FL+KE+KVNWATSPGNQPK D S+HHHIFVGDLSPEIET+TL+EAFAPFGEI
Sbjct  62   LTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEI  121

Query  123  SNCRIVRDPQTLKSKGYAFVSFVKKSEAEAAIAAMNGQWIGSRCIRTNWSTRKPPPPRSE  182
            SNCRIVRDP T+KSKGYAFVSFVKK+EAE AI AMNGQWIGSR IRTNWSTRK PPPR  
Sbjct  122  SNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREP  181

Query  183  RPRHA----------------NNSKPNYEEVYNQSSPTNCTVYCGGF-TNGITDDLITKT  225
                                  + +  +EEVYNQSSPTN TVYCGGF  N I+DDL+ K 
Sbjct  182  SKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKH  241

Query  226  FSPFGTIQDIRVFKDKGYAFIKFTTKEAATHAIESTHNTEINGSIVKCFWGKENGDPNSV  285
            F  FG IQD+RVFKDKG++FIKF TKEAA HAIE THN+E++G++VKCFWGKENG  NS 
Sbjct  242  FVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGGDNSA  301

Query  286  G-------------------------------PNANQQAQQVTAGAG-------------  301
                                            P      QQ+ A  G             
Sbjct  302  NNLNAAAATAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAAIPGQMMTPQQI  361

Query  302  --QYAYGYGQQMGYWYP  316
              QY Y Y QQMGYWYP
Sbjct  362  AAQYPYAY-QQMGYWYP  377


 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 28/199 (14%)

Query  90   LDTSNHHHIFVGDLSPEIETQTLKEAFAPFGEISNCRIVRDPQTLKSKGYAFVSFVKKSE  149
            +D S    ++VG+L   +    L   F+  G + +C+I+R+P    +  YAF+ +     
Sbjct  1    MDESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREP---GNDPYAFIEYSNYQA  57

Query  150  AEAAIAAMNGQWIGSRCIRTNWSTRKPPPPRSERPRHANNSKPNYEEVYNQSSPTNCTVY  209
            A  A+ AMN +    + I+ NW+T     P+++   H +                   ++
Sbjct  58   ATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHH-------------------IF  98

Query  210  CGGFTNGITDDLITKTFSPFGTIQDIRVFKD------KGYAFIKFTTKEAATHAIESTHN  263
             G  +  I  + + + F+PFG I + R+ +D      KGYAF+ F  K  A +AI++ + 
Sbjct  99   VGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG  158

Query  264  TEINGSIVKCFWGKENGDP  282
              I    ++  W      P
Sbjct  159  QWIGSRSIRTNWSTRKLPP  177



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584828.1 DNA-directed RNA polymerase III subunit RPC6 [Cephus
cinctus]

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57WC7_TRYB2  unnamed protein product                                 55.1    2e-08
Q86BJ0_DROME  unnamed protein product                                 33.5    0.22 
CONT_DROME  unnamed protein product                                   29.6    4.1  


>Q57WC7_TRYB2 unnamed protein product
Length=355

 Score = 55.1 bits (131),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/277 (21%), Positives = 107/277 (39%), Gaps = 64/277 (23%)

Query  99   KIVYTIIEEAGNKGIWIRDIRFKSNLMPTQLNKILKSLETKKFIKAVKSVAASKKKVYML  158
             +V   I  +GN GI    +     L   ++ K L+ L ++K IK  +  +   K++Y+L
Sbjct  79   SLVLDAIRASGNSGIDQAALCSSLRLPKGEIIKSLQMLLSQKRIKERRCFSNRAKRIYLL  138

Query  159  YNLEPDRSVTGGAWYQDQD---FEAEFVD--------VLNQQCYRFLEQKRKETKDCRGG  207
            +  EP   VTGG +Y  +D    +  FVD        ++ Q+    LEQ  +  ++ RGG
Sbjct  139  FEFEPSDEVTGGTFYGGEDSREMDIGFVDEMRRRIMLLVAQRHSVSLEQITQHLQEARGG  198

Query  208  PIAARNITFATSREVWKFISDLGISKV--------------------KLSVDDLEMILNT  247
              +A     A    V     +  ++ +                    ++S  D ++++ T
Sbjct  199  SSSADVNATAGGTVVMTTSPNGTVATLLGDSTGSCSGGGSVGAGCVKRISQRDAQLLVQT  258

Query  248  LIYDGKVE---------------------------KTLSNDGTYLYRAVEPLLEPPG---  277
            L+ DG ++                            T +  G+       P+ +P     
Sbjct  259  LVLDGLLDCVTPSPAVPAQYQLATGRNVMRHFSAVPTAAGAGSGTKWVPAPVSQPSAWAM  318

Query  278  -LIKAPCGVCPVRKNCSDFGD--VSPINCQYITEWLA  311
              +  PC  C     C+  G+  V+P NC Y+ EW++
Sbjct  319  PAVGLPCMGCAQLHVCTASGNGVVNPRNCAYLKEWMS  355


>Q86BJ0_DROME unnamed protein product
Length=711

 Score = 33.5 bits (75),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 14/32 (44%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  271  PLLEPPGLIKAPCGVCPVRKNCSDFGDVSPIN  302
            PLL+PP L   PCG+  +R  C+ F D + I 
Sbjct  59   PLLKPPQLQPLPCGLRAIRSKCAAFVDGASIT  90


>CONT_DROME unnamed protein product
Length=1390

 Score = 29.6 bits (65),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 0/31 (0%)

Query  6     GPSEEHNVNASTEDSPEIIEQKIIALAHTKT  36
             GP  E  V  S ED P++  QK IALA+  T
Sbjct  1138  GPESEIAVIHSAEDMPQVAPQKPIALAYNST  1168



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584829.1 uncharacterized protein LOC107275202 isoform X2
[Cephus cinctus]

Length=978
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PYX_DROME  unnamed protein product                                    47.0    8e-05
FEM1_CAEEL  unnamed protein product                                   37.7    0.045
Q8SY24_DROME  unnamed protein product                                 33.9    0.79 


>PYX_DROME unnamed protein product
Length=956

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 122/288 (42%), Gaps = 54/288 (19%)

Query  56   IQNYIFDWNAIPEVFSNKENERRKLREINRNIEKETQTYKTILKLLTRGANPNYPTAPYP  115
            I   + D+ A P    N+ + R+++  ++      +++ + IL LL R A+ N       
Sbjct  148  IAKVLLDFGADP----NRWDARKEVTSLH--CAASSKSVECILLLLRRKASINIGIEKRS  201

Query  116  VLIMAIFSKSTNLVQQLLLYGADPNVTLSKQEYSLAPLHILAVIEPSFDNSIIAKSLIHA  175
             L  AI   + + V+ LL YGADPN   + Q Y+  PLH  +     F   +  + L+  
Sbjct  202  ALHYAIDVNAVDCVEILLKYGADPN---TPQVYTETPLHTASA--AGFAKCV--QLLLSH  254

Query  176  NADV------------NLRTDSTYRPDVKARVSESRSTEFLDDSQGFTALHLLALRSDYK  223
            NADV            +L  ++ Y  +    + E R+     ++   T LHL  L     
Sbjct  255  NADVRSQFGEGKVTALHLAAENDY-VECARLLLEHRAEVDCRNASHQTPLHLACLSQSIG  313

Query  224  TDKNQFLTQLVCALLCNGSNKSYQFYQGHSALSLAIVEE--NIDAMKLLLQTGQ-INVNE  280
            T         V  L+  G+N +  +  G +AL  AIV++  ++D    LL+ G  +N  +
Sbjct  314  T---------VDLLISYGANVNAVYRDGRTALHAAIVKQSRSLDCCNALLKAGADVNKAD  364

Query  281  QLGY---------DVGSCMLMM------VSCRLQEKLSA-SFIEKSIP  312
              GY         +  SC+         ++ R   ++SA SFI +  P
Sbjct  365  NYGYTPLHIAALNEFSSCVYTFIEHGADITARTDGRVSALSFIVRRTP  412


>FEM1_CAEEL unnamed protein product
Length=656

 Score = 37.7 bits (86),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 48/187 (26%), Positives = 81/187 (43%), Gaps = 28/187 (15%)

Query  114  YPVLIMAIFSKSTNLVQQLLLYGADPNV----TLSKQEYSLAPLHILAVIEPSFDNSIIA  169
            YP L++A  +   N+V+ LL  GADP+V        +     P    A      +   I 
Sbjct  50   YP-LVIAARNGHANVVEYLLEIGADPSVRGVVEFDNENIQGTPPLWAASAAGHIE---IV  105

Query  170  KSLIH-ANADVNLRTDSTYRP----------DVKARVSESRSTEFLDDSQGFTALHLLAL  218
            K LI  ANADVN  T++   P          D+   + E  +   + +  G T L + + 
Sbjct  106  KLLIEKANADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIASY  165

Query  219  RSDYKTDKNQFLTQLVCALLCNGSNKSYQFYQGHSALSLAIVEENIDAMKLLLQTGQINV  278
            R+            +V  LL  G + + +  +G++AL  A    N++ +K+LL+ G + +
Sbjct  166  RNK---------VGIVEELLKTGIDVNKKTERGNTALHDAAESGNVEVVKILLKHGSVLM  216

Query  279  NEQLGYD  285
             +  G D
Sbjct  217  KDIQGVD  223


>Q8SY24_DROME unnamed protein product
Length=861

 Score = 33.9 bits (76),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 20/157 (13%)

Query  165  NSIIAKSLIH---ANAD-VNLRTDSTYRPDVKARVSESRSTEFLDDSQGF----------  210
            N+ IAKSL+    AN + VN+   S  +  +K    ++ S  FL D              
Sbjct  7    NAKIAKSLVDNGMANINAVNMEGFSLLKSALKN--GDAFSANFLLDQNCLLDLPSKPSSD  64

Query  211  TALHLLALRSDYKTDKNQFLTQLVCALLCNGSNKSYQFYQGHSALSLAIVEENIDAMKLL  270
            TALH++    +Y  D    + ++V  +L    N + Q  +G + L +AI   N++ +KLL
Sbjct  65   TALHIIC---NYGPDNTPEIMEVVKKILQRQLNINIQNIKGETPLHIAIARRNVEMVKLL  121

Query  271  LQTGQINVNEQLGYDVGSCMLMMVSCRLQEKLSASFI  307
            L+   I++N +  YD    + + +S    E L AS +
Sbjct  122  LKVPNIDINLRT-YDEKCALELSLSMGDHEFLIASIL  157



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584830.1 claspin [Cephus cinctus]

Length=1573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CLSPN_DROME  unnamed protein product                                  155     1e-37
O17838_CAEEL  unnamed protein product                                 38.9    0.045


>CLSPN_DROME unnamed protein product
Length=1465

 Score = 155 bits (392),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 161/288 (56%), Gaps = 27/288 (9%)

Query  1239  EKYIDYDSEENEIVV-VPKKEIKKVAATFLENEAELSESEWGSADEDEKDLDKLEYEEGD  1297
             E ++DYDSEENEIVV + KK+ K  AA F++ EAELSESEWGSADEDEK++D+ + E GD
Sbjct  1153  ETFVDYDSEENEIVVEMTKKDRKIRAANFVDKEAELSESEWGSADEDEKNMDEYDIELGD  1212

Query  1298  NEEIDENQMKDQLGRIHMRQVLDDDQRNVRMIKELLFEDGDLYTDGAGRERKFRWKNMDN  1357
              ++ D ++++ +LG+IH R+++D D R VR IKE      +   +GA R+R+FRWKN++ 
Sbjct  1213  EDQFDRDKLRHELGQIHARKMMDQDIREVRKIKE---LLFEEEEEGANRQRQFRWKNVE-  1268

Query  1358  FGEDVNNPLGDNADATLEITEEENELQWRKLRLEREKFLEEKKKSGEIKDDIEEDMGSSQ  1417
              G  +++   DN +      +EENE  WRK+R ERE+ L EK    E+            
Sbjct  1269  AGFSLDDNRTDNGEGNDGSGDEENEHLWRKIRYEREQLLLEKGLKPEVAS----------  1318

Query  1418  FFKLGMKALQKRKCVQSGSQDSSNGLSKSTDPIMPRTILDLLDSPTIGAKSSILRTAVKR  1477
                L    +       S +    N +S     +  +     L S TI  K    ++AV R
Sbjct  1319  --PLSTSVINTSNNGNSPAIRRLNIISSKKTTVEVKKNSPFLISKTIAGKQQ--KSAV-R  1373

Query  1478  GSFLARGEESLARLAAM-------VNQNTETTICGAKNSRNFVFAHVS  1518
             GSFL R +++L++LA +       V+    T    +  ++NFVFA ++
Sbjct  1374  GSFLIRDQQTLSKLAGLTKGTSGDVDAAEGTISVKSAKAKNFVFATLT  1421


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 24/152 (16%)

Query  234  PNGNKINDLIDSDSDDDNNQNTRNDFAEEDHNDQKSA-EQILKKATKKRTQTARSSKE--  290
            P  NK+  L+DS+S+ +       D  EE   +Q++  E  L +   K+ +  R S +  
Sbjct  445  PVKNKLKGLVDSESEPEL------DNPEESAGEQEAPMESALSREKPKKAKVVRESAKKA  498

Query  291  -EAMRQIRSESQRLVRESNVSLPYHRPKQRTLQEFLNRRKLVSTLPKA-----------P  338
             E M+ I+SE QRL RE+++++PYH+PK RTL+EFL+RR + + L  A           P
Sbjct  499  LEGMQAIQSEQQRLHREAHINVPYHQPKPRTLKEFLSRRTINAPLATALAGGSPMPSRQP  558

Query  339  TTAAKVRMSS---NIVSQVLKEKEKEAELFYK  367
              +  +RM+       +++++++ KEA  F+K
Sbjct  559  RKSVGLRMTREELEAYAKLMEDRAKEATEFFK  590


 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 70/240 (29%), Positives = 111/240 (46%), Gaps = 35/240 (15%)

Query  581  ESLPANNTISETPFISNKELAKLNKKDNISTSSVINQVDKSDSSKMEETELSTPIGHVYG  640
            E++ A++   E P  S    A L   DN       N   KS S     TE       V  
Sbjct  659  EAMVADSITEEEPIASTSTAAALKLADNFEIQQETNA--KSPSKVCLVTE-------VVE  709

Query  641  LPFPEFE--DDIPIEKPS------AIKKKILPNVPNVRPTLRGISGMVIDF-SQDV---K  688
            LP  +    +  P  KP+       I++  +    +  P+L+G   MVID  + D+   K
Sbjct  710  LPKLDLSTINITPSSKPATPKISEVIRQLKIEKSLDESPSLKGDPNMVIDLETGDMFAKK  769

Query  689  PSKEGVNNLMNRFLKHTAIINKAETVTDVTVIHTEITADGVTATKQVIPYKIEGEKNDSE  748
            P+  GV++L+NR +K T    K +T   V ++ TE    G     +V  +  E E   ++
Sbjct  770  PT--GVDDLLNRLMK-TREAKKHKTTETVNILTTE---HGKLEMSKVSIHLHEEEI--AK  821

Query  749  LNKPGAKHVRLREELKQKMFTKRTEEWEQKEQEMKTLEKELYGDEKSTCGMD-DEELEEE  807
              KPGA +++++E LK  +  KR E+  +K+ E    ++++  DE+   GMD DEE E E
Sbjct  822  EPKPGAGYMKMQEHLKTLITKKRMEDLRKKQAEE---QEKMAEDEEE--GMDVDEEYEPE  876


>O17838_CAEEL unnamed protein product
Length=752

 Score = 38.9 bits (89),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 81/144 (56%), Gaps = 21/144 (15%)

Query  1227  EEQEENCELENEEKYID--------YDSEENEIVVVP-------KKEIKKVAATFLENEA  1271
             E +E++ E EN+E   +        +D E++E+ ++        K++IKK   T  ++EA
Sbjct  444   EPEEDDIESENDEAETEGVEAPDPNFDDEDDELAILKRLQHQEYKQKIKK--RTLFDDEA  501

Query  1272  ELSESEWGSADEDEKDLDKL-EYEEGDNEEIDEN-QMKDQLGRIHMRQVLDDDQRNVRMI  1329
              LS  + GS  EDE+ ++ + E EEGD +++ +N  ++ Q  ++ ++Q  D +QR +  +
Sbjct  502   SLSGDDVGSDLEDEEGMENVYEAEEGDADDVPDNDTIRRQNHKLLLKQENDKEQRELAKL  561

Query  1330  KELLFEDGDLYTDGAGRERKFRWK  1353
             ++ L  DGDL   G    R+FR+K
Sbjct  562   QDRLLADGDL--GGVETNRQFRFK  583



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584831.1 ribosomal RNA processing protein 36 homolog [Cephus
cinctus]

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HOOK_CAEEL  unnamed protein product                                   33.9    0.099
Q38EB6_TRYB2  unnamed protein product                                 28.9    3.0  


>HOOK_CAEEL unnamed protein product
Length=777

 Score = 33.9 bits (76),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 67/153 (44%), Gaps = 32/153 (21%)

Query  102  EKAFKHSYAFLTKLRESDLEALKKELKESDDPKRIKKIKYLIQRLENQL---------RE  152
            E A K+  A L + +   L AL  ELK S D K     K  +++LE QL          E
Sbjct  404  EDANKNGIAQL-RTQVGGLTALNTELKASLDSK-----KRCVEQLEIQLIQHKEKVKELE  457

Query  153  ENKRKLEEERNKIEKQEI----------AEDIKEGKKPSFRKKSEKKIL-------NLVS  195
            + K +L EERN++E Q I           E + E    SF   SEK  L        L  
Sbjct  458  DRKDELIEERNRLENQLIFKEAVTPRSLHESMFEAGNLSFEPFSEKNTLPLEIENKRLTE  517

Query  196  QYEELKTTGKLKKHIQRLRKKNTTKDRRKLVAT  228
            + +EL++   LK  +  L+ KN   +  KL AT
Sbjct  518  RIQELESLEPLKGELITLKSKNGVLEEEKLFAT  550


>Q38EB6_TRYB2 unnamed protein product
Length=210

 Score = 28.9 bits (63),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 26/49 (53%), Gaps = 2/49 (4%)

Query  65   PREASAKKQVPRYMEVVP-LKKTAPRDPRFDSLCGTFNEKAFKHSYAFL  112
            P E SA+ + PR    VP ++     DPRF  L G  + K F+ +Y FL
Sbjct  10   PPERSARVR-PRRQSGVPAVRPHRFVDPRFSDLYGAVDRKQFEDNYKFL  57



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584832.1 WD repeat-containing protein 92 [Cephus cinctus]

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387Q4_TRYB2  unnamed protein product                                 312     7e-104
Q9VAJ2_DROME  unnamed protein product                                 43.9    1e-04 
Q9XYF7_DROME  unnamed protein product                                 42.4    4e-04 


>Q387Q4_TRYB2 unnamed protein product
Length=386

 Score = 312 bits (799),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 222/366 (61%), Gaps = 22/366 (6%)

Query  45   IICHIEKSVNYSLFDAKWIPCSAKFVVMGSRPRGSGIIQIYEVSSGELKLIKDIERSNAM  104
            II H++K++ Y+ FD KW+P SA   ++G  P   G +   +++ GEL +  +I     +
Sbjct  25   IIEHVKKNLLYTAFDVKWVPHSACLAIVGQYPNNQGALSFMQLNKGELTVRHEIRTKLPL  84

Query  105  KCGTFKASSLRDRH----LATGDFKGRLNIYNLE------------DPSIPIYTA-NAHK  147
            KC TF  +S +       +A GDF G L+++++E            D +  ++ A  AH+
Sbjct  85   KCCTFAHNSRQMSSAALTIAAGDFAGGLSLWDVERLSSSSGDNGKFDENEALFKAPRAHE  144

Query  148  EIINSIDGVAGQSVGCGAPELVTGSRDGSVKVWDPRQKGKPVAVMEPKEGEVRRDCWTVA  207
             IIN++DG        G PE+ +  RDG VKVWD RQ  KPV V+ P +    RDCWTV 
Sbjct  145  NIINAVDGAQFT----GPPEIASCGRDGCVKVWDVRQAAKPVVVLSPADPARARDCWTVR  200

Query  208  FGNSYNSEERVVAAGYDNGDVKMFDLRAMTLRWESNLKNGVCSLEFDRKDIAMNKLVATT  267
             GNS + +ERVV AGYDNGDVK+FDLR   +  E N+ NGVC +EFDR DI MNKL+ + 
Sbjct  201  LGNSSDPDERVVVAGYDNGDVKLFDLRTQKMLHEFNVGNGVCDVEFDRPDIPMNKLIVSL  260

Query  268  LESKYYLFDLKTQHPKKGFAYLTEKAHKSTVWLVRHLPQNREIFMTCGGGGSLCLWKYNY  327
            LE +  ++D++T HP  G+AY+ E+    TVW  R LPQNRE+F  CGGGG + L +Y Y
Sbjct  261  LEGRVRVYDVRTLHPTLGYAYVEERVSSGTVWCSRALPQNREVF-ACGGGGEVTLCRYRY  319

Query  328  PERRKQTDADGLEHGVVGSVSLLQNSTLSSQPVSSLDWSPDKQGLAVCTAFDQCLRVIIT  387
            P  R   D+DG+  G+ G V  L  + +  QP+ ++DW+  K+GL  C +FDQ +RV++ 
Sbjct  320  PPERTLRDSDGVAKGIAGCVEELNKAKVGDQPIHTMDWNRSKEGLLACASFDQSIRVMLV  379

Query  388  TKLNTI  393
            TKL+ +
Sbjct  380  TKLSLV  385


>Q9VAJ2_DROME unnamed protein product
Length=326

 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 73/329 (22%), Positives = 136/329 (41%), Gaps = 55/329 (17%)

Query  60   AKWIPCSAKFVVMGSRPRGSGIIQIYEVSSGELKLIKDIERSNAMKCGTFKASSLRDRHL  119
             K+ P S +++   S     G ++ Y+V + +L+  K ++ +  + C           H+
Sbjct  19   VKFGPKSNQYMAASS---WDGTLRFYDVPANQLRQ-KFVQDAPLLDCAFMDIV-----HV  69

Query  120  ATGDFKGRLNIYNLEDPSIPIYTANAHKEIINSIDGVAGQSVGCGAPELVTGSRDGSVKV  179
             +G    +L ++++   +  I    AH+E I  ++     +       ++TGS D +VK+
Sbjct  70   VSGSLDNQLRLFDVNTQAESI--IGAHEEPIRCVEHAEYVN------GILTGSWDNTVKL  121

Query  180  WDPRQKGKPVAVMEPKEGEVRRDCWTVAFGNSYNSEERVVAAGYDNGDVKMFDLRAM---  236
            WD R+K + V   E   G+V        +  S   E+ VVA    +  V ++DLR M   
Sbjct  122  WDMREK-RCVGTFEQNNGKV--------YSMSVIDEKIVVATS--DRKVLIWDLRKMDSY  170

Query  237  TLRWESNLKNGV-CSLEFDRKDIAMNKLVATTLESKYYLFDLKTQHPKKGF-AYLTEKAH  294
             ++ ES+LK    C   F  K+  +   +   +  +Y   D + Q  K  F  +   + +
Sbjct  171  IMKRESSLKYQTRCIRLFPNKEGYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNREQN  230

Query  295  KSTVWLVRHLPQNR--EIFMTCGGGGSLCLWKYNYPERRKQTDADGLEHGVVGSVSLLQN  352
               ++ V  L  +   + F T G  G + +W             DG     +        
Sbjct  231  IEQIYPVNALSFHNVYQTFATGGSDGIVNIW-------------DGFNKKRLCQFHEYDT  277

Query  353  STLSSQPVSSLDWSPDKQGLAV-CTAFDQ  380
            S      +S+L++S D   LA+ C+  DQ
Sbjct  278  S------ISTLNFSSDGSALAIGCSYLDQ  300


>Q9XYF7_DROME unnamed protein product
Length=326

 Score = 42.4 bits (98),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 72/329 (22%), Positives = 136/329 (41%), Gaps = 55/329 (17%)

Query  60   AKWIPCSAKFVVMGSRPRGSGIIQIYEVSSGELKLIKDIERSNAMKCGTFKASSLRDRHL  119
             K+ P S +++   S     G ++ Y+V + +L+  K ++ +  + C           H+
Sbjct  19   VKFGPKSNQYMAASS---WDGTLRFYDVPANQLRQ-KFVQDAPLLDCAFMDIV-----HV  69

Query  120  ATGDFKGRLNIYNLEDPSIPIYTANAHKEIINSIDGVAGQSVGCGAPELVTGSRDGSVKV  179
             +G    +L ++++   +  I    AH+E I  ++     +       ++TGS D +VK+
Sbjct  70   VSGSLDNQLRLFDVNTQAESI--IGAHEEPIKCLEHAEYVN------GILTGSWDNTVKL  121

Query  180  WDPRQKGKPVAVMEPKEGEVRRDCWTVAFGNSYNSEERVVAAGYDNGDVKMFDLRAM---  236
            WD R+K + +   E   G+V        +  S   E+ VVA    +  V ++DLR M   
Sbjct  122  WDMREK-RCLGTFEQNNGKV--------YSMSVIDEKIVVATS--DRKVLIWDLRKMDSY  170

Query  237  TLRWESNLKNGV-CSLEFDRKDIAMNKLVATTLESKYYLFDLKTQHPKKGF-AYLTEKAH  294
             ++ ES+LK    C   F  K+  +   +   +  +Y   D + Q  K  F  +   + +
Sbjct  171  IMKRESSLKYQTRCIRLFPNKEGYVMSSIEGRVAVEYLDHDPEVQRRKFAFKCHRNREQN  230

Query  295  KSTVWLVRHLPQNR--EIFMTCGGGGSLCLWKYNYPERRKQTDADGLEHGVVGSVSLLQN  352
               ++ V  L  +   + F T G  G + +W             DG     +        
Sbjct  231  IEQIYPVNALSFHNVYQTFATGGSDGIVNIW-------------DGFNKKRLCQFQEYDT  277

Query  353  STLSSQPVSSLDWSPDKQGLAV-CTAFDQ  380
            S      +S+L++S D   LA+ C+  DQ
Sbjct  278  S------ISTLNFSSDGSALAIGCSYLDQ  300



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584833.1 DNA-directed RNA polymerases I, II, and III subunit
RPABC3 isoform X1 [Cephus cinctus]

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPAB3_CAEEL  unnamed protein product                                  146     7e-46
Q384M6_TRYB2  unnamed protein product                                 62.0    9e-13
Q24062_DROME  unnamed protein product                                 32.0    0.15 


>RPAB3_CAEEL unnamed protein product
Length=148

 Score = 146 bits (369),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 95/127 (75%), Gaps = 3/127 (2%)

Query  26   VSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLREDGYPDGGDWNAIEQEGGS  85
            VSR  C++ESFKM+LI+DINS +YP++  DK RLVLATTLREDG  D G+++   +    
Sbjct  25   VSRYFCDAESFKMELIIDINSQIYPLKQNDKVRLVLATTLREDGLADEGEYDPKAEY--P  82

Query  86   RADSFEYVMSGKVYRIEGDEASNEPSSRLSAYVSFGGLLMRLQGDANNLHGFEIDQHMYL  145
            R   +EYVM GKVYR+E D+   +   +L+AY SFGGLLMRL+G+A NLHGFE+D ++YL
Sbjct  83   RIKQYEYVMYGKVYRLEDDDTGTD-GGKLAAYASFGGLLMRLKGEAINLHGFEVDMNLYL  141

Query  146  LMKKLAF  152
            LMKK  F
Sbjct  142  LMKKTDF  148


>Q384M6_TRYB2 unnamed protein product
Length=149

 Score = 62.0 bits (149),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/124 (27%), Positives = 62/124 (50%), Gaps = 4/124 (3%)

Query  26   VSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATTLREDGYPDGGDWNAIEQEGGS  85
            VSR+ C  E   + +  D+N+  +P+  GD+  ++L  ++          ++       +
Sbjct  27   VSRVRCTGEGGGLIITSDVNTGEFPLHSGDRLTIILTDSIELSEQAGSKHYDQSVYHRST  86

Query  86   RADSFEYVMSGKVYRIEGDEASNEPSSRLSAYVSFGGLLMRLQGDANNLHGFEIDQHMYL  145
            R D  +Y M G+VY +E     NE S  ++ ++S GGLL ++ G   +L     +  +Y+
Sbjct  87   RLDDCDYAMHGRVYSME----VNESSLDVTVHISCGGLLTQIVGKPQSLKDVHYNSDVYI  142

Query  146  LMKK  149
            LMK+
Sbjct  143  LMKR  146


>Q24062_DROME unnamed protein product
Length=575

 Score = 32.0 bits (71),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 46/105 (44%), Gaps = 9/105 (9%)

Query  11   RGAISTCTRSWQTYIVSRLHCESESFKMD---LILDINSWLYPMELGDKFRL----VLAT  63
            R  I    ++   Y +++L+   + + +    L   +N  +Y  E+   F L    VLA 
Sbjct  154  RETIRFSVKTGHPYFINQLYSGVDPYALVGQWLTDALNPSVYTYEVAPLFTLMEEQVLAE  213

Query  64   TLREDGYPDGGDWNAIEQEGGSRADSFEYVMSGKVYRIEGDEASN  108
              R  G+P+GG  + I   GGS A+   Y +S   YR   +   N
Sbjct  214  MRRIVGFPNGGQGDGIFCPGGSIANG--YAISCARYRHSPESKKN  256



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584834.1 DNA-directed RNA polymerases I, II, and III subunit
RPABC3 isoform X2 [Cephus cinctus]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPAB3_CAEEL  unnamed protein product                                  183     2e-60
Q384M6_TRYB2  unnamed protein product                                 80.5    7e-20
Q24062_DROME  unnamed protein product                                 31.2    0.34 


>RPAB3_CAEEL unnamed protein product
Length=148

 Score = 183 bits (465),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 117/151 (77%), Gaps = 3/151 (2%)

Query  1    MAGVLFEDIFNVKDIDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVL  60
            MAG++F+D+F VK +DP+GKKFDRVSR  C++ESFKM+LI+DINS +YP++  DK RLVL
Sbjct  1    MAGIIFDDMFKVKSVDPDGKKFDRVSRYFCDAESFKMELIIDINSQIYPLKQNDKVRLVL  60

Query  61   ATTLREDGYPDGGDWNAIEQEGGSRADSFEYVMSGKVYRIEGDEASNEPSSRLSAYVSFG  120
            ATTLREDG  D G+++   +    R   +EYVM GKVYR+E D+   +   +L+AY SFG
Sbjct  61   ATTLREDGLADEGEYDPKAEY--PRIKQYEYVMYGKVYRLEDDDTGTD-GGKLAAYASFG  117

Query  121  GLLMRLQGDANNLHGFEIDQHMYLLMKKLAF  151
            GLLMRL+G+A NLHGFE+D ++YLLMKK  F
Sbjct  118  GLLMRLKGEAINLHGFEVDMNLYLLMKKTDF  148


>Q384M6_TRYB2 unnamed protein product
Length=149

 Score = 80.5 bits (197),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 74/145 (51%), Gaps = 4/145 (3%)

Query  4    VLFEDIFNVKDIDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATT  63
            V+ ED F V  ++ EG  + RVSR+ C  E   + +  D+N+  +P+  GD+  ++L  +
Sbjct  6    VILEDTFTVAAVNEEGTVYSRVSRVRCTGEGGGLIITSDVNTGEFPLHSGDRLTIILTDS  65

Query  64   LREDGYPDGGDWNAIEQEGGSRADSFEYVMSGKVYRIEGDEASNEPSSRLSAYVSFGGLL  123
            +          ++       +R D  +Y M G+VY +E     NE S  ++ ++S GGLL
Sbjct  66   IELSEQAGSKHYDQSVYHRSTRLDDCDYAMHGRVYSME----VNESSLDVTVHISCGGLL  121

Query  124  MRLQGDANNLHGFEIDQHMYLLMKK  148
             ++ G   +L     +  +Y+LMK+
Sbjct  122  TQIVGKPQSLKDVHYNSDVYILMKR  146


>Q24062_DROME unnamed protein product
Length=575

 Score = 31.2 bits (69),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 32/69 (46%), Gaps = 6/69 (9%)

Query  43   INSWLYPMELGDKFRL----VLATTLREDGYPDGGDWNAIEQEGGSRADSFEYVMSGKVY  98
            +N  +Y  E+   F L    VLA   R  G+P+GG  + I   GGS A+   Y +S   Y
Sbjct  190  LNPSVYTYEVAPLFTLMEEQVLAEMRRIVGFPNGGQGDGIFCPGGSIANG--YAISCARY  247

Query  99   RIEGDEASN  107
            R   +   N
Sbjct  248  RHSPESKKN  256



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584835.1 yae1 domain-containing protein 1 [Cephus cinctus]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIMA_DICDI  unnamed protein product                                   29.6    1.1  
Q9VML2_DROME  unnamed protein product                                 28.9    2.3  
VER1_CAEEL  unnamed protein product                                   28.5    3.0  


>DIMA_DICDI unnamed protein product
Length=1230

 Score = 29.6 bits (65),  Expect = 1.1, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  73   DHNHPLEISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVL  128
            +HN P+E+S +LD TR+ E    LK    K  N   D   +   I    +H+ ++L
Sbjct  866  EHNKPIELSELLDVTRKLE---MLKKNFVKHRNLICDTDLVLSTILTPFQHAKLIL  918


>Q9VML2_DROME unnamed protein product
Length=3489

 Score = 28.9 bits (63),  Expect = 2.3, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  2     DDQKNTEDVLELASKTWNRLTNAAVKAGFR  31
             D Q   E V+ELASK W     A  KA +R
Sbjct  2185  DLQTTREQVMELASKLWFNYVEAERKATYR  2214


>VER1_CAEEL unnamed protein product
Length=1083

 Score = 28.5 bits (62),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 45/118 (38%), Gaps = 27/118 (23%)

Query  32   EGIEDGRQSVFQEGFDKGYKEAFKTAFELGRYKG-------------LAAGLPKDHNHPL  78
            E I  G   V + G  KG K     A +   Y+              L + +PK  N   
Sbjct  807  EPIGSGHFGVVRRGILKGTKTV--VAVKSSSYRSSIGFQKVIVEELKLMSAIPKHPNVLA  864

Query  79   EISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVLDRLHEYFE  136
             + +I    R GE YI +         E  D  ++ D ++ +R    + +D LH+ F+
Sbjct  865  LVGAITKNLRHGELYILM---------EYIDGGNLRDFLQQRRN---VFIDELHDNFD  910



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584836.1 yae1 domain-containing protein 1 [Cephus cinctus]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIMA_DICDI  unnamed protein product                                   29.6    1.1  
Q9VML2_DROME  unnamed protein product                                 28.9    2.3  
VER1_CAEEL  unnamed protein product                                   28.5    3.0  


>DIMA_DICDI unnamed protein product
Length=1230

 Score = 29.6 bits (65),  Expect = 1.1, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  73   DHNHPLEISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVL  128
            +HN P+E+S +LD TR+ E    LK    K  N   D   +   I    +H+ ++L
Sbjct  866  EHNKPIELSELLDVTRKLE---MLKKNFVKHRNLICDTDLVLSTILTPFQHAKLIL  918


>Q9VML2_DROME unnamed protein product
Length=3489

 Score = 28.9 bits (63),  Expect = 2.3, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  2     DDQKNTEDVLELASKTWNRLTNAAVKAGFR  31
             D Q   E V+ELASK W     A  KA +R
Sbjct  2185  DLQTTREQVMELASKLWFNYVEAERKATYR  2214


>VER1_CAEEL unnamed protein product
Length=1083

 Score = 28.5 bits (62),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 45/118 (38%), Gaps = 27/118 (23%)

Query  32   EGIEDGRQSVFQEGFDKGYKEAFKTAFELGRYKG-------------LAAGLPKDHNHPL  78
            E I  G   V + G  KG K     A +   Y+              L + +PK  N   
Sbjct  807  EPIGSGHFGVVRRGILKGTKTV--VAVKSSSYRSSIGFQKVIVEELKLMSAIPKHPNVLA  864

Query  79   EISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVLDRLHEYFE  136
             + +I    R GE YI +         E  D  ++ D ++ +R    + +D LH+ F+
Sbjct  865  LVGAITKNLRHGELYILM---------EYIDGGNLRDFLQQRRN---VFIDELHDNFD  910



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584837.1 yae1 domain-containing protein 1 [Cephus cinctus]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIMA_DICDI  unnamed protein product                                   29.6    1.1  
Q9VML2_DROME  unnamed protein product                                 28.9    2.3  
VER1_CAEEL  unnamed protein product                                   28.5    3.0  


>DIMA_DICDI unnamed protein product
Length=1230

 Score = 29.6 bits (65),  Expect = 1.1, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  73   DHNHPLEISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVL  128
            +HN P+E+S +LD TR+ E    LK    K  N   D   +   I    +H+ ++L
Sbjct  866  EHNKPIELSELLDVTRKLE---MLKKNFVKHRNLICDTDLVLSTILTPFQHAKLIL  918


>Q9VML2_DROME unnamed protein product
Length=3489

 Score = 28.9 bits (63),  Expect = 2.3, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  2     DDQKNTEDVLELASKTWNRLTNAAVKAGFR  31
             D Q   E V+ELASK W     A  KA +R
Sbjct  2185  DLQTTREQVMELASKLWFNYVEAERKATYR  2214


>VER1_CAEEL unnamed protein product
Length=1083

 Score = 28.5 bits (62),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 45/118 (38%), Gaps = 27/118 (23%)

Query  32   EGIEDGRQSVFQEGFDKGYKEAFKTAFELGRYKG-------------LAAGLPKDHNHPL  78
            E I  G   V + G  KG K     A +   Y+              L + +PK  N   
Sbjct  807  EPIGSGHFGVVRRGILKGTKTV--VAVKSSSYRSSIGFQKVIVEELKLMSAIPKHPNVLA  864

Query  79   EISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVLDRLHEYFE  136
             + +I    R GE YI +         E  D  ++ D ++ +R    + +D LH+ F+
Sbjct  865  LVGAITKNLRHGELYILM---------EYIDGGNLRDFLQQRRN---VFIDELHDNFD  910



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584838.1 yae1 domain-containing protein 1 [Cephus cinctus]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIMA_DICDI  unnamed protein product                                   29.6    1.1  
Q9VML2_DROME  unnamed protein product                                 28.9    2.3  
VER1_CAEEL  unnamed protein product                                   28.5    3.0  


>DIMA_DICDI unnamed protein product
Length=1230

 Score = 29.6 bits (65),  Expect = 1.1, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  73   DHNHPLEISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVL  128
            +HN P+E+S +LD TR+ E    LK    K  N   D   +   I    +H+ ++L
Sbjct  866  EHNKPIELSELLDVTRKLE---MLKKNFVKHRNLICDTDLVLSTILTPFQHAKLIL  918


>Q9VML2_DROME unnamed protein product
Length=3489

 Score = 28.9 bits (63),  Expect = 2.3, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  2     DDQKNTEDVLELASKTWNRLTNAAVKAGFR  31
             D Q   E V+ELASK W     A  KA +R
Sbjct  2185  DLQTTREQVMELASKLWFNYVEAERKATYR  2214


>VER1_CAEEL unnamed protein product
Length=1083

 Score = 28.5 bits (62),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 45/118 (38%), Gaps = 27/118 (23%)

Query  32   EGIEDGRQSVFQEGFDKGYKEAFKTAFELGRYKG-------------LAAGLPKDHNHPL  78
            E I  G   V + G  KG K     A +   Y+              L + +PK  N   
Sbjct  807  EPIGSGHFGVVRRGILKGTKTV--VAVKSSSYRSSIGFQKVIVEELKLMSAIPKHPNVLA  864

Query  79   EISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVLDRLHEYFE  136
             + +I    R GE YI +         E  D  ++ D ++ +R    + +D LH+ F+
Sbjct  865  LVGAITKNLRHGELYILM---------EYIDGGNLRDFLQQRRN---VFIDELHDNFD  910



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584840.1 yae1 domain-containing protein 1 [Cephus cinctus]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIMA_DICDI  unnamed protein product                                   29.6    1.1  
Q9VML2_DROME  unnamed protein product                                 28.9    2.3  
VER1_CAEEL  unnamed protein product                                   28.5    3.0  


>DIMA_DICDI unnamed protein product
Length=1230

 Score = 29.6 bits (65),  Expect = 1.1, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query  73   DHNHPLEISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVL  128
            +HN P+E+S +LD TR+ E    LK    K  N   D   +   I    +H+ ++L
Sbjct  866  EHNKPIELSELLDVTRKLE---MLKKNFVKHRNLICDTDLVLSTILTPFQHAKLIL  918


>Q9VML2_DROME unnamed protein product
Length=3489

 Score = 28.9 bits (63),  Expect = 2.3, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 0/30 (0%)

Query  2     DDQKNTEDVLELASKTWNRLTNAAVKAGFR  31
             D Q   E V+ELASK W     A  KA +R
Sbjct  2185  DLQTTREQVMELASKLWFNYVEAERKATYR  2214


>VER1_CAEEL unnamed protein product
Length=1083

 Score = 28.5 bits (62),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 28/118 (24%), Positives = 45/118 (38%), Gaps = 27/118 (23%)

Query  32   EGIEDGRQSVFQEGFDKGYKEAFKTAFELGRYKG-------------LAAGLPKDHNHPL  78
            E I  G   V + G  KG K     A +   Y+              L + +PK  N   
Sbjct  807  EPIGSGHFGVVRRGILKGTKTV--VAVKSSSYRSSIGFQKVIVEELKLMSAIPKHPNVLA  864

Query  79   EISSILDKTRRGECYICLKNTRTKKSNETFDEKSIDDIIEDQRKHSTIVLDRLHEYFE  136
             + +I    R GE YI +         E  D  ++ D ++ +R    + +D LH+ F+
Sbjct  865  LVGAITKNLRHGELYILM---------EYIDGGNLRDFLQQRRN---VFIDELHDNFD  910



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584841.1 uncharacterized protein LOC107262803 [Cephus cinctus]

Length=78
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8X7_DROME  unnamed protein product                                 77.0    3e-20
Q57YC6_TRYB2  unnamed protein product                                 25.8    4.7  
Q8IEN9_PLAF7  unnamed protein product                                 25.0    7.7  


>Q0E8X7_DROME unnamed protein product
Length=82

 Score = 77.0 bits (188),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 4/82 (5%)

Query  1   MADAATPK----RHMKFPYTFTAKMVQFPYKYYINNCWPYKYYLISVLLVSPLFVKITSA  56
           MAD A  +    R M++PYTF+AK+ QFP K+YI N W ++YY I+ +   P+F KI+  
Sbjct  1   MADKAAAEKPAGRPMRYPYTFSAKIAQFPIKHYIKNQWIWRYYFIAAVACVPVFYKISKL  60

Query  57  VNSPANKAKWYEIRKKELEPHH  78
            NSP NK  W E + KE   HH
Sbjct  61  ANSPENKKAWAESQAKEHAEHH  82


>Q57YC6_TRYB2 unnamed protein product
Length=5290

 Score = 25.8 bits (55),  Expect = 4.7, Method: Composition-based stats.
 Identities = 10/34 (29%), Positives = 19/34 (56%), Gaps = 0/34 (0%)

Query  33    CWPYKYYLISVLLVSPLFVKITSAVNSPANKAKW  66
             C P    +++ LL  PLF ++  ++N+P +   W
Sbjct  4408  CSPSSAAVLAELLKLPLFEQVRVSLNNPEHGEAW  4441


>Q8IEN9_PLAF7 unnamed protein product
Length=619

 Score = 25.0 bits (53),  Expect = 7.7, Method: Composition-based stats.
 Identities = 10/17 (59%), Positives = 11/17 (65%), Gaps = 0/17 (0%)

Query  62   NKAKWYEIRKKELEPHH  78
            NK  W+EIRK E E  H
Sbjct  115  NKMNWFEIRKGEKEREH  131



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584842.1 protein YIF1B-B isoform X1 [Cephus cinctus]

Length=340
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMR3_DROME  unnamed protein product                                 261     9e-85
Q8MTA2_DROME  unnamed protein product                                 261     1e-84
Q9VBC5_DROME  unnamed protein product                                 261     1e-84


>Q8IMR3_DROME unnamed protein product
Length=393

 Score = 261 bits (667),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 181/262 (69%), Gaps = 23/262 (9%)

Query  94   PQFATQLLAEPMVTNMAVQYGNALVGSGKQ----QLEKYVPVTALKYYFAVDTDYVIAKL  149
            PQFA  +  +P+V +MA+QYG  L   GKQ    Q EK+VPV  LKYYFAVD  YV  KL
Sbjct  120  PQFA--MFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKL  177

Query  150  SLLFFPFTQRDWSVKYEQDGPLQPRYERNAPDLYIPTMAFLTYVVIAGLALGTQERFTPE  209
             LLFFP+  +DWS++Y+Q+ P+QPRY+ NAPDLY+PTM ++TYV++AGL LG Q+RF+PE
Sbjct  178  RLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPE  237

Query  210  QLGILASSALAWGIIELIVHTITLYVMNLDTSLRTLDLLAYCGYKYVGVNIAVFLSLIFQ  269
            QLGI ASSA+A+ I EL+++++ LYVMN+ TSL+TLDLLA+ GYKYV + + + +S +F 
Sbjct  238  QLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFF  297

Query  270  QLGYYVVLLYFSISLAFFLIRSLKLRVI-------PEGHSSYTASGN----------KRR  312
            + GYY+ L Y S S  FF++R+L+ +++       P G  +Y   GN          KR+
Sbjct  298  KSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRK  357

Query  313  LYFILFIASIQPLLMWWLSFHL  334
            LYF+  I + Q L  + LS HL
Sbjct  358  LYFLFMIVAGQALFAFLLSKHL  379


>Q8MTA2_DROME unnamed protein product
Length=393

 Score = 261 bits (667),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 181/262 (69%), Gaps = 23/262 (9%)

Query  94   PQFATQLLAEPMVTNMAVQYGNALVGSGKQ----QLEKYVPVTALKYYFAVDTDYVIAKL  149
            PQFA  +  +P+V +MA+QYG  L   GKQ    Q EK+VPV  LKYYFAVD  YV  KL
Sbjct  120  PQFA--MFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKL  177

Query  150  SLLFFPFTQRDWSVKYEQDGPLQPRYERNAPDLYIPTMAFLTYVVIAGLALGTQERFTPE  209
             LLFFP+  +DWS++Y+Q+ P+QPRY+ NAPDLY+PTM ++TYV++AGL LG Q+RF+PE
Sbjct  178  RLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPE  237

Query  210  QLGILASSALAWGIIELIVHTITLYVMNLDTSLRTLDLLAYCGYKYVGVNIAVFLSLIFQ  269
            QLGI ASSA+A+ I EL+++++ LYVMN+ TSL+TLDLLA+ GYKYV + + + +S +F 
Sbjct  238  QLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFF  297

Query  270  QLGYYVVLLYFSISLAFFLIRSLKLRVI-------PEGHSSYTASGN----------KRR  312
            + GYY+ L Y S S  FF++R+L+ +++       P G  +Y   GN          KR+
Sbjct  298  KSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRK  357

Query  313  LYFILFIASIQPLLMWWLSFHL  334
            LYF+  I + Q L  + LS HL
Sbjct  358  LYFLFMIVAGQALFAFLLSKHL  379


>Q9VBC5_DROME unnamed protein product
Length=397

 Score = 261 bits (666),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 181/262 (69%), Gaps = 23/262 (9%)

Query  94   PQFATQLLAEPMVTNMAVQYGNALVGSGKQ----QLEKYVPVTALKYYFAVDTDYVIAKL  149
            PQFA  +  +P+V +MA+QYG  L   GKQ    Q EK+VPV  LKYYFAVD  YV  KL
Sbjct  124  PQFA--MFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKL  181

Query  150  SLLFFPFTQRDWSVKYEQDGPLQPRYERNAPDLYIPTMAFLTYVVIAGLALGTQERFTPE  209
             LLFFP+  +DWS++Y+Q+ P+QPRY+ NAPDLY+PTM ++TYV++AGL LG Q+RF+PE
Sbjct  182  RLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPE  241

Query  210  QLGILASSALAWGIIELIVHTITLYVMNLDTSLRTLDLLAYCGYKYVGVNIAVFLSLIFQ  269
            QLGI ASSA+A+ I EL+++++ LYVMN+ TSL+TLDLLA+ GYKYV + + + +S +F 
Sbjct  242  QLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFF  301

Query  270  QLGYYVVLLYFSISLAFFLIRSLKLRVI-------PEGHSSYTASGN----------KRR  312
            + GYY+ L Y S S  FF++R+L+ +++       P G  +Y   GN          KR+
Sbjct  302  KSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRK  361

Query  313  LYFILFIASIQPLLMWWLSFHL  334
            LYF+  I + Q L  + LS HL
Sbjct  362  LYFLFMIVAGQALFAFLLSKHL  383



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584843.1 protein YIF1B-B isoform X2 [Cephus cinctus]

Length=335
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMR3_DROME  unnamed protein product                                 261     9e-85
Q9VBC5_DROME  unnamed protein product                                 261     9e-85
Q8MTA2_DROME  unnamed protein product                                 261     9e-85


>Q8IMR3_DROME unnamed protein product
Length=393

 Score = 261 bits (667),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 181/262 (69%), Gaps = 23/262 (9%)

Query  89   PQFATQLLAEPMVTNMAVQYGNALVGSGKQ----QLEKYVPVTALKYYFAVDTDYVIAKL  144
            PQFA  +  +P+V +MA+QYG  L   GKQ    Q EK+VPV  LKYYFAVD  YV  KL
Sbjct  120  PQFA--MFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKL  177

Query  145  SLLFFPFTQRDWSVKYEQDGPLQPRYERNAPDLYIPTMAFLTYVVIAGLALGTQERFTPE  204
             LLFFP+  +DWS++Y+Q+ P+QPRY+ NAPDLY+PTM ++TYV++AGL LG Q+RF+PE
Sbjct  178  RLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPE  237

Query  205  QLGILASSALAWGIIELIVHTITLYVMNLDTSLRTLDLLAYCGYKYVGVNIAVFLSLIFQ  264
            QLGI ASSA+A+ I EL+++++ LYVMN+ TSL+TLDLLA+ GYKYV + + + +S +F 
Sbjct  238  QLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFF  297

Query  265  QLGYYVVLLYFSISLAFFLIRSLKLRVI-------PEGHSSYTASGN----------KRR  307
            + GYY+ L Y S S  FF++R+L+ +++       P G  +Y   GN          KR+
Sbjct  298  KSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRK  357

Query  308  LYFILFIASIQPLLMWWLSFHL  329
            LYF+  I + Q L  + LS HL
Sbjct  358  LYFLFMIVAGQALFAFLLSKHL  379


>Q9VBC5_DROME unnamed protein product
Length=397

 Score = 261 bits (667),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 181/262 (69%), Gaps = 23/262 (9%)

Query  89   PQFATQLLAEPMVTNMAVQYGNALVGSGKQ----QLEKYVPVTALKYYFAVDTDYVIAKL  144
            PQFA  +  +P+V +MA+QYG  L   GKQ    Q EK+VPV  LKYYFAVD  YV  KL
Sbjct  124  PQFA--MFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKL  181

Query  145  SLLFFPFTQRDWSVKYEQDGPLQPRYERNAPDLYIPTMAFLTYVVIAGLALGTQERFTPE  204
             LLFFP+  +DWS++Y+Q+ P+QPRY+ NAPDLY+PTM ++TYV++AGL LG Q+RF+PE
Sbjct  182  RLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPE  241

Query  205  QLGILASSALAWGIIELIVHTITLYVMNLDTSLRTLDLLAYCGYKYVGVNIAVFLSLIFQ  264
            QLGI ASSA+A+ I EL+++++ LYVMN+ TSL+TLDLLA+ GYKYV + + + +S +F 
Sbjct  242  QLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFF  301

Query  265  QLGYYVVLLYFSISLAFFLIRSLKLRVI-------PEGHSSYTASGN----------KRR  307
            + GYY+ L Y S S  FF++R+L+ +++       P G  +Y   GN          KR+
Sbjct  302  KSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRK  361

Query  308  LYFILFIASIQPLLMWWLSFHL  329
            LYF+  I + Q L  + LS HL
Sbjct  362  LYFLFMIVAGQALFAFLLSKHL  383


>Q8MTA2_DROME unnamed protein product
Length=393

 Score = 261 bits (667),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/262 (50%), Positives = 181/262 (69%), Gaps = 23/262 (9%)

Query  89   PQFATQLLAEPMVTNMAVQYGNALVGSGKQ----QLEKYVPVTALKYYFAVDTDYVIAKL  144
            PQFA  +  +P+V +MA+QYG  L   GKQ    Q EK+VPV  LKYYFAVD  YV  KL
Sbjct  120  PQFA--MFQQPIVQDMAMQYGQKLADQGKQIMENQFEKWVPVAKLKYYFAVDNAYVGRKL  177

Query  145  SLLFFPFTQRDWSVKYEQDGPLQPRYERNAPDLYIPTMAFLTYVVIAGLALGTQERFTPE  204
             LLFFP+  +DWS++Y+Q+ P+QPRY+ NAPDLY+PTM ++TYV++AGL LG Q+RF+PE
Sbjct  178  RLLFFPYMHKDWSLRYDQEHPVQPRYDVNAPDLYLPTMGYITYVIVAGLLLGMQKRFSPE  237

Query  205  QLGILASSALAWGIIELIVHTITLYVMNLDTSLRTLDLLAYCGYKYVGVNIAVFLSLIFQ  264
            QLGI ASSA+A+ I EL+++++ LYVMN+ TSL+TLDLLA+ GYKYV + + + +S +F 
Sbjct  238  QLGIQASSAMAYSIFELVIYSLALYVMNVKTSLKTLDLLAFTGYKYVNIVVCLMVSTLFF  297

Query  265  QLGYYVVLLYFSISLAFFLIRSLKLRVI-------PEGHSSYTASGN----------KRR  307
            + GYY+ L Y S S  FF++R+L+ +++       P G  +Y   GN          KR+
Sbjct  298  KSGYYIALAYTSFSFGFFMLRTLRTKLLQDNSPAAPSGAINYDPYGNPQQFDYSGGKKRK  357

Query  308  LYFILFIASIQPLLMWWLSFHL  329
            LYF+  I + Q L  + LS HL
Sbjct  358  LYFLFMIVAGQALFAFLLSKHL  379



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584844.1 pancreatic triacylglycerol lipase [Cephus cinctus]

Length=337
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SXG0_DROME  unnamed protein product                                 141     2e-38
Q9VX69_DROME  unnamed protein product                                 141     2e-38
Q0E8T1_DROME  unnamed protein product                                 137     9e-38


>Q8SXG0_DROME unnamed protein product
Length=411

 Score = 141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 147/285 (52%), Gaps = 25/285 (9%)

Query  63   NKVKFYLHTLKNPKNTQQLWLNDPKTLSQSN-FNPSKPTRIVTHGWMNSAK-SDACRLVR  120
            NK+ F L T    KN     L  P+++ +S  F+  K   I+  GW  +   SD   +  
Sbjct  98   NKMNFQLQTACEKKNFP---LTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFS  154

Query  121  EAYLKHGEYNVIIVDWSRISKLPYVYASNRVKIVGQYVG----KMIDFLASRGMNTINTL  176
            +AY   G+ N + VD +R     Y +++   + +G+ +     K++D +        N  
Sbjct  155  KAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDLVPVE-----NIH  209

Query  177  VVGHSLGAHVAGIAARNAK----STVGYVVALDPALPLFSSAKPGDRVAKGDAKFVQVIH  232
            ++GHSLGAH+ G A R+ +     T+  +  LDPA P F+  +    + +GDA FV VIH
Sbjct  210  LIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIH  269

Query  233  TNAGALGYSDPIGDVDFYPNGGRK-QAGCVVEWIATSHSRSYRFFAESI--NSKTGFVAT  289
            +N G LG  DP+GDVDFYP G     AGC    +  +H+RS+ +FAE++   ++  F+AT
Sbjct  270  SNPGVLGKRDPVGDVDFYPGGMSPLAAGCFS--VTCAHARSWEYFAETVFPGNERNFMAT  327

Query  290  QCESYSKFTSGGCRGNKKEMMGGPKPTTTATRSFYLDTNGSAPYA  334
            +C S SK     C G++  M  G         +++L+ + SAP+ 
Sbjct  328  RCNSISKLRDFRCPGDEVPM--GYAVPQNIKGNYFLEVSASAPFG  370


>Q9VX69_DROME unnamed protein product
Length=411

 Score = 141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/285 (32%), Positives = 147/285 (52%), Gaps = 25/285 (9%)

Query  63   NKVKFYLHTLKNPKNTQQLWLNDPKTLSQSN-FNPSKPTRIVTHGWMNSAK-SDACRLVR  120
            NK+ F L T    KN     L  P+++ +S  F+  K   I+  GW  +   SD   +  
Sbjct  98   NKMNFQLQTACEKKNFP---LTSPESMWKSPLFDVKKKVVILATGWTTTVNGSDTIEVFS  154

Query  121  EAYLKHGEYNVIIVDWSRISKLPYVYASNRVKIVGQYVG----KMIDFLASRGMNTINTL  176
            +AY   G+ N + VD +R     Y +++   + +G+ +     K++D +        N  
Sbjct  155  KAYNCRGDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDLVPVE-----NIH  209

Query  177  VVGHSLGAHVAGIAARNAK----STVGYVVALDPALPLFSSAKPGDRVAKGDAKFVQVIH  232
            ++GHSLGAH+ G A R+ +     T+  +  LDPA P F+  +    + +GDA FV VIH
Sbjct  210  LIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAHFVDVIH  269

Query  233  TNAGALGYSDPIGDVDFYPNGGRK-QAGCVVEWIATSHSRSYRFFAESI--NSKTGFVAT  289
            +N G LG  DP+GDVDFYP G     AGC    +  +H+RS+ +FAE++   ++  F+AT
Sbjct  270  SNPGVLGKRDPVGDVDFYPGGMSPLAAGCFS--VTCAHARSWEYFAETVFPGNERNFMAT  327

Query  290  QCESYSKFTSGGCRGNKKEMMGGPKPTTTATRSFYLDTNGSAPYA  334
            +C S SK     C G++  M  G         +++L+ + SAP+ 
Sbjct  328  RCNSISKLRDFRCPGDEVPM--GYAVPQNIKGNYFLEVSASAPFG  370


>Q0E8T1_DROME unnamed protein product
Length=338

 Score = 137 bits (346),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/279 (32%), Positives = 140/279 (50%), Gaps = 12/279 (4%)

Query  65   VKFYLHTLKNPKNTQQLWLNDPKTLSQSNFNPSKPTRIVTHGWMNSAKSDACRLVREAYL  124
            + F+L+T +N + T+         L++  F   KP +++ HG+           +R  +L
Sbjct  38   ISFWLYTKENQEGTKLSVFE----LNRFEFYHHKPLKVLIHGFNGHRDFSPNTQLRPLFL  93

Query  125  KHGEYNVIIVDWSRISKLP-YVYASNRVKIVGQYVGKMIDFLASRGMNTINTL-VVGHSL  182
               +YN+I +D+ +++  P Y  A +  K V +   +++  L   G+  I  L ++G  L
Sbjct  94   TQ-DYNLISLDYPKLAYEPCYTEAVHNAKYVARCTAQLLRVLLESGLVKIEDLHLIGLGL  152

Query  183  GAHVAG-IAARNAKSTVGYVVALDPALPLFSSAKPGDRVAKGDAKFVQVIHTNAGALGYS  241
            GAHVAG I     +  + ++ ALDPA P +    P  ++   DAKFV V+HT+   LG  
Sbjct  153  GAHVAGFIGQFLPEHKLEHITALDPAKPFYMVKDPALKLDPTDAKFVDVVHTDVTMLGLL  212

Query  242  DPIGDVDFYPNGGRKQAGC----VVEWIATSHSRSYRFFAESINSKTGFVATQCESYSKF  297
            D +G VDFY N G  Q  C     +E     H+R+  ++AESI+S +GF    C ++  F
Sbjct  213  DAVGHVDFYLNMGVSQPNCGPINKMETHFCYHNRAADYYAESISSPSGFYGFYCPNFKSF  272

Query  298  TSGGCRGNKKEMMGGPKPTTTATRSFYLDTNGSAPYAKG  336
              G C  +K   + G      A   ++LDTN   PYAKG
Sbjct  273  AKGICIPDKNIELMGFHVDPKARGRYFLDTNNGPPYAKG  311



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584845.1 E3 ubiquitin-protein ligase RNF123 isoform X1 [Cephus
cinctus]

Length=1254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

I2HAA6_CAEEL  unnamed protein product                                 82.8    2e-15
Q94279_CAEEL  unnamed protein product                                 82.8    2e-15
I2HAA7_CAEEL  unnamed protein product                                 82.8    2e-15


>I2HAA6_CAEEL unnamed protein product
Length=5187

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 12/143 (8%)

Query  94    SSQSNFSTMRANT--GLYRGKWIYELQLGSKGVMQVGWGTIKCEFNQESGVGDTVNSYAY  151
             + + N  T RA     +  GKW +E ++ + G M++GW  I      + G  D   SYA+
Sbjct  1072  ARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADD--RSYAF  1129

Query  152   DGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNGKIEFYRNGRSL------GTAFENITM  205
             DG   RKW+     YG+ W  GD++GC LD+++  I F  NG  L        AF+N+  
Sbjct  1130  DGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVC  1189

Query  206   GAGIAYFPTVSLAYTENLTANFG  228
             G G+   P ++L   +    NFG
Sbjct  1190  GDGLV--PAMTLGSGQRGRLNFG  1210


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  140  SGVGDTVNSYAYDGNRIRKWNVTTHKYGEPWL-SGDIIGCALDVDNGKIEFYRNGRSLGT  198
            +GVGD   SY +DG  +  +   + + G   L  GD+IGC++D+   +I+F  NG  +  
Sbjct  713  NGVGDDFYSYGFDGKSMY-FGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSG  771

Query  199  AFENITMGAGIAYFPTVSLA  218
            +F+   +     +FP +SL+
Sbjct  772  SFKKFNIDG--YFFPVMSLS  789


 Score = 35.4 bits (80),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (41%), Gaps = 10/113 (9%)

Query  130   GTIKCEFNQESGVGDTVNSY----AYDGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNG  185
             G  KC F++    G TV+S      Y  N + +   TT       +SG +IGC +D   G
Sbjct  1592  GVRKCRFSEADHHGTTVDSVQSQNCYMVN-VSELLATTPDVANTKVSGTLIGCIIDTSIG  1650

Query  186   KIEFYRNGRSLGTAFENITMGAGIAYFPT--VSLAYTENLTANFGSTPLRYPV  236
             ++ F       G  F+   +  G   FP   V+   TE L    G     +P+
Sbjct  1651  ELSFQVGSTDTGIKFK---LEPGAMLFPAAFVTPTATEILQFELGRIKYTFPL  1700


>Q94279_CAEEL unnamed protein product
Length=5201

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 12/143 (8%)

Query  94    SSQSNFSTMRANT--GLYRGKWIYELQLGSKGVMQVGWGTIKCEFNQESGVGDTVNSYAY  151
             + + N  T RA     +  GKW +E ++ + G M++GW  I      + G  D   SYA+
Sbjct  1072  ARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADD--RSYAF  1129

Query  152   DGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNGKIEFYRNGRSL----GT--AFENITM  205
             DG   RKW+     YG+ W  GD++GC LD+++  I F  NG  L    G+  AF+N+  
Sbjct  1130  DGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVC  1189

Query  206   GAGIAYFPTVSLAYTENLTANFG  228
             G G+   P ++L   +    NFG
Sbjct  1190  GDGLV--PAMTLGSGQRGRLNFG  1210


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  140  SGVGDTVNSYAYDGNRIRKWNVTTHKYGEPWL-SGDIIGCALDVDNGKIEFYRNGRSLGT  198
            +GVGD   SY +DG  +  +   + + G   L  GD+IGC++D+   +I+F  NG  +  
Sbjct  713  NGVGDDFYSYGFDGKSMY-FGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSG  771

Query  199  AFENITMGAGIAYFPTVSLA  218
            +F+   +     +FP +SL+
Sbjct  772  SFKKFNIDG--YFFPVMSLS  789


 Score = 35.4 bits (80),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (41%), Gaps = 10/113 (9%)

Query  130   GTIKCEFNQESGVGDTVNSY----AYDGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNG  185
             G  KC F++    G TV+S      Y  N + +   TT       +SG +IGC +D   G
Sbjct  1592  GVRKCRFSEADHHGTTVDSVQSQNCYMVN-VSELLATTPDVANTKVSGTLIGCIIDTSIG  1650

Query  186   KIEFYRNGRSLGTAFENITMGAGIAYFPT--VSLAYTENLTANFGSTPLRYPV  236
             ++ F       G  F+   +  G   FP   V+   TE L    G     +P+
Sbjct  1651  ELSFQVGSTDTGIKFK---LEPGAMLFPAAFVTPTATEILQFELGRIKYTFPL  1700


>I2HAA7_CAEEL unnamed protein product
Length=5071

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 12/143 (8%)

Query  94    SSQSNFSTMRANT--GLYRGKWIYELQLGSKGVMQVGWGTIKCEFNQESGVGDTVNSYAY  151
             + + N  T RA     +  GKW +E ++ + G M++GW  I      + G  D   SYA+
Sbjct  1072  ARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADD--RSYAF  1129

Query  152   DGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNGKIEFYRNGRSL------GTAFENITM  205
             DG   RKW+     YG+ W  GD++GC LD+++  I F  NG  L        AF+N+  
Sbjct  1130  DGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVC  1189

Query  206   GAGIAYFPTVSLAYTENLTANFG  228
             G G+   P ++L   +    NFG
Sbjct  1190  GDGLV--PAMTLGSGQRGRLNFG  1210


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  140  SGVGDTVNSYAYDGNRIRKWNVTTHKYGEPWL-SGDIIGCALDVDNGKIEFYRNGRSLGT  198
            +GVGD   SY +DG  +  +   + + G   L  GD+IGC++D+   +I+F  NG  +  
Sbjct  713  NGVGDDFYSYGFDGKSMY-FGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSG  771

Query  199  AFENITMGAGIAYFPTVSLA  218
            +F+   +     +FP +SL+
Sbjct  772  SFKKFNIDG--YFFPVMSLS  789


 Score = 35.4 bits (80),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (41%), Gaps = 10/113 (9%)

Query  130   GTIKCEFNQESGVGDTVNSY----AYDGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNG  185
             G  KC F++    G TV+S      Y  N + +   TT       +SG +IGC +D   G
Sbjct  1592  GVRKCRFSEADHHGTTVDSVQSQNCYMVN-VSELLATTPDVANTKVSGTLIGCIIDTSIG  1650

Query  186   KIEFYRNGRSLGTAFENITMGAGIAYFPT--VSLAYTENLTANFGSTPLRYPV  236
             ++ F       G  F+   +  G   FP   V+   TE L    G     +P+
Sbjct  1651  ELSFQVGSTDTGIKFK---LEPGAMLFPAAFVTPTATEILQFELGRIKYTFPL  1700



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


Query= XP_015584850.1 E3 ubiquitin-protein ligase RNF123 isoform X2 [Cephus
cinctus]

Length=1249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7WN66_CAEEL  unnamed protein product                                 82.8    2e-15
I2HAA6_CAEEL  unnamed protein product                                 82.4    2e-15
Q94279_CAEEL  unnamed protein product                                 82.4    2e-15


>B7WN66_CAEEL unnamed protein product
Length=5085

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 71/143 (50%), Gaps = 12/143 (8%)

Query  94    SSQSNFSTMRANT--GLYRGKWIYELQLGSKGVMQVGWGTIKCEFNQESGVGDTVNSYAY  151
             + + N  T RA     +  GKW +E ++ + G M++GW  I      + G  D   SYA+
Sbjct  1072  ARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADD--RSYAF  1129

Query  152   DGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNGKIEFYRNGRSL------GTAFENITM  205
             DG   RKW+     YG+ W  GD++GC LD+++  I F  NG  L        AF+N+  
Sbjct  1130  DGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVC  1189

Query  206   GAGIAYFPTVSLAYTENLTANFG  228
             G G+   P ++L   +    NFG
Sbjct  1190  GDGLV--PAMTLGSGQRGRLNFG  1210


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  140  SGVGDTVNSYAYDGNRIRKWNVTTHKYGEPWL-SGDIIGCALDVDNGKIEFYRNGRSLGT  198
            +GVGD   SY +DG  +  +   + + G   L  GD+IGC++D+   +I+F  NG  +  
Sbjct  713  NGVGDDFYSYGFDGKSMY-FGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSG  771

Query  199  AFENITMGAGIAYFPTVSLA  218
            +F+   +     +FP +SL+
Sbjct  772  SFKKFNIDG--YFFPVMSLS  789


 Score = 35.4 bits (80),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (41%), Gaps = 10/113 (9%)

Query  130   GTIKCEFNQESGVGDTVNSY----AYDGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNG  185
             G  KC F++    G TV+S      Y  N + +   TT       +SG +IGC +D   G
Sbjct  1592  GVRKCRFSEADHHGTTVDSVQSQNCYMVN-VSELLATTPDVANTKVSGTLIGCIIDTSIG  1650

Query  186   KIEFYRNGRSLGTAFENITMGAGIAYFPT--VSLAYTENLTANFGSTPLRYPV  236
             ++ F       G  F+   +  G   FP   V+   TE L    G     +P+
Sbjct  1651  ELSFQVGSTDTGIKFK---LEPGAMLFPAAFVTPTATEILQFELGRIKYTFPL  1700


>I2HAA6_CAEEL unnamed protein product
Length=5187

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 12/143 (8%)

Query  94    SSQSNFSTMRANT--GLYRGKWIYELQLGSKGVMQVGWGTIKCEFNQESGVGDTVNSYAY  151
             + + N  T RA     +  GKW +E ++ + G M++GW  I      + G  D   SYA+
Sbjct  1072  ARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADD--RSYAF  1129

Query  152   DGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNGKIEFYRNGRSL----GT--AFENITM  205
             DG   RKW+     YG+ W  GD++GC LD+++  I F  NG  L    G+  AF+N+  
Sbjct  1130  DGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVC  1189

Query  206   GAGIAYFPTVSLAYTENLTANFG  228
             G G+   P ++L   +    NFG
Sbjct  1190  GDGLV--PAMTLGSGQRGRLNFG  1210


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  140  SGVGDTVNSYAYDGNRIRKWNVTTHKYGEPWL-SGDIIGCALDVDNGKIEFYRNGRSLGT  198
            +GVGD   SY +DG  +  +   + + G   L  GD+IGC++D+   +I+F  NG  +  
Sbjct  713  NGVGDDFYSYGFDGKSMY-FGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSG  771

Query  199  AFENITMGAGIAYFPTVSLA  218
            +F+   +     +FP +SL+
Sbjct  772  SFKKFNIDG--YFFPVMSLS  789


 Score = 35.4 bits (80),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (41%), Gaps = 10/113 (9%)

Query  130   GTIKCEFNQESGVGDTVNSY----AYDGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNG  185
             G  KC F++    G TV+S      Y  N + +   TT       +SG +IGC +D   G
Sbjct  1592  GVRKCRFSEADHHGTTVDSVQSQNCYMVN-VSELLATTPDVANTKVSGTLIGCIIDTSIG  1650

Query  186   KIEFYRNGRSLGTAFENITMGAGIAYFPT--VSLAYTENLTANFGSTPLRYPV  236
             ++ F       G  F+   +  G   FP   V+   TE L    G     +P+
Sbjct  1651  ELSFQVGSTDTGIKFK---LEPGAMLFPAAFVTPTATEILQFELGRIKYTFPL  1700


>Q94279_CAEEL unnamed protein product
Length=5201

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 73/143 (51%), Gaps = 12/143 (8%)

Query  94    SSQSNFSTMRANT--GLYRGKWIYELQLGSKGVMQVGWGTIKCEFNQESGVGDTVNSYAY  151
             + + N  T RA     +  GKW +E ++ + G M++GW  I      + G  D   SYA+
Sbjct  1072  ARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADD--RSYAF  1129

Query  152   DGNRIRKWNVTTHKYGEPWLSGDIIGCALDVDNGKIEFYRNGRSL----GT--AFENITM  205
             DG   RKW+     YG+ W  GD++GC LD+++  I F  NG  L    G+  AF+N+  
Sbjct  1130  DGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVC  1189

Query  206   GAGIAYFPTVSLAYTENLTANFG  228
             G G+   P ++L   +    NFG
Sbjct  1190  GDGLV--PAMTLGSGQRGRLNFG  1210


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  140  SGVGDTVNSYAYDGNRIRKWNVTTHKYGEPWL-SGDIIGCALDVDNGKIEFYRNGRSLGT  198
            +GVGD   SY +DG  +  +   + + G   L  GD+IGC++D+   +I+F  NG  +  
Sbjct  713  NGVGDDFYSYGFDGKSMY-FGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSG  771

Query  199  AFENITMGAGIAYFPTVSLA  218
            +F+   +     +FP +SL+
Sbjct  772  SFKKFNIDG--YFFPVMSLS  789


 Score = 35.4 bits (80),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 29/112 (26%), Positives = 44/112 (39%), Gaps = 8/112 (7%)

Query  130   GTIKCEFNQESGVGDTVNSYAYDGN---RIRKWNVTTHKYGEPWLSGDIIGCALDVDNGK  186
             G  KC F++    G TV+S          + +   TT       +SG +IGC +D   G+
Sbjct  1592  GVRKCRFSEADHHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGE  1651

Query  187   IEFYRNGRSLGTAFENITMGAGIAYFPT--VSLAYTENLTANFGSTPLRYPV  236
             + F       G  F+   +  G   FP   V+   TE L    G     +P+
Sbjct  1652  LSFQVGSTDTGIKFK---LEPGAMLFPAAFVTPTATEILQFELGRIKYTFPL  1700



Lambda      K        H
   0.320    0.135    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11660703264


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:17 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_015584852.1 SLIT-ROBO Rho GTPase-activating protein 1 isoform X3
[Cephus cinctus]

Length=1232
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19370_CAEEL  unnamed protein product                                 523     2e-166
D3YT53_CAEEL  unnamed protein product                                 520     5e-166
D3YT54_CAEEL  unnamed protein product                                 258     5e-74 


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 523 bits (1347),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 285/697 (41%), Positives = 435/697 (62%), Gaps = 55/697 (8%)

Query  28   IRLQLNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQ  87
             R ++++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ 
Sbjct  58   FRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERS  117

Query  88   KREQWPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREI  147
            +RE WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREI
Sbjct  118  RREGWPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREI  177

Query  148  GYETHEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSK  207
            G  +H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+
Sbjct  178  GSYSHNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSR  235

Query  208  KYRLIEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGF  267
            ++R + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G 
Sbjct  236  RHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGM  295

Query  268  HNCIARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPK  324
             +   RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK
Sbjct  296  -DFWLRALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPK  352

Query  325  KFEFQGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEAS  384
            +FEF+ Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  
Sbjct  353  QFEFRPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQ  408

Query  385  LLEMLTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIA  444
            LL++        +++ G+              K R D   T ++YL KF  +LL  + + 
Sbjct  409  LLQLYN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLME  450

Query  445  RLDAKQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGR  484
            RL+A+   I ++L            GS++  N S +T           ++++++ +RIG 
Sbjct  451  RLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGG  510

Query  485  LQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVE  539
            +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ E
Sbjct  511  IVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSE  570

Query  540  INNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESK  599
            IN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES 
Sbjct  571  INRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESP  630

Query  600  QDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPED  659
             +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE 
Sbjct  631  TEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEG  690

Query  660  KDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  696
            KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  691  KDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  727


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 520 bits (1339),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 284/693 (41%), Positives = 433/693 (62%), Gaps = 55/693 (8%)

Query  32   LNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQ  91
            +++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE 
Sbjct  1    MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREG  60

Query  92   WPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYET  151
            WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +
Sbjct  61   WPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYS  120

Query  152  HEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRL  211
            H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R 
Sbjct  121  HNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRS  178

Query  212  IEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCI  271
            + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    +
Sbjct  179  LVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL  238

Query  272  ARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEF  328
             RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF
Sbjct  239  -RALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEF  295

Query  329  QGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEM  388
            + Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++
Sbjct  296  RPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQL  351

Query  389  LTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDA  448
                    +++ G+              K R D   T ++YL KF  +LL  + + RL+A
Sbjct  352  YN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEA  393

Query  449  KQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMN  488
            +   I ++L            GS++  N S +T           ++++++ +RIG +   
Sbjct  394  RSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTK  453

Query  489  G-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNF  543
                  +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN F
Sbjct  454  SPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRF  513

Query  544  REWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFV  603
            RE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV
Sbjct  514  REAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFV  573

Query  604  LKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQV  663
             + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV
Sbjct  574  RRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQV  633

Query  664  QYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  696
             Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  634  FYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  666


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  473  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  527
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  528  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  587
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  588  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  647
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  648  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  696
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584853.1 SLIT-ROBO Rho GTPase-activating protein 1 isoform X4
[Cephus cinctus]

Length=1231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19370_CAEEL  unnamed protein product                                 523     2e-166
D3YT53_CAEEL  unnamed protein product                                 520     5e-166
D3YT54_CAEEL  unnamed protein product                                 258     8e-74 


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 523 bits (1346),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 285/698 (41%), Positives = 436/698 (62%), Gaps = 55/698 (8%)

Query  26   DIRLQLNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQK  85
            + R ++++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++
Sbjct  57   EFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSER  116

Query  86   QKREQWPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCRE  145
             +RE WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCRE
Sbjct  117  SRREGWPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCRE  176

Query  146  IGYETHEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARS  205
            IG  +H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S
Sbjct  177  IGSYSHNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGS  234

Query  206  KKYRLIEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFG  265
            +++R + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G
Sbjct  235  RRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLG  294

Query  266  FHNCIARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIP  322
              +   RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+P
Sbjct  295  M-DFWLRALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLP  351

Query  323  KKFEFQGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEA  382
            K+FEF+ Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E 
Sbjct  352  KQFEFRPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEK  407

Query  383  SLLEMLTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRI  442
             LL++        +++ G+              K R D   T ++YL KF  +LL  + +
Sbjct  408  QLLQLYN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLM  449

Query  443  ARLDAKQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIG  482
             RL+A+   I ++L            GS++  N S +T           ++++++ +RIG
Sbjct  450  ERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIG  509

Query  483  RLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQV  537
             +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ 
Sbjct  510  GIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQS  569

Query  538  EINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLES  597
            EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES
Sbjct  570  EINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSES  629

Query  598  KQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPE  657
              +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE
Sbjct  630  PTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPE  689

Query  658  DKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  695
             KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  690  GKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  727


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 520 bits (1339),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 284/693 (41%), Positives = 433/693 (62%), Gaps = 55/693 (8%)

Query  31   LNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQ  90
            +++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE 
Sbjct  1    MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREG  60

Query  91   WPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYET  150
            WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +
Sbjct  61   WPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYS  120

Query  151  HEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRL  210
            H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R 
Sbjct  121  HNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRS  178

Query  211  IEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCI  270
            + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    +
Sbjct  179  LVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL  238

Query  271  ARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEF  327
             RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF
Sbjct  239  -RALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEF  295

Query  328  QGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEM  387
            + Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++
Sbjct  296  RPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQL  351

Query  388  LTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDA  447
                    +++ G+              K R D   T ++YL KF  +LL  + + RL+A
Sbjct  352  YN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEA  393

Query  448  KQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMN  487
            +   I ++L            GS++  N S +T           ++++++ +RIG +   
Sbjct  394  RSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTK  453

Query  488  G-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNF  542
                  +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN F
Sbjct  454  SPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRF  513

Query  543  REWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFV  602
            RE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV
Sbjct  514  REAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFV  573

Query  603  LKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQV  662
             + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV
Sbjct  574  RRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQV  633

Query  663  QYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  695
             Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  634  FYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  666


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (659),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  472  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  526
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  527  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  586
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  587  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  646
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  647  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  695
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584854.1 SLIT-ROBO Rho GTPase-activating protein 1 isoform X5
[Cephus cinctus]

Length=1228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19370_CAEEL  unnamed protein product                                 526     6e-168
D3YT53_CAEEL  unnamed protein product                                 524     1e-167
D3YT54_CAEEL  unnamed protein product                                 258     5e-74 


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 526 bits (1356),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 285/693 (41%), Positives = 434/693 (63%), Gaps = 51/693 (7%)

Query  28   IRLQLNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQ  87
             R ++++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ 
Sbjct  58   FRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERS  117

Query  88   KREQWPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREI  147
            +RE WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREI
Sbjct  118  RREGWPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREI  177

Query  148  GYETHEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSK  207
            G  +H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+
Sbjct  178  GSYSHNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSR  235

Query  208  KYRLIEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGF  267
            ++R + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G 
Sbjct  236  RHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGM  295

Query  268  HNCIARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPK  324
             +   RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK
Sbjct  296  -DFWLRALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPK  352

Query  325  KFEFQGQRGDETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEM  384
            +FEF+ Q GD+  +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++
Sbjct  353  QFEFRPQLGDDIMEVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQL  412

Query  385  LTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDA  444
                    +++ G+              K R D   T ++YL KF  +LL  + + RL+A
Sbjct  413  YN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEA  454

Query  445  KQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMN  484
            +   I ++L            GS++  N S +T           ++++++ +RIG +   
Sbjct  455  RSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTK  514

Query  485  G-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNF  539
                  +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN F
Sbjct  515  SPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRF  574

Query  540  REWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFV  599
            RE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV
Sbjct  575  REAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFV  634

Query  600  LKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQV  659
             + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV
Sbjct  635  RRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQV  694

Query  660  QYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  692
             Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  695  FYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  727


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 524 bits (1350),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 284/689 (41%), Positives = 432/689 (63%), Gaps = 51/689 (7%)

Query  32   LNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQ  91
            +++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE 
Sbjct  1    MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREG  60

Query  92   WPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYET  151
            WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +
Sbjct  61   WPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYS  120

Query  152  HEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRL  211
            H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R 
Sbjct  121  HNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRS  178

Query  212  IEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCI  271
            + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    +
Sbjct  179  LVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL  238

Query  272  ARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEF  328
             RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF
Sbjct  239  -RALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEF  295

Query  329  QGQRGDETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEMLTAK  388
            + Q GD+  +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++    
Sbjct  296  RPQLGDDIMEVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQLYN--  353

Query  389  DYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDAKQEY  448
                +++ G+              K R D   T ++YL KF  +LL  + + RL+A+   
Sbjct  354  ----TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEARSAS  397

Query  449  IRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMNG---  485
            I ++L            GS++  N S +T           ++++++ +RIG +       
Sbjct  398  IGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTKSPDD  457

Query  486  --QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNFREWF  543
              +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN FRE +
Sbjct  458  RPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAY  517

Query  544  ERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFVLKMK  603
            ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV + +
Sbjct  518  ERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFVRRAR  577

Query  604  ELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQVQYQN  663
            EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV Y N
Sbjct  578  ELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQVFYHN  637

Query  664  QVNELIKNIITFCEEIFPEDIGGIQYEKY  692
             VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  638  YVNELVRNLIIHADDVFPRDLAGPVYDKY  666


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  469  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  523
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  524  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  583
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  584  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  643
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  644  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  692
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584855.2 SLIT-ROBO Rho GTPase-activating protein 1 isoform X1
[Cephus cinctus]

Length=1265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19370_CAEEL  unnamed protein product                                 525     9e-167
D3YT53_CAEEL  unnamed protein product                                 520     8e-166
D3YT54_CAEEL  unnamed protein product                                 258     8e-74 


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 525 bits (1351),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 286/708 (40%), Positives = 439/708 (62%), Gaps = 55/708 (8%)

Query  50   VVSGFMAGRRDIRLQLNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMAR  109
            +V       ++ R ++++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++
Sbjct  47   IVHDLECAAKEFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSK  106

Query  110  SIQLRHKEQKQKREQWPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMED  169
            SI  +HK ++ +RE WP  +S   W  LV +TK   +   +L ++Y   +   +    ED
Sbjct  107  SIAQKHKSERSRREGWPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCED  166

Query  170  VQRIYRRCREIGYETHEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVA  229
            + +I +RCREIG  +H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +
Sbjct  167  LAKISKRCREIGSYSHNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDS  226

Query  230  NAPPEKLARSKKYRLIEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDL  289
            N  P K   S+++R + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DL
Sbjct  227  N--PGKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDL  284

Query  290  SDLIDCMDFGFHNCIARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFL  346
            S LIDCMD G  +   RALL     E  R++  Q   + LA+      ++D +ADKQ+F 
Sbjct  285  SYLIDCMDLGM-DFWLRALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFF  341

Query  347  ESHHAAFMIPKKFEFQGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEE  406
            E++H  FM+PK+FEF+ Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +E
Sbjct  342  EANHQLFMLPKQFEFRPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDE  397

Query  407  VWKTLETAEASLLEMLTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKF  466
            VWK+LE +E  LL++        +++ G+              K R D   T ++YL KF
Sbjct  398  VWKSLEASEKQLLQLYN------TQFDGEAG------------KWRNDLHVTYQYYLKKF  439

Query  467  REYLLGTSRIARLDAKQEYIRQSLLD----------GSSASPNPSISTN----------K  506
              +LL  + + RL+A+   I ++L            GS++  N S +T           +
Sbjct  440  EHFLLNGNLMERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLE  499

Query  507  QKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQ  561
            +++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +Q
Sbjct  500  ERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQ  559

Query  562  GIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFE  621
            G+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE
Sbjct  560  GLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFE  619

Query  622  HLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAIC  681
               + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAIC
Sbjct  620  QFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAIC  679

Query  682  FGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  729
            FGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  680  FGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  727


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 520 bits (1340),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 284/693 (41%), Positives = 433/693 (62%), Gaps = 55/693 (8%)

Query  65   LNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQ  124
            +++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE 
Sbjct  1    MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREG  60

Query  125  WPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYET  184
            WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +
Sbjct  61   WPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYS  120

Query  185  HEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRL  244
            H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R 
Sbjct  121  HNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRS  178

Query  245  IEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCI  304
            + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    +
Sbjct  179  LVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL  238

Query  305  ARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEF  361
             RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF
Sbjct  239  -RALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEF  295

Query  362  QGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEM  421
            + Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++
Sbjct  296  RPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQL  351

Query  422  LTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDA  481
                    +++ G+              K R D   T ++YL KF  +LL  + + RL+A
Sbjct  352  YN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEA  393

Query  482  KQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMN  521
            +   I ++L            GS++  N S +T           ++++++ +RIG +   
Sbjct  394  RSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTK  453

Query  522  G-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNF  576
                  +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN F
Sbjct  454  SPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRF  513

Query  577  REWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFV  636
            RE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV
Sbjct  514  REAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFV  573

Query  637  LKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQV  696
             + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV
Sbjct  574  RRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQV  633

Query  697  QYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  729
             Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  634  FYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  666


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (659),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  506  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  560
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  561  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  620
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  621  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  680
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  681  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  729
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584856.1 SLIT-ROBO Rho GTPase-activating protein 1 isoform X7
[Cephus cinctus]

Length=1221
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19370_CAEEL  unnamed protein product                                 526     1e-167
D3YT53_CAEEL  unnamed protein product                                 520     3e-166
D3YT54_CAEEL  unnamed protein product                                 258     5e-74 


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 526 bits (1354),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 287/706 (41%), Positives = 439/706 (62%), Gaps = 55/706 (8%)

Query  8    QEWEAWTKDIRLQLNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSI  67
             + E   K+ R ++++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI
Sbjct  49   HDLECAAKEFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSI  108

Query  68   QLRHKEQKQKREQWPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQ  127
              +HK ++ +RE WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ 
Sbjct  109  AQKHKSERSRREGWPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLA  168

Query  128  RIYRRCREIGYETHEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANA  187
            +I +RCREIG  +H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N 
Sbjct  169  KISKRCREIGSYSHNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN-  227

Query  188  PPEKLARSKKYRLIEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSD  247
             P K   S+++R + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS 
Sbjct  228  -PGKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSY  286

Query  248  LIDCMDFGFHNCIARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLES  304
            LIDCMD G  +   RALL     E  R++  Q   + LA+      ++D +ADKQ+F E+
Sbjct  287  LIDCMDLGM-DFWLRALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEA  343

Query  305  HHAAFMIPKKFEFQGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVW  364
            +H  FM+PK+FEF+ Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVW
Sbjct  344  NHQLFMLPKQFEFRPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVW  399

Query  365  KTLETAEASLLEMLTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFRE  424
            K+LE +E  LL++        +++ G+              K R D   T ++YL KF  
Sbjct  400  KSLEASEKQLLQLYN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEH  441

Query  425  YLLGTSRIARLDAKQEYIRQSLLD----------GSSASPNPSISTN----------KQK  464
            +LL  + + RL+A+   I ++L            GS++  N S +T           +++
Sbjct  442  FLLNGNLMERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEER  501

Query  465  QARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGI  519
            +++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+
Sbjct  502  RSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGL  561

Query  520  FRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHL  579
            FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE  
Sbjct  562  FRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQF  621

Query  580  MELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFG  639
             + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFG
Sbjct  622  CDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFG  681

Query  640  PTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  685
            PTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  682  PTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  727


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 520 bits (1339),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 284/693 (41%), Positives = 433/693 (62%), Gaps = 55/693 (8%)

Query  21   LNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQ  80
            +++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE 
Sbjct  1    MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREG  60

Query  81   WPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYET  140
            WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +
Sbjct  61   WPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYS  120

Query  141  HEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRL  200
            H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R 
Sbjct  121  HNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRS  178

Query  201  IEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCI  260
            + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    +
Sbjct  179  LVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL  238

Query  261  ARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEF  317
             RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF
Sbjct  239  -RALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEF  295

Query  318  QGQRGDEVAYETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEM  377
            + Q GD++     +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++
Sbjct  296  RPQLGDDIM----EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQL  351

Query  378  LTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDA  437
                    +++ G+              K R D   T ++YL KF  +LL  + + RL+A
Sbjct  352  YN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEA  393

Query  438  KQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMN  477
            +   I ++L            GS++  N S +T           ++++++ +RIG +   
Sbjct  394  RSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTK  453

Query  478  G-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNF  532
                  +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN F
Sbjct  454  SPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRF  513

Query  533  REWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFV  592
            RE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV
Sbjct  514  REAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFV  573

Query  593  LKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQV  652
             + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV
Sbjct  574  RRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQV  633

Query  653  QYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  685
             Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  634  FYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  666


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  462  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  516
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  517  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  576
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  577  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  636
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  637  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  685
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584858.1 SLIT-ROBO Rho GTPase-activating protein 1 isoform X8
[Cephus cinctus]

Length=1217
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q19370_CAEEL  unnamed protein product                                 530     3e-169
D3YT53_CAEEL  unnamed protein product                                 524     1e-167
D3YT54_CAEEL  unnamed protein product                                 258     5e-74 


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 530 bits (1365),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 287/702 (41%), Positives = 438/702 (62%), Gaps = 51/702 (7%)

Query  8    QEWEAWTKDIRLQLNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSI  67
             + E   K+ R ++++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI
Sbjct  49   HDLECAAKEFRTKMSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSI  108

Query  68   QLRHKEQKQKREQWPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQ  127
              +HK ++ +RE WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ 
Sbjct  109  AQKHKSERSRREGWPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLA  168

Query  128  RIYRRCREIGYETHEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANA  187
            +I +RCREIG  +H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N 
Sbjct  169  KISKRCREIGSYSHNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN-  227

Query  188  PPEKLARSKKYRLIEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSD  247
             P K   S+++R + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS 
Sbjct  228  -PGKYEGSRRHRSLVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSY  286

Query  248  LIDCMDFGFHNCIARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLES  304
            LIDCMD G  +   RALL     E  R++  Q   + LA+      ++D +ADKQ+F E+
Sbjct  287  LIDCMDLGM-DFWLRALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEA  343

Query  305  HHAAFMIPKKFEFQGQRGDETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLE  364
            +H  FM+PK+FEF+ Q GD+  +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE
Sbjct  344  NHQLFMLPKQFEFRPQLGDDIMEVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLE  403

Query  365  TAEASLLEMLTAKDYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLG  424
             +E  LL++        +++ G+              K R D   T ++YL KF  +LL 
Sbjct  404  ASEKQLLQLYN------TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLN  445

Query  425  TSRIARLDAKQEYIRQSLLD----------GSSASPNPSISTN----------KQKQARR  464
             + + RL+A+   I ++L            GS++  N S +T           ++++++ 
Sbjct  446  GNLMERLEARSASIGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKA  505

Query  465  KRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVS  519
            +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVS
Sbjct  506  RRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVS  565

Query  520  GSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELA  579
            GSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A
Sbjct  566  GSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCA  625

Query  580  QLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLV  639
            + ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+
Sbjct  626  KSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLL  685

Query  640  PVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  681
            P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  686  PIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  727


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 524 bits (1349),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 284/689 (41%), Positives = 432/689 (63%), Gaps = 51/689 (7%)

Query  21   LNEQLRCLDVRMEAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQ  80
            +++QL+CL  R + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE 
Sbjct  1    MSDQLKCLGDRTDVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREG  60

Query  81   WPLFSSYACWQQLVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYET  140
            WP  +S   W  LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +
Sbjct  61   WPQHTSSTVWHTLVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYS  120

Query  141  HEEILRVLHELHTTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRL  200
            H E+ RVL EL T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R 
Sbjct  121  HNELNRVLTELQTAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRS  178

Query  201  IEKEVNKRKSKYTEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCI  260
            + K   +R+ K+   +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    +
Sbjct  179  LVKYFKRREEKFEVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL  238

Query  261  ARALLMHCSAEEGRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEF  317
             RALL     E  R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF
Sbjct  239  -RALLEKVIDE--RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEF  295

Query  318  QGQRGDETPDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEMLTAK  377
            + Q GD+  +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++    
Sbjct  296  RPQLGDDIMEVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQLYN--  353

Query  378  DYDCSRYFGDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDAKQEY  437
                +++ G+              K R D   T ++YL KF  +LL  + + RL+A+   
Sbjct  354  ----TQFDGEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEARSAS  397

Query  438  IRQSLLD----------GSSASPNPSISTN----------KQKQARRKRIGRLQMNG---  474
            I ++L            GS++  N S +T           ++++++ +RIG +       
Sbjct  398  IGEALGKHGISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTKSPDD  457

Query  475  --QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNFREWF  532
              +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN FRE +
Sbjct  458  RPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAY  517

Query  533  ERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFVLKMK  592
            ERGED    + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV + +
Sbjct  518  ERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFVRRAR  577

Query  593  ELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQVQYQN  652
            EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV Y N
Sbjct  578  ELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQVFYHN  637

Query  653  QVNELIKNIITFCEEIFPEDIGGIQYEKY  681
             VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  638  YVNELVRNLIIHADDVFPRDLAGPVYDKY  666


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (660),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  458  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  512
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  513  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  572
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  573  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  632
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  633  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  681
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584859.1 SLIT-ROBO Rho GTPase-activating protein 1 isoform X9
[Cephus cinctus]

Length=1190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D3YT53_CAEEL  unnamed protein product                                 509     3e-162
Q19370_CAEEL  unnamed protein product                                 509     7e-162
D3YT54_CAEEL  unnamed protein product                                 258     4e-74 


>D3YT53_CAEEL unnamed protein product
Length=998

 Score = 509 bits (1310),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 279/681 (41%), Positives = 424/681 (62%), Gaps = 55/681 (8%)

Query  2    EAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQWPLFSSYACWQQ  61
            + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE WP  +S   W  
Sbjct  13   DVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREGWPQHTSSTVWHT  72

Query  62   LVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYETHEEILRVLHELH  121
            LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +H E+ RVL EL 
Sbjct  73   LVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYSHNELNRVLTELQ  132

Query  122  TTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRLIEKEVNKRKSKY  181
            T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R + K   +R+ K+
Sbjct  133  TAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRSLVKYFKRREEKF  190

Query  182  TEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCIARALLMHCSAEE  241
               +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G    + RALL     E 
Sbjct  191  EVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGMDFWL-RALLEKVIDE-  248

Query  242  GRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEFQGQRGDEVAYET  298
             R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF+ Q GD++    
Sbjct  249  -RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEFRPQLGDDIM---  304

Query  299  PDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEMLTAKDYDCSRYF  358
             +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++        +++ 
Sbjct  305  -EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQLYN------TQFD  357

Query  359  GDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDAKQEYIRQSLLD-  417
            G+              K R D   T ++YL KF  +LL  + + RL+A+   I ++L   
Sbjct  358  GEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEARSASIGEALGKH  405

Query  418  ---------GSSASPNPSISTN----------KQKQARRKRIGRLQMNG-----QPKLFG  453
                     GS++  N S +T           ++++++ +RIG +         +PKLFG
Sbjct  406  GISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTKSPDDRPRPKLFG  465

Query  454  GSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNFREWFERGEDPLA  513
            GSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN FRE +ERGED   
Sbjct  466  GSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAYERGEDLFQ  525

Query  514  DVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFVLKMKELISSLPR  573
             + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV + +EL+S LP 
Sbjct  526  YLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFVRRARELVSKLPV  585

Query  574  PVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQVQYQNQVNELIKN  633
              V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV Y N VNEL++N
Sbjct  586  SHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQVFYHNYVNELVRN  645

Query  634  IITFCEEIFPEDIGGIQYEKY  654
            +I   +++FP D+ G  Y+KY
Sbjct  646  LIIHADDVFPRDLAGPVYDKY  666


>Q19370_CAEEL unnamed protein product
Length=1059

 Score = 509 bits (1312),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 279/681 (41%), Positives = 424/681 (62%), Gaps = 55/681 (8%)

Query  2    EAQVALVAELQDFFRRRAELELDYSKNLDKMARSIQLRHKEQKQKREQWPLFSSYACWQQ  61
            + Q++ ++ELQD+FR+R E+E +Y+  L+K+++SI  +HK ++ +RE WP  +S   W  
Sbjct  74   DVQMSSLSELQDYFRKRGEIESEYACKLEKLSKSIAQKHKSERSRREGWPQHTSSTVWHT  133

Query  62   LVNETKSLSRDHAALSDVYSTHLVGRLNQVMEDVQRIYRRCREIGYETHEEILRVLHELH  121
            LV +TK   +   +L ++Y   +   +    ED+ +I +RCREIG  +H E+ RVL EL 
Sbjct  134  LVEQTKEEYKKRQSLGELYGKQMTASIETRCEDLAKISKRCREIGSYSHNELNRVLTELQ  193

Query  122  TTMKTYQAYQAESRQAETKLRVAEQQRSKLEVANAPPEKLARSKKYRLIEKEVNKRKSKY  181
            T MKTYQ   AE    E K R AE+   + E +N  P K   S+++R + K   +R+ K+
Sbjct  194  TAMKTYQLCYAEMCGIERKKRSAEEDVKRYEDSN--PGKYEGSRRHRSLVKYFKRREEKF  251

Query  182  TEAKLKALKARNEYILCLEASNTTIHKYFVDDLSDLIDCMDFGFHNCIARALLMHCSAEE  241
               +LK  KARNEY+LC++A+N  +H++F  DLS LIDCMD G  +   RALL     E 
Sbjct  252  EVVRLKCTKARNEYLLCVKAANAALHRFFAQDLSYLIDCMDLGM-DFWLRALLEKVIDE-  309

Query  242  GRQRSLQSGAEQLAACV---GALDSRADKQRFLESHHAAFMIPKKFEFQGQRGDEVAYET  298
             R++  Q   + LA+      ++D +ADKQ+F E++H  FM+PK+FEF+ Q GD++    
Sbjct  310  -RKKITQHEMDSLASLSTLRSSVDVKADKQKFFEANHQLFMLPKQFEFRPQLGDDIM---  365

Query  299  PDPELQKVLHTEMEQRLAQLQQRVTSLRTESEEVWKTLETAEASLLEMLTAKDYDCSRYF  358
             +   ++ L +++ QR  Q+++R+  L+ E +EVWK+LE +E  LL++        +++ 
Sbjct  366  -EVSAEQSLSSDLLQRQLQIEKRLEGLQFEVDEVWKSLEASEKQLLQLYN------TQFD  418

Query  359  GDNAMPTSRPPETIQIKLRADRQETEEFYLTKFREYLLGTSRIARLDAKQEYIRQSLLD-  417
            G+              K R D   T ++YL KF  +LL  + + RL+A+   I ++L   
Sbjct  419  GEAG------------KWRNDLHVTYQYYLKKFEHFLLNGNLMERLEARSASIGEALGKH  466

Query  418  ---------GSSASPNPSISTN----------KQKQARRKRIGRLQMNG-----QPKLFG  453
                     GS++  N S +T           ++++++ +RIG +         +PKLFG
Sbjct  467  GISLKSASVGSASERNGSFTTENGGSQNHHLLEERRSKARRIGGIVTKSPDDRPRPKLFG  526

Query  454  GSLEEYLESTNQEIPLIVKSCVRVINLFGLHHQGIFRVSGSQVEINNFREWFERGEDPLA  513
            GSL+EY+E+T +EIPL+V+S +  ++ + L +QG+FRVSGSQ EIN FRE +ERGED   
Sbjct  527  GSLDEYVEATGEEIPLLVQSAIAYLSRYSLRNQGLFRVSGSQSEINRFREAYERGEDLFQ  586

Query  514  DVTDASDINSVAGVLKLYLRELREPLFPIIYFEHLMELAQLESKQDFVLKMKELISSLPR  573
             + D SD NS AGVLKLY RELREP+FPI  FE   + A+ ES  +FV + +EL+S LP 
Sbjct  587  YLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFVRRARELVSKLPV  646

Query  574  PVVIVMRYLFAFLNHLSEFSDENMMDPYNLAICFGPTLVPVPEDKDQVQYQNQVNELIKN  633
              V+++R+LFAFL+HL EF+DENMM+P+NLAICFGPTL+P+PE KDQV Y N VNEL++N
Sbjct  647  SHVLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQVFYHNYVNELVRN  706

Query  634  IITFCEEIFPEDIGGIQYEKY  654
            +I   +++FP D+ G  Y+KY
Sbjct  707  LIIHADDVFPRDLAGPVYDKY  727


>D3YT54_CAEEL unnamed protein product
Length=611

 Score = 258 bits (660),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 172/229 (75%), Gaps = 5/229 (2%)

Query  431  KQKQARRKRIGRLQMNG-----QPKLFGGSLEEYLESTNQEIPLIVKSCVRVINLFGLHH  485
            ++++++ +RIG +         +PKLFGGSL+EY+E+T +EIPL+V+S +  ++ + L +
Sbjct  51   EERRSKARRIGGIVTKSPDDRPRPKLFGGSLDEYVEATGEEIPLLVQSAIAYLSRYSLRN  110

Query  486  QGIFRVSGSQVEINNFREWFERGEDPLADVTDASDINSVAGVLKLYLRELREPLFPIIYF  545
            QG+FRVSGSQ EIN FRE +ERGED    + D SD NS AGVLKLY RELREP+FPI  F
Sbjct  111  QGLFRVSGSQSEINRFREAYERGEDLFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMF  170

Query  546  EHLMELAQLESKQDFVLKMKELISSLPRPVVIVMRYLFAFLNHLSEFSDENMMDPYNLAI  605
            E   + A+ ES  +FV + +EL+S LP   V+++R+LFAFL+HL EF+DENMM+P+NLAI
Sbjct  171  EQFCDCAKSESPTEFVRRARELVSKLPVSHVLLLRFLFAFLSHLCEFADENMMEPHNLAI  230

Query  606  CFGPTLVPVPEDKDQVQYQNQVNELIKNIITFCEEIFPEDIGGIQYEKY  654
            CFGPTL+P+PE KDQV Y N VNEL++N+I   +++FP D+ G  Y+KY
Sbjct  231  CFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADDVFPRDLAGPVYDKY  279



Lambda      K        H
   0.312    0.128    0.357 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15998664968


Query= XP_015584860.1 cartilage oligomeric matrix protein [Cephus cinctus]

Length=1046
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q968S4_DROME  unnamed protein product                                 858     0.0  
Q9VM97_DROME  unnamed protein product                                 854     0.0  
B7Z030_DROME  unnamed protein product                                 646     0.0  


>Q968S4_DROME unnamed protein product
Length=1060

 Score = 858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/1073 (44%), Positives = 650/1073 (61%), Gaps = 63/1073 (6%)

Query  5     GVVALVVFFAAMATFSVMAVTPDEGLSKSLKEALNEDEFAIVVKHVKPRKKQTDRLETLL  64
             G+ AL + F  +A+ S+  V      S  L++ + + +  I  +H++PR+K    +E L 
Sbjct  10    GLTALALTFVEVASLSLDPVA-----SAELEQFIRKGDVVISTRHIRPRRKLHISIEALF  64

Query  65    RADFSKTKEQFVLKLDRLEKRIILETTENGHTHFDTFLVESLDESTPIKNLILHVRQEPR  124
               DF   K +    LDR ++R+ L+ + NG T    F + +++E++ I++L L   +   
Sbjct  65    MIDFPMLKHKMSFFLDRKQQRVTLDISANGATESRNFEIPNINETSTIRSLALQFSK---  121

Query  125   HSLVDLYVDCVYQGEIRTKRSFHKITEDAATLHLEVYKERKYHTKIYKTSGIDAILRQEN  184
              + + L+VDC          +  K+        +++++ERKY   ++    ++  L++ N
Sbjct  122   -NRITLHVDCKASTHHDIDMNLAKLYTQMDDPVIKLFRERKY--PLHFDGDMEHSLQRAN  178

Query  185   CP--------LDLL-----------DFDEMQAFQPSLSNNNEISRR----------GDMG  215
             C           +L             D    ++P+++    +  R          GD+ 
Sbjct  179   CQKGNHRRGNRRMLRNKITEREKNKKRDVRGWYEPTIAREGVVDHRHQEVPTDVERGDIP  238

Query  216   ILH-DLDDQICLTEIIKNTINELIAAIRNLQNEVKSNRLETQHLRQLIENCVACK-PGNE  273
             +L+ D +D +        ++++L+A ++ L+ +V   R E  +LR L+ENC  CK P   
Sbjct  239   VLNGDCEDAL------ARSLSDLLALVKLLREDVAHQRQEIAYLRMLLENCAGCKNPLTT  292

Query  274   PPQIS----CTVNSPCYPGAQCRDTSRGPECGLCPRGLVGDGRTCRPGITCADQPCFRAE  329
               Q+     C   +PCYPG +C D++ GP CG CP G +GDG++C+PG+TCA   C+   
Sbjct  293   DNQLRIEPDCRSANPCYPGVECLDSAAGPRCGHCPLGFIGDGKSCKPGVTCAHHMCYPGV  352

Query  330   MCHDTYNGYRCDPCPEGYVGNGETCTMRPNGCESNPCYPAAECIPTNNYPFYECGPCSEG  389
              CHDT NG +CD CP GY G+G TC++R N C   PC   A+C+     P++ C  C  G
Sbjct  353   QCHDTVNGAQCDSCPAGYEGDGRTCSLR-NPCLDTPCPSGAQCLQVGYPPYFHCISCPMG  411

Query  390   YTKNGTTCQDINE