BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933564.1 nose resistant to fluoxetine protein 6-like [Chelonus
insularis]

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IR42_DROME  unnamed protein product                                 221     2e-61
Q9U6W3_DROME  unnamed protein product                                 136     1e-34
Q389C9_TRYB2  unnamed protein product                                 68.9    1e-11


>Q8IR42_DROME unnamed protein product
Length=827

 Score = 221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 178/685 (26%), Positives = 303/685 (44%), Gaps = 61/685 (9%)

Query  70   CRDQVKLVIFGLKNFTKWAFEFYDASAKIPDGILSGSIYQLGNFDECVKVEDE-------  122
            CR Q+   +  L NF  WA + +D+S K+  GIL+G+I Q G+FD+C+ ++         
Sbjct  154  CRRQMHQFLNALDNFDLWALKMHDSSGKLNSGILNGNINQPGDFDQCLGIQQRMNQDQDA  213

Query  123  -------SVIGFSRKYCLSEVTLEKRGN-----------HSDGSGVSVWDEFNSRPGNDR  164
                   S+I    +YCL+        N            S G   S   EFN  PG+  
Sbjct  214  GQDQDGDSII--RGQYCLAYAQPVLPHNSKRLKSFFKLIQSHGPFKS---EFND-PGHRV  267

Query  165  EKSHRDSDLIEKLFYGVCVPVSCDVGDVERVLDKIINHTLNVYGVDLKSRSLVDKEKCYK  224
             +      LI    +G+CVP  C   DVE  + + + +     G+    R  V+ + C  
Sbjct  268  PRY----SLIN---WGLCVPSGCSARDVEYSVAEYLGNQTASTGITFNVR--VEPQMCQV  318

Query  225  NQTINIDTYDIAYLACILIIIFLVFLGTVFHISTLSRPNQPQGLLFNILRAFSLISNIKK  284
                  D      +   L+++ +  L T++  ST S+P Q          AFSL  N++ 
Sbjct  319  RDQRPWDRNTTWAVRFFLLVLSVAVLSTIYDRSTKSQPKQNPWF-----TAFSLDKNLRW  373

Query  285  LCSHAHEDGLNLSCISGIKFAAMGFIVAGHCLMFVLGGPILNKDFWRQASGRVENAIFLN  344
            L S +   G ++  + GI+F     ++  H  M +   P  N+    ++ G+    I   
Sbjct  374  LFSTSSAPG-DIEAVHGIRFLNAIMLIFSHKSMAMFFNPYNNRTAMSESLGQPWTVIGRA  432

Query  345  NPLLVDTFLFLSGFLFARIVLQELDKRKYINFFFLYVFRYIRLTPAYLVMIGLYTTWLPK  404
              L  D FL  SG L +  +   L K++ I     Y+ R +R+ P    +I   T  LP 
Sbjct  433  ASLYTDPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPPLAALILFCTYVLPL  492

Query  405  LDSGPLWSRMTEEKRR-CLDSWWTNLLYINNYVNTDNLCMFQSWYLSVDTQLFILAPAII  463
              SGP W+ +       C  +WW NLL+I+NY     +C+  + +L +DT+LF +AP +I
Sbjct  493  WGSGPQWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHLGIDTELFAVAPLLI  552

Query  464  YPLWRWRKVGELILSSATALTVVVPFTVTLVNSLDPTLMIYIKEIQDI--SSNYYFKNFY  521
              LWRW + G   L     +     +  T+VN L    + +   IQ +  +++Y +    
Sbjct  553  LALWRWPRRGLFALLLLCTVGTAARYYTTIVNQLS-NYIYFGTNIQRLFRTADYMYS---  608

Query  522  IKTHMRASAYCFGLIFGYILYRIQTSNYKFSRLSVRIYWILASLSLVSSMFSITTFYTTR  581
               H R++ Y  G++ GY+L + Q  N + S L +R+ W++A++ +++S+          
Sbjct  609  FPPH-RSTVYIMGILLGYVLRKYQ--NARLSSLQLRLGWLVATVCVLASLLGPAPMGDIN  665

Query  582  KNFTSLEAATYSALHRVFWSLGTGWVIIACITDNSGPVRNFLKWKPFIPLSRLTYCAYLV  641
              + S  AA Y+A   + W L   W++       +  +     W+ F   ++L+Y  YL 
Sbjct  666  YVYNSTHAAIYAAFAPIAWCLFFSWIVFVSHNGYTNKLTKLFAWRGFQVSTKLSYAIYLT  725

Query  642  NGIVELYSISTTRTPQYLDNINLFSKVMGHLVMTFGGAVILSTFFEGPILGLERIFL-RP  700
               V  +++   R   +  N           +  F  +V L+  F+ P   L+++ + RP
Sbjct  726  QFPVFFFNVGRRRHIHHYYNFVSIILDTNEFISIFLASVALTVLFDAPFQNLKKLLIKRP  785

Query  701  ----VMEASKASKRDNQDGTDTTEA  721
                V++ SKA   ++QD T TT A
Sbjct  786  TAAKVVKDSKAKAAESQDATTTTLA  810


>Q9U6W3_DROME unnamed protein product
Length=377

 Score = 136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/383 (26%), Positives = 173/383 (45%), Gaps = 39/383 (10%)

Query  347  LLVDTFLFLSGFLFARIVLQELDKRKYINFFFLYVFRYIRLTPAYLVMIGLYTTWLPKLD  406
            L  D FL  SG L +  +   L K++ I     Y+ R +R+ P    +I   T  LP   
Sbjct  9    LYTDPFLLFSGMLTSYSLFGRLMKQQPIRLKNEYISRLMRIVPPLAALILFCTYVLPLWG  68

Query  407  SGPLWSRMTEEKRR-CLDSWWTNLLYINNYVNTDNLCMFQSWYLSVDTQLFILAPAIIYP  465
            SGP W+ +       C  +WW NLL+I+NY     +C+  + +L +DT+LF +AP +I  
Sbjct  69   SGPQWNLVVGHHADICKKNWWRNLLFIHNYFGFSEMCLTHTHHLGIDTELFAVAPLLILA  128

Query  466  LWRWRKVGELILSSATALTVVVPFTVTLVNSLDPTLMIYIKEIQDI--SSNYYFKNFYIK  523
            LWR    G+ + SS    +                       IQ +  +++Y +      
Sbjct  129  LWR----GQDVASSPCCCSA---------------------RIQRLFRTADYMYS---FP  160

Query  524  THMRASAYCFGLIFGYILYRIQTSNYKFSRLSVRIYWILASLSLVSSMFSITTFYTTRKN  583
             H R++ Y  G++ GY+L + Q  N + S L +R+ W++A++ +++S+            
Sbjct  161  PH-RSTVYIMGILLGYVLRKYQ--NARLSSLQLRLGWLVATVCVLASLLGPAPMGDINYV  217

Query  584  FTSLEAATYSALHRVFWSLGTGWVIIACITDNSGPVRNFLKWKPFIPLSRLTYCAYLVNG  643
            + S  AA Y+A   + W L   W++       +  +     W+ F   ++L+Y  YL   
Sbjct  218  YNSTHAAIYAAFAPIAWCLFFSWIVFVSHNGYTNKLTKLFAWRGFQVSTKLSYAIYLTQF  277

Query  644  IVELYSISTTRTPQYLDNINLFSKVMGHLVMTFGGAVILSTFFEGPILGLERIFL-RP--  700
             V  +++   R   +  N           +  F  +V L+ FF+ P   L+++ + RP  
Sbjct  278  PVFFFNVGRRRHIHHYYNFVSIILDTNEFISIFLASVALTVFFDAPFQNLKKLLIKRPTA  337

Query  701  --VMEASKASKRDNQDGTDTTEA  721
              V++ SKA   ++QD T TT A
Sbjct  338  AKVVKDSKAKAAESQDATTTTLA  360


>Q389C9_TRYB2 unnamed protein product
Length=791

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 133/359 (37%), Gaps = 60/359 (17%)

Query  381  VFRYIRLTPAYLVMIGLYTTWLPKLDSGPLWSRMTEEK---RRCLDSWWTNLLYINNYVN  437
            V R++R+ P  L +  L    LP    GPLW  ++      + C D WWTNLL INN V 
Sbjct  437  VSRFVRVIPVALTVTLLVPNILPATSKGPLWMALSNAPALHKNCEDYWWTNLLLINNMVP  496

Query  438  TDN--LCMFQSWYLSVDTQLFILAPAIIYPLWRWRKVGELILSSATALTVVV--------  487
            TD    C   S+Y++++ QL    P +IY L R          S   + + V        
Sbjct  497  TDGSKCCFPWSYYVALEFQLVATGP-LIYRLARSLHTRVYTAGSIACVMIGVALRYSAFM  555

Query  488  -------------PFTVTLVNSLDPTLMIYIKEIQDISSNYYFKNFYIKTHMRASA-YCF  533
                         P+T       +   +++I  +    +       YI    RA     F
Sbjct  556  SKKGKHLEKSEAAPYTFDAGALYEWPHLMFIPFL----AGAILHRIYIAVKHRAQTLLMF  611

Query  534  GLIFGYILYRIQTSNYKFSRLSVRIYWILASLSLVS----------SMFSITTFY-----  578
            G     +++R   S     RLS   Y+IL  L L S           M  +  F+     
Sbjct  612  GPDMFTVMHRCPESTTTEDRLS---YFILEKLRLRSMRFLIMWGGIGMMCLCVFWGWSVL  668

Query  579  --TTRKNFTSLEAATYSALHRVFWSLGTGWVIIACITDNSGPVRNFLKWKPFIPLSRLTY  636
              +      S+  A Y +L  +FW LG   ++   +    G  R FL    +  LSRL  
Sbjct  669  HLSQETTQVSVCRAAYESLILLFWCLGLCMLVFPLLFGYGGATRRFLVHPLWCGLSRLVL  728

Query  637  CAYLVNGIVELYSISTTRTPQYLDNIN----LFSKVMGHLVMTFGGAVILSTFFEGPIL  691
              YL+  IV    I          N+     L  + +G   +TF  A +L    E P L
Sbjct  729  VGYLLTPIV----IGIVNAHWGPTNVGVMLLLMLRWLGCTFLTFLAAFVLHMLVERPFL  783



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933565.1 uncharacterized protein LOC118063601 [Chelonus
insularis]

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TDRKH_BOMMO  unnamed protein product                                  60.5    3e-09
TDR12_BOMMO  unnamed protein product                                  55.8    1e-07
TDRKH_DROME  unnamed protein product                                  48.9    1e-05


>TDRKH_BOMMO unnamed protein product
Length=629

 Score = 60.5 bits (145),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 71/154 (46%), Gaps = 21/154 (14%)

Query  226  IEVEVVESYSPSFFWIHLLKNK-KQFHIMMTTLGEFYALHYPDQKVPIAKLKRGLNIACL  284
            IEV V    SPS FW+  +  +  Q   ++  + E+Y+     +   +  +  G  +A +
Sbjct  248  IEVYVSAVSSPSRFWVQFVGPQVAQLDDLVAHMTEYYSKKENREAHTLRHVSVGQVVAAV  307

Query  285  F--DGKWHRAVIKSIDPND-----KVTVMFY-DFGTLYKCLSNEVYYLHQSFMDLPAQAV  336
            F  DG+W+RA +  I PN+     +V  +FY D+G      ++E+  L    + L  QA+
Sbjct  308  FRHDGRWYRARVHDIRPNEFDSSQQVADVFYLDYGDSEYVATHELCELRADLLRLRFQAM  367

Query  337  PCRLYGVAPQDG-----------DKW-PKRVRDF  358
             C L GV P  G           DKW P+ V  F
Sbjct  368  ECFLAGVRPASGEEAVSPSGQTWDKWHPQAVERF  401


>TDR12_BOMMO unnamed protein product
Length=1759

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 66/134 (49%), Gaps = 12/134 (9%)

Query  286   DGKWHRAVIKSIDPNDKVTVMFYDFGTLYKCLSNEVYYLHQSFM-DLPAQAVPCRLYGVA  344
             D  + RA I  I   DKV   F D G      +N++  + ++F+  LP QA+ CRL G+ 
Sbjct  1349  DSMYERARIDHIYSEDKVKCFFVDQGDWRDVSTNDLATITENFITQLPFQAIECRLIGIR  1408

Query  345   PQDGDKWPKRVRDFFNQWVYERP---LWANIIEADVKKKS-------ISVTLVDTSENDD  394
             P  G++W +   ++F+   +E     L    ++   K+K+         V L+DT  N+D
Sbjct  1409  PF-GEQWTEFSTNWFSDHCFEDAKGNLKHLYVKHFTKEKADCTGGHKYGVALIDTYTNED  1467

Query  395   FIINDWLIHNKMAK  408
              I+N  LI   +AK
Sbjct  1468  IIVNQLLIDLNLAK  1481


>TDRKH_DROME unnamed protein product
Length=576

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/211 (25%), Positives = 81/211 (38%), Gaps = 29/211 (14%)

Query  226  IEVEVVESYSPSFFWIHLLK-NKKQFHIMMTTLGEFYALHYPDQKVPIAKLKRGLNIACL  284
            +EV V    SP+ FW+ L+    K+   M+  +  +Y+      K  +     G  +A +
Sbjct  261  MEVYVSAVASPTKFWVQLIGPQSKKLDSMVQEMTSYYSSAENRAKHVLTAPYVGQIVAAV  320

Query  285  F--DGKWHRAVIKSIDPNDK------VTVMFYDFGTLYKCLSNEVYYLHQSFMDLPAQAV  336
            F  D KW+RA I  I PN        + + F D+G        ++  L   F+ L  QAV
Sbjct  321  FKFDEKWYRAEIVDIMPNQYNPKEQVIDLYFVDYGDSEYISPADICELRTDFLTLRFQAV  380

Query  337  PCRLYGVAP---QDGDKWPKRVRDFFNQWV---------------YERPLWANIIEADVK  378
             C L  V      +   WPK     F +                  ERP     + A  K
Sbjct  381  ECFLANVKSTIQTEPITWPKSSIAKFEELTEVAHWRKLIARVVTYKERPRATTAVSAAAK  440

Query  379  KKS--ISVTLVDTSENDDFIINDWLIHNKMA  407
            + +    V L D ++N +  I D +I    A
Sbjct  441  EGTPLPGVELFDPADNSELNIADLMITQGFA  471



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933566.1 tyrosine-protein kinase transmembrane receptor Ror2
[Chelonus insularis]

Length=655
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ROR2_DROME  unnamed protein product                                   718     0.0  
ROR1_DROME  unnamed protein product                                   295     4e-90
INSR_DROME  unnamed protein product                                   231     2e-64


>ROR2_DROME unnamed protein product
Length=724

 Score = 718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/676 (52%), Positives = 456/676 (67%), Gaps = 74/676 (11%)

Query  24   GYCAIYNGKICKKYLNGVGKVWFNNSQDNPGSWLNEKITSDLWEELISTLKEPCRSAAEK  83
            GYCA Y+GK+CK+YL   G+VW++  +D  G W NE++T+ LW+ELIS L   CR AAEK
Sbjct  68   GYCAPYSGKVCKEYL--TGQVWYS-LEDPTGGWKNEQVTTALWDELISDLTGLCREAAEK  124

Query  84   MLCVYAFPLCH----KSERLPLCYEDCMAIRHEFCFNDWALIEDNKQRKIFIRSRGHFRL  139
            MLC YAFP CH    ++ + PLC+EDC A   +FC+NDW LIE+ K+R +FI+SRGHFRL
Sbjct  125  MLCAYAFPNCHMEGGRAVKAPLCFEDCQATHLQFCYNDWVLIEEKKERNMFIKSRGHFRL  184

Query  140  PDCDELPKLEED--KVTCSHVHLTDVNQNLVTYDCVLDNGRYYMGKMNKTKTGLDCQPWN  197
            P+C  LP       +  CS++ LT++ ++ V+YDC   NGR+YMG MN +K+G+ CQ W+
Sbjct  185  PNCSSLPHYNASMRRPNCSYIGLTELKESEVSYDCRNGNGRFYMGTMNVSKSGIPCQRWD  244

Query  198  SQEPHSHNEPPNVFPQIKFGENFCRNAGGDEPMPWCFTMDPKIRWQHCDIPICDNSTNFI  257
            +Q PH H +PP VF Q+  GEN+CRNAGG+EP PWC+T+D  +RWQHCDIP+C +  +  
Sbjct  245  TQYPHKHFQPPLVFHQLLEGENYCRNAGGEEPHPWCYTVDESVRWQHCDIPMCPDYVDPN  304

Query  258  WDTEHKNVATEIVFTSTFTMILSALGFIIIVGSLMAIFLSQRFKKHDGYVSPEAR-----  312
                +  +  E  FT +   +L+ +GF+ IV   + I L  +  KH  Y  P        
Sbjct  305  AVDLNTPIKMEKFFTPSMIFLLAGIGFVAIVTLHLMILLVYKLSKHKDYSQPAGAATAEC  364

Query  313  ------------DINIDLDKLPSN-----------------------------DAYHKTG  331
                        ++N   + L  N                             +     G
Sbjct  365  SVSMRGGGDCGGNLNTSRETLGGNGNTNTLAKWGTIRSTATIHSNCVALTTVTNVSDAKG  424

Query  332  AQLNPKLEKLEFPRNNIIYVRDLGQGAFGRVFQAKAPGLIPGEEFTNVAVKMLKEEASDD  391
             + N +LEKLE+PR +I+YVR LGQGAFGRVFQA+APGL+P +E   VAVKMLK++ASD 
Sbjct  425  TKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDLLVAVKMLKDDASDQ  484

Query  392  LLVDFEREACLLAEFDHPNIVKLLGVCALGRPMCLLFEYMGRGDLNEFLRSCCPDNYKFT  451
            + +DFEREACLLAEFDHPNIV+LLGVCALGRPMCLLFEYM  GDL+EFLR+C P      
Sbjct  485  MQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPY-----  539

Query  452  NGDVTHSNLNQKNWQNGTDNSKLSHMDLINIARQVASGMVYLSDRKFVHRDLATRNCLIN  511
                TH    Q       D  +L+ + L+ +A  +A+GM+YLS+RKFVHRDLATRNCLIN
Sbjct  540  ---ATHQAPTQ-------DRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLIN  589

Query  512  DEMVVKIADFGLSQKIYLQDYYKGDDQDAIPVRWMPLESILYNKYTIESDVWAFAVCLWE  571
            + M VKIADFGLS KIYLQDYYKGD+ D IP+RWMPLESILYNK+++ESDVWA+ +CLWE
Sbjct  590  EHMAVKIADFGLSHKIYLQDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWE  649

Query  572  IFSFALQPYYGMTHEEVVKYIKEGNVLSCPDNTPPAIYGLMKICWNKKPSDRPSFRTIYQ  631
            +FSFALQPY+G+THEEV+KYIKEGNVL CPDNTP ++Y LM+ CWN+KPS+RP F  I  
Sbjct  650  VFSFALQPYFGLTHEEVIKYIKEGNVLGCPDNTPLSVYALMRRCWNRKPSERPGFAEINH  709

Query  632  TLDDIKHQL-EAENKS  646
                I+H + E+E K+
Sbjct  710  C---IQHSIAESECKA  722


>ROR1_DROME unnamed protein product
Length=685

 Score = 295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 184/516 (36%), Positives = 273/516 (53%), Gaps = 68/516 (13%)

Query  135  GHFRLPDCDELPKLEEDKVTCSHVHLT-DVNQNLVTYDCVLDNGRYYMGKMNKTKTGLDC  193
            G   + DC +LP+ ++    C  + +T +V++   T +C  ++G  Y G  N + +G  C
Sbjct  206  GMVGVEDCQKLPQHKD----CLSLGITIEVDK---TENCYWEDGSTYRGVANVSASGKPC  258

Query  194  QPWNSQEPHSHNEPPNVFPQIKFGENFCRNAGGDEPMPWCFTMDPKIRW-QHCDIPICDN  252
              W+       +     FP++  G+N+CRN G  E  PWCF    + R  + CDIP C +
Sbjct  259  LRWSWLMKEISD-----FPEL-IGQNYCRNPGSVENSPWCFVDSSRERIIELCDIPKCAD  312

Query  253  STNFIWDTEHKNVATEIVFTSTFTMILSALGFIIIVGSLMAIFLSQRFKKHDGYVSPEAR  312
                IW          IV T+   +++  + F II+     I        H+  ++  + 
Sbjct  313  K---IW--------IAIVGTTAAIILIFIIIFAIILFKRRTIMHYGMRNIHN--INTPSA  359

Query  313  DINI---------------DLDKLPSNDAYHKTGAQLNPKLEKLEFPRNNIIYVRDLGQG  357
            D NI               +L  L  + A +    + N  L    F   ++ ++ +LG+G
Sbjct  360  DKNIYGNSQLNNAQDAGRGNLGNLSDHVALNSKLIERNTLLRINHFTLQDVEFLEELGEG  419

Query  358  AFGRVFQAKAPGLIPGEEFTNVAVKMLKEEASDDLLVDFEREACLLAEFDHPNIVKLLGV  417
            AFG+V++ +   L P +    VA+K LKE AS     DF+RE  L+++  H NIV +LGV
Sbjct  420  AFGKVYKGQL--LQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGV  477

Query  418  CALGRPMCLLFEYMGRGDLNEFLRSCCPDNYKFTNGDVTHSNLNQKNWQNGTDNSKLSHM  477
                 P C+LFEYM  GDL+EFL S  P                       T+   LS +
Sbjct  478  VLNKEPYCMLFEYMANGDLHEFLISNSP-----------------------TEGKSLSQL  514

Query  478  DLINIARQVASGMVYLSDRKFVHRDLATRNCLINDEMVVKIADFGLSQKIYLQDYYKGDD  537
            + + IA Q++ GM YLS   +VHRDLA RNCL+N+ +VVKI+DFGLS+ IY  DYY+   
Sbjct  515  EFLQIALQISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQS  574

Query  538  QDAIPVRWMPLESILYNKYTIESDVWAFAVCLWEIFSFALQPYYGMTHEEVVKYIKEGNV  597
            +  +PVRWMP ESILY K+T ESDVW+F V LWEI+S+ +QPYYG +++EV+  I+   +
Sbjct  575  KSLLPVRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGMQPYYGFSNQEVINLIRSRQL  634

Query  598  LSCPDNTPPAIYGLMKICWNKKPSDRPSFRTIYQTL  633
            LS P+N P A+Y LM  CW+++   RP+F  I   L
Sbjct  635  LSAPENCPTAVYSLMIECWHEQSVKRPTFTDISNRL  670


 Score = 35.8 bits (81),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 41/93 (44%), Gaps = 22/93 (24%)

Query  21   ESQGYCAIYNGKICKKYLNGVGKVWFNNSQDNPGSWLNEKIT-SDLWEELIST---LKEP  76
            +S G C IYNG IC+  L+            N   +++  +T +DL E L +    +KE 
Sbjct  36   QSSGICHIYNGTICRDVLS------------NAHVFVSPNLTMNDLEERLKAAYGVIKES  83

Query  77   ------CRSAAEKMLCVYAFPLCHKSERLPLCY  103
                  CR  A   LC  + P+C   ER  L Y
Sbjct  84   KDMNANCRMYALPSLCFSSMPICRTPERTNLLY  116


>INSR_DROME unnamed protein product
Length=2144

 Score = 231 bits (590),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/322 (37%), Positives = 190/322 (59%), Gaps = 15/322 (5%)

Query  320   KLPSNDAYHKTGAQLNPKLEKLEFP-------RNNIIYVRDLGQGAFGRVFQAKAPGLIP  372
             K+PSND +  T  ++NP    +++        R NII +  LGQG+FG V++       P
Sbjct  1338  KVPSNDLHMNT--EVNPFYASMQYIPDDWEVLRENIIQLAPLGQGSFGMVYEGILKSFPP  1395

Query  373   GEEFTNVAVKMLKEEASDDLLVDFEREACLLAEFDHPNIVKLLGVCALGRPMCLLFEYMG  432
                    A+K + E A+D    +F  EA ++ EFD  ++V+LLGVC+ G+P  ++ E M 
Sbjct  1396  NGVDRECAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLGVCSRGQPALVVMELMK  1455

Query  433   RGDLNEFLRSCCPDNYKFTNGDVTHSNLNQKNWQNGTDNSKLSHMDLINIARQVASGMVY  492
             +GDL  +LR+  P+       +   + LN+            ++  +  +A ++A GM Y
Sbjct  1456  KGDLKSYLRAHRPEE----RDEAMMTYLNRIGVTGNVQPP--TYGRIYQMAIEIADGMAY  1509

Query  493   LSDRKFVHRDLATRNCLINDEMVVKIADFGLSQKIYLQDYYKGDDQDAIPVRWMPLESIL  552
             L+ +KFVHRDLA RNC++ D++ VKI DFG+++ IY  DYY+   +  +PVRWMP ES+ 
Sbjct  1510  LAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPVRWMPPESLR  1569

Query  553   YNKYTIESDVWAFAVCLWEIFSFALQPYYGMTHEEVVKYIKEGNVLSCPDNTPPAIYGLM  612
                Y+  SDV++F V LWE+ + A QPY G+++E+V++Y+ +G V+  P+N P  ++ LM
Sbjct  1570  DGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPENCPDFLHKLM  1629

Query  613   KICWNKKPSDRPSFRTIYQTLD  634
             + CW+ + S RPSF  I   L+
Sbjct  1630  QRCWHHRSSARPSFLDIIAYLE  1651



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933567.1 mucin-5AC-like isoform X4 [Chelonus insularis]

Length=2255


***** No hits found *****



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933568.1 uncharacterized protein LOC118063603 [Chelonus
insularis]

Length=646
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KI42_DROME  unnamed protein product                                 43.5    6e-04
GLR1_CAEEL  unnamed protein product                                   37.0    0.051
Q7KUT6_DROME  unnamed protein product                                 35.4    0.14 


>Q0KI42_DROME unnamed protein product
Length=897

 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 104/258 (40%), Gaps = 43/258 (17%)

Query  381  VINSGVEIPINTLSLKIFFCMIFLYFIVIHSTFSGNLPRFLTIPEYHDSIDSLEDLSNPW  440
            ++  G EI    LS +      + + +++ S+++ NL  FLTI +    I+S++DL++  
Sbjct  608  LLQQGSEIGPKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNK  667

Query  441  ITTIYD-------KGFY----TEHYEFKDKEIKRKVKYLFD---------HSDLFEHFMM  480
               +Y        + F+     E Y+  +K +    +YL +          ++    F+M
Sbjct  668  DGVVYGAKKTGSTRNFFMTSAEERYKKMNKFMSENPQYLTEDNMEGVNRVKTNTHYAFLM  727

Query  481  DKNSVCIINKIHANLLTFNLGKSMNEIHISKNDIGDAI----FGIVSRPRFYLREKFQRA  536
            +  S+    K   NL                  IGDA+    +GI  R  +  R KF  A
Sbjct  728  ESTSIEYNTKRECNL----------------KKIGDALDEKGYGIAMRKDWPHRGKFNNA  771

Query  537  TSYMFDVSLNKQLKSVVNKAQRTIIKQRSTSDIKFRKITVNDLMFAFIFLTIGNTVGLVC  596
               + +  + +++K+       T I            + +N+L   F  L +G+   L+ 
Sbjct  772  LLELQEQGVLEKMKNKWWNEVGTGICATKEDAPDATPLDMNNLEGVFFVLLVGSCCALLY  831

Query  597  FLIE---LVMGKKYHQRI  611
             +I     VM K +H R+
Sbjct  832  GIISWVLFVMKKAHHYRV  849


>GLR1_CAEEL unnamed protein product
Length=962

 Score = 37.0 bits (84),  Expect = 0.051, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (57%), Gaps = 6/67 (9%)

Query  371  TLAAFDVLRLVINSGVEIPINTLSLKIFFCMIFLYFIVIHSTFSGNLPRFLTIPEYHDSI  430
            TLAAF      +  G +I   ++S +I     + + ++I S+++ NL  FLT+ +    I
Sbjct  645  TLAAF------MQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPI  698

Query  431  DSLEDLS  437
            +S+EDL+
Sbjct  699  ESVEDLA  705


>Q7KUT6_DROME unnamed protein product
Length=433

 Score = 35.4 bits (80),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 24/105 (23%), Positives = 43/105 (41%), Gaps = 16/105 (15%)

Query  373  AAFDVLRLVINSGVEIPINTLSLKIFFCMIFLYFIVIHSTFSGNLPRFLTIPEYHDSIDS  432
                 L+L +N       ++ +L+      ++  I++ + +SG L   LT+P   ++ DS
Sbjct  187  GCISTLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADS  246

Query  433  LEDL----------SNPWITTIYDKGF------YTEHYEFKDKEI  461
             + L          S  WITTI ++          EHY   D  +
Sbjct  247  RQRLFDHKLIWTGTSQAWITTIDERSADPVLLGLMEHYRVYDANL  291



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933569.1 glycosylphosphatidylinositol anchor attachment 1
protein [Chelonus insularis]

Length=638
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W464_DROME  unnamed protein product                                 463     2e-155
Q961V1_DROME  unnamed protein product                                 408     2e-135
C0H5L4_PLAF7  unnamed protein product                                 63.9    2e-10 


>Q9W464_DROME unnamed protein product
Length=674

 Score = 463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 259/660 (39%), Positives = 386/660 (58%), Gaps = 56/660 (8%)

Query  1    MGLLTDPR-AGNMKIIKIIVRWETQICALMYIAGIIWMMLLALPYFNDSTYFSENALLPG  59
            MGLL+DP  +   K++  + R   ++C  +Y+AG+ W   LALP FN  TY SENAL PG
Sbjct  1    MGLLSDPSISTQSKLVDGLARHVRKVCYALYVAGVAWFFCLALPEFNHGTYLSENALSPG  60

Query  60   LVTKESNLEST--ARQYYRELLDEMSKDPNRMPLPWISAKLNQLHLDVYTHNFSLNYPFQ  117
            LV  E  +++   A Q   EL  E     +  P  WI+AK+N+  L+ +THN++L YPF 
Sbjct  61   LVYPEIRIDANRLAIQLLEELQRERKDHLSTTPHAWIAAKMNEFGLETHTHNYTLRYPFG  120

Query  118  K-HQFTGQNIYGIVRAPRAASTEAIVISVPFRKLSSVHPLTAPSIALLLAFAKFCRKKKY  176
               ++ G+NIYGI+RAPR ASTE IV + P+R  SSVH   + S+ LLLAFA F R+K Y
Sbjct  121  GGKEYHGKNIYGILRAPRIASTEGIVFAAPYRAASSVHTDISASVPLLLAFADFARRKNY  180

Query  177  WAKDIIFLITEHEQLGMQAWLDAYHG---VVSGQKGVLIPGDLSGRAGSIQAAINLELHS  233
            WAKD+IFLITE EQLGMQAWL+AYH     +   K  L PG+L  RAGS+QAA+N+E+  
Sbjct  181  WAKDLIFLITEQEQLGMQAWLEAYHDGDRELDLSKAYLRPGNLPARAGSLQAALNIEVQD  240

Query  234  IKVSYIDVKVEGLNGQLPNLDLFNLAQNMIKKEEIKRSFQRRFDIRSKHAFKEWWYYFNT  293
            +++ ++DV++EGLNG+LPNLD+FNL Q ++ +E I   +++    + +H+   +   F  
Sbjct  241  LEIDHVDVRIEGLNGKLPNLDMFNLVQRIMAREGIASGYKQAPRKKRRHSQSHFEQNFRQ  300

Query  294  LSSMIFTQATGVPTGNHGLFHRYGIEAITLEGFEATDKKT-----GVNFHQLGRVIESIV  348
            + +M+ +Q++GVPTGNHGLFHRY I+A+T+         T     G     L + IE I 
Sbjct  301  MLTMLASQSSGVPTGNHGLFHRYRIDALTIAANRRATHATLKGSPGSAAVPLLKAIEGIA  360

Query  349  RSLNNLLERFHQSFFFYLLPSTDRYISIGLYMPSLVLIVGSLFIKAFSIWVKMQDSTSKV  408
            RSLNNLLERFHQSFFFY++ S DRYISIG YMP+LV +V   F+KA+  W  +  + +++
Sbjct  361  RSLNNLLERFHQSFFFYVIVSNDRYISIGDYMPALVALVACAFLKAYLTWSTLPATNAEL  420

Query  409  DPTT-----------KEATLKSDESEEK--------SSEIQVGNIASDFLWSHIFGVAVM  449
            +               E  L+ D+ E          ++ + +G + +       F    M
Sbjct  421  EKAAGWLREHEQEAELEENLEPDKFELPYGSVLIYLTATLLIGFLCNVLPLQQYFLEIPM  480

Query  450  SSPPLLTSLGAQYLHLQTEDSIYYGF---FIITLITWTYFIFTKRSSKPDSISQIRVIVL  506
             + PL TS+   +L L        GF   F++ L              P  +  + V  L
Sbjct  481  GAAPLTTSV-LSFLSL-------IGFVLPFVVVL-------------PPGGLELLHVAFL  519

Query  507  VEFSTSLMCIGMHNFSLALLTGIIYVP-AILLITPNENSNSKARHLLKLTWILLHPFMII  565
            + +  +L+ IG+ NF+L L   ++ VP  I L T  ENS S  R+ ++L  ++++P M++
Sbjct  520  LIYGCALIVIGLLNFALGLFAAVLTVPLVIALETKEENSRSTLRNTIRLATLVMNPMMVV  579

Query  566  SIIISAVTYNNFPEESLSSLFVRSIDATKKALVFSIVDSMIYGNWLFHAATIILLPVWLL  625
             +I+ A+T+  FPE  +  + +R+  A   A  + ++DS+IYGNWL+     I LP+W++
Sbjct  580  YVIVLAMTFYQFPELPVQKIMLRAATAAMDASAYGLIDSVIYGNWLYFVICTIFLPLWII  639


>Q961V1_DROME unnamed protein product
Length=561

 Score = 408 bits (1048),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 232/583 (40%), Positives = 337/583 (58%), Gaps = 56/583 (10%)

Query  1    MGLLTDPR-AGNMKIIKIIVRWETQICALMYIAGIIWMMLLALPYFNDSTYFSENALLPG  59
            MGLL+DP  +   K++  + R   ++C  +Y+AG+ W   LALP FN  TY SENAL PG
Sbjct  1    MGLLSDPSISTQSKLVDGLARHVRKVCYALYVAGVAWFFCLALPEFNHGTYLSENALSPG  60

Query  60   LVTKESNLEST--ARQYYRELLDEMSKDPNRMPLPWISAKLNQLHLDVYTHNFSLNYPFQ  117
            LV  E  +++   A Q   EL  E     +  P  WI+AK+N+  L+ +THN++L YPF 
Sbjct  61   LVYPEIRIDANRLAIQLLEELQRERKDHLSTTPHAWIAAKMNEFGLETHTHNYTLRYPFG  120

Query  118  K-HQFTGQNIYGIVRAPRAASTEAIVISVPFRKLSSVHPLTAPSIALLLAFAKFCRKKKY  176
               ++ G+NIYGI+RAPR ASTE IV + P+R  SSVH   + S+ LLLAFA F R+K Y
Sbjct  121  GGKEYHGKNIYGILRAPRIASTEGIVFAAPYRAASSVHTDISASVPLLLAFADFARRKNY  180

Query  177  WAKDIIFLITEHEQLGMQAWLDAYHG---VVSGQKGVLIPGDLSGRAGSIQAAINLELHS  233
            WAKD+IFLITE EQLGMQAWL+AYH     +   K  L PG+L  RAGS+QAA+N+E+  
Sbjct  181  WAKDLIFLITEQEQLGMQAWLEAYHDGDRELDLSKAYLRPGNLPARAGSLQAALNIEVQD  240

Query  234  IKVSYIDVKVEGLNGQLPNLDLFNLAQNMIKKEEIKRSFQRRFDIRSKHAFKEWWYYFNT  293
            +++ ++DV++EGLNG+LPNLD+FNL Q ++ +E I   +++    + +H+   +   F  
Sbjct  241  LEIDHVDVRIEGLNGKLPNLDMFNLVQRIMAREGIASGYKQAPRKKRRHSQSHFEQNFRQ  300

Query  294  LSSMIFTQATGVPTGNHGLFHRYGIEAITLEGFEATDKKT-----GVNFHQLGRVIESIV  348
            + +M+ +Q++GVPTGNHGLFHRY I+A+T+         T     G     L + IE I 
Sbjct  301  MLTMLASQSSGVPTGNHGLFHRYRIDALTIAANRRATHATLKGSPGSAAVPLLKAIEGIA  360

Query  349  RSLNNLLERFHQSFFFYLLPSTDRYISIGLYMPSLVLIVGSLFIKAFSIWVKMQDSTSKV  408
            RSLNNLLERFHQSFFFY++ S DRYISIG YMP+LV +V   F+KA+  W  +  + +++
Sbjct  361  RSLNNLLERFHQSFFFYVIVSNDRYISIGDYMPALVALVACAFLKAYLTWSTLPATNAEL  420

Query  409  DPTT-----------KEATLKSDESEEK--------SSEIQVGNIASDFLWSHIFGVAVM  449
            +               E  L+ D+ E          ++ + +G + +       F    M
Sbjct  421  EKAAGWLREHEQEAELEENLEPDKFELPYGSVLIYLTATLLIGFLCNVLPLQQYFLEIPM  480

Query  450  SSPPLLTSLGAQYLHLQTEDSIYYGF---FIITLITWTYFIFTKRSSKPDSISQIRVIVL  506
             + PL TS+   +L L        GF   F++ L              P  +  + V  L
Sbjct  481  GAAPLTTSV-LSFLSL-------IGFVLPFVVVL-------------PPGGLELLHVAFL  519

Query  507  VEFSTSLMCIGMHNFSLALLTGIIYVPAILLITPNENSNSKAR  549
            + +  +L+ IG+ NF+L L   ++ VP ++ +   E  NS AR
Sbjct  520  LIYGCALIVIGLLNFALGLFAAVLTVPLVIALETKEE-NSAAR  561


>C0H5L4_PLAF7 unnamed protein product
Length=795

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 104/262 (40%), Gaps = 39/262 (15%)

Query  140  AIVISVPFRKLSSVHPLTAPSIALLLAFAKFCRKKKYWAKDIIFLITEHE---QLGMQAW  196
             +VI+  F++    H     S+ + L   +   K  Y +KD+ FL T  E    LG+Q +
Sbjct  137  VVVINFDFKERKYFH-----SVIIGLTLMEHFSKCNYMSKDVTFLFTNKELLYSLGVQEF  191

Query  197  LDAYHGVVSGQKGVLIPGDLSGRAGSIQAAINLELHSIKVSYIDVKVEGLNGQLPNLDLF  256
            +  Y    + + G  I          I+++  +E  SI  SYI +  EGLNG LPN DL 
Sbjct  192  IQKYFYNNTNRIGKKI----------IRSSTIIEFDSIYPSYIKINYEGLNGMLPNQDLI  241

Query  257  NLAQNMIKKEEIKRSFQRRFDIRSKHAFKEWWYYFNTLSSMIFTQATGVPTGN-HGLFHR  315
             L  N +    I    +                        IF  A      N H  F R
Sbjct  242  LLLTNELHFYSIPIKME-------------------LTHGSIFDMALEKNYENGHIYFLR  282

Query  316  YGIEAITLEGFEATD-KKTGVNFHQLGRVIESIVRSLNNLLERFHQSFFFYLLPSTDRYI  374
              I A T  G      +   +N   L + ++S +RS +N  E F  S  FY   +  R+I
Sbjct  283  ENIPAFTATGGSKVPIRNKMINLFNLTKALQSYLRSQSNTHEGFCHSSNFYFFNTFRRHI  342

Query  375  SIGLYMPSLVLIVGSLFIKAFS  396
             I +Y  S+ LI     +K F 
Sbjct  343  PISIYCYSVYLICAYSIMKLFK  364



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933570.1 uncharacterized protein LOC118063605 [Chelonus
insularis]

Length=606


***** No hits found *****



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933571.1 EGF domain-specific O-linked N-acetylglucosamine
transferase isoform X1 [Chelonus insularis]

Length=555
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EOGT_DROME  unnamed protein product                                   599     0.0  
CBPC_DICDI  unnamed protein product                                   32.3    0.48 
DPOLA_DROME  unnamed protein product                                  31.2    3.2  


>EOGT_DROME unnamed protein product
Length=520

 Score = 599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/516 (56%), Positives = 367/516 (71%), Gaps = 16/516 (3%)

Query  30   VKIFIILAMLINISSASVGENLGNYSDIDLPTNHLKYYFHSFPAVVQKCQDDPACPYKDY  89
            + I  IL  ++++S A   ++L  +S   LP+ HL  Y ++FP + Q+   +        
Sbjct  1    MPILPILIGILHLSLAEDAKHLDGFSLPSLPSEHLIRYLNTFPKLKQQLPTN--------  52

Query  90   LNEKG-----CWGYEEDCDKKYAFSTPHCPGDHKGWVQTKEAQVDTFYAQGDFGYVRDQR  144
            L  KG     CWG+E DC     F TP CPG+H GW ++KEAQV TFY Q DFGY+++Q 
Sbjct  53   LTGKGTISSACWGHERDCTPAGRFQTPQCPGEHTGWARSKEAQVRTFYNQADFGYIQEQL  112

Query  145  KEMMLLCEPFFVEDSSLECSEHLRFCRGRNIMINFEDLINRNEPLRYAMDVLKEGQIGGY  204
             ++   C P ++ DSSLEC+ +LRFCRGRN++ +F  L  R E +RY MDVL  GQ+ G+
Sbjct  113  SQLTPQCVPTYLGDSSLECTHYLRFCRGRNLLFDFRGLEQREERIRYHMDVLGPGQLLGH  172

Query  205  CSWNAKKLLENADHI-SALQSWGPEFRNFRKLPRRPIVEGDCDIVIEKPTYIMKIDATVN  263
            C  N  +L    +HI SALQSWGPE RNF  LP   +  G CD+V+  PT+IMKIDAT N
Sbjct  173  CKLNRTRLSGEMEHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDATYN  232

Query  264  LYHHFCDFFNLYASLHVNNTHPSTFSTDNHILIWESYSYRSAFQDTFEAFTRNPLWDLNT  323
            +YHHFCDFFNLYASL VN +HP+ F+TD  ILIWE+Y Y S F+DTF+AF++ P+W L+ 
Sbjct  233  MYHHFCDFFNLYASLFVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAFSQRPVWTLSD  292

Query  324  FRGDKVCFRNVVFPLLPRMIFGLYYNTPLIYGCEKSGLFKAFSEHILHRLKIPLHPRKND  383
              G +VCF+NVV PLLPRMIFGL+YNTP+I GC  SGLF+AFSE ILHRL+IP  P +  
Sbjct  293  VEGKRVCFKNVVLPLLPRMIFGLFYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQQ-  351

Query  384  KIKVTLLSRDTRYRRILNEDELVEALKKNKKYKVRKVVYNRNVPFKKQLEITRNTDIFIG  443
            KI++T LSR T+YR++LNEDEL+  L+ N KY V++V Y R +PF  QL ITRNTDI IG
Sbjct  352  KIRITYLSRRTKYRQVLNEDELLAPLEANDKYDVQRVSYER-LPFTNQLAITRNTDILIG  410

Query  444  IHGAGLTHALFLPDWAAIFELYNCEDSSCYKDLARLRGVKYFTWEKNDKLIQQDPGTHPD  503
            +HGAGLTH LFLP+WA IFELYNCED +CYKDLARLRGV+Y TWE+ D +  QD G HP+
Sbjct  411  MHGAGLTHLLFLPNWACIFELYNCEDPNCYKDLARLRGVRYRTWEQRDLVYPQDEGHHPE  470

Query  504  GGAHAKFTNYSFDVEEFLRIVSRAAKYVKGQESFKR  539
            GGAHAKFTNYSFDV+EF+ +V  AA+ +   + F R
Sbjct  471  GGAHAKFTNYSFDVKEFVHLVDGAAEEILSHKEFPR  506


>CBPC_DICDI unnamed protein product
Length=166

 Score = 32.3 bits (72),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 36/80 (45%), Gaps = 13/80 (16%)

Query  192  AMDVLKEG-----QIGGYCSWNAKKLLENADHISALQSWGPEFRNF-----RKLPRRPIV  241
             +D+ K+G     +I  YC+ NAKKL+E    I+AL         F     RKL +   V
Sbjct  56   TIDINKDGKFSYHEIAKYCADNAKKLIEQNADIAALADVEAFLLRFDKDKDRKLNKTEFV  115

Query  242  E---GDCDIVIEKPTYIMKI  258
            E   G  D       Y++KI
Sbjct  116  EYFKGGTDTPYSDRDYVLKI  135


>DPOLA_DROME unnamed protein product
Length=1488

 Score = 31.2 bits (69),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 27/123 (22%), Positives = 44/123 (36%), Gaps = 10/123 (8%)

Query  258  IDATVNLYHHFCDFFNLYASLHVNNTHPSTFSTDNHILIWESYSYRSAFQDTFEAFTRNP  317
            I   +N +   C   + +    +     ST S+D  +  W   +Y    +   E F    
Sbjct  326  ISRLLNNWESICQMDDDFEKSVLTTEQDSTISSDQQLRFWYWEAYEDPVKMPGEVFLFGR  385

Query  318  LWDLNTFRGDKVCFR----NVVFPLLPRM-IFGLYYNTPLIYGCEKSGLFKAFSEHILHR  372
              D     G  VC R    N V  LLPR  +       P       + ++K F   + ++
Sbjct  386  TAD-----GKSVCLRVQNINRVLYLLPRQFLLDPISKEPTKQKVTVADIYKEFDSEVANQ  440

Query  373  LKI  375
            LK+
Sbjct  441  LKL  443



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933572.1 EGF domain-specific O-linked N-acetylglucosamine
transferase isoform X2 [Chelonus insularis]

Length=498
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EOGT_DROME  unnamed protein product                                   580     0.0  
CBPC_DICDI  unnamed protein product                                   32.7    0.37 
DPOLA_DROME  unnamed protein product                                  30.4    4.3  


>EOGT_DROME unnamed protein product
Length=520

 Score = 580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/448 (60%), Positives = 335/448 (75%), Gaps = 3/448 (1%)

Query  36   KGCWGYEEDCDKKYAFSTPHCPGDHKGWVQTKEAQVDTFYAQGDFGYVRDQRKEMMLLCE  95
              CWG+E DC     F TP CPG+H GW ++KEAQV TFY Q DFGY+++Q  ++   C 
Sbjct  61   SACWGHERDCTPAGRFQTPQCPGEHTGWARSKEAQVRTFYNQADFGYIQEQLSQLTPQCV  120

Query  96   PFFVEDSSLECSEHLRFCRGRNIMINFEDLINRNEPLRYAMDVLKEGQIGGYCSWNAKKL  155
            P ++ DSSLEC+ +LRFCRGRN++ +F  L  R E +RY MDVL  GQ+ G+C  N  +L
Sbjct  121  PTYLGDSSLECTHYLRFCRGRNLLFDFRGLEQREERIRYHMDVLGPGQLLGHCKLNRTRL  180

Query  156  LENADHI-SALQSWGPEFRNFRKLPRRPIVEGDCDIVIEKPTYIMKIDATVNLYHHFCDF  214
                +HI SALQSWGPE RNF  LP   +  G CD+V+  PT+IMKIDAT N+YHHFCDF
Sbjct  181  SGEMEHIGSALQSWGPELRNFDVLPHPVLESGLCDVVVNTPTFIMKIDATYNMYHHFCDF  240

Query  215  FNLYASLHVNNTHPSTFSTDNHILIWESYSYRSAFQDTFEAFTRNPLWDLNTFRGDKVCF  274
            FNLYASL VN +HP+ F+TD  ILIWE+Y Y S F+DTF+AF++ P+W L+   G +VCF
Sbjct  241  FNLYASLFVNQSHPAAFNTDVQILIWETYPYDSPFRDTFKAFSQRPVWTLSDVEGKRVCF  300

Query  275  RNVVFPLLPRMIFGLYYNTPLIYGCEKSGLFKAFSEHILHRLKIPLHPRKNDKIKVTLLS  334
            +NVV PLLPRMIFGL+YNTP+I GC  SGLF+AFSE ILHRL+IP  P +  KI++T LS
Sbjct  301  KNVVLPLLPRMIFGLFYNTPIIQGCSNSGLFRAFSEFILHRLQIPYKPPQQ-KIRITYLS  359

Query  335  RDTRYRRILNEDELVEALKKNKKYKVRKVVYNRNVPFKKQLEITRNTDIFIGIHGAGLTH  394
            R T+YR++LNEDEL+  L+ N KY V++V Y R +PF  QL ITRNTDI IG+HGAGLTH
Sbjct  360  RRTKYRQVLNEDELLAPLEANDKYDVQRVSYER-LPFTNQLAITRNTDILIGMHGAGLTH  418

Query  395  ALFLPDWAAIFELYNCEDSSCYKDLARLRGVKYFTWEKNDKLIQQDPGTHPDGGAHAKFT  454
             LFLP+WA IFELYNCED +CYKDLARLRGV+Y TWE+ D +  QD G HP+GGAHAKFT
Sbjct  419  LLFLPNWACIFELYNCEDPNCYKDLARLRGVRYRTWEQRDLVYPQDEGHHPEGGAHAKFT  478

Query  455  NYSFDVEEFLRIVSRAAKYVKGQESFKR  482
            NYSFDV+EF+ +V  AA+ +   + F R
Sbjct  479  NYSFDVKEFVHLVDGAAEEILSHKEFPR  506


>CBPC_DICDI unnamed protein product
Length=166

 Score = 32.7 bits (73),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 36/80 (45%), Gaps = 13/80 (16%)

Query  135  AMDVLKEG-----QIGGYCSWNAKKLLENADHISALQSWGPEFRNF-----RKLPRRPIV  184
             +D+ K+G     +I  YC+ NAKKL+E    I+AL         F     RKL +   V
Sbjct  56   TIDINKDGKFSYHEIAKYCADNAKKLIEQNADIAALADVEAFLLRFDKDKDRKLNKTEFV  115

Query  185  E---GDCDIVIEKPTYIMKI  201
            E   G  D       Y++KI
Sbjct  116  EYFKGGTDTPYSDRDYVLKI  135


>DPOLA_DROME unnamed protein product
Length=1488

 Score = 30.4 bits (67),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 27/123 (22%), Positives = 44/123 (36%), Gaps = 10/123 (8%)

Query  201  IDATVNLYHHFCDFFNLYASLHVNNTHPSTFSTDNHILIWESYSYRSAFQDTFEAFTRNP  260
            I   +N +   C   + +    +     ST S+D  +  W   +Y    +   E F    
Sbjct  326  ISRLLNNWESICQMDDDFEKSVLTTEQDSTISSDQQLRFWYWEAYEDPVKMPGEVFLFGR  385

Query  261  LWDLNTFRGDKVCFR----NVVFPLLPRM-IFGLYYNTPLIYGCEKSGLFKAFSEHILHR  315
              D     G  VC R    N V  LLPR  +       P       + ++K F   + ++
Sbjct  386  TAD-----GKSVCLRVQNINRVLYLLPRQFLLDPISKEPTKQKVTVADIYKEFDSEVANQ  440

Query  316  LKI  318
            LK+
Sbjct  441  LKL  443



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933573.1 uncharacterized protein LOC118063607 [Chelonus
insularis]

Length=553


***** No hits found *****



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933574.1 uncharacterized protein LOC118063607 [Chelonus
insularis]

Length=553


***** No hits found *****



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933575.1 uncharacterized protein LOC118063607 [Chelonus
insularis]

Length=553


***** No hits found *****



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


Query= XP_034933576.1 mucin-5AC-like isoform X5 [Chelonus insularis]

Length=2252


***** No hits found *****



Lambda      K        H
   0.326    0.140    0.432 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 8805040348


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933577.1 uncharacterized protein LOC118063607 [Chelonus
insularis]

Length=553


***** No hits found *****



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933578.1 polyubiquitin-like [Chelonus insularis]

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBIQP_DROME  unnamed protein product                                  1035    0.0  
Q9W418_DROME  unnamed protein product                                 1034    0.0  
Q383T7_TRYB2  unnamed protein product                                 1024    0.0  


>UBIQP_DROME unnamed protein product
Length=763

 Score = 1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/533 (98%), Positives = 526/533 (99%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  180

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  241  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  301  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  420

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  480

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG+
Sbjct  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  533


 Score = 1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/533 (98%), Positives = 526/533 (99%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  77   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  197  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  256

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  317  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  376

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  377  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  436

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  437  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  496

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  497  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  556

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG+
Sbjct  557  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  609


 Score = 1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/533 (98%), Positives = 526/533 (99%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  153  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  272

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  273  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  332

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  393  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  452

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  453  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  512

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  513  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  572

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  573  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  632

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG+
Sbjct  633  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  685


 Score = 1034 bits (2674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/533 (98%), Positives = 526/533 (99%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  229  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  348

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  408

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  468

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  469  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  528

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  529  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  588

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  589  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  648

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  649  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  708

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG+
Sbjct  709  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  761


 Score = 889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/458 (98%), Positives = 452/458 (99%), Gaps = 0/458 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  305  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  364

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  365  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  424

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  425  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  484

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  485  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  544

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  545  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  604

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  605  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  664

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  665  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  724

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ  458
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG+Q
Sbjct  725  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIQ  762


>Q9W418_DROME unnamed protein product
Length=534

 Score = 1034 bits (2674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/534 (98%), Positives = 526/534 (99%), Gaps = 0/534 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  180

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  241  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  301  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  420

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  480

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGLL  534
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG +
Sbjct  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAI  534


>Q383T7_TRYB2 unnamed protein product
Length=685

 Score = 1024 bits (2647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/533 (96%), Positives = 526/533 (99%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYN
Sbjct  1    MQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  60

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKA
Sbjct  121  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKA  180

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            I LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLR
Sbjct  241  IALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLR  300

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL
Sbjct  301  LRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTL  360

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQ
Sbjct  361  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQ  420

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIE
Sbjct  421  QRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIE  480

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  533


 Score = 1024 bits (2647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/533 (96%), Positives = 526/533 (99%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYN
Sbjct  77   MQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  136

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKA
Sbjct  197  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKA  256

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            I LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLR
Sbjct  317  IALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLR  376

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL
Sbjct  377  LRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTL  436

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQ
Sbjct  437  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQ  496

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIE
Sbjct  497  QRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIE  556

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  557  NVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGM  609


 Score = 1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/533 (96%), Positives = 525/533 (98%), Gaps = 0/533 (0%)

Query  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60
            MQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYN
Sbjct  153  MQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  212

Query  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120
            IQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  213  IQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLI  272

Query  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180
            FAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKA
Sbjct  273  FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKA  332

Query  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240
            KIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  241  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300
            I LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLR
Sbjct  393  IALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLR  452

Query  301  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360
            LRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL
Sbjct  453  LRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTL  512

Query  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  420
            +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQ
Sbjct  513  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQ  572

Query  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  480
            QRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIE
Sbjct  573  QRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIE  632

Query  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  533
            NVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  633  NVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGW  685



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933579.1 phosphatidylinositol-glycan biosynthesis class W
protein [Chelonus insularis]

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAYP_DROME  unnamed protein product                                   29.6    8.7  


>SAYP_DROME unnamed protein product
Length=2006

 Score = 29.6 bits (65),  Expect = 8.7, Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (5%)

Query  419  QMTTEDNSDRSKLLRTNVNGDKSKKEKNRQVKFKEKETTKDESD  462
            +M T+DN++ + L RTN  G++S    +R    K++    DE+D
Sbjct  742  RMDTQDNNNENHLKRTNSEGNESP--SSRLPPSKQRRLDNDEND  783



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933580.1 uncharacterized protein LOC118063610 [Chelonus
insularis]

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W365_DROME  unnamed protein product                                 37.0    0.049
GLR1_CAEEL  unnamed protein product                                   36.6    0.061
IR25A_DROME  unnamed protein product                                  34.7    0.26 


>Q9W365_DROME unnamed protein product
Length=936

 Score = 37.0 bits (84),  Expect = 0.049, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 36/56 (64%), Gaps = 2/56 (4%)

Query  268  TLSLKIFFSVIFLYFMVLHATFSGNLAKFLTIPILQTNVEMVEDLLDPRISKIYHS  323
             +S ++  +  +L+ +++ ATF+ NLA FLT+  +QT V+ +E L   R S+I ++
Sbjct  585  AISGRMLVAAYWLFVVLMLATFTANLAAFLTVERMQTPVQSLEQLA--RQSRINYT  638


>GLR1_CAEEL unnamed protein product
Length=962

 Score = 36.6 bits (83),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 40/67 (60%), Gaps = 6/67 (9%)

Query  246  FSFASFEVIRLLINTEILIPINTLSLKIFFSVIFLYFMVLHATFSGNLAKFLTIPILQTN  305
            F+ A+F    +   T+IL    ++S +I  S  + + M++ ++++ NLA FLT+  +Q  
Sbjct  644  FTLAAF----MQQGTDILP--RSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAP  697

Query  306  VEMVEDL  312
            +E VEDL
Sbjct  698  IESVEDL  704


>IR25A_DROME unnamed protein product
Length=947

 Score = 34.7 bits (78),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query  269  LSLKIFFSVIFLYFMVLHATFSGNLAKFLTIPILQTNVEMVEDLLDPRISKIYHSGFNFE  328
            LS ++  +  +L+  ++ A+++ NLA FLT+  L T VE ++DL   +  KI ++  N  
Sbjct  632  LSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDL--AKQYKILYAPLNGS  689

Query  329  S  329
            S
Sbjct  690  S  690



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933581.1 vacuolar fusion protein MON1 homolog A [Chelonus
insularis]

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRZ0_DROME  unnamed protein product                                 474     1e-163
Q9VR38_DROME  unnamed protein product                                 472     9e-163
Q9BI89_CAEEL  unnamed protein product                                 212     6e-63 


>Q8MRZ0_DROME unnamed protein product
Length=528

 Score = 474 bits (1221),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 232/418 (56%), Positives = 296/418 (71%), Gaps = 12/418 (3%)

Query  109  WLAQKKHIFVLSQAGKPVYSRHSTEDKLVTIMGVMQALVSFVQAGNDTIRSVHAGDANFV  168
            W  QKKHIF+LS+AGKP++S H  EDKL T+ GV+QALVSFVQ G D I S+HAG   F 
Sbjct  112  WQGQKKHIFILSEAGKPIFSLHGNEDKLATLFGVIQALVSFVQMGQDAITSIHAGGIKFA  171

Query  169  FLIKGPLILVAVSKTLESVPQLILQLTYVYNQILFVLTQSHLTRVYEQRRNFDLRRLLTG  228
            F+ +  LILVA S++  SV QL LQL  VYNQIL +LT SH+T+++E+R+NFDLRRLL+G
Sbjct  172  FMQRSSLILVAASRSNMSVQQLQLQLGDVYNQILSILTYSHMTKIFERRKNFDLRRLLSG  231

Query  229  SERLIDHLLNFMDREPA--------FFLGAIKCLPLSPSMRDSITQTIIQTCGKIKNLVF  280
            SERL  +LL F D   A        F   +I+  PL  ++R  IT  I   C KIKNLVF
Sbjct  232  SERLFYNLL-FYDSSSAKVSNNIFTFLTNSIRVFPLPTTIRSQITSAIQSNCSKIKNLVF  290

Query  281  GLLLANNQLVTLVRMKKFFIHPADLHLIQNLVASSESFKTAEGWTPICLPKFNANGFMHG  340
             +L+ANN+L+ LVRMKK+ IHPADL LI NLV  SESFK++E W+PICLPKF+ NG++H 
Sbjct  291  AVLIANNKLIALVRMKKYSIHPADLRLIFNLVECSESFKSSENWSPICLPKFDMNGYLHA  350

Query  341  HVSYLAEDCQACLLLLTADRDVFTTLSEAKQKIVEKLRRTNCLEAINESMNR---VSITT  397
            HVSYLA+DCQACLLLL+ DRD F TL+EAK KI EKLR+++CLEAINE + +     +  
Sbjct  351  HVSYLADDCQACLLLLSVDRDAFFTLAEAKAKITEKLRKSHCLEAINEELQQPFNAKLYQ  410

Query  398  SEIGLPEMRHVLYKCRSTAQFWSPGFQPPYNNDQEIKRLLGLYQCLHHRLHAPNRPLKLI  457
              +G+PE+RH LYK +STAQ   P  + PY +  E++RL  +Y  L HR+H  +RPLKLI
Sbjct  411  QVVGIPELRHFLYKPKSTAQLLCPMLRHPYKSLTELERLEAIYCDLLHRIHNSSRPLKLI  470

Query  458  FQQLDKETMLAWVTSGFELYVTFEPLVTKPDAINAVSKLLKWIKKEEDRLFILNSPTF  515
            ++  ++E +LAW T  +ELY  FEP+V K   I  V KL+KWI+KE D  FI N  TF
Sbjct  471  YEMKEREVVLAWATGTYELYAIFEPVVDKATVIKYVVKLIKWIEKEYDVYFIRNHATF  528


>Q9VR38_DROME unnamed protein product
Length=528

 Score = 472 bits (1215),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 295/418 (71%), Gaps = 12/418 (3%)

Query  109  WLAQKKHIFVLSQAGKPVYSRHSTEDKLVTIMGVMQALVSFVQAGNDTIRSVHAGDANFV  168
            W  QKKHIF+LS+AGKP++S H  EDKL T+ GV+QALVSFVQ G D I S+HAG   F 
Sbjct  112  WQGQKKHIFILSEAGKPIFSLHGNEDKLATLFGVIQALVSFVQMGQDAITSIHAGGIKFA  171

Query  169  FLIKGPLILVAVSKTLESVPQLILQLTYVYNQILFVLTQSHLTRVYEQRRNFDLRRLLTG  228
            F+ +  LILVA S++  SV QL LQL  VYNQIL +LT SH+T+++E+R+NFDLRRLL+G
Sbjct  172  FMQRSSLILVAASRSNMSVQQLQLQLGDVYNQILSILTYSHMTKIFERRKNFDLRRLLSG  231

Query  229  SERLIDHLLNFMDREPA--------FFLGAIKCLPLSPSMRDSITQTIIQTCGKIKNLVF  280
            SERL  +LL   D   A        F   +I+  PL  ++R  IT  I   C KIKNLVF
Sbjct  232  SERLFYNLLA-NDSSSAKVSNNIFTFLTNSIRVFPLPTTIRSQITSAIQSNCSKIKNLVF  290

Query  281  GLLLANNQLVTLVRMKKFFIHPADLHLIQNLVASSESFKTAEGWTPICLPKFNANGFMHG  340
             +L+ANN+L+ LVRMKK+ IHPADL LI NLV  SESFK++E W+PICLPKF+ NG++H 
Sbjct  291  AVLIANNKLIALVRMKKYSIHPADLRLIFNLVECSESFKSSENWSPICLPKFDMNGYLHA  350

Query  341  HVSYLAEDCQACLLLLTADRDVFTTLSEAKQKIVEKLRRTNCLEAINESMNR---VSITT  397
            HVSYLA+DCQACLLLL+ DRD F TL+EAK KI EKLR+++CLEAINE + +     +  
Sbjct  351  HVSYLADDCQACLLLLSVDRDAFFTLAEAKAKITEKLRKSHCLEAINEELQQPFNAKLYQ  410

Query  398  SEIGLPEMRHVLYKCRSTAQFWSPGFQPPYNNDQEIKRLLGLYQCLHHRLHAPNRPLKLI  457
              +G+PE+RH LYK +STAQ   P  + PY +  E++RL  +Y  L HR+H  +RPLKLI
Sbjct  411  QVVGIPELRHFLYKPKSTAQLLCPMLRHPYKSLTELERLEAIYCDLLHRIHNSSRPLKLI  470

Query  458  FQQLDKETMLAWVTSGFELYVTFEPLVTKPDAINAVSKLLKWIKKEEDRLFILNSPTF  515
            ++  ++E +LAW T  +ELY  FEP+V K   I  V KL+KWI+KE D  FI N  TF
Sbjct  471  YEMKEREVVLAWATGTYELYAIFEPVVDKATVIKYVDKLIKWIEKEYDVYFIRNHATF  528


>Q9BI89_CAEEL unnamed protein product
Length=459

 Score = 212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 135/416 (32%), Positives = 222/416 (53%), Gaps = 21/416 (5%)

Query  115  HIFVLSQAGKPVYSRHS-TEDKLVTIMGVMQALVSFVQAGNDTIRSVHAGDANFVFLIKG  173
             +F+LS+ GKP++  +   E ++V+++ ++ A VS  Q+  D++ ++ + D +  FL K 
Sbjct  50   QVFILSEFGKPIFVNNDRNEGEIVSLVALICAFVSRCQSWGDSLMTMTSQDNHIQFLHKS  109

Query  174  PLILVAVSKTLESVPQLILQLTYVYNQILFVLTQSHLTRVYEQR-RNFDLRRLLTGSERL  232
            PLI   VSK  E + Q   QL  ++ QI  +L++S L  VY+++  N+DLR+LL G++RL
Sbjct  110  PLIFCVVSKYPEQLDQ---QLEVLFEQICSILSKSQLENVYKKKGDNYDLRKLLRGTDRL  166

Query  233  IDHLLNFMDREPAFFL-GAIKCLPLSPSMRDSITQTIIQTCG--KIKNLVFGLLLANNQL  289
            ID  ++     P   +  +I  +P++PS R+ ++ T+    G  K+   +FG+++A  Q+
Sbjct  167  IDSSISSWRASPINLVDSSISAIPMNPSDREFLSTTMASCLGAAKLDGALFGIMIARRQI  226

Query  290  VTLVRMKKFFIHPADLHLIQNLVASSESFKTAEGWTPICLPKFNANGFMHGHVSY----L  345
              +VR KK+ IHP DL+++ NLV+ +     ++ W PICLP+FN  GF + ++SY     
Sbjct  227  AAMVRFKKYMIHPRDLNIVINLVSDNTLQTDSQNWVPICLPRFNDTGFFYAYISYPWCNK  286

Query  346  AEDCQACLLLLTADRDVFTTLSEAKQKIVEKLRR-----TNCLEAINESMNRVSITTSEI  400
             +D   C++LL+  RD F  L E +Q+IV KL        N  +A+ ++ N   I+    
Sbjct  287  EQDIPVCIVLLSVKRDHFDGLKEVRQQIVTKLENNQKFFVNFAQAM-KTPNLYQISQIGS  345

Query  401  GLPEMRHVLYKCRSTAQFWSPGFQPPYNNDQEIKRLLGLYQCLHHRLHAPNRP-LKLIFQ  459
                +   LY   S+ Q      + P     E  R +   +       +   P L+ +F 
Sbjct  346  NSESLWSFLYLNHSSKQVCMSASKIPLITRDE--RWIARSEMRRSSSLSSLHPHLRTLFV  403

Query  460  QLDKETMLAWVTSGFELYVTFEPLVTKPDAINAVSKLLKWIKKEEDRLFILNSPTF  515
            +  K  +  WVT  F LY  F P VT   A   V KLLK +K  E R FI+NS +F
Sbjct  404  RGTKHCLFVWVTDLFSLYCIFGPFVTATIAFQVVEKLLKSLKSHEQRYFIINSTSF  459



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933582.1 ataxin-10 [Chelonus insularis]

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZJ4_DROME  unnamed protein product                                 101     5e-23
MSPS_DROME  unnamed protein product                                   33.1    0.63 
Q95Z12_9TRYP  unnamed protein product                                 32.0    1.4  


>B7YZJ4_DROME unnamed protein product
Length=418

 Score = 101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 101/182 (55%), Gaps = 11/182 (6%)

Query  293  VEFLSEKFKKRSDLILKTEEFYLDGMEPSEVIILLDILGILTSTSSSAYQSLR-KDKSLL  351
            ++  +++F+ +SD +L+        + P EV  LL I  I +++ S  Y ++   D+SL 
Sbjct  215  LQHFAKEFRMKSDCLLRETIKLKHELHPREVHTLLRI--IASASGSEKYANVYPNDQSLF  272

Query  352  INVIFLLKAVHMTGKE--NQNCFTPIQKLSELAPSSYQNDEDSLDKDYLRHPTFGFKTAL  409
            INV  LL+ +   GKE        P+ KL E+A +S       +D  Y +  ++  KT L
Sbjct  273  INVSSLLRCIVSAGKEPDGGGLDKPMTKLEEVALTS------DIDAGYEKKVSYELKTLL  326

Query  410  IRLIGNLVYNNKVNQDLIRETDGISLLLDCCNIDARNPLITQWSILAIRNLTENNPENQE  469
            +R   NL+Y+NK N+    +T  +  LL+C  +DARNPL+ +WSILAIRN   N PE Q+
Sbjct  327  VRCSANLLYDNKANKGYCLDTQLLPTLLECTTMDARNPLMREWSILAIRNACINCPEAQQ  386

Query  470  FI  471
             I
Sbjct  387  VI  388


>MSPS_DROME unnamed protein product
Length=2042

 Score = 33.1 bits (74),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  114   YDEVIQEVVQFLIKIPAEYQQSKITDTKLELIRISLRFLCNI  155
             YD VI EV +F++ +P+ + Q++ +DT +  I+  L  +  +
Sbjct  1779  YDAVILEVHEFMLALPSTWWQNRPSDTPMRTIKTILHNMAKV  1820


>Q95Z12_9TRYP unnamed protein product
Length=972

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/80 (28%), Positives = 42/80 (53%), Gaps = 5/80 (6%)

Query  68   MTNSSTDLGYKHQQLSQYNRDQEDSFCNFFIKYSTNNDQYPSTTFPYDEVIQEVVQFLIK  127
            M   +++L Y+H+Q  +  RD ++ F  F+++ +  N + PS    Y   + E   F++ 
Sbjct  837  MEALASNLNYRHEQAQRAGRDSQNLFTGFYLR-NFANQEIPSED-GYVVKLSETHVFVL-  893

Query  128  IPAEYQQSKITDTKLELIRI  147
            +P   Q+ KI   K  L+R+
Sbjct  894  VPKYGQEGKI--AKETLVRV  911



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933583.1 ataxin-10 [Chelonus insularis]

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZJ4_DROME  unnamed protein product                                 101     5e-23
MSPS_DROME  unnamed protein product                                   33.1    0.63 
Q95Z12_9TRYP  unnamed protein product                                 32.0    1.4  


>B7YZJ4_DROME unnamed protein product
Length=418

 Score = 101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 101/182 (55%), Gaps = 11/182 (6%)

Query  293  VEFLSEKFKKRSDLILKTEEFYLDGMEPSEVIILLDILGILTSTSSSAYQSLR-KDKSLL  351
            ++  +++F+ +SD +L+        + P EV  LL I  I +++ S  Y ++   D+SL 
Sbjct  215  LQHFAKEFRMKSDCLLRETIKLKHELHPREVHTLLRI--IASASGSEKYANVYPNDQSLF  272

Query  352  INVIFLLKAVHMTGKE--NQNCFTPIQKLSELAPSSYQNDEDSLDKDYLRHPTFGFKTAL  409
            INV  LL+ +   GKE        P+ KL E+A +S       +D  Y +  ++  KT L
Sbjct  273  INVSSLLRCIVSAGKEPDGGGLDKPMTKLEEVALTS------DIDAGYEKKVSYELKTLL  326

Query  410  IRLIGNLVYNNKVNQDLIRETDGISLLLDCCNIDARNPLITQWSILAIRNLTENNPENQE  469
            +R   NL+Y+NK N+    +T  +  LL+C  +DARNPL+ +WSILAIRN   N PE Q+
Sbjct  327  VRCSANLLYDNKANKGYCLDTQLLPTLLECTTMDARNPLMREWSILAIRNACINCPEAQQ  386

Query  470  FI  471
             I
Sbjct  387  VI  388


>MSPS_DROME unnamed protein product
Length=2042

 Score = 33.1 bits (74),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  114   YDEVIQEVVQFLIKIPAEYQQSKITDTKLELIRISLRFLCNI  155
             YD VI EV +F++ +P+ + Q++ +DT +  I+  L  +  +
Sbjct  1779  YDAVILEVHEFMLALPSTWWQNRPSDTPMRTIKTILHNMAKV  1820


>Q95Z12_9TRYP unnamed protein product
Length=972

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/80 (28%), Positives = 42/80 (53%), Gaps = 5/80 (6%)

Query  68   MTNSSTDLGYKHQQLSQYNRDQEDSFCNFFIKYSTNNDQYPSTTFPYDEVIQEVVQFLIK  127
            M   +++L Y+H+Q  +  RD ++ F  F+++ +  N + PS    Y   + E   F++ 
Sbjct  837  MEALASNLNYRHEQAQRAGRDSQNLFTGFYLR-NFANQEIPSED-GYVVKLSETHVFVL-  893

Query  128  IPAEYQQSKITDTKLELIRI  147
            +P   Q+ KI   K  L+R+
Sbjct  894  VPKYGQEGKI--AKETLVRV  911



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933584.1 ataxin-10 [Chelonus insularis]

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZJ4_DROME  unnamed protein product                                 101     5e-23
MSPS_DROME  unnamed protein product                                   33.1    0.63 
Q95Z12_9TRYP  unnamed protein product                                 32.0    1.4  


>B7YZJ4_DROME unnamed protein product
Length=418

 Score = 101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/182 (36%), Positives = 101/182 (55%), Gaps = 11/182 (6%)

Query  293  VEFLSEKFKKRSDLILKTEEFYLDGMEPSEVIILLDILGILTSTSSSAYQSLR-KDKSLL  351
            ++  +++F+ +SD +L+        + P EV  LL I  I +++ S  Y ++   D+SL 
Sbjct  215  LQHFAKEFRMKSDCLLRETIKLKHELHPREVHTLLRI--IASASGSEKYANVYPNDQSLF  272

Query  352  INVIFLLKAVHMTGKE--NQNCFTPIQKLSELAPSSYQNDEDSLDKDYLRHPTFGFKTAL  409
            INV  LL+ +   GKE        P+ KL E+A +S       +D  Y +  ++  KT L
Sbjct  273  INVSSLLRCIVSAGKEPDGGGLDKPMTKLEEVALTS------DIDAGYEKKVSYELKTLL  326

Query  410  IRLIGNLVYNNKVNQDLIRETDGISLLLDCCNIDARNPLITQWSILAIRNLTENNPENQE  469
            +R   NL+Y+NK N+    +T  +  LL+C  +DARNPL+ +WSILAIRN   N PE Q+
Sbjct  327  VRCSANLLYDNKANKGYCLDTQLLPTLLECTTMDARNPLMREWSILAIRNACINCPEAQQ  386

Query  470  FI  471
             I
Sbjct  387  VI  388


>MSPS_DROME unnamed protein product
Length=2042

 Score = 33.1 bits (74),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 13/42 (31%), Positives = 26/42 (62%), Gaps = 0/42 (0%)

Query  114   YDEVIQEVVQFLIKIPAEYQQSKITDTKLELIRISLRFLCNI  155
             YD VI EV +F++ +P+ + Q++ +DT +  I+  L  +  +
Sbjct  1779  YDAVILEVHEFMLALPSTWWQNRPSDTPMRTIKTILHNMAKV  1820


>Q95Z12_9TRYP unnamed protein product
Length=972

 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/80 (28%), Positives = 42/80 (53%), Gaps = 5/80 (6%)

Query  68   MTNSSTDLGYKHQQLSQYNRDQEDSFCNFFIKYSTNNDQYPSTTFPYDEVIQEVVQFLIK  127
            M   +++L Y+H+Q  +  RD ++ F  F+++ +  N + PS    Y   + E   F++ 
Sbjct  837  MEALASNLNYRHEQAQRAGRDSQNLFTGFYLR-NFANQEIPSED-GYVVKLSETHVFVL-  893

Query  128  IPAEYQQSKITDTKLELIRI  147
            +P   Q+ KI   K  L+R+
Sbjct  894  VPKYGQEGKI--AKETLVRV  911



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933585.1 mucin-5AC-like isoform X6 [Chelonus insularis]

Length=2244


***** No hits found *****



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933586.1 CDK5 regulatory subunit-associated protein 3
[Chelonus insularis]

Length=502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CK5P3_DROME  unnamed protein product                                  367     6e-122
Q7KQP6_DROME  unnamed protein product                                 33.1    0.68  
X2JD89_DROME  unnamed protein product                                 33.1    0.71  


>CK5P3_DROME unnamed protein product
Length=509

 Score = 367 bits (941),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 199/525 (38%), Positives = 322/525 (61%), Gaps = 41/525 (8%)

Query  1    MEDQNIPIDINSGKLLDWLINRRHCSTGWQVHVKTIREKINNALQDMPVHEEIARLLTGT  60
            M +  IPIDI++ KL DWLI+RR      Q  ++ I  KI+NALQDMP +E++ +LL  T
Sbjct  1    MNESEIPIDIHTLKLQDWLISRRIVPKNVQQELREIHRKISNALQDMPSNEQLIKLLART  60

Query  61   YINYFHCKRIVEILKETEADSKNLFGRYGSQRMKDWQEIIRMYEKDNLYLAEVAQMLIRN  120
             INY+H K I+EILK+TE D+K++FG YGSQRMKDWQEI R+YEK+  YLAE AQ+ +RN
Sbjct  61   NINYYHVKEIIEILKQTEKDTKSVFGTYGSQRMKDWQEISRLYEKNATYLAETAQIFVRN  120

Query  121  ITYEIPNLKKQIQKLEQSKNDLQKKAADYKKSETQARSEFQSMCKNLRIEGKNIKKELVD  180
            + YEIP ++KQ+ +LEQ  ++ QK+A D  K E+Q  ++  ++ + L ++G N+  E V 
Sbjct  121  VNYEIPGVRKQMARLEQQADETQKRAHDLNKPESQILADHSALLEQLGVKGDNLHAEFVQ  180

Query  181  LIVELPQIYTEVVKKCQSLREAVEFYSAFIHFVLGRYHDGGCVPIVQYVIDKGNTTTYQW  240
            ++  LP++Y + +    +++  ++ Y+     V G       +PI+ ++++ GNTT YQ+
Sbjct  181  VLSGLPELYDKSLVGIANIQPGIDLYAE----VSGNKQ---VLPILNHLVEFGNTTVYQY  233

Query  241  IYGEEPLSIVEPSVDIEIEDQSA---------IDLIDDQNA----------IDFNE--EV  279
            I+ E PL++ EP + + + + +A         ID   D N           ID+ +    
Sbjct  234  IHKEAPLAVEEPPIRLNLSEGNASKDDNAVAEIDFGTDDNGGTSSTVSAEIIDYGDFGSG  293

Query  280  DLDE--GGEIDWGDINVVEENNEALDIDLNISLEESGIVVESAGHEGGVATGDEALTILD  337
            DL E  GG IDWG   +     +A++I+ +I +EE GIVVE  G +GG A GD+A T+LD
Sbjct  294  DLPESDGGNIDWG---IESAPTDAVEINFDIPVEEYGIVVEGTGMDGGTAKGDQAYTLLD  350

Query  338  NPKIRNDFIDQLLELEAFFKLRLYELKSESKTNLLSLSQMQLASPILQLSTMD--STQNM  395
            +P  R+ F+D++ ELE+F ++R+YELK    ++ +  S M        ++T D  S   +
Sbjct  351  SPNYRDRFLDEIYELESFLRMRIYELKQLESSSDIMFSLMD------NIATHDGESIWKI  404

Query  396  LDNVQVVLSTILDSRVQHLHSIKHSPKYIDILTETLKQKREVIEKMGSIQKNIVAKKKDI  455
            L +V+ ++    D + QHL  +KHSPKY ++L   L+Q  + +EK+ + ++ +     ++
Sbjct  405  LVSVEKIIQQTSDKQTQHLFQLKHSPKYANMLATKLQQMTKAVEKLRATREALKQLTIEL  464

Query  456  TEQIEAVHVTLKLVVQRTKELQFDIEQELSKKYNNRAVRLTGGIN  500
             EQ + ++  L+ ++ +T+ LQ  IE+++SK+Y NR V L GG+N
Sbjct  465  REQRQDLNPVLEELIAQTRTLQSHIEKDISKRYKNRVVNLMGGVN  509


>Q7KQP6_DROME unnamed protein product
Length=8648

 Score = 33.1 bits (74),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 1/39 (3%)

Query  219   DGGCVPIVQYVIDKGNTTTYQWI-YGEEPLSIVEPSVDI  256
             D G VPI +YV++K +T T +W+  G  P     PS D+
Sbjct  2438  DDGGVPIKEYVVEKMDTATGKWVRVGRSPGEKEPPSFDV  2476


 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 5/42 (12%)

Query  219   DGGCVPIVQYVIDKGNTTTYQWIYGEEPLSIVEP-SVDIEIE  259
             D G +PI  YVI+K +T T +W+    P   V+P   DIEI+
Sbjct  3037  DDGGIPITGYVIEKMDTATGKWV----PAGSVDPEKYDIEIK  3074


>X2JD89_DROME unnamed protein product
Length=8602

 Score = 33.1 bits (74),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 1/39 (3%)

Query  219   DGGCVPIVQYVIDKGNTTTYQWI-YGEEPLSIVEPSVDI  256
             D G VPI +YV++K +T T +W+  G  P     PS D+
Sbjct  2392  DDGGVPIKEYVVEKMDTATGKWVRVGRSPGEKEPPSFDV  2430


 Score = 32.3 bits (72),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/42 (43%), Positives = 25/42 (60%), Gaps = 5/42 (12%)

Query  219   DGGCVPIVQYVIDKGNTTTYQWIYGEEPLSIVEP-SVDIEIE  259
             D G +PI  YVI+K +T T +W+    P   V+P   DIEI+
Sbjct  2991  DDGGIPITGYVIEKMDTATGKWV----PAGSVDPEKYDIEIK  3028



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933587.1 serine/threonine-protein phosphatase 6 regulatory
ankyrin repeat subunit B-like [Chelonus insularis]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KU95_DROME  unnamed protein product                                 116     4e-27
X2JGD3_DROME  unnamed protein product                                 116     5e-27
Q8SWY2_DROME  unnamed protein product                                 115     5e-27


>Q7KU95_DROME unnamed protein product
Length=2404

 Score = 116 bits (290),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 142/293 (48%), Gaps = 13/293 (4%)

Query  44   YWLDLLKSPDQYDVEFKATGRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVA  103
            Y L    SPD   V     G TP+     ++ +  I  +L     ++ + +  QTPLH+A
Sbjct  421  YLLQHDASPDVPTVR----GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA  476

Query  104  VANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDD  163
                N++ V L++     +        T+LH+A+  K  + E+   ++     L+     
Sbjct  477  SRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEGQDEVAAVLIENGAALDAATKK  534

Query  164  GLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGAN  223
            G TPLH+   + +I++    L   A  D    +N  TPLH A        ALLLL +GA+
Sbjct  535  GFTPLHLTAKYGHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNNQQVALLLLEKGAS  593

Query  224  PNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWF  283
            P+ T K G +P+  A    ++D+ + +++YGA     +K G TPLHL++Q   + +    
Sbjct  594  PHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL  653

Query  284  LDRNWNININVQNRKGQTPLH-CAVEDNRSDNIVTILQKE-PDLDLRDRQGLT  334
            ++    +N   +N  G TP+H CA EDN   N+  IL+K   ++D+  + G T
Sbjct  654  IEHKAAVNHPAKN--GLTPMHLCAQEDNV--NVAEILEKNGANIDMATKAGYT  702


 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 113/227 (50%), Gaps = 9/227 (4%)

Query  82   VLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTR--KPDLCIRNVLGDTSLHVASAT  139
            +L K  +++ Q K+G TPLHVA   NN +   L++ +   P    +N  G T LH+A A 
Sbjct  554  LLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN--GHTPLHIA-AR  610

Query  140  KNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRW  199
            KN + +I   +L      N ++  G TPLH+++   + E+    ++  A  +    +N  
Sbjct  611  KN-QMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN-HPAKNGL  668

Query  200  TPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYI  259
            TP+H        + A +L + GAN ++  K G +P+  A   G+ ++V  +++ GA++  
Sbjct  669  TPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDA  728

Query  260  PNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCA  306
                G TPLH  AQ     ++   L+   N N    N  GQTPLH A
Sbjct  729  ATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN--GQTPLHIA  773


 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 128/251 (51%), Gaps = 9/251 (4%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G T +   +++     +  +L+   ++N+Q ++G TPL++A   N+   VRL+++   + 
Sbjct  77   GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ  136

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTD  182
             +    G T L VA   +    ++V  +L +     ++    L  LHIA   ++++  T 
Sbjct  137  SLATEDGFTPLAVA--MQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATL  190

Query  183  YLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGG  242
             LD     D+T +++ +TPLH A+     + A LL+++GA+ N + K   SP+  A   G
Sbjct  191  LLDNDHNPDVT-SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWG  249

Query  243  EVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTP  302
            + ++VS +++ G +I    + G TPLH AA++    V+   L+R   I+   +N  G  P
Sbjct  250  KTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAP  307

Query  303  LHCAVEDNRSD  313
            LH A +    D
Sbjct  308  LHMAAQGEHVD  318


 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/248 (29%), Positives = 126/248 (51%), Gaps = 5/248 (2%)

Query  79   ISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASA  138
            +S +L+K  NI  + + G TPLH A  + + + V +++ R   +  +   G   LH+A+ 
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ  313

Query  139  TKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENR  198
             +++  +  + +L  R  ++    D LT LH+A    ++ +    LD  A  +     N 
Sbjct  314  GEHV--DAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADAN-ARALNG  370

Query  199  WTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIY  258
            +TPLH A          LLLR GA+ + T + G +P+  A   G +++V  ++++ A   
Sbjct  371  FTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD  430

Query  259  IPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCAVEDNRSDNIVTI  318
            +P   G+TPLHLAA+   + ++R  L RN    ++ + R+ QTPLH A      D ++ +
Sbjct  431  VPTVRGETPLHLAARANQTDIIRILL-RN-GAQVDARAREQQTPLHIASRLGNVDIVMLL  488

Query  319  LQKEPDLD  326
            LQ    +D
Sbjct  489  LQHGAQVD  496


 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 125/276 (45%), Gaps = 5/276 (2%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G TP+      +    +  +L    +I+   +SG TPLHVA     +  V  ++      
Sbjct  370  GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP  429

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTD  182
             +  V G+T LH+A+       +I++ +LR    ++ +  +  TPLHIA+   N++++  
Sbjct  430  DVPTVRGETPLHLAARANQT--DIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVML  487

Query  183  YLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGG  242
             L  GA+ D T  ++ +T LH A        A +L+  GA  +   K G +P+      G
Sbjct  488  LLQHGAQVDAT-TKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYG  546

Query  243  EVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTP  302
             + +   +++  AD+    K G TPLH+A       V    L++  + +   +N  G TP
Sbjct  547  HIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN--GHTP  604

Query  303  LHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDL  338
            LH A   N+ D   T+L+     +   + G T   L
Sbjct  605  LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL  640


 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 130/287 (45%), Gaps = 38/287 (13%)

Query  88   NINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIV  147
            +IN  + +G   LH+A  + ++  V  ++ R   +      G+T+LH+AS     + E+V
Sbjct  36   DINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAG--QEEVV  93

Query  148  QEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATM  207
            + +L     +N+++ +G TPL++A   N+  ++   L  GA   +   E+ +TPL  A  
Sbjct  94   KLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLA-TEDGFTPL--AVA  150

Query  208  VRYSH-------------------------------AALLLLRRGANPNITDKFGQSPIF  236
            ++  H                               AA LLL    NP++T K G +P+ 
Sbjct  151  MQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLH  210

Query  237  NAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQN  296
             A   G  ++ + +++ GAD+    K   +PLH+AA+   + ++   L++    NI  + 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG--NIEAKT  268

Query  297  RKGQTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDLRLDDE  343
            R G TPLHCA        +  +L++   +  + + GL    +    E
Sbjct  269  RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGE  315


 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 128/279 (46%), Gaps = 9/279 (3%)

Query  62   TGRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPD  121
            +G TP+       C   +  +L    + ++    G+TPLH+A   N  + +R+++     
Sbjct  402  SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ  461

Query  122  LCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMT  181
            +  R     T LH+AS   N+  +IV  +L+    ++    D  T LHIA      E+  
Sbjct  462  VDARAREQQTPLHIASRLGNV--DIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAA  519

Query  182  DYLDLGAKTDITDNENRWTPLHHATMVRYSH--AALLLLRRGANPNITDKFGQSPIFNAV  239
              ++ GA  D    +  +TPLH     +Y H   A LLL++ A+ +   K G +P+  A 
Sbjct  520  VLIENGAALDAATKKG-FTPLH--LTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC  576

Query  240  MGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKG  299
                  +   +++ GA  +   K G TPLH+AA+     +    L+  +    N +++ G
Sbjct  577  HYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAG  634

Query  300  QTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDL  338
             TPLH + ++  ++    +++ +  ++   + GLT   L
Sbjct  635  FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHL  673


 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 123/272 (45%), Gaps = 42/272 (15%)

Query  96   GQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRV  155
            G T    A    NLE V   +    D+   N  G  +LH+AS   +I   +V E+LR   
Sbjct  11   GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIH--VVSELLRRGA  68

Query  156  CLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAAL  215
             ++     G T LHIA++    E++   L+  A  ++  ++N +TPL+ A    +     
Sbjct  69   IVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVR  127

Query  216  LLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKY---------------------G  254
            LLL  GAN ++  + G +P+  A+  G   +V+ +++                       
Sbjct  128  LLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKA  187

Query  255  ADIYIPN--------KFGQTPLHLAA----QNPTSAVLRWFLDRNWNININVQNRKGQTP  302
            A + + N        K G TPLH+A+    QN  + +++   D N++   N+      +P
Sbjct  188  ATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNI------SP  241

Query  303  LHCAVEDNRSDNIVTILQKEPDLDLRDRQGLT  334
            LH A +  +++ +  +L+K  +++ + R GLT
Sbjct  242  LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLT  273


 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 83/168 (49%), Gaps = 10/168 (6%)

Query  155  VCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDI---TDNENRWTPLHHATMVRYS  211
            V  N    DG T    A    N+E + ++L    K +I   T N N    LH A+   + 
Sbjct  2    VTENGAQGDGNTSFLRAARAGNLERVLEHL----KNNIDINTSNANGLNALHLASKDGHI  57

Query  212  HAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLA  271
            H    LLRRGA  +   K G + +  A + G+ ++V  ++++ A + + ++ G TPL++A
Sbjct  58   HVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA  117

Query  272  AQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCAVEDNRSDNIVTIL  319
            AQ    AV+R  L    N ++  ++  G TPL  A++    D +V +L
Sbjct  118  AQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGH-DKVVAVL  162


 Score = 59.3 bits (142),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (44%), Gaps = 5/189 (3%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G TP+      +     + +L+     N + K+G TPLH++    + E   L++  K  +
Sbjct  601  GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV  660

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEIL-RTRVCLNLKNDDGLTPLHIATIHNNIELMT  181
                  G T +H+ +   N+    V EIL +    +++    G TPLH+A+      ++ 
Sbjct  661  NHPAKNGLTPMHLCAQEDNVN---VAEILEKNGANIDMATKAGYTPLHVASHFGQANMVR  717

Query  182  DYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMG  241
              L  GA  D   +   +TPLH      + H   LLL   AN N     GQ+P+  A   
Sbjct  718  FLLQNGANVDAATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKL  776

Query  242  GEVDLVSNM  250
            G + ++ ++
Sbjct  777  GYISVLDSL  785


>X2JGD3_DROME unnamed protein product
Length=2566

 Score = 116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 142/293 (48%), Gaps = 13/293 (4%)

Query  44   YWLDLLKSPDQYDVEFKATGRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVA  103
            Y L    SPD   V     G TP+     ++ +  I  +L     ++ + +  QTPLH+A
Sbjct  421  YLLQHDASPDVPTVR----GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA  476

Query  104  VANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDD  163
                N++ V L++     +        T+LH+A+  K  + E+   ++     L+     
Sbjct  477  SRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEGQDEVAAVLIENGAALDAATKK  534

Query  164  GLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGAN  223
            G TPLH+   + +I++    L   A  D    +N  TPLH A        ALLLL +GA+
Sbjct  535  GFTPLHLTAKYGHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNNQQVALLLLEKGAS  593

Query  224  PNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWF  283
            P+ T K G +P+  A    ++D+ + +++YGA     +K G TPLHL++Q   + +    
Sbjct  594  PHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL  653

Query  284  LDRNWNININVQNRKGQTPLH-CAVEDNRSDNIVTILQKE-PDLDLRDRQGLT  334
            ++    +N   +N  G TP+H CA EDN   N+  IL+K   ++D+  + G T
Sbjct  654  IEHKAAVNHPAKN--GLTPMHLCAQEDNV--NVAEILEKNGANIDMATKAGYT  702


 Score = 97.1 bits (240),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 113/227 (50%), Gaps = 9/227 (4%)

Query  82   VLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTR--KPDLCIRNVLGDTSLHVASAT  139
            +L K  +++ Q K+G TPLHVA   NN +   L++ +   P    +N  G T LH+A A 
Sbjct  554  LLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN--GHTPLHIA-AR  610

Query  140  KNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRW  199
            KN + +I   +L      N ++  G TPLH+++   + E+    ++  A  +    +N  
Sbjct  611  KN-QMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN-HPAKNGL  668

Query  200  TPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYI  259
            TP+H        + A +L + GAN ++  K G +P+  A   G+ ++V  +++ GA++  
Sbjct  669  TPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDA  728

Query  260  PNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCA  306
                G TPLH  AQ     ++   L+   N N    N  GQTPLH A
Sbjct  729  ATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVN--GQTPLHIA  773


 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 128/251 (51%), Gaps = 9/251 (4%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G T +   +++     +  +L+   ++N+Q ++G TPL++A   N+   VRL+++   + 
Sbjct  77   GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ  136

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTD  182
             +    G T L VA   +    ++V  +L +     ++    L  LHIA   ++++  T 
Sbjct  137  SLATEDGFTPLAVA--MQQGHDKVVAVLLESDTRGKVR----LPALHIAAKKDDVKAATL  190

Query  183  YLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGG  242
             LD     D+T +++ +TPLH A+     + A LL+++GA+ N + K   SP+  A   G
Sbjct  191  LLDNDHNPDVT-SKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWG  249

Query  243  EVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTP  302
            + ++VS +++ G +I    + G TPLH AA++    V+   L+R   I+   +N  G  P
Sbjct  250  KTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKN--GLAP  307

Query  303  LHCAVEDNRSD  313
            LH A +    D
Sbjct  308  LHMAAQGEHVD  318


 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 71/248 (29%), Positives = 126/248 (51%), Gaps = 5/248 (2%)

Query  79   ISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASA  138
            +S +L+K  NI  + + G TPLH A  + + + V +++ R   +  +   G   LH+A+ 
Sbjct  254  VSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQ  313

Query  139  TKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENR  198
             +++  +  + +L  R  ++    D LT LH+A    ++ +    LD  A  +     N 
Sbjct  314  GEHV--DAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADAN-ARALNG  370

Query  199  WTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIY  258
            +TPLH A          LLLR GA+ + T + G +P+  A   G +++V  ++++ A   
Sbjct  371  FTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPD  430

Query  259  IPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCAVEDNRSDNIVTI  318
            +P   G+TPLHLAA+   + ++R  L RN    ++ + R+ QTPLH A      D ++ +
Sbjct  431  VPTVRGETPLHLAARANQTDIIRILL-RN-GAQVDARAREQQTPLHIASRLGNVDIVMLL  488

Query  319  LQKEPDLD  326
            LQ    +D
Sbjct  489  LQHGAQVD  496


 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 125/276 (45%), Gaps = 5/276 (2%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G TP+      +    +  +L    +I+   +SG TPLHVA     +  V  ++      
Sbjct  370  GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP  429

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTD  182
             +  V G+T LH+A+       +I++ +LR    ++ +  +  TPLHIA+   N++++  
Sbjct  430  DVPTVRGETPLHLAARANQT--DIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVML  487

Query  183  YLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGG  242
             L  GA+ D T  ++ +T LH A        A +L+  GA  +   K G +P+      G
Sbjct  488  LLQHGAQVDAT-TKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYG  546

Query  243  EVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTP  302
             + +   +++  AD+    K G TPLH+A       V    L++  + +   +N  G TP
Sbjct  547  HIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN--GHTP  604

Query  303  LHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDL  338
            LH A   N+ D   T+L+     +   + G T   L
Sbjct  605  LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL  640


 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 130/287 (45%), Gaps = 38/287 (13%)

Query  88   NINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIV  147
            +IN  + +G   LH+A  + ++  V  ++ R   +      G+T+LH+AS     + E+V
Sbjct  36   DINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAG--QEEVV  93

Query  148  QEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATM  207
            + +L     +N+++ +G TPL++A   N+  ++   L  GA   +   E+ +TPL  A  
Sbjct  94   KLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLA-TEDGFTPL--AVA  150

Query  208  VRYSH-------------------------------AALLLLRRGANPNITDKFGQSPIF  236
            ++  H                               AA LLL    NP++T K G +P+ 
Sbjct  151  MQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLH  210

Query  237  NAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQN  296
             A   G  ++ + +++ GAD+    K   +PLH+AA+   + ++   L++    NI  + 
Sbjct  211  IASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG--NIEAKT  268

Query  297  RKGQTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDLRLDDE  343
            R G TPLHCA        +  +L++   +  + + GL    +    E
Sbjct  269  RDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGE  315


 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 128/279 (46%), Gaps = 9/279 (3%)

Query  62   TGRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPD  121
            +G TP+       C   +  +L    + ++    G+TPLH+A   N  + +R+++     
Sbjct  402  SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ  461

Query  122  LCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMT  181
            +  R     T LH+AS   N+  +IV  +L+    ++    D  T LHIA      E+  
Sbjct  462  VDARAREQQTPLHIASRLGNV--DIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAA  519

Query  182  DYLDLGAKTDITDNENRWTPLHHATMVRYSH--AALLLLRRGANPNITDKFGQSPIFNAV  239
              ++ GA  D    +  +TPLH     +Y H   A LLL++ A+ +   K G +P+  A 
Sbjct  520  VLIENGAALDAATKKG-FTPLH--LTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC  576

Query  240  MGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKG  299
                  +   +++ GA  +   K G TPLH+AA+     +    L+  +    N +++ G
Sbjct  577  HYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAG  634

Query  300  QTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDL  338
             TPLH + ++  ++    +++ +  ++   + GLT   L
Sbjct  635  FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHL  673


 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 123/272 (45%), Gaps = 42/272 (15%)

Query  96   GQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRV  155
            G T    A    NLE V   +    D+   N  G  +LH+AS   +I   +V E+LR   
Sbjct  11   GNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIH--VVSELLRRGA  68

Query  156  CLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAAL  215
             ++     G T LHIA++    E++   L+  A  ++  ++N +TPL+ A    +     
Sbjct  69   IVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNV-QSQNGFTPLYMAAQENHDAVVR  127

Query  216  LLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKY---------------------G  254
            LLL  GAN ++  + G +P+  A+  G   +V+ +++                       
Sbjct  128  LLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKA  187

Query  255  ADIYIPN--------KFGQTPLHLAA----QNPTSAVLRWFLDRNWNININVQNRKGQTP  302
            A + + N        K G TPLH+A+    QN  + +++   D N++   N+      +P
Sbjct  188  ATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNI------SP  241

Query  303  LHCAVEDNRSDNIVTILQKEPDLDLRDRQGLT  334
            LH A +  +++ +  +L+K  +++ + R GLT
Sbjct  242  LHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLT  273


 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 83/168 (49%), Gaps = 10/168 (6%)

Query  155  VCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDI---TDNENRWTPLHHATMVRYS  211
            V  N    DG T    A    N+E + ++L    K +I   T N N    LH A+   + 
Sbjct  2    VTENGAQGDGNTSFLRAARAGNLERVLEHL----KNNIDINTSNANGLNALHLASKDGHI  57

Query  212  HAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLA  271
            H    LLRRGA  +   K G + +  A + G+ ++V  ++++ A + + ++ G TPL++A
Sbjct  58   HVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMA  117

Query  272  AQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCAVEDNRSDNIVTIL  319
            AQ    AV+R  L    N ++  ++  G TPL  A++    D +V +L
Sbjct  118  AQENHDAVVRLLLSNGANQSLATED--GFTPLAVAMQQGH-DKVVAVL  162


 Score = 58.9 bits (141),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (44%), Gaps = 5/189 (3%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G TP+      +     + +L+     N + K+G TPLH++    + E   L++  K  +
Sbjct  601  GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV  660

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEIL-RTRVCLNLKNDDGLTPLHIATIHNNIELMT  181
                  G T +H+ +   N+    V EIL +    +++    G TPLH+A+      ++ 
Sbjct  661  NHPAKNGLTPMHLCAQEDNVN---VAEILEKNGANIDMATKAGYTPLHVASHFGQANMVR  717

Query  182  DYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMG  241
              L  GA  D   +   +TPLH      + H   LLL   AN N     GQ+P+  A   
Sbjct  718  FLLQNGANVDAATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKL  776

Query  242  GEVDLVSNM  250
            G + ++ ++
Sbjct  777  GYISVLDSL  785


>Q8SWY2_DROME unnamed protein product
Length=1009

 Score = 115 bits (288),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 142/293 (48%), Gaps = 13/293 (4%)

Query  44   YWLDLLKSPDQYDVEFKATGRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVA  103
            Y L    SPD   V     G TP+     ++ +  I  +L     ++ + +  QTPLH+A
Sbjct  271  YLLQHDASPDVPTVR----GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIA  326

Query  104  VANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDD  163
                N++ V L++     +        T+LH+A+  K  + E+   ++     L+     
Sbjct  327  SRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--KEGQDEVAAVLIENGAALDAATKK  384

Query  164  GLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGAN  223
            G TPLH+   + +I++    L   A  D    +N  TPLH A        ALLLL +GA+
Sbjct  385  GFTPLHLTAKYGHIKVAQLLLQKEADVD-AQGKNGVTPLHVACHYNNQQVALLLLEKGAS  443

Query  224  PNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWF  283
            P+ T K G +P+  A    ++D+ + +++YGA     +K G TPLHL++Q   + +    
Sbjct  444  PHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLL  503

Query  284  LDRNWNININVQNRKGQTPLH-CAVEDNRSDNIVTILQKE-PDLDLRDRQGLT  334
            ++    +N   +N  G TP+H CA EDN   N+  IL+K   ++D+  + G T
Sbjct  504  IEHKAAVNHPAKN--GLTPMHLCAQEDNV--NVAEILEKNGANIDMATKAGYT  552


 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 113/227 (50%), Gaps = 9/227 (4%)

Query  82   VLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTR--KPDLCIRNVLGDTSLHVASAT  139
            +L K  +++ Q K+G TPLHVA   NN +   L++ +   P    +N  G T LH+A A 
Sbjct  404  LLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN--GHTPLHIA-AR  460

Query  140  KNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRW  199
            KN + +I   +L      N ++  G TPLH+++   + E+    ++  A  +    +N  
Sbjct  461  KN-QMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVN-HPAKNGL  518

Query  200  TPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYI  259
            TP+H        + A +L + GAN ++  K G +P+  A   G+ ++V  +++ GA++  
Sbjct  519  TPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDA  578

Query  260  PNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCA  306
                G TPLH  AQ     ++   L+     N N Q   GQTPLH A
Sbjct  579  ATSIGYTPLHQTAQQGHCHIVNLLLEHKA--NANAQTVNGQTPLHIA  623


 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 75/272 (28%), Positives = 134/272 (49%), Gaps = 6/272 (2%)

Query  56   DVEFKATGR-TPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRL  114
            DV + A    +P+        +  +S +L+K  NI  + + G TPLH A  + + + V +
Sbjct  80   DVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDM  139

Query  115  IMTRKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIH  174
            ++ R   +  +   G   LH+A+  +++  +  + +L  R  ++    D LT LH+A   
Sbjct  140  LLERGAPISAKTKNGLAPLHMAAQGEHV--DAARILLYHRAPVDEVTVDYLTALHVAAHC  197

Query  175  NNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSP  234
             ++ +    LD  A  +     N +TPLH A          LLLR GA+ + T + G +P
Sbjct  198  GHVRVAKLLLDRNADAN-ARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTP  256

Query  235  IFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININV  294
            +  A   G +++V  ++++ A   +P   G+TPLHLAA+   + ++R  L RN    ++ 
Sbjct  257  LHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL-RN-GAQVDA  314

Query  295  QNRKGQTPLHCAVEDNRSDNIVTILQKEPDLD  326
            + R+ QTPLH A      D ++ +LQ    +D
Sbjct  315  RAREQQTPLHIASRLGNVDIVMLLLQHGAQVD  346


 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 126/276 (46%), Gaps = 5/276 (2%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G TP+      +    +  +L    +I+   +SG TPLHVA     +  V  ++      
Sbjct  220  GFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASP  279

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTD  182
             +  V G+T LH+A+     + +I++ +LR    ++ +  +  TPLHIA+   N++++  
Sbjct  280  DVPTVRGETPLHLAARAN--QTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVML  337

Query  183  YLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGG  242
             L  GA+ D T  ++ +T LH A        A +L+  GA  +   K G +P+      G
Sbjct  338  LLQHGAQVDAT-TKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYG  396

Query  243  EVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTP  302
             + +   +++  AD+    K G TPLH+A       V    L++  + +   +N  G TP
Sbjct  397  HIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKN--GHTP  454

Query  303  LHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDL  338
            LH A   N+ D   T+L+     +   + G T   L
Sbjct  455  LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHL  490


 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/279 (25%), Positives = 128/279 (46%), Gaps = 9/279 (3%)

Query  62   TGRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPD  121
            +G TP+       C   +  +L    + ++    G+TPLH+A   N  + +R+++     
Sbjct  252  SGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQ  311

Query  122  LCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMT  181
            +  R     T LH+AS   N+  +IV  +L+    ++    D  T LHIA      E+  
Sbjct  312  VDARAREQQTPLHIASRLGNV--DIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAA  369

Query  182  DYLDLGAKTDITDNENRWTPLHHATMVRYSH--AALLLLRRGANPNITDKFGQSPIFNAV  239
              ++ GA  D    +  +TPLH     +Y H   A LLL++ A+ +   K G +P+  A 
Sbjct  370  VLIENGAALDAATKKG-FTPLH--LTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVAC  426

Query  240  MGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKG  299
                  +   +++ GA  +   K G TPLH+AA+     +    L+  +    N +++ G
Sbjct  427  HYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE--YGALANAESKAG  484

Query  300  QTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDL  338
             TPLH + ++  ++    +++ +  ++   + GLT   L
Sbjct  485  FTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHL  523


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 75/283 (27%), Positives = 121/283 (43%), Gaps = 38/283 (13%)

Query  82   VLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDLCIRNVLGDTSLHVASATKN  141
            +LD   N ++  KSG TPLH+A    N     L++ +  D+        + LHVA+  K 
Sbjct  41   LLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAA--KW  98

Query  142  IRPEIVQEILRTRVCLNLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTP  201
             +  +V  +L     +  K  DGLTPLH A    + +++   L+ GA       +N   P
Sbjct  99   GKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPIS-AKTKNGLAP  157

Query  202  LHHATMVRYSHA---------------------------------ALLLLRRGANPNITD  228
            LH A    +  A                                 A LLL R A+ N   
Sbjct  158  LHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA  217

Query  229  KFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNW  288
              G +P+  A     + +V  ++++GA I    + G TPLH+AA      ++ + L  + 
Sbjct  218  LNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDA  277

Query  289  NININVQNRKGQTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQ  331
              + +V   +G+TPLH A   N++D I  +L+    +D R R+
Sbjct  278  --SPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARARE  318


 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 105/237 (44%), Gaps = 9/237 (4%)

Query  100  LHVAVANNNLEAVRLIMT--RKPDLCIRNVLGDTSLHVASATKNIRPEIVQEILRTRVCL  157
            LH+A   ++++A  L++     PD+  ++  G T LH+AS   N    I   +++    +
Sbjct  26   LHIAAKKDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGN--QNIANLLIQKGADV  81

Query  158  NLKNDDGLTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLL  217
            N      ++PLH+A       +++  L+ G   +     +  TPLH A    +     +L
Sbjct  82   NYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIE-AKTRDGLTPLHCAARSGHEQVVDML  140

Query  218  LRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTS  277
            L RGA  +   K G +P+  A  G  VD    ++ + A +        T LH+AA     
Sbjct  141  LERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHV  200

Query  278  AVLRWFLDRNWNININVQNRKGQTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLT  334
             V +  LDRN + N    N  G TPLH A + NR   +  +L+    +      GLT
Sbjct  201  RVAKLLLDRNADANARALN--GFTPLHIACKKNRLKVVELLLRHGASISATTESGLT  255


 Score = 72.8 bits (177),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 94/192 (49%), Gaps = 9/192 (5%)

Query  165  LTPLHIATIHNNIELMTDYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANP  224
            L  LHIA   ++++  T  LD     D+T +++ +TPLH A+     + A LL+++GA+ 
Sbjct  23   LPALHIAAKKDDVKAATLLLDNDHNPDVT-SKSGFTPLHIASHYGNQNIANLLIQKGADV  81

Query  225  NITDKFGQSPIFNAVMGGEVDLVSNMVKYGADIYIPNKFGQTPLHLAAQNPTSAVLRWFL  284
            N + K   SP+  A   G+ ++VS +++ G +I    + G TPLH AA++    V+   L
Sbjct  82   NYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLL  141

Query  285  DRNWNININVQNRKGQTPLHCAVEDNRSDNIVTILQKEPDLDLRDRQGLTVFDLRLDDEL  344
            +R   I+   +N  G  PLH A +    D    +L     +D      LT         +
Sbjct  142  ERGAPISAKTKN--GLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTAL------HV  193

Query  345  IKHVVKLKVAKL  356
              H   ++VAKL
Sbjct  194  AAHCGHVRVAKL  205


 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 83/184 (45%), Gaps = 5/184 (3%)

Query  193  TDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMGGEVDLVSNMVK  252
            T  + R   LH A       AA LLL    NP++T K G +P+  A   G  ++ + +++
Sbjct  17   TRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQ  76

Query  253  YGADIYIPNKFGQTPLHLAAQNPTSAVLRWFLDRNWNININVQNRKGQTPLHCAVEDNRS  312
             GAD+    K   +PLH+AA+   + ++   L++    NI  + R G TPLHCA      
Sbjct  77   KGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG--NIEAKTRDGLTPLHCAARSGHE  134

Query  313  DNIVTILQKEPDLDLRDRQGLTVFDLRLDDELIKHVVKLKVAKLRVSQRT---LNVVHTA  369
              +  +L++   +  + + GL    +    E +     L   +  V + T   L  +H A
Sbjct  135  QVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVA  194

Query  370  DNSG  373
             + G
Sbjct  195  AHCG  198


 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 83/189 (44%), Gaps = 5/189 (3%)

Query  63   GRTPIFFVTMSHCSTQISAVLDKTPNINIQDKSGQTPLHVAVANNNLEAVRLIMTRKPDL  122
            G TP+      +     + +L+     N + K+G TPLH++    + E   L++  K  +
Sbjct  451  GHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAV  510

Query  123  CIRNVLGDTSLHVASATKNIRPEIVQEIL-RTRVCLNLKNDDGLTPLHIATIHNNIELMT  181
                  G T +H+ +   N+    V EIL +    +++    G TPLH+A+      ++ 
Sbjct  511  NHPAKNGLTPMHLCAQEDNVN---VAEILEKNGANIDMATKAGYTPLHVASHFGQANMVR  567

Query  182  DYLDLGAKTDITDNENRWTPLHHATMVRYSHAALLLLRRGANPNITDKFGQSPIFNAVMG  241
              L  GA  D   +   +TPLH      + H   LLL   AN N     GQ+P+  A   
Sbjct  568  FLLQNGANVDAATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKL  626

Query  242  GEVDLVSNM  250
            G + ++ ++
Sbjct  627  GYISVLDSL  635



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933588.1 diacylglycerol O-acyltransferase 1 [Chelonus
insularis]

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q960U8_DROME  unnamed protein product                                 655     0.0  
Q8ST50_DROME  unnamed protein product                                 653     0.0  
DGAT1_DICDI  unnamed protein product                                  243     3e-73


>Q960U8_DROME unnamed protein product
Length=565

 Score = 655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/483 (63%), Positives = 377/483 (78%), Gaps = 10/483 (2%)

Query  7    EAKVRLRRTKSVTRAEEIQRLDYMMRKSQPDKPCHKPRDSLFSWSSGFNNFTGFINWGFL  66
            E K+R RRT+SVTRAEEI   +   R++QP +P H+PRDSLFSWSSGF NF+G +NWGFL
Sbjct  86   EKKLRYRRTQSVTRAEEISNKEEKQRRAQPGRPIHRPRDSLFSWSSGFTNFSGLVNWGFL  145

Query  67   LLGLGGVRLLLENFIKYGIRVDPWEWYLFLSGKNDGSEEHPSILLICYSMVPVTMCLLIE  126
            LL +GG+RL LEN +KYGIR++P +W+ F+SG N+G E H +++L  YS+V +++CL +E
Sbjct  146  LLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEG-EGHNALILSIYSLVHISLCLAVE  204

Query  127  KGLALDIIEHGPGTVFHVINLVVMVMMPMVIIHVKGSGFSLIGALYVSMLYAVLFLKLWS  186
            KGLA++II  G G    ++N+VV+V +P+V IH+KG  FSL+GA  V   Y+VLFLKLWS
Sbjct  205  KGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFFYSVLFLKLWS  264

Query  187  YVQVNMWCRLSQKNHSSQNRIRRQSLSYNDLQSSSVHQNDNDEDILHDGTGIPVLVKYPD  246
            YVQ NMWCR  Q  +    R RR S++  +L+   ++  + DED+         LV+YPD
Sbjct  265  YVQTNMWCR--QTYYQKNPRERRPSITLAELKKGVLNGGEEDEDV-------SKLVQYPD  315

Query  247  NLNIRDLIYFLLAPTLCYELNFPRTERIRKRFLMKRIFEVFVGCQVVMSLCQQWMIPSVK  306
            NL  +DL+YFL APTLCYELNFPRT R+RKRFL+KR+ EV +G  VVM+L QQW+IPSV+
Sbjct  316  NLTYKDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPSVR  375

Query  307  NSLIPFTNMDVAKAAERLLKLAIPNHLMWLCFFYLVFHSCFNLIGELLHFADRNFYGDWW  366
            NSLIPF+NMDVA A ERLLKLA+PNHL WLCFFYL+FHS  N +GELL+FADRNFY DWW
Sbjct  376  NSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWW  435

Query  367  NANNIDTFWRTWNMAVHRWAVRHLYIPIVEMGYSRTVASVTVFFFSAFFHEYLVSIPLQT  426
            NANNIDTFWRTWNM VHRW VRHLYIP+V+MGYS   AS  VF FSA FHEYLVS+PLQ 
Sbjct  436  NANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQI  495

Query  427  FKIWAFMGMMSQIPLSIISKRVENRFGARWGNIVVWSSLIIGQPLCIMVYYHDYVVTHFG  486
            +KIWAFMGMM QIPLS ISK +E + G R GNI+VW+S+I+GQPLCIM YYHDYVV HF 
Sbjct  496  YKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFK  555

Query  487  ETL  489
             +L
Sbjct  556  NSL  558


>Q8ST50_DROME unnamed protein product
Length=565

 Score = 653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/483 (63%), Positives = 376/483 (78%), Gaps = 10/483 (2%)

Query  7    EAKVRLRRTKSVTRAEEIQRLDYMMRKSQPDKPCHKPRDSLFSWSSGFNNFTGFINWGFL  66
            E K+R RRT+SVTRAEEI   +   R++QP +P H+PRDSLFSWSSGF NF+G +NWGFL
Sbjct  86   EKKLRYRRTQSVTRAEEISNKEEKQRRAQPGRPIHRPRDSLFSWSSGFTNFSGLVNWGFL  145

Query  67   LLGLGGVRLLLENFIKYGIRVDPWEWYLFLSGKNDGSEEHPSILLICYSMVPVTMCLLIE  126
            LL +GG+RL LEN +KYGIR++P +W+ F+SG N+G E H +++L  YS+V +++CL +E
Sbjct  146  LLCIGGLRLGLENLLKYGIRINPLDWFFFISGHNEG-EGHNALILSIYSLVHISLCLAVE  204

Query  127  KGLALDIIEHGPGTVFHVINLVVMVMMPMVIIHVKGSGFSLIGALYVSMLYAVLFLKLWS  186
            KGLA++II  G G    ++N+VV+V +P+V IH+KG  FSL+GA  V   Y+VLFLKLWS
Sbjct  205  KGLAMEIIAEGLGLFIQIVNIVVLVCLPVVTIHLKGHAFSLMGASTVCFFYSVLFLKLWS  264

Query  187  YVQVNMWCRLSQKNHSSQNRIRRQSLSYNDLQSSSVHQNDNDEDILHDGTGIPVLVKYPD  246
            YVQ NMWCR  Q  +    R RR S++  +L+   ++  + DED+         LV+YPD
Sbjct  265  YVQTNMWCR--QTYYQKNPRERRPSITLAELKKGVLNGGEEDEDV-------SKLVQYPD  315

Query  247  NLNIRDLIYFLLAPTLCYELNFPRTERIRKRFLMKRIFEVFVGCQVVMSLCQQWMIPSVK  306
            NL   DL+YFL APTLCYELNFPRT R+RKRFL+KR+ EV +G  VVM+L QQW+IPSV+
Sbjct  316  NLTYNDLLYFLCAPTLCYELNFPRTSRVRKRFLLKRLLEVVIGVNVVMALFQQWIIPSVR  375

Query  307  NSLIPFTNMDVAKAAERLLKLAIPNHLMWLCFFYLVFHSCFNLIGELLHFADRNFYGDWW  366
            NSLIPF+NMDVA A ERLLKLA+PNHL WLCFFYL+FHS  N +GELL+FADRNFY DWW
Sbjct  376  NSLIPFSNMDVALATERLLKLALPNHLCWLCFFYLMFHSFLNAVGELLNFADRNFYCDWW  435

Query  367  NANNIDTFWRTWNMAVHRWAVRHLYIPIVEMGYSRTVASVTVFFFSAFFHEYLVSIPLQT  426
            NANNIDTFWRTWNM VHRW VRHLYIP+V+MGYS   AS  VF FSA FHEYLVS+PLQ 
Sbjct  436  NANNIDTFWRTWNMPVHRWCVRHLYIPVVQMGYSSRQASTIVFLFSAVFHEYLVSVPLQI  495

Query  427  FKIWAFMGMMSQIPLSIISKRVENRFGARWGNIVVWSSLIIGQPLCIMVYYHDYVVTHFG  486
            +KIWAFMGMM QIPLS ISK +E + G R GNI+VW+S+I+GQPLCIM YYHDYVV HF 
Sbjct  496  YKIWAFMGMMGQIPLSAISKSIEKKLGPRMGNIIVWASIILGQPLCIMAYYHDYVVQHFK  555

Query  487  ETL  489
             +L
Sbjct  556  NSL  558


>DGAT1_DICDI unnamed protein product
Length=617

 Score = 243 bits (620),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 240/444 (54%), Gaps = 46/444 (10%)

Query  44   RDSLFSWSSGFNNFTGFINWGFLLLGLGGVRLLLENFIKYGIRVDPWEWYLFLSGKNDGS  103
            R S+ S  S  +++ GF+N   +LL     RL++ N + YGIR++  + Y         S
Sbjct  198  RPSILSSESNGSSYRGFLNLLLILLITASFRLVILNHLLYGIRIN-LDLYKI-------S  249

Query  104  EEH--PSILLICYSMVPVTMCLLIEKGLALDIIEHGPGTVFHVINLVVMVMMPM-VIIHV  160
            E H  P +++     + +    LIEK  A  ++      +  +IN   ++++P   II  
Sbjct  250  EYHRWPGVMISLMINLFIIAAYLIEKAAAKQLLPDRICYLLRIINCAAVIIVPSGSIIAF  309

Query  161  KGSGFSLIGALYVSMLYAVLFLKLWSYVQVNMWCRLSQKNHSSQNRIRRQSLSYNDLQSS  220
              +  S    + V +L     +K+ SY   N          S Q ++             
Sbjct  310  SPNPAS---GIIVMILICTFSMKIISYAYEN----------SKQRKL-------------  343

Query  221  SVHQNDNDEDILHDGTGIPVLVKYPDNLNIRDLIYFLLAPTLCYELNFPRTERIRKRFLM  280
                N +++  + D T   +   YP+NL++R   +F+L PTL Y+L++PR+ +IRK +L+
Sbjct  344  ----NPDNKKFVIDPTNTSI---YPNNLSLRSTYWFMLVPTLVYQLSYPRSPKIRKGYLL  396

Query  281  KRIFEVFVGCQVVMSLCQQWMIPSVKNSLIPFTNMDVAKAAERLLKLAIPNHLMWLCFFY  340
            +RI E      +++ +  Q+M+P V+NS+ P   +D+    ER++KL++PN  +WL  FY
Sbjct  397  RRIVEALSLSLLILWMVNQYMLPLVQNSIEPLEKIDIVLIVERIMKLSLPNLYVWLLGFY  456

Query  341  LVFHSCFNLIGELLHFADRNFYGDWWNANNIDTFWRTWNMAVHRWAVRHLYIPIVEMGYS  400
            + FH   N++ E+  F DR FY DWWN+  +D FWRTWNM VH W V  +Y P+   G+S
Sbjct  457  VFFHLYLNIVAEITRFGDREFYRDWWNSTGLDYFWRTWNMPVHHWMVVLIYTPMRRRGFS  516

Query  401  RTVASVTVFFFSAFFHEYLVSIPLQTFKIWAFMGMMSQIPLSIISKRVENRFGARWGNIV  460
            + +     FF SA FHE ++SIP  + K+W F G+MSQ+ L  ++K + N  G   GN++
Sbjct  517  KNMGYFMCFFVSAIFHELVISIPFHSLKLWGFFGIMSQMVLIALTKNLMN--GRNLGNVI  574

Query  461  VWSSLIIGQPLCIMVYYHDYVVTH  484
             W S+++GQPL +++YY ++V+ +
Sbjct  575  FWISIVLGQPLVVLLYYRNFVLEN  598



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933589.1 G2/mitotic-specific cyclin-B3 [Chelonus insularis]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CCNB3_DROME  unnamed protein product                                  420     4e-142
CCNB3_CAEEL  unnamed protein product                                  248     1e-77 
CCNB_DICDI  unnamed protein product                                   176     9e-50 


>CCNB3_DROME unnamed protein product
Length=575

 Score = 420 bits (1080),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 249/540 (46%), Positives = 322/540 (60%), Gaps = 87/540 (16%)

Query  17   VALRSGVTTRNQQATDTNNINNNSKPSVSKDLRTKRKAEASPLKNKTIKRSALENIT-NA  75
             A R G+T R   A  T NI+ N +   +   R KRKA+ SP+KN  IKRSAL N+T N 
Sbjct  32   AATRKGLTRR---AAATGNIDPNVE---NMQTRAKRKADHSPIKNDKIKRSALGNLTNNV  85

Query  76   IAKTQGIAQSKK---IVKKVQIKQAQPVKANDKPVTTKQSTNIVSNL--KSKLTTKSVVK  130
               T   AQ ++   + KK   +Q Q +      +  K+  N+  N+   SK+TT++  K
Sbjct  86   KIMTLHPAQDEEQSGVGKKPTAQQLQAL------MDAKKQENLSVNVFGASKMTTRASSK  139

Query  131  KKPEIK----------------KPLVEKVVELKKSEAAE---------------------  153
             +  ++                KP  + V   KK+   E                     
Sbjct  140  VEDSVENCHKVLDKLEEALARPKPRPKAVPAAKKTVLGEVQLPAMPNPMQIPVLLPPTHN  199

Query  154  --------------------KSDDSSLYVSALEDVSGGSAKKSSATVEKAAEKDEVVPKK  193
                                K++DS LY+SALEDVS   + + S   E A  +   + +K
Sbjct  200  LAAPQVAAVKPVRRISNDFNKTEDS-LYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQK  258

Query  194  NADQKPKEVI---PKSLHLDDPPYRELPEGMESDFDIENWRDPYQVSQYASEIFEYLKSR  250
              +Q+P+ ++   P++      P   +PE +E DFD +NW DP+QVS YA +IF YLK R
Sbjct  259  T-EQQPQPLLLTLPETAPSQVVPIPPVPEEVE-DFDRKNWDDPFQVSHYAMDIFNYLKVR  316

Query  251  ESQFVIDDYMENQTHISAWMRSLLVDWMVEVQESFELNHETLYLAVKLVDLYLSKINVMK  310
            E++F I DYM  Q H++ WMR+LLVDWMVEVQE+FELNHETLYLAVK+VDLYL +  + K
Sbjct  317  EAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINK  376

Query  311  EILQLLGAASLFIASKFDERIPPLVEDFLYICDGAYSQRELMRMEMSILKTIDFDLGIPL  370
            E LQLLGAA+ FIA K+DER PPL+EDFLYICDGAY+  EL+RME   L+ I +DLGIPL
Sbjct  377  EKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPL  436

Query  371  SYRFLRRYARCIKVSMPTLTLARYILEYSLMDYETVQFSDSKIAVAALVLALMMKDLGG-  429
            SYRFLRRYARC KV MPTLTLARYILE SLMDY  + FSDS++A AAL +AL M    G 
Sbjct  437  SYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQ  496

Query  430  -----WSTELEYYTGYQIDDIRDIVFVLNNGLHRKPKDELATVRHKYSHKIFFEVAKIPL  484
                 W++ L YYTGYQ+ D  +IV  LN GLHRKP+  + T+R+KYSHKIF EVAK+PL
Sbjct  497  LDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPL  556


>CCNB3_CAEEL unnamed protein product
Length=385

 Score = 248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 175/268 (65%), Gaps = 8/268 (3%)

Query  224  DFDIENWRDPYQVSQYASEIFEYLKSRESQFVIDDYMENQTHISAWMRSLLVDWMVEVQE  283
            D+D+E   +P  +S YA  IF+Y + RE  F +  Y+     +    R++L+DWMVE+QE
Sbjct  97   DYDLEEAGNPDSISDYAQGIFDYYRHREVHFRVRKYLHKHPEVDVKTRAILIDWMVEIQE  156

Query  284  SFELNHETLYLAVKLVDLYLSKI-NVMKEILQLLGAASLFIASKFDERIPPLVEDFLYIC  342
            +FELNHETLY AVKL D+YL K  NV K  +Q L   ++FIA+K+DER PPLV+D +Y+ 
Sbjct  157  TFELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAIFIAAKYDERSPPLVDDLIYLS  216

Query  343  DGAYSQRELMRMEMSILKTIDFDLGIPLSYRFLRRYARCIKVSMPTLTLARYILEYSLMD  402
               +S+ EL+ ME  +  T+ +DLG PLSYR+LRR+ R  +V M TLT+ R+ILE SLM 
Sbjct  217  GDRFSRDELLAMERELFATVGYDLGSPLSYRYLRRFGRVCRVDMKTLTMGRFILETSLMV  276

Query  403  YETVQFSDSKIAVAALVLALMMKDLGG---WSTELEYYTGYQIDDIRDIVFVLNNGLHRK  459
            YE    S S++A AA VLA+ M D      W+  LE Y+G+  +++  +V  +N+ LH  
Sbjct  277  YEYAMVSQSRLAAAAFVLAMRMLDKNNEYEWNPVLEKYSGFTGEEVMPLVEHMNHILHFS  336

Query  460  PKD---ELATVRHKYSHKIFFEVAKIPL  484
             KD   +L +VR KYSH++FF VA IP+
Sbjct  337  -KDKWAQLTSVRQKYSHEVFFHVASIPM  363


>CCNB_DICDI unnamed protein product
Length=436

 Score = 176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 129/422 (31%), Positives = 206/422 (49%), Gaps = 41/422 (10%)

Query  66   RSALENITNAIAKTQGIAQSKKIVKKVQIKQAQPVKANDKPVTTKQSTNIVSNLKSKLTT  125
            R AL ++TN   +T G+A     +    I   QP    +  +T  +S +I+ N  S   +
Sbjct  50   RGALSDLTNNTHQTTGMATKTVQLSNNNIIMPQPTNTRNNIIT--RSKSIIDNGASLRNS  107

Query  126  KSVVKKKPEIKKPLVEKVVELKKSEAAEKSDDSSLYVSALEDVSGGSAKKSSATVEKAAE  185
              +    P    P V KV         +K D  S+    + ++            ++   
Sbjct  108  ALISGVLPNANGP-VNKV---------QKRDIQSM--EMMNNIP-----------QQPVM  144

Query  186  KDEVVPKKNADQKPKEVIPKSLHLDDPPYRELPEGMESDFDIENWRDPYQVSQYASEIFE  245
             D+V    N  Q+ + VI  +         E+PE    + DI +  DP  V +Y +EIF 
Sbjct  145  IDDVDNDTNMIQEEQMVIDIT---------EVPE----NIDIYDSHDPQCVGEYVNEIFA  191

Query  246  YLKSRESQFVID-DYMENQTHISAWMRSLLVDWMVEVQESFELNHETLYLAVKLVDLYLS  304
            Y + +E    ID DY++NQ HI+  MR++LVDWM+ V   F+L  ET +L+V +VD YL+
Sbjct  192  YYREKEQIDKIDKDYIKNQYHINERMRAILVDWMMAVHVRFKLLSETFFLSVNIVDRYLA  251

Query  305  KINVMKEILQLLGAASLFIASKFDERIPPLVEDFLYICDGAYSQRELMRMEMSILKTIDF  364
            K+ +    LQL+G  ++ +A K++E   P ++DF++  D A +  E++ ME  IL T+ F
Sbjct  252  KVMIPVTKLQLVGITAILLACKYEEIYSPQIKDFVHTSDDACTHAEVIDMERQILSTLQF  311

Query  365  DLGIPLSYRFLRRYARCIKVSMPTLTLARYILEYSLMDYETVQFSDSKIAVAALVLA--L  422
             + +     FLRR+++       T +L++Y+ E S+++Y  VQF  S IA A++ +A  +
Sbjct  312  HMSVATPLHFLRRFSKAAGSDSRTHSLSKYLSELSMVEYRMVQFVPSMIAAASIYVARRM  371

Query  423  MMKDLGGWSTELEYYTGYQIDDIRDIVFVLNNGLHRKPKDELATVRHKYSHKIFFEVAKI  482
             MK    W+  LEYYT Y+  +I      L     R     L   R KY      EVA I
Sbjct  372  TMKSGPYWNVTLEYYTCYKESEILQCAQELKEVRKRADTSNLKATRKKYLSSKLMEVAAI  431

Query  483  PL  484
            P+
Sbjct  432  PV  433



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933590.1 G2/mitotic-specific cyclin-B3 [Chelonus insularis]

Length=490
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CCNB3_DROME  unnamed protein product                                  420     4e-142
CCNB3_CAEEL  unnamed protein product                                  248     1e-77 
CCNB_DICDI  unnamed protein product                                   176     9e-50 


>CCNB3_DROME unnamed protein product
Length=575

 Score = 420 bits (1080),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 249/540 (46%), Positives = 322/540 (60%), Gaps = 87/540 (16%)

Query  17   VALRSGVTTRNQQATDTNNINNNSKPSVSKDLRTKRKAEASPLKNKTIKRSALENIT-NA  75
             A R G+T R   A  T NI+ N +   +   R KRKA+ SP+KN  IKRSAL N+T N 
Sbjct  32   AATRKGLTRR---AAATGNIDPNVE---NMQTRAKRKADHSPIKNDKIKRSALGNLTNNV  85

Query  76   IAKTQGIAQSKK---IVKKVQIKQAQPVKANDKPVTTKQSTNIVSNL--KSKLTTKSVVK  130
               T   AQ ++   + KK   +Q Q +      +  K+  N+  N+   SK+TT++  K
Sbjct  86   KIMTLHPAQDEEQSGVGKKPTAQQLQAL------MDAKKQENLSVNVFGASKMTTRASSK  139

Query  131  KKPEIK----------------KPLVEKVVELKKSEAAE---------------------  153
             +  ++                KP  + V   KK+   E                     
Sbjct  140  VEDSVENCHKVLDKLEEALARPKPRPKAVPAAKKTVLGEVQLPAMPNPMQIPVLLPPTHN  199

Query  154  --------------------KSDDSSLYVSALEDVSGGSAKKSSATVEKAAEKDEVVPKK  193
                                K++DS LY+SALEDVS   + + S   E A  +   + +K
Sbjct  200  LAAPQVAAVKPVRRISNDFNKTEDS-LYMSALEDVSSCDSMRLSGNFEAARRRSAKLQQK  258

Query  194  NADQKPKEVI---PKSLHLDDPPYRELPEGMESDFDIENWRDPYQVSQYASEIFEYLKSR  250
              +Q+P+ ++   P++      P   +PE +E DFD +NW DP+QVS YA +IF YLK R
Sbjct  259  T-EQQPQPLLLTLPETAPSQVVPIPPVPEEVE-DFDRKNWDDPFQVSHYAMDIFNYLKVR  316

Query  251  ESQFVIDDYMENQTHISAWMRSLLVDWMVEVQESFELNHETLYLAVKLVDLYLSKINVMK  310
            E++F I DYM  Q H++ WMR+LLVDWMVEVQE+FELNHETLYLAVK+VDLYL +  + K
Sbjct  317  EAEFPIADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINK  376

Query  311  EILQLLGAASLFIASKFDERIPPLVEDFLYICDGAYSQRELMRMEMSILKTIDFDLGIPL  370
            E LQLLGAA+ FIA K+DER PPL+EDFLYICDGAY+  EL+RME   L+ I +DLGIPL
Sbjct  377  EKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPL  436

Query  371  SYRFLRRYARCIKVSMPTLTLARYILEYSLMDYETVQFSDSKIAVAALVLALMMKDLGG-  429
            SYRFLRRYARC KV MPTLTLARYILE SLMDY  + FSDS++A AAL +AL M    G 
Sbjct  437  SYRFLRRYARCAKVPMPTLTLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQ  496

Query  430  -----WSTELEYYTGYQIDDIRDIVFVLNNGLHRKPKDELATVRHKYSHKIFFEVAKIPL  484
                 W++ L YYTGYQ+ D  +IV  LN GLHRKP+  + T+R+KYSHKIF EVAK+PL
Sbjct  497  LDKQTWTSTLIYYTGYQLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPL  556


>CCNB3_CAEEL unnamed protein product
Length=385

 Score = 248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 175/268 (65%), Gaps = 8/268 (3%)

Query  224  DFDIENWRDPYQVSQYASEIFEYLKSRESQFVIDDYMENQTHISAWMRSLLVDWMVEVQE  283
            D+D+E   +P  +S YA  IF+Y + RE  F +  Y+     +    R++L+DWMVE+QE
Sbjct  97   DYDLEEAGNPDSISDYAQGIFDYYRHREVHFRVRKYLHKHPEVDVKTRAILIDWMVEIQE  156

Query  284  SFELNHETLYLAVKLVDLYLSKI-NVMKEILQLLGAASLFIASKFDERIPPLVEDFLYIC  342
            +FELNHETLY AVKL D+YL K  NV K  +Q L   ++FIA+K+DER PPLV+D +Y+ 
Sbjct  157  TFELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAIFIAAKYDERSPPLVDDLIYLS  216

Query  343  DGAYSQRELMRMEMSILKTIDFDLGIPLSYRFLRRYARCIKVSMPTLTLARYILEYSLMD  402
               +S+ EL+ ME  +  T+ +DLG PLSYR+LRR+ R  +V M TLT+ R+ILE SLM 
Sbjct  217  GDRFSRDELLAMERELFATVGYDLGSPLSYRYLRRFGRVCRVDMKTLTMGRFILETSLMV  276

Query  403  YETVQFSDSKIAVAALVLALMMKDLGG---WSTELEYYTGYQIDDIRDIVFVLNNGLHRK  459
            YE    S S++A AA VLA+ M D      W+  LE Y+G+  +++  +V  +N+ LH  
Sbjct  277  YEYAMVSQSRLAAAAFVLAMRMLDKNNEYEWNPVLEKYSGFTGEEVMPLVEHMNHILHFS  336

Query  460  PKD---ELATVRHKYSHKIFFEVAKIPL  484
             KD   +L +VR KYSH++FF VA IP+
Sbjct  337  -KDKWAQLTSVRQKYSHEVFFHVASIPM  363


>CCNB_DICDI unnamed protein product
Length=436

 Score = 176 bits (446),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 129/422 (31%), Positives = 206/422 (49%), Gaps = 41/422 (10%)

Query  66   RSALENITNAIAKTQGIAQSKKIVKKVQIKQAQPVKANDKPVTTKQSTNIVSNLKSKLTT  125
            R AL ++TN   +T G+A     +    I   QP    +  +T  +S +I+ N  S   +
Sbjct  50   RGALSDLTNNTHQTTGMATKTVQLSNNNIIMPQPTNTRNNIIT--RSKSIIDNGASLRNS  107

Query  126  KSVVKKKPEIKKPLVEKVVELKKSEAAEKSDDSSLYVSALEDVSGGSAKKSSATVEKAAE  185
              +    P    P V KV         +K D  S+    + ++            ++   
Sbjct  108  ALISGVLPNANGP-VNKV---------QKRDIQSM--EMMNNIP-----------QQPVM  144

Query  186  KDEVVPKKNADQKPKEVIPKSLHLDDPPYRELPEGMESDFDIENWRDPYQVSQYASEIFE  245
             D+V    N  Q+ + VI  +         E+PE    + DI +  DP  V +Y +EIF 
Sbjct  145  IDDVDNDTNMIQEEQMVIDIT---------EVPE----NIDIYDSHDPQCVGEYVNEIFA  191

Query  246  YLKSRESQFVID-DYMENQTHISAWMRSLLVDWMVEVQESFELNHETLYLAVKLVDLYLS  304
            Y + +E    ID DY++NQ HI+  MR++LVDWM+ V   F+L  ET +L+V +VD YL+
Sbjct  192  YYREKEQIDKIDKDYIKNQYHINERMRAILVDWMMAVHVRFKLLSETFFLSVNIVDRYLA  251

Query  305  KINVMKEILQLLGAASLFIASKFDERIPPLVEDFLYICDGAYSQRELMRMEMSILKTIDF  364
            K+ +    LQL+G  ++ +A K++E   P ++DF++  D A +  E++ ME  IL T+ F
Sbjct  252  KVMIPVTKLQLVGITAILLACKYEEIYSPQIKDFVHTSDDACTHAEVIDMERQILSTLQF  311

Query  365  DLGIPLSYRFLRRYARCIKVSMPTLTLARYILEYSLMDYETVQFSDSKIAVAALVLA--L  422
             + +     FLRR+++       T +L++Y+ E S+++Y  VQF  S IA A++ +A  +
Sbjct  312  HMSVATPLHFLRRFSKAAGSDSRTHSLSKYLSELSMVEYRMVQFVPSMIAAASIYVARRM  371

Query  423  MMKDLGGWSTELEYYTGYQIDDIRDIVFVLNNGLHRKPKDELATVRHKYSHKIFFEVAKI  482
             MK    W+  LEYYT Y+  +I      L     R     L   R KY      EVA I
Sbjct  372  TMKSGPYWNVTLEYYTCYKESEILQCAQELKEVRKRADTSNLKATRKKYLSSKLMEVAAI  431

Query  483  PL  484
            P+
Sbjct  432  PV  433



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933591.1 protein krueppel-like [Chelonus insularis]

Length=475
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KRUP_DROME  unnamed protein product                                   350     8e-116
GLAS_DROME  unnamed protein product                                   145     2e-37 
R9PY35_DROME  unnamed protein product                                 132     2e-34 


>KRUP_DROME unnamed protein product
Length=502

 Score = 350 bits (897),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 221/485 (46%), Positives = 277/485 (57%), Gaps = 89/485 (18%)

Query  1    MALSYLQEAQIN--AGLLTGQQFDMKESEKQSSMSPPLNNNTSMS----LFPRIGAAAAA  54
            M++S LQ+AQ    A  L G + +    ++  S+SPP++ NTS +    ++P +G   AA
Sbjct  1    MSISMLQDAQTRTLAAALAGIKQEDVHLDRSMSLSPPMSANTSATSAAAIYPAMGLQQAA  60

Query  55   AAS-LSMLTPQQLLAASRTAALMAAGLPVSLHASLAAAAASNPSLYGHHNQPMSLFGGWA  113
            AAS   ML+P QLLAA+R AA   A LP+S  A+         +L+ H   P +LFG WA
Sbjct  61   AASAFGMLSPTQLLAANRQAAAFMAQLPMSTLAN---------TLFPH--NPAALFGAWA  109

Query  114  -----PPAAP---SPPSSVSPALSTKSTSRRSTNNNNNIVSSSVDRVTKKNQVK-KRGPK  164
                 PP      SPP+S    LST   S +   N+ N      +   K  ++  K+  +
Sbjct  110  AQQSLPPQGTHLHSPPASPHSPLSTPLGSGKHPLNSPNSTPQHHEPAKKARKLSVKKEFQ  169

Query  165  TKVEMSLPTLL--------------------EGTAPPSPPTSVSPEAVKD-SRDKVFTCG  203
            T++ MS+  +                     +G    +    VS    KD SRDK FTC 
Sbjct  170  TEISMSVNDMYHTSGGPISPPSSGSSPNSTHDGAGGNAGCVGVS----KDPSRDKSFTCK  225

Query  204  VCSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDR  263
            +CSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDR
Sbjct  226  ICSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDR  285

Query  264  QFVQVANLRRHLRVHTGERPYACELCSAKFSDSNQLKAHLLIHKGEKPFECEHCQMRFRR  323
            QFVQVANLRRHLRVHTGERPY CE+C  KFSDSNQLK+H+L+H GEKPFECE C M+FRR
Sbjct  286  QFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKSHMLVHNGEKPFECERCHMKFRR  345

Query  324  RHHLLHHKCGTSGSRTHMASPSVTSD-------------------------------DL-  351
            RHHL++HKCG     T   SP+++ D                               D+ 
Sbjct  346  RHHLMNHKCGIQSPPTPALSPAMSGDYPVAISAIAIEASTNRFAAMCATYGGSNESVDME  405

Query  352  ----EEDIDIDIDPEVSLRAKSHPSHRLPSPATTESRPIHL-PLNLANVPIDLPEQTEPE  406
                E+D  +D+  + +     H S+     A    R   L P  + +VP D+PEQTEPE
Sbjct  406  KATPEDDGPLDLSEDGASSVDGHCSNIARRKAQDIRRVFRLPPPQIPHVPSDMPEQTEPE  465

Query  407  DLSMH  411
            DLSMH
Sbjct  466  DLSMH  470


>GLAS_DROME unnamed protein product
Length=604

 Score = 145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 87/129 (67%), Gaps = 0/129 (0%)

Query  202  CGVCSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHC  261
            C +C +++     L+ H RTH+GE+P+ CP+C+K F++  +L  H+R HTG+KP+ C  C
Sbjct  439  CRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPIC  498

Query  262  DRQFVQVANLRRHLRVHTGERPYACELCSAKFSDSNQLKAHLLIHKGEKPFECEHCQMRF  321
            DR+F Q +++  H+R H+GERPY C  C   FSDS+ L  HL IH GEKP++C+ C +RF
Sbjct  499  DRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRF  558

Query  322  RRRHHLLHH  330
             +  +L  H
Sbjct  559  SQSGNLNRH  567


 Score = 124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 73/112 (65%), Gaps = 0/112 (0%)

Query  195  SRDKVFTCGVCSRSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEK  254
            S ++ + C  C++SF     L  H RTHTG+KPF CP C +RF++   + THMR H+GE+
Sbjct  460  SGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGER  519

Query  255  PYHCSHCDRQFVQVANLRRHLRVHTGERPYACELCSAKFSDSNQLKAHLLIH  306
            PY CS C + F   + L +HLR+H+GE+PY C+LC  +FS S  L  H+ +H
Sbjct  520  PYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  571


 Score = 109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 1/117 (1%)

Query  215  LQNHERTHTGE-KPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFVQVANLRR  273
            L   E +  GE KP  C  C K + R   LKTH+R H+GE+PY C  C++ F Q ANL  
Sbjct  423  LDGDEGSSGGEMKPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTA  482

Query  274  HLRVHTGERPYACELCSAKFSDSNQLKAHLLIHKGEKPFECEHCQMRFRRRHHLLHH  330
            H+R HTG++P+ C +C  +FS S+ +  H+  H GE+P+ C  C+  F     L  H
Sbjct  483  HVRTHTGQKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKH  539


 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 48/90 (53%), Gaps = 0/90 (0%)

Query  254  KPYHCSHCDRQFVQVANLRRHLRVHTGERPYACELCSAKFSDSNQLKAHLLIHKGEKPFE  313
            KP  C  C + + + + L+ HLR H+GERPY C  C+  FS +  L AH+  H G+KPF 
Sbjct  435  KPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFR  494

Query  314  CEHCQMRFRRRHHLLHHKCGTSGSRTHMAS  343
            C  C  RF +   +  H    SG R +  S
Sbjct  495  CPICDRRFSQSSSVTTHMRTHSGERPYRCS  524


>R9PY35_DROME unnamed protein product
Length=345

 Score = 132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 102/189 (54%), Gaps = 23/189 (12%)

Query  165  TKVEMSL--PTLLE-------GTAPPSPPTSVSPEAVKD---------SRDKVFTCGVCS  206
            T+  MS   P LLE        T  P P +S S  AVK+         SR+   TC +C+
Sbjct  147  TQCHMSFRRPGLLELHILRHHTTDGPRPMSSTSEHAVKEELRTKARQLSRNSTHTCRLCN  206

Query  207  RSFGYKHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSHCDRQFV  266
            ++F  K     H++THTGEKPF C  C K F     +K H+R HTGE+P+ C  C   F 
Sbjct  207  KTFCSKASCVRHQKTHTGEKPFACEICQKPFADLASVKRHLRTHTGERPFKCLTCQSAFS  266

Query  267  QVANLRRHLRVHTGERPYACELCSAKFSDSNQLKAHLLIHKGEKPFECEHCQMRFR----  322
              + LR+H+R+HTGERPY C++C   F + +  + H++ H  EK F+C  C+ RFR    
Sbjct  267  DGSALRQHIRIHTGERPYKCDMCDKFFRERSDARKHMMSHTAEKRFKCSQCERRFRQPKG  326

Query  323  -RRHHLLHH  330
             RRH  L H
Sbjct  327  LRRHVKLCH  335


 Score = 70.1 bits (170),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 56/172 (33%), Positives = 78/172 (45%), Gaps = 28/172 (16%)

Query  195  SRDKVFTCGVCSRSFGY-----KHVLQNHERTHTGEKPFECPECHKRFTRDHHLKTHMRL  249
            S DK   C  C  SF        H+L++H  T  G +P      H        L+T  R 
Sbjct  139  SEDKGHICTQCHMSFRRPGLLELHILRHH--TTDGPRPMSSTSEH---AVKEELRTKARQ  193

Query  250  HTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYACELCSAKFSDSNQLKAHLLIHKGE  309
             +    + C  C++ F   A+  RH + HTGE+P+ACE+C   F+D   +K HL  H GE
Sbjct  194  LSRNSTHTCRLCNKTFCSKASCVRHQKTHTGEKPFACEICQKPFADLASVKRHLRTHTGE  253

Query  310  KPFECEHCQMRFR-----RRHHLLH-----HKCGT--------SGSRTHMAS  343
            +PF+C  CQ  F      R+H  +H     +KC          S +R HM S
Sbjct  254  RPFKCLTCQSAFSDGSALRQHIRIHTGERPYKCDMCDKFFRERSDARKHMMS  305



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933592.1 myb-like protein O [Chelonus insularis]

Length=472
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JXA2_DROME  unnamed protein product                                 61.2    8e-10


>Q7JXA2_DROME unnamed protein product
Length=562

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 12/91 (13%)

Query  392  DEGIHIP-RGQRGGHPT------LAKSLPVSVPNFSFGR---LIQDQNEDQLSMDPRDPN  441
            D  I IP RG  GG P+       A+SLP+ + N +      +  + N  Q   +  D  
Sbjct  472  DSSISIPVRG--GGRPSHAQLMNFARSLPIEIANTTLAERAAVANNNNFGQGCEEGMDNI  529

Query  442  NIRASIKALAKSVHGDTVFGDLPRPRFSTQI  472
            +I ASI+AL +SVHG+ VFGDLPRPR  +QI
Sbjct  530  DIAASIQALTRSVHGEAVFGDLPRPRLRSQI  560


 Score = 32.7 bits (73),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 41/210 (20%), Positives = 83/210 (40%), Gaps = 26/210 (12%)

Query  55   EFFQHDLLALTSPSSSNYEIMKRQ--HPLIYEKVVDNWTISRCINCLMYTHALNKRYETK  112
            EFF+H    +  P  +   I +R+  + L  E    +W +S CINC     A  KR    
Sbjct  66   EFFKHAYGPI--PDLTVAVINQRELLYGLTLEAAGQSWQLSLCINCKEVLCA--KRLTA-  120

Query  113  NHMNDDDNPSDDNDYHNYKLLINNTMILPTDNSDNNVEYYKKLKLNVNYSKIYKIIVDKK  172
                    P+          LIN T++        + E   + K N  +S+ +++++   
Sbjct  121  ---GAGATPT--------LYLINCTLL-------TSSEELAQRKSNKAFSETFELLI-MD  161

Query  173  FNNSNNNSDNDDDDDDDNIDEEYKILSKKKLSDTLNSTISHLQLQYEMGYQNMKKKIDEK  232
               S++ S        ++             +D     +  +Q   +   Q    + +E+
Sbjct  162  HTGSDSGSTRPTSGLSNSASSLSIGSLSSNPTDARVQRLRMIQAHQQARLQEEIVETNER  221

Query  233  IKKFVAEQYEFLDEFKERGYREYCLLAKKV  262
            I+++   Q++ L+ F+E+  ++  LL K +
Sbjct  222  IERYTRTQFQLLNSFREKSDQDCALLFKVI  251



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


Query= XP_034933593.1 mucin-3A-like isoform X7 [Chelonus insularis]

Length=2213


***** No hits found *****



Lambda      K        H
   0.317    0.127    0.377 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6460962052


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933594.1 uncharacterized protein LOC118063619 [Chelonus
insularis]

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54H25_DICDI  unnamed protein product                                 31.6    1.9  


>Q54H25_DICDI unnamed protein product
Length=2417

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (62%), Gaps = 5/52 (10%)

Query  151   KQNVFKISADY--INKYMDQVNTNELWKTSKHLKLDS--KHIGILATSYFKV  198
             K N+F +  D+  INKY+D+ N NEL  T+ +L + +  K I I A+ YF V
Sbjct  2159  KSNLFSLLIDFCIINKYIDKCNPNELTNTTSNLTIGNWVKLIEI-ASRYFSV  2209



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933595.1 paired box pox-neuro protein isoform X1 [Chelonus
insularis]

Length=419
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   225     2e-69
D1YSG9_DROME  unnamed protein product                                 186     1e-53
Q8IM96_DROME  unnamed protein product                                 189     1e-53


>POXN_DROME unnamed protein product
Length=425

 Score = 225 bits (574),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  30   MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  89
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  90   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  149
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  150  PQSLPSVSSVNRILRGGGLHTD  171
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.095, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  377  RKRNPYSIEELLKKDENEV  395
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  32   HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  91
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  92   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  151
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  152  SLPSVSSVNRILR  164
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  34   GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  93
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  94   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  153
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  154  PSVSSVNRILR  164
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933596.1 paired box pox-neuro protein isoform X2 [Chelonus
insularis]

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   232     6e-72
D1YSG9_DROME  unnamed protein product                                 188     1e-54
Q8IM96_DROME  unnamed protein product                                 191     2e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 232 bits (591),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)

Query  30   MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  89
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  90   FYETGSIRPGSIGGSKTKQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSLP  149
            FYETGSIRPGSIGGSKTKQVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CDP S+P
Sbjct  61   FYETGSIRPGSIGGSKTKQVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCDPSSVP  120

Query  150  SVSSVNRILRGGGLHTD  166
            S+SS+NRILR  GL TD
Sbjct  121  SISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  372  RKRNPYSIEELLKKDENEV  390
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 102/128 (80%), Gaps = 1/128 (1%)

Query  32   HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  91
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  92   ETGSIRPGSIGGSKTKQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSLPSV  151
            ETGS + G IGGSK K VATP VV  I   K+E PTMFAWEIR++L  +  C   ++PSV
Sbjct  77   ETGSFKAGVIGGSKPK-VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSV  135

Query  152  SSVNRILR  159
            SS+NRI+R
Sbjct  136  SSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 101/126 (80%), Gaps = 1/126 (1%)

Query  34   GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  93
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  94   GSIRPGSIGGSKTKQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSLPSVSS  153
            GS + G IGGSK K VATP VV  I   K+E PTMFAWEIR++L  +  C   ++PSVSS
Sbjct  235  GSFKAGVIGGSKPK-VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNVPSVSS  293

Query  154  VNRILR  159
            +NRI+R
Sbjct  294  INRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933597.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933598.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933599.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933600.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933601.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933602.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933603.1 mucin-3A-like isoform X8 [Chelonus insularis]

Length=2210


***** No hits found *****



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933604.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933605.1 paired box pox-neuro protein isoform X3 [Chelonus
insularis]

Length=390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

POXN_DROME  unnamed protein product                                   226     5e-70
D1YSG9_DROME  unnamed protein product                                 186     4e-54
Q8IM96_DROME  unnamed protein product                                 189     6e-54


>POXN_DROME unnamed protein product
Length=425

 Score = 226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 125/142 (88%), Gaps = 5/142 (4%)

Query  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTR  60
            MPHTGQAGVNQLGGVFVNGRPLPDCVR+RIV LAL GVRPCDISRQLLVSHGCVSKILTR
Sbjct  1    MPHTGQAGVNQLGGVFVNGRPLPDCVRRRIVDLALCGVRPCDISRQLLVSHGCVSKILTR  60

Query  61   FYETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACD  120
            FYETGSIRPGSIGGSKTK     QVATPTVVKKI+R+K+E   MFAWEIREQL +Q  CD
Sbjct  61   FYETGSIRPGSIGGSKTK-----QVATPTVVKKIIRLKEENSGMFAWEIREQLQQQRVCD  115

Query  121  PQSLPSVSSVNRILRGGGLHTD  142
            P S+PS+SS+NRILR  GL TD
Sbjct  116  PSSVPSISSINRILRNSGLWTD  137


 Score = 35.0 bits (79),  Expect = 0.088, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 16/19 (84%), Gaps = 0/19 (0%)

Query  348  RKRNPYSIEELLKKDENEV  366
            RKRNPYSIEELLKK E  +
Sbjct  355  RKRNPYSIEELLKKPEKRL  373


>D1YSG9_DROME unnamed protein product
Length=491

 Score = 186 bits (473),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 6/133 (5%)

Query  3    HTGQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFY  62
            +T   GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+Y
Sbjct  17   YTCHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYY  76

Query  63   ETGSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQ  122
            ETGS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   
Sbjct  77   ETGSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQD  130

Query  123  SLPSVSSVNRILR  135
            ++PSVSS+NRI+R
Sbjct  131  NVPSVSSINRIVR  143


>Q8IM96_DROME unnamed protein product
Length=647

 Score = 189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 101/131 (77%), Gaps = 6/131 (5%)

Query  5    GQAGVNQLGGVFVNGRPLPDCVRQRIVQLALVGVRPCDISRQLLVSHGCVSKILTRFYET  64
            G  GVNQLGGVFVNGRPLPD VRQRIV+LA  GVRPCDISRQL VSHGCVSKIL+R+YET
Sbjct  175  GHGGVNQLGGVFVNGRPLPDVVRQRIVELAHNGVRPCDISRQLRVSHGCVSKILSRYYET  234

Query  65   GSIRPGSIGGSKTKKCIFQQVATPTVVKKILRMKQEQPTMFAWEIREQLARQGACDPQSL  124
            GS + G IGGSK K      VATP VV  I   K+E PTMFAWEIR++L  +  C   ++
Sbjct  235  GSFKAGVIGGSKPK------VATPPVVDAIANYKRENPTMFAWEIRDRLLAEAICSQDNV  288

Query  125  PSVSSVNRILR  135
            PSVSS+NRI+R
Sbjct  289  PSVSSINRIVR  299



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933606.1 protein Wnt-2-like isoform X1 [Chelonus insularis]

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WNT2_DROME  unnamed protein product                                   351     2e-119
WNTG_DROME  unnamed protein product                                   256     7e-81 
WNT2_CAEEL  unnamed protein product                                   247     1e-78 


>WNT2_DROME unnamed protein product
Length=352

 Score = 351 bits (900),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 198/399 (50%), Positives = 246/399 (62%), Gaps = 60/399 (15%)

Query  13   LIIIGLIQGPHQTRVVGAVVVGAAVCGRIPGLAKNQREQCRKMPHAMPAVGEGAELGLRE  72
            LI I  I    + R+V +      +CGRIPGL   QR  CR+MP A+ A+GEG +LG +E
Sbjct  9    LIYILWIM---EIRLVSSFT-SVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQE  64

Query  73   CRHQFRHHRWNCSHVAHDRVFGHVVVVGSREAAFTYAISSAGVTYAVTAACSRGNITACG  132
            C+HQFR HRWNCS V    VF HV+   SREAA+TYAI+SAG  YAVTAAC+RGNI+ CG
Sbjct  65   CQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCG  124

Query  133  CE---PAVRTRKALPPNGWEWGGCSADVTYGMRFARRFLDAREVEGDARSLMNLHNNKAG  189
            C+    A  T    P   W+WGGCSADV +GMR+ARRF+DARE+E D+R+LMNLHNN+AG
Sbjct  125  CDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAG  184

Query  190  RKIVKAMLQTECKCHGVSGSCTVRTCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPA  249
            R +VK ML+T+CKCHGVSGSC ++TCW++LP FR +GD LM KY +A+ V A+       
Sbjct  185  RTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAV-------  237

Query  250  IIQSTDYMDQSSIEVVPIVGNDAKTQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLS  309
                                     +GK                   R L LVL R K +
Sbjct  238  -------------------------KGK-------------------RGLRLVLSRKKHA  253

Query  310  GGVGINQKRI--PKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSKGTDGCDLMCCG  367
            G     +  +  PKR EL++L+ SPNYCE  L  GS GT GR+C RT  G   CDL+CCG
Sbjct  254  GTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCG  313

Query  368  RGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTCK  406
            RG+NT    R+ QCRC+F WCC V CD C E  EE+TCK
Sbjct  314  RGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK  352


>WNTG_DROME unnamed protein product
Length=468

 Score = 256 bits (654),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 155/408 (38%), Positives = 207/408 (51%), Gaps = 50/408 (12%)

Query  44   LAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDR---VFGHVVVVG  100
            L + QR   R  P  + A+ +GA L + EC+HQFR+ RWNCS     R   +FG +V  G
Sbjct  64   LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRG  123

Query  101  SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPN---------GWEWG  151
             RE +F YAI+SA VT+++  ACS G I +C C+ + ++R     +          WEWG
Sbjct  124  CRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWG  183

Query  152  GCSADVTYGMRFARRFLDAREVEGDARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCT  211
            GCS ++ +G +F+R F+D  E   + R  MNLHNN+AGR  V+A ++ ECKCHG+SGSCT
Sbjct  184  GCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCT  243

Query  212  VRTCWRTLPSFRQIGDALMKKYYRA---------RPVIAITPPSSPA------------I  250
            V+TCW  L +FR IGD L  ++  A         R   A+ P S  A            I
Sbjct  244  VKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLII  303

Query  251  IQS------------TDYMDQSSIEVV-PIVGNDAKTQGKPNEVNVRTDRRTLKKFSSAR  297
             QS             D+M    +E   PI          PN +     R         R
Sbjct  304  PQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGR  363

Query  298  KLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSKG  357
            K +    R          + + P   +LV+L+PSP++CE +L  G LGT GR CN TS G
Sbjct  364  KHN----RYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLG  419

Query  358  TDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTC  405
             DGC LMCCGRGY   +     +C C FHWCC V C  C  +   YTC
Sbjct  420  VDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC  467


>WNT2_CAEEL unnamed protein product
Length=360

 Score = 247 bits (630),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/373 (38%), Positives = 190/373 (51%), Gaps = 67/373 (18%)

Query  41   IPGLAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDRVFGHVVVVG  100
            +PGL+  Q + C      MPAV  GA+  ++EC+ QF  HRWNCS      + G +  + 
Sbjct  48   LPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMA  107

Query  101  SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPNGWEWGGCSADVTYG  160
            +REAAFTYAI SAGVT+ +   C +G +T+CGC    + +    P  W WGGC  +V YG
Sbjct  108  TREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNV--PTDWSWGGCGDNVEYG  165

Query  161  MRFARRFLDAREVEGD-------ARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCTVR  213
             +F+R F+D RE E D        RSLMN  NN+AGRKI+K   + +CKCHGVSG+C ++
Sbjct  166  YKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMK  225

Query  214  TCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPAIIQSTDYMDQSSIEVVPIVGNDAK  273
            TCW  LPS  Q+G  L  KY +A  V                  D+ +++++        
Sbjct  226  TCWMQLPSMEQVGKILRNKYDKAIRV---------------QINDRGNLQLL--------  262

Query  274  TQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPN  333
                        D  T ++ + A    LV                         +  SP+
Sbjct  263  -----------ADEATKERKTRALPTDLVF------------------------MDDSPD  287

Query  334  YCEPDLTMGSLGTQGRSCNRTSKGTDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHC  393
            YC  D   G+LGT+GR C R S G +GCD +CCGRGYNT+      +C CKF WCC+V C
Sbjct  288  YCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVC  347

Query  394  DTCTERTEEYTCK  406
             TC   T+   CK
Sbjct  348  QTCNNVTQVDICK  360



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933607.1 protein Wnt-2-like isoform X2 [Chelonus insularis]

Length=404
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WNT2_DROME  unnamed protein product                                   344     1e-116
WNTG_DROME  unnamed protein product                                   249     4e-78 
WNT2_CAEEL  unnamed protein product                                   240     4e-76 


>WNT2_DROME unnamed protein product
Length=352

 Score = 344 bits (882),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 197/399 (49%), Positives = 245/399 (61%), Gaps = 62/399 (16%)

Query  13   LIIIGLIQGPHQTRVVGAVVVGAAVCGRIPGLAKNQREQCRKMPHAMPAVGEGAELGLRE  72
            LI I  I    + R+V +      +CGRIPGL   QR  CR+MP A+ A+GEG +LG +E
Sbjct  9    LIYILWIM---EIRLVSSFT-SVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQE  64

Query  73   CRHQFRHHRWNCSHVAHDRVFGHVVVVGSREAAFTYAISSAGVTYAVTAACSRGNITACG  132
            C+HQFR HRWNCS V    VF HV+   SREAA+TYAI+SAG  YAVTAAC+RGNI+ CG
Sbjct  65   CQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCG  124

Query  133  CE---PAVRTRKALPPNGWEWGGCSADVTYGMRFARRFLDAREVEGDARSLMNLHNNKAG  189
            C+    A  T    P   W+WGGCSADV +GMR+ARRF+DARE+E D+R+LMNLHNN+AG
Sbjct  125  CDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAG  184

Query  190  RKIVKAMLQTECKCHGVSGSCTVRTCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPA  249
            R +VK ML+T+CKCHGVSGSC ++TCW++LP FR +GD LM KY +A+ V A+       
Sbjct  185  RTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAV-------  237

Query  250  IIQSTDYMDQSSIEVVPIVGNDAKTQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLS  309
                                     +GK                   R L LVL R K +
Sbjct  238  -------------------------KGK-------------------RGLRLVLSRKKHA  253

Query  310  GGVGINQKRI--PKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSK--DGCDLMCCG  365
            G     +  +  PKR EL++L+ SPNYCE  L  GS GT GR+C RT      CDL+CCG
Sbjct  254  GTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCG  313

Query  366  RGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTCK  404
            RG+NT    R+ QCRC+F WCC V CD C E  EE+TCK
Sbjct  314  RGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK  352


>WNTG_DROME unnamed protein product
Length=468

 Score = 249 bits (635),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 154/408 (38%), Positives = 206/408 (50%), Gaps = 52/408 (13%)

Query  44   LAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDR---VFGHVVVVG  100
            L + QR   R  P  + A+ +GA L + EC+HQFR+ RWNCS     R   +FG +V  G
Sbjct  64   LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRG  123

Query  101  SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPN---------GWEWG  151
             RE +F YAI+SA VT+++  ACS G I +C C+ + ++R     +          WEWG
Sbjct  124  CRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWG  183

Query  152  GCSADVTYGMRFARRFLDAREVEGDARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCT  211
            GCS ++ +G +F+R F+D  E   + R  MNLHNN+AGR  V+A ++ ECKCHG+SGSCT
Sbjct  184  GCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCT  243

Query  212  VRTCWRTLPSFRQIGDALMKKYYRA---------RPVIAITPPSSPA------------I  250
            V+TCW  L +FR IGD L  ++  A         R   A+ P S  A            I
Sbjct  244  VKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLII  303

Query  251  IQS------------TDYMDQSSIEVV-PIVGNDAKTQGKPNEVNVRTDRRTLKKFSSAR  297
             QS             D+M    +E   PI          PN +     R         R
Sbjct  304  PQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGR  363

Query  298  KLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSK-  356
            K +    R          + + P   +LV+L+PSP++CE +L  G LGT GR CN TS  
Sbjct  364  KHN----RYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLG  419

Query  357  -DGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTC  403
             DGC LMCCGRGY   +     +C C FHWCC V C  C  +   YTC
Sbjct  420  VDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC  467


>WNT2_CAEEL unnamed protein product
Length=360

 Score = 240 bits (613),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 139/373 (37%), Positives = 189/373 (51%), Gaps = 69/373 (18%)

Query  41   IPGLAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDRVFGHVVVVG  100
            +PGL+  Q + C      MPAV  GA+  ++EC+ QF  HRWNCS      + G +  + 
Sbjct  48   LPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMA  107

Query  101  SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPNGWEWGGCSADVTYG  160
            +REAAFTYAI SAGVT+ +   C +G +T+CGC    + +    P  W WGGC  +V YG
Sbjct  108  TREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNV--PTDWSWGGCGDNVEYG  165

Query  161  MRFARRFLDAREVEGD-------ARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCTVR  213
             +F+R F+D RE E D        RSLMN  NN+AGRKI+K   + +CKCHGVSG+C ++
Sbjct  166  YKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMK  225

Query  214  TCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPAIIQSTDYMDQSSIEVVPIVGNDAK  273
            TCW  LPS  Q+G  L  KY +A  V                  D+ +++++        
Sbjct  226  TCWMQLPSMEQVGKILRNKYDKAIRV---------------QINDRGNLQLL--------  262

Query  274  TQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPN  333
                        D  T ++ + A    LV                         +  SP+
Sbjct  263  -----------ADEATKERKTRALPTDLVF------------------------MDDSPD  287

Query  334  YCEPDLTMGSLGTQGRSCNRTS--KDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHC  391
            YC  D   G+LGT+GR C R S   +GCD +CCGRGYNT+      +C CKF WCC+V C
Sbjct  288  YCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVC  347

Query  392  DTCTERTEEYTCK  404
             TC   T+   CK
Sbjct  348  QTCNNVTQVDICK  360



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933608.1 protein Wnt-2-like isoform X3 [Chelonus insularis]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WNT2_DROME  unnamed protein product                                   355     4e-121
WNTG_DROME  unnamed protein product                                   256     9e-81 
WNT2_CAEEL  unnamed protein product                                   246     2e-78 


>WNT2_DROME unnamed protein product
Length=352

 Score = 355 bits (911),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 196/398 (49%), Positives = 249/398 (63%), Gaps = 57/398 (14%)

Query  10   KIGIFMIQKLFLRVVGAVVVGAAVCGRIPGLAKNQREQCRKMPHAMPAVGEGAELGLREC  69
            K+ I+++  + +R+V +      +CGRIPGL   QR  CR+MP A+ A+GEG +LG +EC
Sbjct  7    KLLIYILWIMEIRLVSSFT-SVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQEC  65

Query  70   RHQFRHHRWNCSHVAHDRVFGHVVVVGSREAAFTYAISSAGVTYAVTAACSRGNITACGC  129
            +HQFR HRWNCS V    VF HV+   SREAA+TYAI+SAG  YAVTAAC+RGNI+ CGC
Sbjct  66   QHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGC  125

Query  130  E---PAVRTRKALPPNGWEWGGCSADVTYGMRFARRFLDAREVEGDARSLMNLHNNKAGR  186
            +    A  T    P   W+WGGCSADV +GMR+ARRF+DARE+E D+R+LMNLHNN+AGR
Sbjct  126  DVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAGR  185

Query  187  KIVKAMLQTECKCHGVSGSCTVRTCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPAI  246
             +VK ML+T+CKCHGVSGSC ++TCW++LP FR +GD LM KY +A+ V A+        
Sbjct  186  TLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAV--------  237

Query  247  IQSTDYMDQSSIEVVPIVGNDAKTQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLSG  306
                                    +GK                   R L LVL R K +G
Sbjct  238  ------------------------KGK-------------------RGLRLVLSRKKHAG  254

Query  307  GVGINQKRI--PKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSKGTDGCDLMCCGR  364
                 +  +  PKR EL++L+ SPNYCE  L  GS GT GR+C RT  G   CDL+CCGR
Sbjct  255  TARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGR  314

Query  365  GYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTCK  402
            G+NT    R+ QCRC+F WCC V CD C E  EE+TCK
Sbjct  315  GHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK  352


>WNTG_DROME unnamed protein product
Length=468

 Score = 256 bits (653),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 155/408 (38%), Positives = 207/408 (51%), Gaps = 50/408 (12%)

Query  40   LAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDR---VFGHVVVVG  96
            L + QR   R  P  + A+ +GA L + EC+HQFR+ RWNCS     R   +FG +V  G
Sbjct  64   LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRG  123

Query  97   SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPN---------GWEWG  147
             RE +F YAI+SA VT+++  ACS G I +C C+ + ++R     +          WEWG
Sbjct  124  CRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWG  183

Query  148  GCSADVTYGMRFARRFLDAREVEGDARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCT  207
            GCS ++ +G +F+R F+D  E   + R  MNLHNN+AGR  V+A ++ ECKCHG+SGSCT
Sbjct  184  GCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCT  243

Query  208  VRTCWRTLPSFRQIGDALMKKYYRA---------RPVIAITPPSSPA------------I  246
            V+TCW  L +FR IGD L  ++  A         R   A+ P S  A            I
Sbjct  244  VKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLII  303

Query  247  IQS------------TDYMDQSSIEVV-PIVGNDAKTQGKPNEVNVRTDRRTLKKFSSAR  293
             QS             D+M    +E   PI          PN +     R         R
Sbjct  304  PQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGR  363

Query  294  KLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSKG  353
            K +    R          + + P   +LV+L+PSP++CE +L  G LGT GR CN TS G
Sbjct  364  KHN----RYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLG  419

Query  354  TDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTC  401
             DGC LMCCGRGY   +     +C C FHWCC V C  C  +   YTC
Sbjct  420  VDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC  467


>WNT2_CAEEL unnamed protein product
Length=360

 Score = 246 bits (629),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/373 (38%), Positives = 190/373 (51%), Gaps = 67/373 (18%)

Query  37   IPGLAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDRVFGHVVVVG  96
            +PGL+  Q + C      MPAV  GA+  ++EC+ QF  HRWNCS      + G +  + 
Sbjct  48   LPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMA  107

Query  97   SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPNGWEWGGCSADVTYG  156
            +REAAFTYAI SAGVT+ +   C +G +T+CGC    + +    P  W WGGC  +V YG
Sbjct  108  TREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNV--PTDWSWGGCGDNVEYG  165

Query  157  MRFARRFLDAREVEGD-------ARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCTVR  209
             +F+R F+D RE E D        RSLMN  NN+AGRKI+K   + +CKCHGVSG+C ++
Sbjct  166  YKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMK  225

Query  210  TCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPAIIQSTDYMDQSSIEVVPIVGNDAK  269
            TCW  LPS  Q+G  L  KY +A  V                  D+ +++++        
Sbjct  226  TCWMQLPSMEQVGKILRNKYDKAIRV---------------QINDRGNLQLL--------  262

Query  270  TQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPN  329
                        D  T ++ + A    LV                         +  SP+
Sbjct  263  -----------ADEATKERKTRALPTDLVF------------------------MDDSPD  287

Query  330  YCEPDLTMGSLGTQGRSCNRTSKGTDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHC  389
            YC  D   G+LGT+GR C R S G +GCD +CCGRGYNT+      +C CKF WCC+V C
Sbjct  288  YCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVC  347

Query  390  DTCTERTEEYTCK  402
             TC   T+   CK
Sbjct  348  QTCNNVTQVDICK  360



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933609.1 protein Wnt-2-like isoform X4 [Chelonus insularis]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WNT2_DROME  unnamed protein product                                   338     1e-114
WNTG_DROME  unnamed protein product                                   245     1e-76 
WNT2_CAEEL  unnamed protein product                                   236     2e-74 


>WNT2_DROME unnamed protein product
Length=352

 Score = 338 bits (868),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 195/399 (49%), Positives = 242/399 (61%), Gaps = 64/399 (16%)

Query  13   LIIIGLIQGPHQTRVVGAVVVGAAVCGRIPGLAKNQREQCRKMPHAMPAVGEGAELGLRE  72
            LI I  I    + R+V +      +CGRIPGL   QR  CR+MP A+ A+GEG +LG +E
Sbjct  9    LIYILWIM---EIRLVSSFT-SVMLCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQE  64

Query  73   CRHQFRHHRWNCSHVAHDRVFGHVVVVGSREAAFTYAISSAGVTYAVTAACSRGNITACG  132
            C+HQFR HRWNCS V    VF HV+   SREAA+TYAI+SAG  YAVTAAC+RGNI+ CG
Sbjct  65   CQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCG  124

Query  133  CE---PAVRTRKALPPNGWEWGGCSADVTYGM----RFLDAREVEGDARSLMNLHNNKAG  185
            C+    A  T    P   W+WGGCSADV +GM    RF+DARE+E D+R+LMNLHNN+AG
Sbjct  125  CDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSRTLMNLHNNRAG  184

Query  186  RKIVKAMLQTECKCHGVSGSCTVRTCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPA  245
            R +VK ML+T+CKCHGVSGSC ++TCW++LP FR +GD LM KY +A+ V A+       
Sbjct  185  RTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAV-------  237

Query  246  IIQSTDYMDQSSIEVVPIVGNDAKTQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLS  305
                                     +GK                   R L LVL R K +
Sbjct  238  -------------------------KGK-------------------RGLRLVLSRKKHA  253

Query  306  GGVGINQKRI--PKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSKGTDGCDLMCCG  363
            G     +  +  PKR EL++L+ SPNYCE  L  GS GT GR+C RT  G   CDL+CCG
Sbjct  254  GTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCG  313

Query  364  RGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTCK  402
            RG+NT    R+ QCRC+F WCC V CD C E  EE+TCK
Sbjct  314  RGHNTQHIRRTTQCRCQFRWCCEVKCDECDESYEEFTCK  352


>WNTG_DROME unnamed protein product
Length=468

 Score = 245 bits (625),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 153/408 (38%), Positives = 204/408 (50%), Gaps = 54/408 (13%)

Query  44   LAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDR---VFGHVVVVG  100
            L + QR   R  P  + A+ +GA L + EC+HQFR+ RWNCS     R   +FG +V  G
Sbjct  64   LRRKQRRLVRDNPGVLGALVKGANLAISECQHQFRNRRWNCSTRNFSRGKNLFGKIVDRG  123

Query  101  SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPN---------GWEWG  151
             RE +F YAI+SA VT+++  ACS G I +C C+ + ++R     +          WEWG
Sbjct  124  CRETSFIYAITSAAVTHSIARACSEGTIESCTCDYSHQSRSPQANHQAGSVAGVRDWEWG  183

Query  152  GCSADVTYGMRF----LDAREVEGDARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCT  207
            GCS ++ +G +F    +D  E   + R  MNLHNN+AGR  V+A ++ ECKCHG+SGSCT
Sbjct  184  GCSDNIGFGFKFSREFVDTGERGRNLREKMNLHNNEAGRAHVQAEMRQECKCHGMSGSCT  243

Query  208  VRTCWRTLPSFRQIGDALMKKYYRA---------RPVIAITPPSSPA------------I  246
            V+TCW  L +FR IGD L  ++  A         R   A+ P S  A            I
Sbjct  244  VKTCWMRLANFRVIGDNLKARFDGATRVQVTNSLRATNALAPVSPNAAGSNSVGSNGLII  303

Query  247  IQS------------TDYMDQSSIEVV-PIVGNDAKTQGKPNEVNVRTDRRTLKKFSSAR  293
             QS             D+M    +E   PI          PN +     R         R
Sbjct  304  PQSGLVYGEEEERMLNDHMPDILLENSHPISKIHHPNMPSPNSLPQAGQRGGRNGRRQGR  363

Query  294  KLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPNYCEPDLTMGSLGTQGRSCNRTSKG  353
            K +    R          + + P   +LV+L+PSP++CE +L  G LGT GR CN TS G
Sbjct  364  KHN----RYHFQLNPHNPEHKPPGSKDLVYLEPSPSFCEKNLRQGILGTHGRQCNETSLG  419

Query  354  TDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHCDTCTERTEEYTC  401
             DGC LMCCGRGY   +     +C C FHWCC V C  C  +   YTC
Sbjct  420  VDGCGLMCCGRGYRRDEVVVVERCACTFHWCCEVKCKLCRTKKVIYTC  467


>WNT2_CAEEL unnamed protein product
Length=360

 Score = 236 bits (602),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/373 (37%), Positives = 187/373 (50%), Gaps = 71/373 (19%)

Query  41   IPGLAKNQREQCRKMPHAMPAVGEGAELGLRECRHQFRHHRWNCSHVAHDRVFGHVVVVG  100
            +PGL+  Q + C      MPAV  GA+  ++EC+ QF  HRWNCS      + G +  + 
Sbjct  48   LPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMA  107

Query  101  SREAAFTYAISSAGVTYAVTAACSRGNITACGCEPAVRTRKALPPNGWEWGGCSADVTYG  160
            +REAAFTYAI SAGVT+ +   C +G +T+CGC    + +    P  W WGGC  +V YG
Sbjct  108  TREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNV--PTDWSWGGCGDNVEYG  165

Query  161  MR----FLDAREVEGD-------ARSLMNLHNNKAGRKIVKAMLQTECKCHGVSGSCTVR  209
             +    F+D RE E D        RSLMN  NN+AGRKI+K   + +CKCHGVSG+C ++
Sbjct  166  YKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMK  225

Query  210  TCWRTLPSFRQIGDALMKKYYRARPVIAITPPSSPAIIQSTDYMDQSSIEVVPIVGNDAK  269
            TCW  LPS  Q+G  L  KY +A  V                  D+ +++++        
Sbjct  226  TCWMQLPSMEQVGKILRNKYDKAIRV---------------QINDRGNLQLL--------  262

Query  270  TQGKPNEVNVRTDRRTLKKFSSARKLHLVLKRAKLSGGVGINQKRIPKRSELVFLQPSPN  329
                        D  T ++ + A    LV                         +  SP+
Sbjct  263  -----------ADEATKERKTRALPTDLVF------------------------MDDSPD  287

Query  330  YCEPDLTMGSLGTQGRSCNRTSKGTDGCDLMCCGRGYNTHQYTRSWQCRCKFHWCCRVHC  389
            YC  D   G+LGT+GR C R S G +GCD +CCGRGYNT+      +C CKF WCC+V C
Sbjct  288  YCRFDRHSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVC  347

Query  390  DTCTERTEEYTCK  402
             TC   T+   CK
Sbjct  348  QTCNNVTQVDICK  360



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933610.1 N-acetylglucosamine-6-phosphate deacetylase [Chelonus
insularis]

Length=397
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IHR4_PLAF7  unnamed protein product                                 31.6    1.3  
O97224_PLAF7  unnamed protein product                                 30.0    3.6  
Q57YY1_TRYB2  unnamed protein product                                 29.3    6.0  


>Q8IHR4_PLAF7 unnamed protein product
Length=837

 Score = 31.6 bits (70),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query  337  ADCSIVEALE-AATLHPA--RALGIESKKGTLDFGADADFLILNDHLDI  382
            AD S  +AL+ A  + P   R +G+ +K   +D GADA  ++LND +++
Sbjct  185  ADMSTSDALQIARKVDPKGLRTIGVITKIDLMDKGADASKMLLNDEINL  233


>O97224_PLAF7 unnamed protein product
Length=616

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 15/63 (24%), Positives = 32/63 (51%), Gaps = 1/63 (2%)

Query  65   NGGYGVDFSYNVDNVEEGVNKVAKELLSHGVTSFCPTLVTSPV-NSYHKILPRIKKQKGG  123
            NG +  +  Y ++N+E  + ++ K+L+S    +  P      + N Y+ IL  ++ QK  
Sbjct  349  NGTFKTNAEYQLNNIEREIFQINKKLISTNFNTLTPINHDQALSNKYNDILINLEYQKLS  408

Query  124  IHG  126
            ++ 
Sbjct  409  LYS  411


>Q57YY1_TRYB2 unnamed protein product
Length=469

 Score = 29.3 bits (64),  Expect = 6.0, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 0/51 (0%)

Query  289  ALGLTEGIHRLGQADIEIKSGRAYIANTNTLCGSTAKMSECVKFFKKAADC  339
            +LG  E + R G +   +K+G   + + +  CGSTA  S     F K  D 
Sbjct  61   SLGSLEVMWRFGASSTGLKAGSPLVGSASRRCGSTATPSRRRSGFFKMGDM  111



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933611.1 eukaryotic translation initiation factor 3 subunit M
[Chelonus insularis]

Length=392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIF3M_DROME  unnamed protein product                                  521     0.0  
EIF3M_CAEEL  unnamed protein product                                  129     8e-34
CSN7_DICDI  unnamed protein product                                   54.3    4e-08


>EIF3M_DROME unnamed protein product
Length=387

 Score = 521 bits (1343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/381 (65%), Positives = 311/381 (82%), Gaps = 2/381 (1%)

Query  1    MTVPAVFMDLPPEDQAQELRIYFKSLGAEISDEKSPRGIEDDLHKIIGVCDACFKEGNEV  60
            MT   VF+DL  ++Q QELR YFK LGAEIS EKS +G+EDDLHKIIGVCD CFK+G   
Sbjct  1    MTSHPVFIDLSLDEQVQELRKYFKKLGAEISSEKSNKGVEDDLHKIIGVCDVCFKDGEPS  60

Query  61   EIENILNDIVSILIHIPVERAENLILVFCDKLKKAPGQKLGLVCLKALWLLFQSLEEKSP  120
            +I+ ILN IVSI+I IP++R EN++L +C+K+ KAP   LG VCL++LW LF +L+  SP
Sbjct  61   QIDGILNSIVSIMITIPLDRGENIVLAYCEKMTKAPNLPLGKVCLQSLWRLFNNLDTASP  120

Query  121  MRYHVYYHLVQVARNVGQVHAVYSGVEQLKEQFKAFPPNNEQMQKLLRLLHEILLSCKQG  180
            +RYHVYYHLVQVA+   QV  V+SGV+QLK QF   PP++EQMQKL RLLH++       
Sbjct  121  LRYHVYYHLVQVAKQCEQVLEVFSGVDQLKSQFANCPPSSEQMQKLYRLLHDVTKDTNL-  179

Query  181  DRAAAVMVELLGTYTAENASEAREDAQHCIQAALADPNTFLLDPLLALKPVKFLEGENIH  240
            + ++ VM+ELLGTYTA+NA  AREDA  CI  ALADPNTFLLDPLL+LKPV+FLEG+ IH
Sbjct  180  ELSSKVMIELLGTYTADNACVAREDAMKCIVTALADPNTFLLDPLLSLKPVRFLEGDLIH  239

Query  241  DLLFIFVQEKLPAYIKFYKEHKDYVEHTVGLNHEQNMKKMRLLTFMQLAETNPEMSFETI  300
            DLL IFV EKLPAY++FY++H+++V ++ GLNHEQNMKKMRLLTFMQLAE++PEM+FET+
Sbjct  240  DLLSIFVSEKLPAYVQFYEDHREFV-NSQGLNHEQNMKKMRLLTFMQLAESSPEMTFETL  298

Query  301  QNELQIEEKDVESFIIDVLKTKLVRARMDQANKKVLISSTMHRTFGRPQWMQLRDLLAAW  360
              ELQI E +VE F+I+VLKTKLVRAR+DQAN+KV ISSTMHRTFG PQW QLRDLL AW
Sbjct  299  TKELQINEDEVEPFVIEVLKTKLVRARLDQANQKVHISSTMHRTFGAPQWEQLRDLLQAW  358

Query  361  KTNLSSVQDGMKSVADAQMEM  381
            K NLS+V++G+ SV+ AQ+++
Sbjct  359  KENLSTVREGLTSVSSAQLDL  379


>EIF3M_CAEEL unnamed protein product
Length=390

 Score = 129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 98/377 (26%), Positives = 185/377 (49%), Gaps = 10/377 (3%)

Query  6    VFMDLPPEDQAQELRIYFKSLGAEISDEKSPRGIEDDLHKIIGVCDACFKEGNEVEIENI  65
            VF  +    Q QELR Y     +   D   P     ++ +I    +       +V++  +
Sbjct  9    VFAYIDDVKQLQELRQYLNKHDSVKLDPNGPSETAQNMIEICSTLNVLPSWSQDVDL--V  66

Query  66   LNDIVSILIHIPVERAENLILVFCDKLKKAPGQKLGL-----VCLKALWLLFQSLEEKSP  120
            LN I S+++ +P E+ E ++  F   +     +  G      + ++ L  L++       
Sbjct  67   LNSISSLIVVVPGEKCEPVVDSFIKNVAPQFYKGTGWASHAGIAVRVLSNLYKGYSNFHT  126

Query  121  MRYHVYYHLVQVARNVGQVHAVYSGVEQLKEQFKAFPPNNEQMQKLLRLLHEILLSCKQG  180
            ++  ++  LV +      +  +   +E L+++F  +    E  +++LR +H  LL  ++ 
Sbjct  127  VQEKIFKALVDMCAEARLIGELECNLETLQDRFNTWKTPVEGQREILRAVHRALLVDQRV  186

Query  181  DRAAAVMVELLGTYTAENASEAREDAQHCIQAALADPNTFLLDPLLALKPVKFLEGEN--  238
            D+AA VM  LLGTYT ++A+ AR+DA  C++ A+ DP +F  D L  L  VK L+  +  
Sbjct  187  DQAAKVMTALLGTYTEKDAAAARDDAMECVRTAVVDPKSFSFDHLERLSAVKALKTSDPL  246

Query  239  IHDLLFIFVQEKLPAYIKFYKEHKDYVEHTVGLNHEQNMKKMRLLTFMQLAETNPEMSFE  298
            +   L +F+   L  Y +F  ++  +V   + ++    +KK+RLLT M LAE   E+S +
Sbjct  247  MFTALELFISGTLKDYKEFVAKNPKFVTEHLKVDETILLKKIRLLTLMSLAEEKNEISLD  306

Query  299  TIQNELQI-EEKDVESFIIDVLKTKLVRARMDQANKKVLISSTMHRTFGRPQWMQLRDLL  357
             +  +L I  ++ +E F+ID ++   +  ++++  + +++SS  HR FG  QW+ L   L
Sbjct  307  ELAKQLDILADETLEEFVIDAIQVNAISGKINEMARTLIVSSYQHRRFGTEQWVLLEKRL  366

Query  358  AAWKTNLSSVQDGMKSV  374
                 NL    + +  V
Sbjct  367  KVLIANLKQTHNNVHEV  383


>CSN7_DICDI unnamed protein product
Length=259

 Score = 54.3 bits (129),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 83/172 (48%), Gaps = 16/172 (9%)

Query  209  CIQAALADPNTFLLDPLLALKPVKFL---EGENIHDLLFIFVQEKLPAYIKF--YKEHKD  263
             I+ AL  P+ F+   LL +  V+ L   E +N +DLL IF      AY  F  YK  KD
Sbjct  32   IIEKALNHPSVFVFGELLDMPNVQQLKETEFKNYYDLLLIF------AYGSFIDYKNKKD  85

Query  264  YVEHTVGLNHEQNMKKMRLLTFMQLAETNPEMSFETIQNELQIEE-KDVESFIIDVLKTK  322
             +         Q + K++ LT + L+ T+  + +  +Q +++I   +++E  IID +   
Sbjct  86   SLPQLT----PQMITKLKQLTIVFLSSTSNVIPYSVLQEQIEITNVRELEDLIIDSIYQN  141

Query  323  LVRARMDQANKKVLISSTMHRTFGRPQWMQLRDLLAAWKTNLSSVQDGMKSV  374
            +++ ++DQ NK + I  ++ R     Q   + + L  W +    + D +  +
Sbjct  142  IIKGKLDQKNKHLEIDFSIGRDVQPEQLDSMINCLNNWSSTSQKLLDDISGL  193



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


Query= XP_034933612.1 serine-rich adhesin for platelets-like isoform X9
[Chelonus insularis]

Length=1929
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PC41_DROME  unnamed protein product                                 63.9    2e-09
M9PB30_DROME  unnamed protein product                                 63.9    2e-09


>M9PC41_DROME unnamed protein product
Length=22743

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 273/1356 (20%), Positives = 464/1356 (34%), Gaps = 201/1356 (15%)

Query  425   LSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAATSILTIKT  484
             LSS  +  T   + S   T      TT FT E+  +   +  T  P +     + +T ++
Sbjct  4014  LSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSES  4073

Query  485   LPKEKDLDDTLDFRGRKEFKQASYTTSITFSNQNTENLLNDISSTNLSNNRRRGNKLFNK  544
               +E       D          +   SITF            ++TN+     RG      
Sbjct  4074  TTREVYTIKPFDRSTPTPVSPDTTVPSITFE-----------TTTNIPIGTTRG------  4116

Query  545   ASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNERSELPKINKYIYYQDDEVTKIITR  604
                     ++  +  + P E +  +          E S LP                   
Sbjct  4117  --------QVTEQTTSSPSEKRTTIRV--------EESTLPS------------------  4142

Query  605   HLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKL  661
               RSTD+  P    SE+ E P ++ S+S   T S+      +  P T     ST S   L
Sbjct  4143  --RSTDRTTP----SESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASL  4196

Query  662   EEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVT  721
             E     V  E  + + +    G  T        E++ S     R       S  P     
Sbjct  4197  ETTVPSVTLETTTNDPIGSTGGQVT--------EQTTSSPSEVRTTIGLEESTLPSRSTD  4248

Query  722   ISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-  780
              + P         S+S E       + I    + +   +T   P     ++ T  ++ L 
Sbjct  4249  RTTP---------SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLE  4299

Query  781   TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQ  828
             TTV  + LET T  P+            SS +   TT+++  +T  SR+  A     +  
Sbjct  4300  TTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS--ADRTTPSES  4357

Query  829   EPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRV  887
               TP ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T     
Sbjct  4358  PETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETT-----  4412

Query  888   WNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHL  947
               +  I     + T ++  + ++   T R   S+L +    +T+   +  P T T     
Sbjct  4413  -TNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTT--PSESPETPTTLPSD  4469

Query  948   EVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNK---------  998
              +++P +  T  +    V  T  + A   +  S + ++   P+V+LE             
Sbjct  4470  FITRPHSEKT-TESTRDVPTTRPFEASTPSSASLETTV---PSVTLETTTNVPIGSTGGQ  4525

Query  999   ------TNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV---  1049
                   ++ +E    I +  S+  +     + +     T   + S+ ++    + T    
Sbjct  4526  VTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTEST  4585

Query  1050  --APLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGS------------PPRFSARYRG  1095
                P      A  P+ A +   V S  +      P GS            P  F    R 
Sbjct  4586  RDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRV  4645

Query  1096  VE-LFVRKPNDANSTGNASTTSFISSSDEASSPVSISNLGDSKEVTFYR----------A  1144
              E     +  D  +   +  T  I  SD  +   S      +++V   R          +
Sbjct  4646  EESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPAS  4705

Query  1145  LETVSINNEVNQATDEERQQQLNRVAQITNASPGGLRP---------PSGVTPSSINPQG  1195
             LET   +  +   T+        +V + T +SP  +R          PS     +   + 
Sbjct  4706  LETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSES  4765

Query  1196  GRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAIN  1255
                   +  D  +R        ST  +   +     T  +A  ++ V SV + +  + + 
Sbjct  4766  PETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTN-VP  4824

Query  1256  EGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEP  1315
              G  G  ++       ++V+  +            D+     +ESP    ++ S+ +  P
Sbjct  4825  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT--TPSESPETPTTLPSDFITRP  4882

Query  1316  SSSRSPITAR--PINRLLEVFTP-------LLNANQLARDTSITITNDAPTVSTTVGASM  1366
              S ++  + R  P  R  E  TP        + +  L   T++ I +    V+    +S 
Sbjct  4883  HSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSP  4942

Query  1367  TTPTTTTSTTKSTTNSRPVTTTTMTNS--APTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1424
             +   TT    +ST  SR    TT + S   PT + +     P    +T ST    TT  F
Sbjct  4943  SEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPF  5002

Query  1425  TTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQA  1484
                  P   S  TT   +    TL  +   P  I ST   +TE      +++ +    + 
Sbjct  5003  EA-STPSPASLETTVPSV----TLETTTNVP--IGSTGGQVTEQTTSSPSEVRTTIRVEE  5055

Query  1485  G--PTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPF---  1539
                P+RS     PS  SP +   LP+ F       I       + +      TT PF   
Sbjct  5056  STLPSRSADRTTPSE-SPETPTTLPSDF-------ITRTYSDQTTESTRDVPTTRPFEAS  5107

Query  1540  TWKPV---TDVTSITSSKQTEISTKTTTSITSTTTTSTMTPSASQIIFD--TFPTHPP--  1592
             T  P    T V S+TS   T +   +T    +  TT+  +   + I  +  T P+     
Sbjct  5108  TPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDR  5167

Query  1593  TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV-AVRPAPPPTTTQAPLGFGAS  1651
             T  S +  T     +  TT P    TT  T  V T +P  A  P+P    T  P     +
Sbjct  5168  TTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLET  5227

Query  1652  LLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTT  1687
                   G         TT  P +  ++TT+R  ++T
Sbjct  5228  TTNVPIGSTGGQVTEQTTSSPSE--VRTTIRVEEST  5261


 Score = 61.2 bits (147),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 285/1374 (21%), Positives = 484/1374 (35%), Gaps = 231/1374 (17%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  5508  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEFRTTIRVEE  5563

Query  478   SIL----TIKTLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTEN  521
             S L      +T P E     TL  DF  R   +Q + +T          + T S  + E 
Sbjct  5564  STLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  5623

Query  522   LLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNER  581
              +  ++S   +N             I  TG ++ G+    P E +  +          E 
Sbjct  5624  TVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEVRTTIRV--------EE  5664

Query  582   SELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIF  641
             S LP                     RSTD+  P    SE+ E P ++ S+S   T S+  
Sbjct  5665  STLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQT  5700

Query  642   QGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNE---  695
                 +  P T     ST S   LE     V  E  +   +    G  T   +   +E   
Sbjct  5701  TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT  5760

Query  696   ----ESKSLQDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRI  751
                 E  +L  P R       S +P T  T  LP                      T R 
Sbjct  5761  TIGVEESTL--PSRSTDRTSPSESPETPTT--LPS-------------------DFTTRP  5797

Query  752   RQNQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL------------SSR  799
               +Q    T        F  S  +  S  TTV  +  ET T  P+            SS 
Sbjct  5798  HSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSP  5857

Query  800   NIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSIDSHNTSRSVVSKPLTRSRGYTNRN  859
             +   TT+ +  +T  SR+ +     ++ + PT    D      S  +   TR    T R 
Sbjct  5858  SEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVP-TTRP  5916

Query  860   RQISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTY  919
              + ST + ++ ETT  SVT + T       +  I     + T ++    ++   T     
Sbjct  5917  FEASTPSPASLETTVPSVTSETT------TNVPIGSTGGQVTGQTTAPPSEVRTTIGVEE  5970

Query  920   SSLTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTEN  979
             S+L +  T +TS   +  P T T      +++P +  T  +    V  T  + A   +  
Sbjct  5971  STLPSRSTDRTSP--SESPETPTTLPSDFITRPHSEQT-TESTRDVPTTRPFEASTPSPA  6027

Query  980   STQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNA  1039
             S + ++   P+V+ E         T   IG + S             +P   T L +   
Sbjct  6028  SLKTTV---PSVTSEATTNVPIGSTGQRIGTTPSE------------SPETPTTLPSDFT  6072

Query  1040  SLLEQIKSTVA----PLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRG  1095
             +     K+T +    P         P+ A +   V S         P GS        + 
Sbjct  6073  TRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIGS-----TGGQV  6127

Query  1096  VELFVRKPNDANSTGNASTTSFISSSDEASSPVSISNLGDSKEVTFYRALETVSINNEVN  1155
              E     P++  +T     ++  S S + ++P       +S E     +  T   ++E  
Sbjct  6128  TEQTTSSPSEVRTTIRVEESTLPSRSADRTTP------SESPETPTLPSDFTTRPHSE--  6179

Query  1156  QATDEERQQQLNRVAQITNASPGGLRP--PSGVTPSSINPQGGRIIQDIERDKASRTKEA  1213
             Q T+  R     R  + +  SP  L    PS  + ++ N   G     +     +   E 
Sbjct  6180  QTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEV  6239

Query  1214  GGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINS--VASAINEGLPGSSISPLDILPN  1271
                R+T+ + +    +  T+ T+ ++S      + S  +    +E    ++ S  D+   
Sbjct  6240  ---RTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQ---TTESTRDVPTT  6293

Query  1272  NQVQGRVTAPPGFPWKDPLDQIFGITTESPI--IRASVASNTLDEPSSSRSPITARPINR  1329
                +    +P       P       TT  PI      V   T   PS  R+ I      R
Sbjct  6294  RPFEASTPSPASLKTTVP-SVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI------R  6346

Query  1330  LLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVT  1386
             + E   P       +R T  T  +++P   TT+ +  TT   +  TT+ST +   +RP  
Sbjct  6347  VEESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFE  6399

Query  1387  TTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGI-----PKQTS  1434
             T+T        T  + T+ TTT +P  +     T   +   + + TTI +     P +++
Sbjct  6400  TSTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRST  6459

Query  1435  FGTTFDDLAFLNTLLESDY--RPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKA  1492
               T+  +     T L SD+  RP+S  +T  T                      TR  +A
Sbjct  6460  DRTSPSESPETPTTLPSDFITRPHSEKTTEST-----------------RDVPTTRPFEA  6502

Query  1493  IQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITS  1552
               PS+AS         S  + S     +  + +++   +A  TT   + +  T  +  T+
Sbjct  6503  STPSSAS---------SGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTT  6553

Query  1553  SKQTEISTKTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTI  1612
                +E +T++T  + +T      TPS + +          T  +  + +    VT  TT 
Sbjct  6554  RPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTA  6613

Query  1613  PTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKP  1672
             P     TT+  +  T    +     P  + + P     ++L + F      P +  T + 
Sbjct  6614  PPSEVRTTIRVEESTLPSRSTDRTTPSESPETP-----TILPSDFTTR---PHSDQTTES  6665

Query  1673  LKKVIQTTLRPVQ-TTPKPISTTAAREMYAASEQIN-HIDYSNSLVSGSKSTSP  1724
              + V   T RP + +TP+P++   A          N  I  +   V+G  + +P
Sbjct  6666  TRDV--PTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATP  6717


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 315/1447 (22%), Positives = 519/1447 (36%), Gaps = 238/1447 (16%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  4490  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEVRTTIRVEE  4545

Query  478   SILTIK-----TLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTE  520
             S L  +     TL +  +   TL  DF  R   +Q + +T          + T S  + E
Sbjct  4546  STLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLE  4605

Query  521   NLLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNE  580
               +  ++S   +N             I  TG ++ G+    P EF+  +          E
Sbjct  4606  TTVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEFRTTIRV--------E  4646

Query  581   RSELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEI  640
              S LP                     RSTD+  P    SE+ E P ++ S+S   T S+ 
Sbjct  4647  ESTLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQ  4682

Query  641   FQGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEES  697
                  +  P T     ST S   LE     V  E  +   +    G  T        E++
Sbjct  4683  TTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVT--------EQT  4734

Query  698   KSLQDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKE  757
              S     R       S  P      + P         S+S E       + I    ++K 
Sbjct  4735  TSSPSEVRTTIRVEESTLPSRSADRTTP---------SESPETPTTLPSDFITRPHSEKT  4785

Query  758   RITTTGTPDDVFVQSKTAYNSEL-TTVEKIKLETVTIRPL------------SSRNIDTT  804
               +T   P     ++ T  ++ L TTV  + LET T  P+            SS +   T
Sbjct  4786  TESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRT  4845

Query  805   TVKMLSTTRRSRAWNAAYIDKNWQEPT---------PRSIDSHNTSRSV-------VSKP  848
             T+++  +T  SR+ +     ++ + PT         P S  +  ++R V        S P
Sbjct  4846  TIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTP  4905

Query  849   LTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTS  908
              + S   T  +  + TTT     +T   VT + T  P    +    +    P++ +D T+
Sbjct  4906  SSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTT  4965

Query  909   ------TQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRR--HLEVSQPQNSL----  956
                   T  T+ S  T    + + T  T     +RP  A+      LE + P  +L    
Sbjct  4966  PSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTT  5025

Query  957   ------TGKKEVSSVAITP-KYHALIKTENST---QQSIKKEPAVSLE--------LLNK  998
                   TG +       +P +    I+ E ST   + + +  P+ S E         + +
Sbjct  5026  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITR  5085

Query  999   TNANETFNLIGISTSSRGNSGNSDSNIFNPAR---TTYLINSNASLLEQIKSTVAPLLSV  1055
             T +++T      ST     +   +++  +PA    T   + S  +    I ST   +   
Sbjct  5086  TYSDQTTE----STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQ  5141

Query  1056  LGAKAPAFAGVYRNVSSN--ETAAQRVTPSGSPPR-------FSARYRG-------VELF  1099
               A    F    R   S     +  R TPS SP         F+ R           ++ 
Sbjct  5142  TTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVP  5201

Query  1100  VRKPNDANSTGNAS-TTSFISSSDEASSPVSISNLGDSKEVTFYRALETVSINNEVNQAT  1158
               +P +A++   AS  T+  S + E ++ V I + G   +VT     +T S  +EV    
Sbjct  5202  TTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGG--QVT----EQTTSSPSEVRTTI  5255

Query  1159  DEERQQQLNRVAQITNASPGGLRP--PSGVTPSSINPQGGRIIQDIERDK---ASRTKEA  1213
               E     +R A  T  S     P  PS  T    + Q     +D+   +   AS    A
Sbjct  5256  RVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPA  5315

Query  1214  GGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAI---NEGLPGSSISPLDILP  1270
               + +   +  E   N     T    +   +   + V + I      LP  S       P
Sbjct  5316  SLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTS--P  5373

Query  1271  NNQVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRL  1330
             +   +   T P  F  +   DQ    T + P  R   AS     PSS+    T   +   
Sbjct  5374  SESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEAST----PSSASLETTVPSVT--  5427

Query  1331  LEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTT----TTSTTKSTTNSRPVT  1386
             LE  T +   +   + T  T ++ +   +T      T P+     TT +    T + P  
Sbjct  5428  LETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSD  5487

Query  1387  TTTMTNSAPTMMTTTLLPTP-TIAASTTSTMSTSTT----SLFTTIGIPKQTSFG-----  1436
              TT  +S  T  +T  +PT     AST S+ S  TT    +L TT  +P  ++ G     
Sbjct  5488  FTTRPHSEQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQ  5547

Query  1437  TTFDDLAFLNTL-LESDYRPNSIS--STPKTLTEVERLLANKILSLALSQAG-PTRSPKA  1492
             TT     F  T+ +E    P+  +  +TP    E   L ++        Q    TR    
Sbjct  5548  TTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPT  5607

Query  1493  IQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPFTWKPVT  1545
              +P  AS  S    PAS   + P +     ++T+  P+ +T       TT  P   +   
Sbjct  5608  TRPFEASTPS----PASLETTVPSVTS---ETTTNVPIGSTGGQVTGQTTAPPSEVRTTI  5660

Query  1546  DVTSIT-SSKQTEIST-----KTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNL  1599
              V   T  S+ T+ +T     +T T + S +TT T +   ++   D   T P    + + 
Sbjct  5661  RVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSP  5720

Query  1600  ATILNTVTSSTTIPTISF-TTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFG  1658
             A++       TT+P+++  TTT  P   T   V  +    P+  +  +G   S L +   
Sbjct  5721  ASL------ETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPS--R  5772

Query  1659  RNIFAPPTSTTQKPLKKVIQTTLRPV--QTTPKPISTTAAREMYAASEQINHIDYSNSLV  1716
                   P+ + + P       T RP   QTT         R   A++     ++ +   V
Sbjct  5773  STDRTSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSV  5832

Query  1717  SGSKSTS  1723
             +   +T+
Sbjct  5833  TSETTTN  5839


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 125/538 (23%), Positives = 202/538 (38%), Gaps = 86/538 (16%)

Query  1344  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLL  1403
             +R T  T  +++P   TT+ +  TT   +  TT+ST   R V TT    ++     T   
Sbjct  7651  SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST---RDVPTTRPFEASTPRPVTLET  7707

Query  1404  PTPTIAASTTSTMST-STTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTP  1462
               P++ + TT+ +   ST +  TT  +P     G+T   +A   T   S+ R  +I    
Sbjct  7708  AVPSVTSETTTNVPIGSTVTSETTTNVP----IGSTGGQVAGQTTAPPSEVR-TTIRVEE  7762

Query  1463  KTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLL  1522
              TL                    P+RS     PS  SP +   LP+ F  ++ P      
Sbjct  7763  STL--------------------PSRSADRTTPSE-SPETPTTLPSDF--TTRPHSEQTT  7799

Query  1523  QSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQT---------EISTKTTTSIT  1567
             +ST   P     TT PF   T  P    T V S+TS   T         +++ ++T+S +
Sbjct  7800  ESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7854

Query  1568  STTTTSTMTPSA--SQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKV  1625
                TT  +  S   S+    TFP+  P  K + L       +  TT P +  TT  T  V
Sbjct  7855  EVRTTIRVEESTLPSRSTDRTFPSESPE-KPTTLP------SDFTTRPHLEQTTESTRDV  7907

Query  1626  ITRKPVAVRPAPP------------PTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPL  1673
             +T +P       P             T+T  P+G     +         APP+  T + +
Sbjct  7908  LTTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVT----EQTTAPPSVRTTETI  7963

Query  1674  KKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPE  1733
              K     + P  T P  I  T            +      S    + S  P  +T+ + E
Sbjct  7964  VKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSE  8023

Query  1734  EDAKFLLELLEASERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKATTEDHASKNA  1793
             E  +    +   S R        SL+ +   +        GQ   +  K+ +E    +++
Sbjct  8024  ESTETTRPVPTVSPRDALETTVTSLI-TETTKTTSGGTPRGQVTERTTKSVSELTTGRSS  8082

Query  1794  VLLAELLKAQGIKPSTSSNHLREPLQGISITSTTTIGPQIISTSSKRPTTPRPRPTVK  1851
              ++ E      I  +T+  +  EP+   ++ +T +I      T +  PTT  P PT K
Sbjct  8083  DVVTERTMPSNISSTTTVFNNSEPVSD-NLPTTISI------TVTDSPTTV-PVPTCK  8132


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 239/1103 (22%), Positives = 400/1103 (36%), Gaps = 194/1103 (18%)

Query  713   SITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIR-QNQKERITTTGTPDDVFVQ  771
             S+T      + +    ++I  T         T+      R  ++K   +T   P     +
Sbjct  6035  SVTSEATTNVPIGSTGQRIGTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFE  6094

Query  772   SKTAYNSEL-TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAW  818
             + T   + L TTV  + LET T  P+            SS +   TT+++  +T  SR+ 
Sbjct  6095  TSTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSA  6154

Query  819   NAAYIDKNWQEPT--------PRSIDSHNTSRSV-------VSKPLTRSRGYTNRNRQIS  863
             +     ++ + PT        P S  +  ++R V        S P   S   T  +    
Sbjct  6155  DRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSE  6214

Query  864   TTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSS--  921
             TTT     +T   VT + T  P    +    +    P++ +D TS   +  +  T  S  
Sbjct  6215  TTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDF  6274

Query  922   LTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIK-----  976
             +T   + QT+      P T    R  E S P  + + K  V SV      +  I      
Sbjct  6275  ITRPHSEQTTESTRDVPTT----RPFEASTPSPA-SLKTTVPSVTSEATTNVPIGSTGGQ  6329

Query  977   -TENST------QQSIKKE----PAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNI  1025
              TE +T      + +I+ E    P+ S +    + + ET   +    ++R +S  +  + 
Sbjct  6330  VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEKTTEST  6389

Query  1026  FNPARTTYLINSN---ASLLEQIKS-TVAPLLSV-LGAKAPAFAGVYRNVSSNETAAQRV  1080
              +   T     S    ASL   + S T+    SV +G+      G      S      RV
Sbjct  6390  RDVPTTRPFETSTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV  6449

Query  1081  TPSGSPPRFSARYRGVEL----------FVRKPNDANSTGNASTTSFISSSDEASSPVSI  1130
               S  P R + R    E           F+ +P+   +T +       +   EAS+P S 
Sbjct  6450  EESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEKTTESTRDVP-TTRPFEASTPSSA  6508

Query  1131  SNLGDSKEVTFYRALETVSINNEVNQATDEERQQQLNRVAQITNASPGGLRPPSGVTPSS  1190
             S+ G++  ++++R     S  N  N++ D     +          SP     PS  T   
Sbjct  6509  SS-GNNCSISYFRNHYKCS--NRFNRSADRTTPSE----------SPETPTLPSDFTTRP  6555

Query  1191  INPQGGRIIQDIERDK---ASRTKEAGGQRSTVYIGQEKFINY--------WTNDTAQND  1239
              + Q     +D+   +   AS    A  + +   +  E   N          T  T    
Sbjct  6556  HSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPP  6615

Query  1240  SRV---VSVEINSVAS-AINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKD-PLDQIF  1294
             S V   + VE +++ S + +   P  S     ILP++      +       +D P  + F
Sbjct  6616  SEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPF  6675

Query  1295  GITTESPI-IRASVASNTLDEPS-----SSRSPITARPINRLLEVFTPLL--NANQLARD  1346
               +T  P+ +  +V S TL+  +     S+   +T +      EV T +    +   +R 
Sbjct  6676  EASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIRVEESTLPSRS  6735

Query  1347  TSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPT  1396
             T  T  +++P   TT+ +  TT   +  TT+ST +   +RP   +T        T  + T
Sbjct  6736  TDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVT  6795

Query  1397  MMTTTLLPTPTIAASTTSTMSTSTTSLFTTIG-----IPKQTSFGTTFDDLAFLNTLLES  1451
               TTT +P  +     T   ++S + + TTIG     +P +++  T+  +     T L S
Sbjct  6796  SETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPS  6855

Query  1452  DY--RPNSISSTPKTL-------------------TEVERLLANKILSLALSQAG-----  1485
             D+  RP+S  +T  T                    T V  + +    ++ +   G     
Sbjct  6856  DFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTE  6915

Query  1486  --------------------PTRSPKAIQPSNASPNSLDILPASF---GHS---------  1513
                                 P+RS     PS  SP +   LP+ F    HS         
Sbjct  6916  QTTSSPSEVRTTIGLEESTLPSRSTDRTSPSE-SPETPTTLPSDFITRPHSDQTTESTRD  6974

Query  1514  ---SPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTD----VTSITSSKQTEIST--KTTT  1564
                + P       S S +    + T E  T  P+      VT  T+S  +E+ T  +   
Sbjct  6975  VPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEE  7034

Query  1565  SITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPK  1624
             S   + +T   TPS S     T P+   T   S+      T  SS  +PT       TP+
Sbjct  7035  STLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD-----QTTESSRDVPTTQPFEASTPR  7089

Query  1625  VITRKPVAVRPAPPPTTTQAPLG  1647
              +T +  AV P    TTT  P+G
Sbjct  7090  PVTLQ-TAVLPVTSETTTNVPIG  7111


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 89/357 (25%), Positives = 142/357 (40%), Gaps = 50/357 (14%)

Query  1297  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1354
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7207  TTNVPIGSTGGQVTEQTTPSPSEVRTTI------RIEESTFP-------SRSTDRTTPSE  7253

Query  1355  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1414
             +P   TT+ +  TT   +  TT+ST +    TT    +S P  +T  +   P  + +TT+
Sbjct  7254  SPETPTTLPSDFTTRPHSDQTTESTRDVP--TTRPFESSTPRPVTLEIAVPPVTSETTTN  7311

Query  1415  TMSTSTTSLFT--TIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLL  1472
                 ST    T  T   P +       ++    +TL        + S +P+T T +    
Sbjct  7312  VAIGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLPSDF  7367

Query  1473  ANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAA  1532
               +  S   +++  TR     +P  AS  S    PAS   + P +    L++T+  P+ +
Sbjct  7368  TTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTSVPMGS  7418

Query  1533  TTTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTH  1590
             T             VT  T++  +E+ T  +   S   + +T    PS S     T P+ 
Sbjct  7419  TG----------GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSD  7468

Query  1591  PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1647
               T   S+      T  SS  +PT     + TP+ +T + +AV P    TTT  P+G
Sbjct  7469  FTTRPHSD-----QTTESSRDVPTTQPFESSTPRPVTLE-IAVPPVTSETTTNVPIG  7519


 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 133/597 (22%), Positives = 223/597 (37%), Gaps = 87/597 (15%)

Query  1297  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1354
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  4922  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  4968

Query  1355  APTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMTTTLLP  1404
             +P   TT+ +  TT   +  TT+ST +   +RP   +T        T  + T+ TTT +P
Sbjct  4969  SPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVP  5028

Query  1405  TPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKT  1464
               +     T   ++S + + TTI + + T    + D                + S +P+T
Sbjct  5029  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADR--------------TTPSESPET  5074

Query  1465  LTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQS  1524
              T +      +  S   +++  TR     +P  AS  S    PAS   + P +     ++
Sbjct  5075  PTTLPSDFITRTYSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVTS---ET  5125

Query  1525  TSKKPVAAT-------TTTEPFTWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT  1576
             T+  P+ +T       TT  P  ++    V   T  S+ T+ +T + +  T TT  S  T
Sbjct  5126  TTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFT  5185

Query  1577  --PSASQIIFDT--FPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVA  1632
               P + Q    T   PT  P   S+     L T   S T+     TTT  P   T   V 
Sbjct  5186  TRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLE----TTTNVPIGSTGGQVT  5241

Query  1633  VRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPIS  1692
              +    P+  +  +    S L          P  S  +    +  +T   P   T +P S
Sbjct  5242  EQTTSSPSEVRTTIRVEESTL----------PSRSADRTTPSESPETPTLPSDFTTRPHS  5291

Query  1693  ---TTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKFLLELLEAS-ER  1748
                T + R++ A            SL +   S + +ATT          + E   +S   
Sbjct  5292  EQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE  5351

Query  1749  VKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKP  1807
             V+   + E   L +          S +    +P   TT  H+ +      ++   +  + 
Sbjct  5352  VRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEA  5411

Query  1808  ST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1858
             ST SS  L   +  +++ +TT +     G Q+   ++  P+    R T++ + ST P
Sbjct  5412  STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIRVEESTLP  5466


 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 127/596 (21%), Positives = 233/596 (39%), Gaps = 106/596 (18%)

Query  1317  SSRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1376
             ++ SP   R   R+ E   P       +R T  T  +++P   TT+ +  TT   +  TT
Sbjct  7325  TTSSPSEVRTTIRVEESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  7377

Query  1377  KSTTN---SRPVTTTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTT  1426
             +ST +   +RP   +T        T  + T+ TTT +P  +     T   +   + + TT
Sbjct  7378  ESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTT  7437

Query  1427  IGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAGP  1486
             I + + T    + D              P+    TP TL        +   +   S+  P
Sbjct  7438  IRVEESTLPSRSTDRTP-----------PSESPETPTTLPSDFTTRPHSDQTTESSRDVP  7486

Query  1487  TRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPF  1539
             T  P   + S   P +L+I       + PP+     ++T+  P+ +T       TT  P 
Sbjct  7487  TTQP--FESSTPRPVTLEI-------AVPPVTS---ETTTNVPIGSTGGQVTGQTTATPS  7534

Query  1540  TWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT--PSASQIIFDT--FPTHPP--  1592
               +    V   T  S+ T+ +T + +  T TT  S  T  P + Q    T   PT  P  
Sbjct  7535  EVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFE  7594

Query  1593  --TIKSSNLATILNTVT--SSTTIP------TISFTTTVTPKVITRKPVAVRPAPPPT--  1640
               T   ++L T + +VT  ++T +P       ++  TT TP  + R  + V  +  P+  
Sbjct  7595  ASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV-RTTIGVEESTLPSRS  7653

Query  1641  ---TTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQ-TTPKPISTTAA  1696
                TT +      + L + F      P +  T +  + V   T RP + +TP+P++   A
Sbjct  7654  TDRTTPSESPETPTTLPSDFTTR---PHSDQTTESTRDV--PTTRPFEASTPRPVTLETA  7708

Query  1697  REMYAASEQINHIDYSNSLVSGSKSTSPQATT-------KYSPEEDAKFLLELLEASERV  1749
                   SE   ++   +++ S + +  P  +T         +P  + +  + + E++   
Sbjct  7709  VPS-VTSETTTNVPIGSTVTSETTTNVPIGSTGGQVAGQTTAPPSEVRTTIRVEESTLPS  7767

Query  1750  KKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKPS  1808
             +  D+      +   E       S +    +P   TT  H+ +      ++   +  + S
Sbjct  7768  RSADR------TTPSE-------SPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEAS  7814

Query  1809  T-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1858
             T S   L   +  ++  +TT +     G Q+   S+  P+    R T++ + ST P
Sbjct  7815  TPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS--EVRTTIRVEESTLP  7868


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 82/356 (23%), Positives = 134/356 (38%), Gaps = 48/356 (13%)

Query  1297  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1354
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7003  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  7049

Query  1355  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1414
             +P   TT+ +  TT   +  TT+S+ +         +   P  + T +LP  +   +   
Sbjct  7050  SPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVP  7109

Query  1415  TMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLAN  1474
               ST       T   P +       ++    +TL        + S +P+T T +      
Sbjct  7110  IGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLP-----  7160

Query  1475  KILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSP-PIIIDLLQSTSKKPVAAT  1533
                      +  T  P + Q + +S +     P  F  S+P P+ ++    T+  PV + 
Sbjct  7161  ---------SDFTTRPHSDQTTESSRDVPTTQP--FESSTPRPVTLE----TAVPPVTSE  7205

Query  1534  TTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHP  1591
             TTT          VT  T+   +E+ T  +   S   + +T   TPS S     T P+  
Sbjct  7206  TTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDF  7265

Query  1592  PTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1647
              T   S+      T  S+  +PT     + TP+ +T + +AV P    TTT   +G
Sbjct  7266  TTRPHSD-----QTTESTRDVPTTRPFESSTPRPVTLE-IAVPPVTSETTTNVAIG  7315


 Score = 44.3 bits (103),  Expect = 0.001, Method: Composition-based stats.
 Identities = 218/1077 (20%), Positives = 388/1077 (36%), Gaps = 174/1077 (16%)

Query  823   IDKNWQEPTPRSIDSHNTSRSVVSKPLT-RSRGYTNRNRQISTTTMSNNETTQKSVTFKV  881
             +  N +  TP ++ S  T+R    +     S   T    + ST T S+ ETT  S+T + 
Sbjct  4014  LSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSES  4073

Query  882   TKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTA  941
             T R  V+     D++   P        +    T+ N     T  +  + +    S  RT 
Sbjct  4074  TTR-EVYTIKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTTRGQVTEQTTSSPSEKRTT  4132

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNA  1001
                R  E + P  S T +   S    TP     I   +ST ++   +   S   +  T  
Sbjct  4133  I--RVEESTLPSRS-TDRTTPSESPETPT----ILPSDSTTRTYSDQTTESTRDVPTTRP  4185

Query  1002  NETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAP  1061
              E       S  +   S   ++   +P  +T        + EQ  S+ + + + +G +  
Sbjct  4186  FEASTPSPASLETTVPSVTLETTTNDPIGST-----GGQVTEQTTSSPSEVRTTIGLEES  4240

Query  1062  AFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRG-------VELFVRKPNDANSTGNAS-  1113
                   R+      +    TP+  P  F  R           ++   +P +A++  +AS 
Sbjct  4241  TLPS--RSTDRTTPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASL  4298

Query  1114  TTSFISSSDEASSPVSISNLGDSKEVTFYRALETVSINNEVNQATDEERQQQLNRVAQIT  1173
              T+  S + E ++ V I + G   +VT     +T S  +EV      E     +R A  T
Sbjct  4299  ETTVPSVTLETTTNVPIGSTGG--QVT----EQTTSSPSEVRTTIRVEESTLPSRSADRT  4352

Query  1174  NASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1233
               S     P +  +  +  P   +  +       +R  EA                  T 
Sbjct  4353  TPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEAS-----------------TP  4395

Query  1234  DTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLDQI  1293
               A  ++ V SV + +  +     +P  S          QV G+ T+ P           
Sbjct  4396  SPASLETTVPSVTLETTTN-----VPIGSTG-------GQVTGQTTSSPS----------  4433

Query  1294  FGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITN  1353
               + T   +  +++ S + D  + S SP T   +              +  RD   T   
Sbjct  4434  -EVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPF  4492

Query  1354  DAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTT-----TMTNSAPTMMTTTLLPTPTI  1408
             +A T S     S +  TT  S T  TT + P+ +T       T S+P+ + TT+     +
Sbjct  4493  EASTPS-----SASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTI----RV  4543

Query  1409  AASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTLT  1466
               ST  + S   T+L  +   P                T L SD+  RP+S  +T  T  
Sbjct  4544  EESTLPSRSADRTTLSESPETP----------------TTLPSDFTIRPHSEQTTEST--  4585

Query  1467  EVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLD-ILPASFGHSSPPIIIDLLQST  1525
                             +  PT  P   + S  SP SL+  +P+    ++  + I     +
Sbjct  4586  ----------------RDVPTTRP--FEASTPSPASLETTVPSVTSETTTNVPI----GS  4623

Query  1526  SKKPVAATTTTEPFTWKPVTDVTSIT-SSKQTEIST-----KTTTSITSTTTTSTMTPSA  1579
             +   V   TT  P  ++    V   T  S+ T+ +T     +T T + S +TT T +   
Sbjct  4624  TGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQT  4683

Query  1580  SQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISF-TTTVTPKVITRKPVAVRPAPP  1638
             ++   D   T P    + + A++       TT+P+++  TTT  P   T   V  +    
Sbjct  4684  TESTRDVPTTRPFEASTPSPASL------ETTVPSVTLETTTNVPIGSTGGQVTEQTTSS  4737

Query  1639  PTTTQAPLGFGASLLQAIFGRNIF---APPTSTT------QKPLKKVIQTTLRPVQTT-P  1688
             P+  +  +    S L +          +P T TT       +P  +    + R V TT P
Sbjct  4738  PSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRP  4797

Query  1689  KPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKFLLELLEASER  1748
                ST ++  +      +  ++ + ++  GS        T  SP E  +  + + E++  
Sbjct  4798  FEASTPSSASLETTVPSVT-LETTTNVPIGSTGGQVTEQTTSSPSE-VRTTIRVEESTLP  4855

Query  1749  VKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKP  1807
              +  D+      +   E       S +    +P    T  H+ K      ++   +  + 
Sbjct  4856  SRSADR------TTPSE-------SPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA  4902

Query  1808  ST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1858
             ST SS  L   +  +++ +TT +     G Q+   ++  P+    R T++ + ST P
Sbjct  4903  STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIRVEESTLP  4957


 Score = 37.4 bits (85),  Expect = 0.16, Method: Composition-based stats.
 Identities = 46/172 (27%), Positives = 69/172 (40%), Gaps = 24/172 (14%)

Query  1543   PVTDVTSITSSKQTEISTKT--TTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLA  1600
              P + V +I S     IS  T    +I S    +   PS   I   + P   PT  S    
Sbjct  19088  PTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPG--  19145

Query  1601   TILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRN  1660
               I+N  +    +P+       TP VI    +  +P PPP   Q  +    S+ Q      
Sbjct  19146  -IINIPSVPQPLPS------PTPGVIN---IPQQPTPPPLVQQPGIINIPSVQQ------  19189

Query  1661   IFAPPTSTTQKPLKKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYS  1712
                 P T TTQ P++ V   T RP Q TP  I+  +  +    +++ ++ D S
Sbjct  19190  ---PSTPTTQHPIQDVQYETQRP-QPTPGVINIPSVSQPTYPTQKPSYQDTS  19237


 Score = 35.0 bits (79),  Expect = 0.96, Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 60/168 (36%), Gaps = 28/168 (17%)

Query  1273  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1332
             QV  + TAPP             + T   I++++  + + D    S  P T  P+     
Sbjct  7946  QVTEQTTAPPS------------VRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTR  7993

Query  1333  VFTPLL----------------NANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1376
             ++T                    + +L  + S   T   PTVS       T  +  T TT
Sbjct  7994  LYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETT  8053

Query  1377  KSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1424
             K+T+   P    T   +      TT   +  +   T  +  +STT++F
Sbjct  8054  KTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTVF  8101


>M9PB30_DROME unnamed protein product
Length=22949

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 273/1356 (20%), Positives = 464/1356 (34%), Gaps = 201/1356 (15%)

Query  425   LSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAATSILTIKT  484
             LSS  +  T   + S   T      TT FT E+  +   +  T  P +     + +T ++
Sbjct  4014  LSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSES  4073

Query  485   LPKEKDLDDTLDFRGRKEFKQASYTTSITFSNQNTENLLNDISSTNLSNNRRRGNKLFNK  544
               +E       D          +   SITF            ++TN+     RG      
Sbjct  4074  TTREVYTIKPFDRSTPTPVSPDTTVPSITFE-----------TTTNIPIGTTRG------  4116

Query  545   ASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNERSELPKINKYIYYQDDEVTKIITR  604
                     ++  +  + P E +  +          E S LP                   
Sbjct  4117  --------QVTEQTTSSPSEKRTTIRV--------EESTLPS------------------  4142

Query  605   HLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKL  661
               RSTD+  P    SE+ E P ++ S+S   T S+      +  P T     ST S   L
Sbjct  4143  --RSTDRTTP----SESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASL  4196

Query  662   EEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVT  721
             E     V  E  + + +    G  T        E++ S     R       S  P     
Sbjct  4197  ETTVPSVTLETTTNDPIGSTGGQVT--------EQTTSSPSEVRTTIGLEESTLPSRSTD  4248

Query  722   ISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-  780
              + P         S+S E       + I    + +   +T   P     ++ T  ++ L 
Sbjct  4249  RTTP---------SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLE  4299

Query  781   TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQ  828
             TTV  + LET T  P+            SS +   TT+++  +T  SR+  A     +  
Sbjct  4300  TTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS--ADRTTPSES  4357

Query  829   EPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRV  887
               TP ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T     
Sbjct  4358  PETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETT-----  4412

Query  888   WNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHL  947
               +  I     + T ++  + ++   T R   S+L +    +T+   +  P T T     
Sbjct  4413  -TNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTT--PSESPETPTTLPSD  4469

Query  948   EVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNK---------  998
              +++P +  T  +    V  T  + A   +  S + ++   P+V+LE             
Sbjct  4470  FITRPHSEKT-TESTRDVPTTRPFEASTPSSASLETTV---PSVTLETTTNVPIGSTGGQ  4525

Query  999   ------TNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV---  1049
                   ++ +E    I +  S+  +     + +     T   + S+ ++    + T    
Sbjct  4526  VTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTEST  4585

Query  1050  --APLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGS------------PPRFSARYRG  1095
                P      A  P+ A +   V S  +      P GS            P  F    R 
Sbjct  4586  RDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRV  4645

Query  1096  VE-LFVRKPNDANSTGNASTTSFISSSDEASSPVSISNLGDSKEVTFYR----------A  1144
              E     +  D  +   +  T  I  SD  +   S      +++V   R          +
Sbjct  4646  EESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPAS  4705

Query  1145  LETVSINNEVNQATDEERQQQLNRVAQITNASPGGLRP---------PSGVTPSSINPQG  1195
             LET   +  +   T+        +V + T +SP  +R          PS     +   + 
Sbjct  4706  LETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSES  4765

Query  1196  GRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAIN  1255
                   +  D  +R        ST  +   +     T  +A  ++ V SV + +  + + 
Sbjct  4766  PETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTN-VP  4824

Query  1256  EGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEP  1315
              G  G  ++       ++V+  +            D+     +ESP    ++ S+ +  P
Sbjct  4825  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT--TPSESPETPTTLPSDFITRP  4882

Query  1316  SSSRSPITAR--PINRLLEVFTP-------LLNANQLARDTSITITNDAPTVSTTVGASM  1366
              S ++  + R  P  R  E  TP        + +  L   T++ I +    V+    +S 
Sbjct  4883  HSEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSP  4942

Query  1367  TTPTTTTSTTKSTTNSRPVTTTTMTNS--APTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1424
             +   TT    +ST  SR    TT + S   PT + +     P    +T ST    TT  F
Sbjct  4943  SEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPF  5002

Query  1425  TTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQA  1484
                  P   S  TT   +    TL  +   P  I ST   +TE      +++ +    + 
Sbjct  5003  EA-STPSPASLETTVPSV----TLETTTNVP--IGSTGGQVTEQTTSSPSEVRTTIRVEE  5055

Query  1485  G--PTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPF---  1539
                P+RS     PS  SP +   LP+ F       I       + +      TT PF   
Sbjct  5056  STLPSRSADRTTPSE-SPETPTTLPSDF-------ITRTYSDQTTESTRDVPTTRPFEAS  5107

Query  1540  TWKPV---TDVTSITSSKQTEISTKTTTSITSTTTTSTMTPSASQIIFD--TFPTHPP--  1592
             T  P    T V S+TS   T +   +T    +  TT+  +   + I  +  T P+     
Sbjct  5108  TPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDR  5167

Query  1593  TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV-AVRPAPPPTTTQAPLGFGAS  1651
             T  S +  T     +  TT P    TT  T  V T +P  A  P+P    T  P     +
Sbjct  5168  TTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLET  5227

Query  1652  LLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTT  1687
                   G         TT  P +  ++TT+R  ++T
Sbjct  5228  TTNVPIGSTGGQVTEQTTSSPSE--VRTTIRVEEST  5261


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 283/1372 (21%), Positives = 483/1372 (35%), Gaps = 227/1372 (17%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  5508  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEFRTTIRVEE  5563

Query  478   SIL----TIKTLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTEN  521
             S L      +T P E     TL  DF  R   +Q + +T          + T S  + E 
Sbjct  5564  STLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  5623

Query  522   LLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNER  581
              +  ++S   +N             I  TG ++ G+    P E +  +          E 
Sbjct  5624  TVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEVRTTIRV--------EE  5664

Query  582   SELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIF  641
             S LP                     RSTD+  P    SE+ E P ++ S+S   T S+  
Sbjct  5665  STLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQT  5700

Query  642   QGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESK  698
                 +  P T     ST S   LE     V  E  +   +    G  T   +   +E   
Sbjct  5701  TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT  5760

Query  699   SL-----QDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQ  753
             ++       P R       S +P T  T  LP                      T R   
Sbjct  5761  TIGVEESTLPSRSTDRTSPSESPETPTT--LPS-------------------DFTTRPHS  5799

Query  754   NQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL------------SSRNI  801
             +Q    T        F  S  +  S  TTV  +  ET T  P+            SS + 
Sbjct  5800  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSE  5859

Query  802   DTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSIDSHNTSRSVVSKPLTRSRGYTNRNRQ  861
               TT+ +  +T  SR+ +     ++ + PT    D      S  +   TR    T R  +
Sbjct  5860  VRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVP-TTRPFE  5918

Query  862   ISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSS  921
              ST + ++ ETT  SVT + T       +  I     + T ++    ++   T     S+
Sbjct  5919  ASTPSPASLETTVPSVTSETT------TNVPIGSTGGQVTGQTTAPPSEVRTTIGVEEST  5972

Query  922   LTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENST  981
             L +  T +TS   +  P T T      +++P +  T  +    V  T  + A   +  S 
Sbjct  5973  LPSRSTDRTSP--SESPETPTTLPSDFITRPHSEQT-TESTRDVPTTRPFEASTPSPASL  6029

Query  982   QQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASL  1041
             + ++   P+V+ E         T   IG + S             +P   T L +   + 
Sbjct  6030  KTTV---PSVTSEATTNVPIGSTGQRIGTTPSE------------SPETPTTLPSDFTTR  6074

Query  1042  LEQIKSTVA----PLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVE  1097
                 K+T +    P         P+ A +   V S         P GS        +  E
Sbjct  6075  PHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLETTTNVPIGS-----TGGQVTE  6129

Query  1098  LFVRKPNDANSTGNASTTSFISSSDEASSPVSISNLGDSKEVTFYRALETVSINNEVNQA  1157
                  P++  +T     ++  S S + ++P       +S E     +  T   ++E  Q 
Sbjct  6130  QTTSSPSEVRTTIRVEESTLPSRSADRTTP------SESPETPTLPSDFTTRPHSE--QT  6181

Query  1158  TDEERQQQLNRVAQITNASPGGLRP--PSGVTPSSINPQGGRIIQDIERDKASRTKEAGG  1215
             T+  R     R  + +  SP  L    PS  + ++ N   G     +     +   E   
Sbjct  6182  TESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEV--  6239

Query  1216  QRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINS--VASAINEGLPGSSISPLDILPNNQ  1273
              R+T+ + +    +  T+ T+ ++S      + S  +    +E    ++ S  D+     
Sbjct  6240  -RTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQ---TTESTRDVPTTRP  6295

Query  1274  VQGRVTAPPGFPWKDPLDQIFGITTESPI--IRASVASNTLDEPSSSRSPITARPINRLL  1331
              +    +P       P       TT  PI      V   T   PS  R+ I      R+ 
Sbjct  6296  FEASTPSPASLKTTVP-SVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVE  6348

Query  1332  EVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTT  1388
             E   P       +R T  T  +++P   TT+ +  TT   +  TT+ST +   +RP  T+
Sbjct  6349  ESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETS  6401

Query  1389  T-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGI-----PKQTSFG  1436
             T        T  + T+ TTT +P  +     T   +   + + TTI +     P +++  
Sbjct  6402  TPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDR  6461

Query  1437  TTFDDLAFLNTLLESDY--RPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQ  1494
             T+  +     T L SD+  RP+S  +T  T                      TR  +A  
Sbjct  6462  TSPSESPETPTTLPSDFITRPHSEKTTEST-----------------RDVPTTRPFEAST  6504

Query  1495  PSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSK  1554
             PS+AS         S  + S     +  + +++   +A  TT   + +  T  +  T+  
Sbjct  6505  PSSAS---------SGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRP  6555

Query  1555  QTEISTKTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPT  1614
              +E +T++T  + +T      TPS + +          T  +  + +    VT  TT P 
Sbjct  6556  HSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPP  6615

Query  1615  ISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLK  1674
                 TT+  +  T    +     P  + + P     ++L + F      P +  T +  +
Sbjct  6616  SEVRTTIRVEESTLPSRSTDRTTPSESPETP-----TILPSDFTTR---PHSDQTTESTR  6667

Query  1675  KVIQTTLRPVQ-TTPKPISTTAAREMYAASEQIN-HIDYSNSLVSGSKSTSP  1724
              V   T RP + +TP+P++   A          N  I  +   V+G  + +P
Sbjct  6668  DV--PTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATP  6717


 Score = 60.5 bits (145),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 315/1447 (22%), Positives = 519/1447 (36%), Gaps = 238/1447 (16%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  4490  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEVRTTIRVEE  4545

Query  478   SILTIK-----TLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTE  520
             S L  +     TL +  +   TL  DF  R   +Q + +T          + T S  + E
Sbjct  4546  STLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPFEASTPSPASLE  4605

Query  521   NLLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNE  580
               +  ++S   +N             I  TG ++ G+    P EF+  +          E
Sbjct  4606  TTVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEFRTTIRV--------E  4646

Query  581   RSELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEI  640
              S LP                     RSTD+  P    SE+ E P ++ S+S   T S+ 
Sbjct  4647  ESTLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQ  4682

Query  641   FQGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEES  697
                  +  P T     ST S   LE     V  E  +   +    G  T        E++
Sbjct  4683  TTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVT--------EQT  4734

Query  698   KSLQDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKE  757
              S     R       S  P      + P         S+S E       + I    ++K 
Sbjct  4735  TSSPSEVRTTIRVEESTLPSRSADRTTP---------SESPETPTTLPSDFITRPHSEKT  4785

Query  758   RITTTGTPDDVFVQSKTAYNSEL-TTVEKIKLETVTIRPL------------SSRNIDTT  804
               +T   P     ++ T  ++ L TTV  + LET T  P+            SS +   T
Sbjct  4786  TESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRT  4845

Query  805   TVKMLSTTRRSRAWNAAYIDKNWQEPT---------PRSIDSHNTSRSV-------VSKP  848
             T+++  +T  SR+ +     ++ + PT         P S  +  ++R V        S P
Sbjct  4846  TIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTP  4905

Query  849   LTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTS  908
              + S   T  +  + TTT     +T   VT + T  P    +    +    P++ +D T+
Sbjct  4906  SSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTT  4965

Query  909   ------TQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRR--HLEVSQPQNSL----  956
                   T  T+ S  T    + + T  T     +RP  A+      LE + P  +L    
Sbjct  4966  PSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTT  5025

Query  957   ------TGKKEVSSVAITP-KYHALIKTENST---QQSIKKEPAVSLE--------LLNK  998
                   TG +       +P +    I+ E ST   + + +  P+ S E         + +
Sbjct  5026  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITR  5085

Query  999   TNANETFNLIGISTSSRGNSGNSDSNIFNPAR---TTYLINSNASLLEQIKSTVAPLLSV  1055
             T +++T      ST     +   +++  +PA    T   + S  +    I ST   +   
Sbjct  5086  TYSDQTTE----STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQ  5141

Query  1056  LGAKAPAFAGVYRNVSSN--ETAAQRVTPSGSPPR-------FSARYRG-------VELF  1099
               A    F    R   S     +  R TPS SP         F+ R           ++ 
Sbjct  5142  TTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVP  5201

Query  1100  VRKPNDANSTGNAS-TTSFISSSDEASSPVSISNLGDSKEVTFYRALETVSINNEVNQAT  1158
               +P +A++   AS  T+  S + E ++ V I + G   +VT     +T S  +EV    
Sbjct  5202  TTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGG--QVT----EQTTSSPSEVRTTI  5255

Query  1159  DEERQQQLNRVAQITNASPGGLRP--PSGVTPSSINPQGGRIIQDIERDK---ASRTKEA  1213
               E     +R A  T  S     P  PS  T    + Q     +D+   +   AS    A
Sbjct  5256  RVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPA  5315

Query  1214  GGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAI---NEGLPGSSISPLDILP  1270
               + +   +  E   N     T    +   +   + V + I      LP  S       P
Sbjct  5316  SLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTS--P  5373

Query  1271  NNQVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRL  1330
             +   +   T P  F  +   DQ    T + P  R   AS     PSS+    T   +   
Sbjct  5374  SESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEAST----PSSASLETTVPSVT--  5427

Query  1331  LEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTT----TTSTTKSTTNSRPVT  1386
             LE  T +   +   + T  T ++ +   +T      T P+     TT +    T + P  
Sbjct  5428  LETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSD  5487

Query  1387  TTTMTNSAPTMMTTTLLPTP-TIAASTTSTMSTSTT----SLFTTIGIPKQTSFG-----  1436
              TT  +S  T  +T  +PT     AST S+ S  TT    +L TT  +P  ++ G     
Sbjct  5488  FTTRPHSEQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQ  5547

Query  1437  TTFDDLAFLNTL-LESDYRPNSIS--STPKTLTEVERLLANKILSLALSQAG-PTRSPKA  1492
             TT     F  T+ +E    P+  +  +TP    E   L ++        Q    TR    
Sbjct  5548  TTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPT  5607

Query  1493  IQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPFTWKPVT  1545
              +P  AS  S    PAS   + P +     ++T+  P+ +T       TT  P   +   
Sbjct  5608  TRPFEASTPS----PASLETTVPSVTS---ETTTNVPIGSTGGQVTGQTTAPPSEVRTTI  5660

Query  1546  DVTSIT-SSKQTEIST-----KTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNL  1599
              V   T  S+ T+ +T     +T T + S +TT T +   ++   D   T P    + + 
Sbjct  5661  RVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSP  5720

Query  1600  ATILNTVTSSTTIPTISF-TTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFG  1658
             A++       TT+P+++  TTT  P   T   V  +    P+  +  +G   S L +   
Sbjct  5721  ASL------ETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRST  5774

Query  1659  RNIFAPPTSTTQKPLKKVIQTTLRPV--QTTPKPISTTAAREMYAASEQINHIDYSNSLV  1716
                   P+ + + P       T RP   QTT         R   A++     ++ +   V
Sbjct  5775  DR--TSPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSV  5832

Query  1717  SGSKSTS  1723
             +   +T+
Sbjct  5833  TSETTTN  5839


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 125/538 (23%), Positives = 202/538 (38%), Gaps = 86/538 (16%)

Query  1344  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLL  1403
             +R T  T  +++P   TT+ +  TT   +  TT+ST   R V TT    ++     T   
Sbjct  7651  SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST---RDVPTTRPFEASTPRPVTLET  7707

Query  1404  PTPTIAASTTSTMST-STTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTP  1462
               P++ + TT+ +   ST +  TT  +P     G+T   +A   T   S+ R  +I    
Sbjct  7708  AVPSVTSETTTNVPIGSTVTSETTTNVP----IGSTGGQVAGQTTAPPSEVR-TTIRVEE  7762

Query  1463  KTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLL  1522
              TL                    P+RS     PS  SP +   LP+ F  ++ P      
Sbjct  7763  STL--------------------PSRSADRTTPSE-SPETPTTLPSDF--TTRPHSEQTT  7799

Query  1523  QSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQT---------EISTKTTTSIT  1567
             +ST   P     TT PF   T  P    T V S+TS   T         +++ ++T+S +
Sbjct  7800  ESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7854

Query  1568  STTTTSTMTPSA--SQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKV  1625
                TT  +  S   S+    TFP+  P  K + L       +  TT P +  TT  T  V
Sbjct  7855  EVRTTIRVEESTLPSRSTDRTFPSESPE-KPTTLP------SDFTTRPHLEQTTESTRDV  7907

Query  1626  ITRKPVAVRPAPP------------PTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPL  1673
             +T +P       P             T+T  P+G     +         APP+  T + +
Sbjct  7908  LTTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVT----EQTTAPPSVRTTETI  7963

Query  1674  KKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPE  1733
              K     + P  T P  I  T            +      S    + S  P  +T+ + E
Sbjct  7964  VKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSE  8023

Query  1734  EDAKFLLELLEASERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKATTEDHASKNA  1793
             E  +    +   S R        SL+ +   +        GQ   +  K+ +E    +++
Sbjct  8024  ESTETTRPVPTVSPRDALETTVTSLI-TETTKTTSGGTPRGQVTERTTKSVSELTTGRSS  8082

Query  1794  VLLAELLKAQGIKPSTSSNHLREPLQGISITSTTTIGPQIISTSSKRPTTPRPRPTVK  1851
              ++ E      I  +T+  +  EP+   ++ +T +I      T +  PTT  P PT K
Sbjct  8083  DVVTERTMPSNISSTTTVFNNSEPVSD-NLPTTISI------TVTDSPTTV-PVPTCK  8132


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 239/1103 (22%), Positives = 400/1103 (36%), Gaps = 194/1103 (18%)

Query  713   SITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIR-QNQKERITTTGTPDDVFVQ  771
             S+T      + +    ++I  T         T+      R  ++K   +T   P     +
Sbjct  6035  SVTSEATTNVPIGSTGQRIGTTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFE  6094

Query  772   SKTAYNSEL-TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAW  818
             + T   + L TTV  + LET T  P+            SS +   TT+++  +T  SR+ 
Sbjct  6095  TSTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSA  6154

Query  819   NAAYIDKNWQEPT--------PRSIDSHNTSRSV-------VSKPLTRSRGYTNRNRQIS  863
             +     ++ + PT        P S  +  ++R V        S P   S   T  +    
Sbjct  6155  DRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSE  6214

Query  864   TTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSS--  921
             TTT     +T   VT + T  P    +    +    P++ +D TS   +  +  T  S  
Sbjct  6215  TTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDF  6274

Query  922   LTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIK-----  976
             +T   + QT+      P T    R  E S P  + + K  V SV      +  I      
Sbjct  6275  ITRPHSEQTTESTRDVPTT----RPFEASTPSPA-SLKTTVPSVTSEATTNVPIGSTGGQ  6329

Query  977   -TENST------QQSIKKE----PAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNI  1025
              TE +T      + +I+ E    P+ S +    + + ET   +    ++R +S  +  + 
Sbjct  6330  VTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEKTTEST  6389

Query  1026  FNPARTTYLINSN---ASLLEQIKS-TVAPLLSV-LGAKAPAFAGVYRNVSSNETAAQRV  1080
              +   T     S    ASL   + S T+    SV +G+      G      S      RV
Sbjct  6390  RDVPTTRPFETSTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTTIRV  6449

Query  1081  TPSGSPPRFSARYRGVEL----------FVRKPNDANSTGNASTTSFISSSDEASSPVSI  1130
               S  P R + R    E           F+ +P+   +T +       +   EAS+P S 
Sbjct  6450  EESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEKTTESTRDVP-TTRPFEASTPSSA  6508

Query  1131  SNLGDSKEVTFYRALETVSINNEVNQATDEERQQQLNRVAQITNASPGGLRPPSGVTPSS  1190
             S+ G++  ++++R     S  N  N++ D     +          SP     PS  T   
Sbjct  6509  SS-GNNCSISYFRNHYKCS--NRFNRSADRTTPSE----------SPETPTLPSDFTTRP  6555

Query  1191  INPQGGRIIQDIERDK---ASRTKEAGGQRSTVYIGQEKFINY--------WTNDTAQND  1239
              + Q     +D+   +   AS    A  + +   +  E   N          T  T    
Sbjct  6556  HSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPP  6615

Query  1240  SRV---VSVEINSVAS-AINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKD-PLDQIF  1294
             S V   + VE +++ S + +   P  S     ILP++      +       +D P  + F
Sbjct  6616  SEVRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDFTTRPHSDQTTESTRDVPTTRPF  6675

Query  1295  GITTESPI-IRASVASNTLDEPS-----SSRSPITARPINRLLEVFTPLL--NANQLARD  1346
               +T  P+ +  +V S TL+  +     S+   +T +      EV T +    +   +R 
Sbjct  6676  EASTPRPVTLETAVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIRVEESTLPSRS  6735

Query  1347  TSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPT  1396
             T  T  +++P   TT+ +  TT   +  TT+ST +   +RP   +T        T  + T
Sbjct  6736  TDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVT  6795

Query  1397  MMTTTLLPTPTIAASTTSTMSTSTTSLFTTIG-----IPKQTSFGTTFDDLAFLNTLLES  1451
               TTT +P  +     T   ++S + + TTIG     +P +++  T+  +     T L S
Sbjct  6796  SETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPS  6855

Query  1452  DY--RPNSISSTPKTL-------------------TEVERLLANKILSLALSQAG-----  1485
             D+  RP+S  +T  T                    T V  + +    ++ +   G     
Sbjct  6856  DFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTE  6915

Query  1486  --------------------PTRSPKAIQPSNASPNSLDILPASF---GHS---------  1513
                                 P+RS     PS  SP +   LP+ F    HS         
Sbjct  6916  QTTSSPSEVRTTIGLEESTLPSRSTDRTSPSE-SPETPTTLPSDFITRPHSDQTTESTRD  6974

Query  1514  ---SPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTD----VTSITSSKQTEIST--KTTT  1564
                + P       S S +    + T E  T  P+      VT  T+S  +E+ T  +   
Sbjct  6975  VPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEE  7034

Query  1565  SITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPK  1624
             S   + +T   TPS S     T P+   T   S+      T  SS  +PT       TP+
Sbjct  7035  STLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD-----QTTESSRDVPTTQPFEASTPR  7089

Query  1625  VITRKPVAVRPAPPPTTTQAPLG  1647
              +T +  AV P    TTT  P+G
Sbjct  7090  PVTLQ-TAVLPVTSETTTNVPIG  7111


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 89/357 (25%), Positives = 142/357 (40%), Gaps = 50/357 (14%)

Query  1297  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1354
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7207  TTNVPIGSTGGQVTEQTTPSPSEVRTTI------RIEESTFP-------SRSTDRTTPSE  7253

Query  1355  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1414
             +P   TT+ +  TT   +  TT+ST +    TT    +S P  +T  +   P  + +TT+
Sbjct  7254  SPETPTTLPSDFTTRPHSDQTTESTRDVP--TTRPFESSTPRPVTLEIAVPPVTSETTTN  7311

Query  1415  TMSTSTTSLFT--TIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLL  1472
                 ST    T  T   P +       ++    +TL        + S +P+T T +    
Sbjct  7312  VAIGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLPSDF  7367

Query  1473  ANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAA  1532
               +  S   +++  TR     +P  AS  S    PAS   + P +    L++T+  P+ +
Sbjct  7368  TTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTSVPMGS  7418

Query  1533  TTTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTH  1590
             T             VT  T++  +E+ T  +   S   + +T    PS S     T P+ 
Sbjct  7419  TG----------GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSD  7468

Query  1591  PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1647
               T   S+      T  SS  +PT     + TP+ +T + +AV P    TTT  P+G
Sbjct  7469  FTTRPHSD-----QTTESSRDVPTTQPFESSTPRPVTLE-IAVPPVTSETTTNVPIG  7519


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 133/597 (22%), Positives = 223/597 (37%), Gaps = 87/597 (15%)

Query  1297  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1354
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  4922  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  4968

Query  1355  APTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMTTTLLP  1404
             +P   TT+ +  TT   +  TT+ST +   +RP   +T        T  + T+ TTT +P
Sbjct  4969  SPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVP  5028

Query  1405  TPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKT  1464
               +     T   ++S + + TTI + + T    + D                + S +P+T
Sbjct  5029  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADR--------------TTPSESPET  5074

Query  1465  LTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQS  1524
              T +      +  S   +++  TR     +P  AS  S    PAS   + P +     ++
Sbjct  5075  PTTLPSDFITRTYSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVTS---ET  5125

Query  1525  TSKKPVAAT-------TTTEPFTWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT  1576
             T+  P+ +T       TT  P  ++    V   T  S+ T+ +T + +  T TT  S  T
Sbjct  5126  TTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFT  5185

Query  1577  --PSASQIIFDT--FPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVA  1632
               P + Q    T   PT  P   S+     L T   S T+     TTT  P   T   V 
Sbjct  5186  TRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLE----TTTNVPIGSTGGQVT  5241

Query  1633  VRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPIS  1692
              +    P+  +  +    S L          P  S  +    +  +T   P   T +P S
Sbjct  5242  EQTTSSPSEVRTTIRVEESTL----------PSRSADRTTPSESPETPTLPSDFTTRPHS  5291

Query  1693  ---TTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKFLLELLEAS-ER  1748
                T + R++ A            SL +   S + +ATT          + E   +S   
Sbjct  5292  EQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE  5351

Query  1749  VKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKP  1807
             V+   + E   L +          S +    +P   TT  H+ +      ++   +  + 
Sbjct  5352  VRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEA  5411

Query  1808  ST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1858
             ST SS  L   +  +++ +TT +     G Q+   ++  P+    R T++ + ST P
Sbjct  5412  STPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIRVEESTLP  5466


 Score = 52.0 bits (123),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 127/596 (21%), Positives = 233/596 (39%), Gaps = 106/596 (18%)

Query  1317  SSRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1376
             ++ SP   R   R+ E   P       +R T  T  +++P   TT+ +  TT   +  TT
Sbjct  7325  TTSSPSEVRTTIRVEESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  7377

Query  1377  KSTTN---SRPVTTTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTT  1426
             +ST +   +RP   +T        T  + T+ TTT +P  +     T   +   + + TT
Sbjct  7378  ESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGSTGGQVTGQTTAPPSEVRTT  7437

Query  1427  IGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAGP  1486
             I + + T    + D              P+    TP TL        +   +   S+  P
Sbjct  7438  IRVEESTLPSRSTDRTP-----------PSESPETPTTLPSDFTTRPHSDQTTESSRDVP  7486

Query  1487  TRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPF  1539
             T  P   + S   P +L+I       + PP+     ++T+  P+ +T       TT  P 
Sbjct  7487  TTQP--FESSTPRPVTLEI-------AVPPVTS---ETTTNVPIGSTGGQVTGQTTATPS  7534

Query  1540  TWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT--PSASQIIFDT--FPTHPP--  1592
               +    V   T  S+ T+ +T + +  T TT  S  T  P + Q    T   PT  P  
Sbjct  7535  EVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFE  7594

Query  1593  --TIKSSNLATILNTVT--SSTTIP------TISFTTTVTPKVITRKPVAVRPAPPPT--  1640
               T   ++L T + +VT  ++T +P       ++  TT TP  + R  + V  +  P+  
Sbjct  7595  ASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEV-RTTIGVEESTLPSRS  7653

Query  1641  ---TTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQ-TTPKPISTTAA  1696
                TT +      + L + F      P +  T +  + V   T RP + +TP+P++   A
Sbjct  7654  TDRTTPSESPETPTTLPSDFTTR---PHSDQTTESTRDV--PTTRPFEASTPRPVTLETA  7708

Query  1697  REMYAASEQINHIDYSNSLVSGSKSTSPQATT-------KYSPEEDAKFLLELLEASERV  1749
                   SE   ++   +++ S + +  P  +T         +P  + +  + + E++   
Sbjct  7709  VPS-VTSETTTNVPIGSTVTSETTTNVPIGSTGGQVAGQTTAPPSEVRTTIRVEESTLPS  7767

Query  1750  KKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKPS  1808
             +  D+      +   E       S +    +P   TT  H+ +      ++   +  + S
Sbjct  7768  RSADR------TTPSE-------SPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEAS  7814

Query  1809  T-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1858
             T S   L   +  ++  +TT +     G Q+   S+  P+    R T++ + ST P
Sbjct  7815  TPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS--EVRTTIRVEESTLP  7868


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 82/356 (23%), Positives = 134/356 (38%), Gaps = 48/356 (13%)

Query  1297  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1354
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7003  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  7049

Query  1355  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1414
             +P   TT+ +  TT   +  TT+S+ +         +   P  + T +LP  +   +   
Sbjct  7050  SPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVP  7109

Query  1415  TMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLAN  1474
               ST       T   P +       ++    +TL        + S +P+T T +      
Sbjct  7110  IGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLP-----  7160

Query  1475  KILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSP-PIIIDLLQSTSKKPVAAT  1533
                      +  T  P + Q + +S +     P  F  S+P P+ ++    T+  PV + 
Sbjct  7161  ---------SDFTTRPHSDQTTESSRDVPTTQP--FESSTPRPVTLE----TAVPPVTSE  7205

Query  1534  TTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHP  1591
             TTT          VT  T+   +E+ T  +   S   + +T   TPS S     T P+  
Sbjct  7206  TTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDF  7265

Query  1592  PTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1647
              T   S+      T  S+  +PT     + TP+ +T + +AV P    TTT   +G
Sbjct  7266  TTRPHSD-----QTTESTRDVPTTRPFESSTPRPVTLE-IAVPPVTSETTTNVAIG  7315


 Score = 43.9 bits (102),  Expect = 0.002, Method: Composition-based stats.
 Identities = 129/607 (21%), Positives = 229/607 (38%), Gaps = 112/607 (18%)

Query  1292  QIFGITTESP--------IIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQL  1343
             Q+ G TT SP        +  +++ S + D  + S SP T   +              + 
Sbjct  4423  QVTGQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTES  4482

Query  1344  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTT-----TMTNSAPTMM  1398
              RD   T   +A T S     S +  TT  S T  TT + P+ +T       T S+P+ +
Sbjct  4483  TRDVPTTRPFEASTPS-----SASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEV  4537

Query  1399  TTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDY--RPN  1456
              TT+     +  ST  + S   T+L  +   P                T L SD+  RP+
Sbjct  4538  RTTI----RVEESTLPSRSADRTTLSESPETP----------------TTLPSDFTIRPH  4577

Query  1457  SISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLD-ILPASFGHSSP  1515
             S  +T  T                  +  PT  P   + S  SP SL+  +P+    ++ 
Sbjct  4578  SEQTTEST------------------RDVPTTRP--FEASTPSPASLETTVPSVTSETTT  4617

Query  1516  PIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSIT-SSKQTEIST-----KTTTSITST  1569
              + I     ++   V   TT  P  ++    V   T  S+ T+ +T     +T T + S 
Sbjct  4618  NVPI----GSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSESPETPTILPSD  4673

Query  1570  TTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISF-TTTVTPKVITR  1628
             +TT T +   ++   D   T P    + + A++       TT+P+++  TTT  P   T 
Sbjct  4674  STTRTYSDQTTESTRDVPTTRPFEASTPSPASL------ETTVPSVTLETTTNVPIGSTG  4727

Query  1629  KPVAVRPAPPPTTTQAPLGFGASLLQAIFGRNIF---APPTSTT------QKPLKKVIQT  1679
               V  +    P+  +  +    S L +          +P T TT       +P  +    
Sbjct  4728  GQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTE  4787

Query  1680  TLRPVQTT-PKPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKF  1738
             + R V TT P   ST ++  +      +  ++ + ++  GS        T  SP E  + 
Sbjct  4788  STRDVPTTRPFEASTPSSASLETTVPSVT-LETTTNVPIGSTGGQVTEQTTSSPSE-VRT  4845

Query  1739  LLELLEASERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLA  1797
              + + E++   +  D+      +   E       S +    +P    T  H+ K      
Sbjct  4846  TIRVEESTLPSRSADR------TTPSE-------SPETPTTLPSDFITRPHSEKTTESTR  4892

Query  1798  ELLKAQGIKPST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVK  1851
             ++   +  + ST SS  L   +  +++ +TT +     G Q+   ++  P+    R T++
Sbjct  4893  DVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIR  4950

Query  1852  AQSSTYP  1858
              + ST P
Sbjct  4951  VEESTLP  4957


 Score = 37.7 bits (86),  Expect = 0.15, Method: Composition-based stats.
 Identities = 46/172 (27%), Positives = 69/172 (40%), Gaps = 24/172 (14%)

Query  1543   PVTDVTSITSSKQTEISTKT--TTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLA  1600
              P + V +I S     IS  T    +I S    +   PS   I   + P   PT  S    
Sbjct  19294  PTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPG--  19351

Query  1601   TILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRN  1660
               I+N  +    +P+       TP VI    +  +P PPP   Q  +    S+ Q      
Sbjct  19352  -IINIPSVPQPLPS------PTPGVIN---IPQQPTPPPLVQQPGIINIPSVQQ------  19395

Query  1661   IFAPPTSTTQKPLKKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYS  1712
                 P T TTQ P++ V   T RP Q TP  I+  +  +    +++ ++ D S
Sbjct  19396  ---PSTPTTQHPIQDVQYETQRP-QPTPGVINIPSVSQPTYPTQKPSYQDTS  19443


 Score = 35.0 bits (79),  Expect = 0.96, Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 60/168 (36%), Gaps = 28/168 (17%)

Query  1273  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1332
             QV  + TAPP             + T   I++++  + + D    S  P T  P+     
Sbjct  7946  QVTEQTTAPPS------------VRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTR  7993

Query  1333  VFTPLL----------------NANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1376
             ++T                    + +L  + S   T   PTVS       T  +  T TT
Sbjct  7994  LYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETT  8053

Query  1377  KSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1424
             K+T+   P    T   +      TT   +  +   T  +  +STT++F
Sbjct  8054  KTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTVF  8101



Lambda      K        H
   0.320    0.134    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5064569340


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933613.1 uncharacterized protein LOC118063625 [Chelonus
insularis]

Length=389
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388T9_TRYB2  unnamed protein product                                 35.4    0.095
Q9W3K6_DROME  unnamed protein product                                 33.5    0.37 
RAN_DICDI  unnamed protein product                                    29.3    4.4  


>Q388T9_TRYB2 unnamed protein product
Length=1251

 Score = 35.4 bits (80),  Expect = 0.095, Method: Composition-based stats.
 Identities = 41/151 (27%), Positives = 67/151 (44%), Gaps = 24/151 (16%)

Query  18    VENSETQEVDQIEISHDGSFTHKDIQYIIFENILSLRQHH-----STFEYDDKAIPTFAV  72
             V  S  Q++ +    H   + H  +Q II  +I S +  H     S F +DD    T   
Sbjct  864   VRFSSPQDILKRIKQHGVRWLHGALQAII--DIHSCQVTHGDICMSNFTHDDFGNTTLGF  921

Query  73    ISVS-SAHKFLTWMATIHEHSLDY---LGVKRLPSVRDAL-KMITAELKSQMDQMAS---  124
              S S   HK+ T   T  + + D+   L  + LP +R  L +  ++  ++  D  AS   
Sbjct  922   FSNSLKVHKYGT--KTAQDDAADFGVTLHAEVLPYLRGTLPQTKSSPHRNASDDRASSGV  979

Query  125   -------DQDLQSMFNVFLNLLDQLISEITP  148
                    +Q ++ MFNVFL + D+L  ++ P
Sbjct  980   VTGCGQAEQQIREMFNVFLEVADRLTGKLEP  1010


>Q9W3K6_DROME unnamed protein product
Length=801

 Score = 33.5 bits (75),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query  197  LTYPMQMLSYVLRIFLLLFSHFDIS---FTNHESILIHEVTAILIDLISDRLTTYVYL  251
            L +P + ++ VLR+F+ +FSH D +   +TN   +LI  V   L DL +   T   YL
Sbjct  687  LKHPNEHMNTVLRMFIDIFSHPDTAGMFYTNDIKVLIDIVVRQLSDLDAGSTTRPCYL  744


>RAN_DICDI unnamed protein product
Length=212

 Score = 29.3 bits (64),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 25/55 (45%), Gaps = 6/55 (11%)

Query  55   QHHSTFEYDDKAIPTFAVISVSSAHK--FLTWMATIHEHSLDYLGVKRLPSVRDA  107
            Q H T E++ + IPT  V    S H   F T    IH +  D  G ++   +RD 
Sbjct  24   QRHLTGEFEPRYIPTLGV----SVHPLIFYTNFGKIHFNVWDTAGQEKFGGLRDG  74



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933614.1 EARP-interacting protein homolog [Chelonus insularis]

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIPR1_CAEEL  unnamed protein product                                  197     1e-59
EIPR1_DICDI  unnamed protein product                                  193     5e-58
Q57V96_TRYB2  unnamed protein product                                 66.6    5e-12


>EIPR1_CAEEL unnamed protein product
Length=362

 Score = 197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 122/370 (33%), Positives = 199/370 (54%), Gaps = 17/370 (5%)

Query  7    VIYGLEFQARALSAQNAETDIVRFLVGTQSLKFASNQIHLLELNDETNTLKTQVYHHDVG  66
            +++G++ +AR +++  A+ + + FLVGT ++K   NQ++ L ++ E + L ++ + H  G
Sbjct  5    LMFGMDCEARCMTSMTADEENICFLVGTNNIKNDKNQVNKLFMDPEASRLMSKTFRHPAG  64

Query  67   EVWSLQASPTDPDKFITSYNTMDNQGLCVMRGALWKLPELGEYTNEVESMEKVSDIDTTI  126
            EV ++ A PT      T      + G       +W + E      +  ++E VS + T  
Sbjct  65   EVRAIAAHPTKSTILATCTADFSSLG-GTHSITIWNIEE------DKRTLETVSRLPTE-  116

Query  127  HGADLRTIVYHPTESIRAVAVV--DNHFVLWNLE-GPSPQPSTIGTLTSKSQPRFTTGKW  183
                +  + + P  S++  A+        L N+E GP    +    L ++    F+   W
Sbjct  117  --QVMSCLEWEPN-SMKCAAMTPFRPEIQLLNMENGPEIVQNLKIPLENEEDEMFS-ATW  172

Query  184  NPHNGCNQFVTLNDNNVRGWDLRTPSKEAWTIIPAHCQIVRDLDFNVNKQYILSTCGDDG  243
            +PH+  N             D RT   E   I  AH      +DFN N Q++++TCGDDG
Sbjct  173  SPHHDGNMLGVTGGRTAWCIDCRT-DNEYLKIRDAHIHRTISMDFNPNLQHVIATCGDDG  231

Query  244  YMKFWDIRSPAEPIMARMEHSHWVWNIKVNKFHDQLVLTSSSDSRVILCSIPSVSSEPFG  303
            Y++ WD RS +  + +   H+HWVW+++ +  HDQL+LT  SD+ V+L    SVSSE   
Sbjct  232  YVRIWDTRSTSSALTSLHPHAHWVWSVRFHPVHDQLLLTGGSDASVVLSCAQSVSSEQQI  291

Query  304  PISHDDDNSLNQSINGTKLEDGVIGKYEEHEDSVYAVEWSSADPWTFASLSYDGRLVINK  363
                D++   +  +   KL+DG + + +EHEDSVYA  WSSADPWTFASLSYDGR++++ 
Sbjct  292  EFRDDEEEEEDDDL-VEKLQDGQLERIDEHEDSVYACAWSSADPWTFASLSYDGRMIVSN  350

Query  364  VPRKYKYKIL  373
            V RK+KY ++
Sbjct  351  VSRKHKYALM  360


>EIPR1_DICDI unnamed protein product
Length=400

 Score = 193 bits (491),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 132/397 (33%), Positives = 209/397 (53%), Gaps = 52/397 (13%)

Query  8    IYGLEFQARALSAQNAETDIVRFLVGTQSLKFASNQIHLLELNDETNTLKTQVYHHDVGE  67
            +YGL  + RALS   AE D+ RFLVGT +L+   N+I LLE  +        ++ H   E
Sbjct  13   VYGLSQKTRALSHITAEADVNRFLVGTTALR-EENEIALLEAKEGEGVRCLSIFPHP-KE  70

Query  68   VWSLQASPTDPDKFITSYNTMDNQGLCV-----------------MRGALWKLPELGEYT  110
            + S+ + P D   F + YNT                          + +LW++ E     
Sbjct  71   IHSITSCPFDSSLFFSVYNTSGGGNNNSNNTNNNDNTNNNTNNNDFKSSLWRINE-----  125

Query  111  NEVESMEKVSDIDTTIHGADLRTIVYHPTESIR-AVAVVDNHFVLWNLEGPSPQPSTIGT  169
              ++S+E++ ++    H   ++ I+  P+ S    +++ D++  LW+      +P+ I  
Sbjct  126  -SMDSIEELFELKG--HTGIIKPILCDPSGSNNFIISLDDSNIRLWSKIDDQNEPTVIKQ  182

Query  170  LTSKSQPRFTTGKWNPHNGCNQFVTLNDNNVRGWDLRTPSKEAWTIIPAHCQIVRDLDFN  229
              + S  + + G  NP N  NQ  T ND N++GWD R  +KE +++  AH + +RD+DFN
Sbjct  183  FGNLS--KLSVGSINP-NISNQLATANDVNIKGWDFRN-AKETFSMDKAHSEQIRDIDFN  238

Query  230  VNKQYILSTCGDDGYMKFWDIRSPAEPIMARMEHSHWVWNIKVNKFHDQLVLTSSSDSRV  289
             NK Y L + GDD  +K WD R   +P+     H+HW+W+ K N++HDQL++TSSSD+ V
Sbjct  239  PNKPYYLLSAGDDCKLKIWDTRQTRDPVKIFSGHNHWIWSAKFNRYHDQLIITSSSDNTV  298

Query  290  ILCSIPSVSSEPFGPISHDDDNSLNQ------------------SINGTKLEDGVIGKYE  331
             L ++ S+SS  F   ++  +++  Q                       + ED +I  YE
Sbjct  299  KLWNLYSLSS-AFNSENNISNSNEQQHSQQPNEQQPQQPPQPVKQKKNKRNEDQLIKTYE  357

Query  332  EHEDSVYAVEWSSADPWTFASLSYDGRLVINKVPRKY  368
            EHEDSVY + WSS++ + FASLSYDGR V+N VP++Y
Sbjct  358  EHEDSVYNISWSSSN-FLFASLSYDGRFVVNNVPKEY  393


>Q57V96_TRYB2 unnamed protein product
Length=348

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/158 (27%), Positives = 73/158 (46%), Gaps = 27/158 (17%)

Query  222  IVRDLDFNVNKQYILSTCGDDGYMKFWDIRSPAEPIMARME-----HSHWVWNIKVNKFH  276
            +++ +DF+  ++ +  T G DG + + D R   E  +         H H V     N FH
Sbjct  208  MIQSIDFSNAREGLFMTAGTDGVIMWHDFRMDGEKSVVERRGYLDAHDHCVQRSLFNPFH  267

Query  277  DQLVLTSSSDSRVILCSIPSVSSEPFGPISHDDDNSLNQSINGTKLEDGV-IGKYEEHED  335
            D+L+++  SD  + L                      + S  G   E  V + K  +  +
Sbjct  268  DELLISCGSDHTLKL---------------------WDTSKKGADGECAVCVSKLSDFAE  306

Query  336  SVYAVEWSSADPWTFASLSYDGRLVINKVPRKYKYKIL  373
            SV A  WS+++PW FA LSY+GR++++ VP + K + +
Sbjct  307  SVVACCWSNSNPWVFAGLSYNGRVLVDSVPEECKMQFI  344


 Score = 32.7 bits (73),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 39/73 (53%), Gaps = 7/73 (10%)

Query  9   YGLEFQARALS----AQNAETDIVRFLVGTQSLKFASNQIHLLELNDETNTLK-TQVYHH  63
           YG+E QARA++    + N  +   RF+ GT       N I LL   +E+  L+ T  + H
Sbjct  7   YGMELQARAIAPFYHSSNNSSSTHRFVAGTACFA-GGNVIRLLTFQEESQLLECTATWSH  65

Query  64  DVGEVWSLQASPT  76
           +  E++ L +SP+
Sbjct  66  EE-EIFGLWSSPS  77



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933615.1 repetitive proline-rich cell wall protein 2 [Chelonus
insularis]

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3Z9_DROME  unnamed protein product                                 61.6    1e-10
O97229_PLAF7  unnamed protein product                                 33.1    0.37 


>Q9V3Z9_DROME unnamed protein product
Length=277

 Score = 61.6 bits (148),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 96/260 (37%), Positives = 123/260 (47%), Gaps = 36/260 (14%)

Query  3    MKIVLTLLLLTVSQSSWVSCGESVKESTDKVSSASDTDSSSTEKKTEKRGLHGSYGDLGS  62
            MK+ + L  L V+ +                +S ++ +    EKK +KRGL     DLG 
Sbjct  1    MKVFICLAALLVASAC---------------ASKTEGEKVPLEKKLDKRGLL----DLG-  40

Query  63   YGGGYGHGHEEHVKTVTIEKKVPVPYEVTKHVPYLVEKPVPYEVKVGVPQPYTVEKHVPY  122
                YG+GH   + T  +       +    H   L     P  V VG   P     H   
Sbjct  41   ----YGYGHAG-LDTGYLGHGSISGHGSYGHGYGLTGYSAPAAVAVGHSGPAIAVGHTAP  95

Query  123  PVKVFVKVPVPVPQPYTVEKKIPYEVKVPVDKPYEVKVYVPQPYTV--EKHVPVPVKVPV  180
             V V        P PY + K+      + + K   V V+V +PY V  EK VPV VKVPV
Sbjct  96   AVAVH-----HAPAPYVISKQADVHKTITITKGIPVPVHVDRPYPVVHEKRVPVEVKVPV  150

Query  181  PQPYTVEKHVPYPVK----VKIPVPAPYPVEKHVPYEVKVPVDRPYPVHVPKPYPVTVEK  236
            PQPY V + VP  VK    V +PVP PY V +H    V VPVDRP PV VP+PYPV V K
Sbjct  151  PQPYEVIRKVPVTVKEYVKVPVPVPQPYEVIRHEKVPVHVPVDRPVPVEVPRPYPVPVAK  210

Query  237  PYPVPVDKPVPYEVKVPVEK  256
            PYPV V+K V  +V V V++
Sbjct  211  PYPVYVEKAVNVQVPVHVDR  230


 Score = 37.0 bits (84),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 59/130 (45%), Gaps = 30/130 (23%)

Query  201  PAPYPVEKHVPYEVKVPVDR--PYPVHVPKPYPVTVEK------------PYPVPVDKPV  246
            PAPY + K       + + +  P PVHV +PYPV  EK            PY V    PV
Sbjct  103  PAPYVISKQADVHKTITITKGIPVPVHVDRPYPVVHEKRVPVEVKVPVPQPYEVIRKVPV  162

Query  247  P--------------YEVKVPVEKPYPVPVEKPYPVPVKVPVPQPYTVHKPVPVPVEKPV  292
                           YEV    + P  VPV++  PVPV+VP P P  V KP PV VEK V
Sbjct  163  TVKEYVKVPVPVPQPYEVIRHEKVPVHVPVDR--PVPVEVPRPYPVPVAKPYPVYVEKAV  220

Query  293  PYPVKVPVDR  302
               V V VDR
Sbjct  221  NVQVPVHVDR  230


 Score = 28.9 bits (63),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 69/130 (53%), Gaps = 24/130 (18%)

Query  225  HVPKPYPVTVEKPY--PVPVDKPVPYEVKVPVEKPYPVPVEKPYPVPVKVPVPQPYTVHK  282
            H P PY ++ +      + + K +P  V V V++PYPV  EK  PV VKVPVPQPY V +
Sbjct  101  HAPAPYVISKQADVHKTITITKGIP--VPVHVDRPYPVVHEKRVPVEVKVPVPQPYEVIR  158

Query  283  PVPVPVE----------------KPVPYPVKVPVDRPYLVE--KEVPVPVEKEVPVPVK-  323
             VPV V+                +    PV VPVDRP  VE  +  PVPV K  PV V+ 
Sbjct  159  KVPVTVKEYVKVPVPVPQPYEVIRHEKVPVHVPVDRPVPVEVPRPYPVPVAKPYPVYVEK  218

Query  324  -VPVPVPVHV  332
             V V VPVHV
Sbjct  219  AVNVQVPVHV  228


>O97229_PLAF7 unnamed protein product
Length=525

 Score = 33.1 bits (74),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 75/251 (30%), Positives = 116/251 (46%), Gaps = 37/251 (15%)

Query  81   EKKVPVPYEVTKHVPYLVEKP--VPYEVKVGVPQPYTVEKHVPYPVKVFVKVPVPVPQPY  138
            EK + VP    +++  LVE P  +  E  + +P+P   E+       +F +  V VPQ  
Sbjct  107  EKIIEVPQ--VQYIEKLVEVPHVILQEKLIHIPKPVIHERIKKCSKTIFQEKIVEVPQIK  164

Query  139  TVEKKIPYEVKVPVDKPYEVKVYVPQPYTVEKHVPVPVKV----PVPQPYTVEKHVPYPV  194
             V+K     V+VP     E  + VP+    E+ +PVP K+     V  P    K++    
Sbjct  165  VVDKI----VEVPQYVYQEKIIEVPKIMVQERIIPVPKKIVKEKIVEIPQIELKNIDIEK  220

Query  195  KVKIPVPAPYPVEKHVPYEVKVPVDRPYPV-------HVPKPYPVTVEKPY---PVPVDK  244
              +IP   P  V+K +PY     VDRPY V       HV   Y   V   Y   P PV+ 
Sbjct  221  VQEIPEYIPEVVQKDIPY--TQIVDRPYHVEKIVEVPHVQHIYRNIVSPQYRHIPKPVEI  278

Query  245  PVPYEVKVPVEKPYPVPVEKPYPVPVKVPVPQPYTVHK--------PVPVPVEKPVPYPV  296
            P+ +    PVEK     V++  PVPV++ + Q +   K        PVPV V++ + +P+
Sbjct  279  PMAHYRTFPVEKI----VDRNVPVPVELQIVQEFLCPKIEARYKEIPVPVHVQRIIEHPI  334

Query  297  -KVPVDRPYLV  306
             K  ++ P+L+
Sbjct  335  PKDAMNNPHLL  345


 Score = 32.3 bits (72),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 47/92 (51%), Gaps = 14/92 (15%)

Query  257  PYPVPVEKPYPVPVKVPVPQPYTVHKPVPVPVEKPVPYPVKVPVD--RPY----LVEKEV  310
            PY   V++PY V   V VP    +++ +  P  + +P PV++P+   R +    +V++ V
Sbjct  237  PYTQIVDRPYHVEKIVEVPHVQHIYRNIVSPQYRHIPKPVEIPMAHYRTFPVEKIVDRNV  296

Query  311  PVPVEKEVPVPVKVP--------VPVPVHVHH  334
            PVPVE ++      P        +PVPVHV  
Sbjct  297  PVPVELQIVQEFLCPKIEARYKEIPVPVHVQR  328



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933616.1 heat shock factor 2-binding protein-like [Chelonus
insularis]

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PI3K1_DICDI  unnamed protein product                                  30.4    3.1  
TTC30_DROME  unnamed protein product                                  29.6    4.3  
Q38FQ7_TRYB2  unnamed protein product                                 29.6    5.3  


>PI3K1_DICDI unnamed protein product
Length=1571

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 22/42 (52%), Gaps = 0/42 (0%)

Query  265   IEESIVHCFEDCTPVEILTLVLQLLQSLTYNLLDPQILQRLL  306
             + E  V C ED +  E+L ++LQL+Q L Y       L R L
Sbjct  1134  VREFAVTCLEDLSEDELLDILLQLVQVLKYEPFHDSKLSRFL  1175


>TTC30_DROME unnamed protein product
Length=655

 Score = 29.6 bits (65),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 39/83 (47%), Gaps = 6/83 (7%)

Query  277  TPVEILT----LVLQLLQSLTYNLLDPQILQRLLEKLPMDKIKTLSASEDQDIRSDIAIK  332
            T  +IL     L  + L    Y LLD  I  +   +L   K+ TL++S    +RS +A K
Sbjct  330  TAADILAEHTDLTYKYLSQYLYELLDSLITAQTSAELAEKKLGTLASSLAGKLRS-LAAK  388

Query  333  AQEVLINLNNDQADADTLSNFSK  355
             QEV    N  QA  D L ++ +
Sbjct  389  VQEVRAT-NEQQALRDALKDYEQ  410


>Q38FQ7_TRYB2 unnamed protein product
Length=1919

 Score = 29.6 bits (65),  Expect = 5.3, Method: Composition-based stats.
 Identities = 19/69 (28%), Positives = 32/69 (46%), Gaps = 0/69 (0%)

Query  268   SIVHCFEDCTPVEILTLVLQLLQSLTYNLLDPQILQRLLEKLPMDKIKTLSASEDQDIRS  327
             ++VHCF D     ++ L+L  L+SL   +  P    +  E+   D  KT   +  +DI  
Sbjct  1496  ALVHCFHDDEDGLLMELMLPGLKSLDAFVEAPSTAAKAQERTRKDSGKTTKGTISEDIHP  1555

Query  328   DIAIKAQEV  336
              +    +EV
Sbjct  1556  SLPHADKEV  1564



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933617.1 ethanolamine kinase 1 [Chelonus insularis]

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EAS_DROME  unnamed protein product                                    322     1e-106
Q8IIB7_PLAF7  unnamed protein product                                 139     2e-37 
CKA2_CAEEL  unnamed protein product                                   103     1e-24 


>EAS_DROME unnamed protein product
Length=518

 Score = 322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/409 (41%), Positives = 236/409 (58%), Gaps = 79/409 (19%)

Query  14   IDENDSIDGAKKIVSKLRPTWSYDQLQYKI-----------------------FTNGITN  50
            ++E D I GAK+++  +RPTW    +++KI                       FT+GITN
Sbjct  101  VEEADVIQGAKELLKVIRPTWDLSHVEFKIRVVPQIEDRYPAQNAMVMMTLYSFTDGITN  160

Query  51   KLIGI---------------YLP---------------------------DRY-------  61
            KL+G                YLP                           DR        
Sbjct  161  KLVGCFHKEISKLNDENGGSYLPIKTQGLSPVQSEDPVIIEKEDDDEFTDDRAADDGSPV  220

Query  62   ---DEMVLVRIYGNKTDLLIDRKDEIRNIKIMNKAGYTHSLYATFNNGLAYEFLPGEILT  118
               D +VLVRIYGNKTDLLIDRK E +N  +++  G   SLYATF NGL YE++PG  L 
Sbjct  221  QYSDNVVLVRIYGNKTDLLIDRKAETQNFLLLHTYGLAPSLYATFKNGLVYEYVPGTTLN  280

Query  119  PETVKKPEIYCLVAKRLAQMHRLCPEECLPKFDGFSGSKEPVIWKKIERFMELMPKKFDD  178
             ++V  PEI+ LVA+R+A+MHR   +      D  +    P+IWKK + F++L+P++F D
Sbjct  281  TDSVLCPEIWPLVARRMAEMHRKVRKHG----DSSATKPMPMIWKKTQSFLDLVPERFSD  336

Query  179  SIKQSRFKKFIKPYKVLADEYKLLKNHLTQLDSPIVYAHNDLLLANILYDKENHTVTFID  238
            + K  R K+   P   L +E+  L  +L  LDSPIV++HNDLLL N++Y +  +TV FID
Sbjct  337  AEKHKRVKETFLPIGRLREEFNKLYEYLEALDSPIVFSHNDLLLGNVIYTQSLNTVNFID  396

Query  239  FEYSGFNYQAFDIANHFAEFAGVEEIDYSQYPDETYQRSWLRIYLQAYKQSSNVSEDEVT  298
            +EY+ +N+QAFDI NHFAE  GV+E+DYS+YP   +Q  WLR+YL+ Y Q SN+  DEV 
Sbjct  397  YEYADYNFQAFDIGNHFAEMCGVDEVDYSRYPKREFQLQWLRVYLEEYLQRSNIQNDEVE  456

Query  299  VLFKQINKFVLLAHFLWGCWALIQYEHSTIDFDFLNFAATRFNEYFKRR  347
            +L+ Q+N+F L +H  W  W+L+Q EHSTIDFD++ +A  R+NEY  R+
Sbjct  457  LLYVQVNQFALASHIFWTVWSLLQAEHSTIDFDYVGYAFLRYNEYLARK  505


>Q8IIB7_PLAF7 unnamed protein product
Length=423

 Score = 139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 98/335 (29%), Positives = 174/335 (52%), Gaps = 37/335 (11%)

Query  37   DQLQYKIFTNGITNKLIGIYLPDRYDEMVLVRIYGNKTDLLIDRKDEIRNIKIMNKAGYT  96
            + L ++I   GITN L+ +   + +    L+R+YG KT  +I+R+ E     I+     +
Sbjct  108  ESLNFEIIKGGITNILVKVE-DNIHQNKYLIRLYGPKTSEIINREREKLISNILCDKNIS  166

Query  97   HSLYATFNNGLAYEFLPGEILTPETVKKPEIYCLVAKRLAQMHRLCPEECLPK----FDG  152
              +Y  F NG   EF  G  L+ E +K  +    +A+ L  +H +  ++ + K       
Sbjct  167  KKIYVFFPNGRIEEFKDGYALSREDIKNKDFQKEIAENLRILHDIQLDDTIYKKLQALQN  226

Query  153  FSGSKEPVIWKKIERFMELMPKKFDDSIKQSRFKKFI---KPYKVLADEYKLLKNHLTQL  209
              G++   +W  + ++         +++K+ R KK+    K Y +   ++ +L++ +T++
Sbjct  227  IQGNRSSFLWSTLWKYF--------NTLKEERQKKYSFNPKAYILKLIDFDMLESIITEI  278

Query  210  -------DSPIVYAHNDLLLANILYDKENHTVTFIDFEYSGFNYQAFDIANHFAEFAGVE  262
                   +SP+V  H DLL +NI+   E  +++FIDFEYS    +A+DIANHF E+AG  
Sbjct  279  QELCCKKNSPVVLCHCDLLSSNII-KTEGSSISFIDFEYSCPMERAYDIANHFNEYAGFN  337

Query  263  EIDYSQYPDETYQRSWLRIYLQAYKQSSNVSEDE--VTVLFKQINKFVLLAHFLWGCWAL  320
              ++   P+ + +  +++ YL+        ++DE  +  L  +I  F + +H +WG WAL
Sbjct  338  -CEWDLTPNRSEEYHFIKHYLK--------TDDEQLINQLIDEIQPFYVCSHIVWGLWAL  388

Query  321  IQYEHSTIDFDFLNFAATRFNEYF--KRRGSLERD  353
            +Q  HS IDFDF+N+  TR    F  K R  LE++
Sbjct  389  LQGLHSVIDFDFINYGMTRLTAAFSVKFRSKLEKN  423


>CKA2_CAEEL unnamed protein product
Length=429

 Score = 103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 91/370 (25%), Positives = 160/370 (43%), Gaps = 75/370 (20%)

Query  33   TWSYDQLQYKIFTNGITN-----KLIGIYLPDRYD-EMVLVRIYGN-KTDLLIDRKDEIR  85
            T   + L+      G++N     +L  +Y P R +   VL+R+Y N +T+  +  +  I 
Sbjct  70   TVPLEHLRISRIKGGMSNMLFLCRLSEVYPPIRNEPNKVLLRVYFNPETESHLVAESVI-  128

Query  86   NIKIMNKAGYTHSLYATFNNGLAYEFLPGEILTPETVKKPEIYCLVAKRLAQMHRLCPEE  145
               ++++      LY  F+ G   E++P   L+   +    +   +AKR+A++H+L    
Sbjct  129  -FTLLSERHLGPKLYGIFSGGRLEEYIPSRPLSCHEISLAHMSTKIAKRVAKVHQL----  183

Query  146  CLPKFDGFSGSKEPVIWKKIERFMELMP---KKFDDSIKQSRFKKFIKPYKV--------  194
                        E  IWK+ +   E +    K+   ++      +F  P +         
Sbjct  184  ------------EVPIWKEPDYLCEALQRWLKQLTGTVDAEH--RFDLPEECGVSSVNCL  229

Query  195  -LADEYKLLKNHLTQLDSPIVYAHNDLLLANILYDKENHT--------------------  233
             LA E + L+ H++   SP+ + HNDL   NIL  K +                      
Sbjct  230  DLARELEFLRAHISLSKSPVTFCHNDLQEGNILLPKASSGNIRMPSLSDETQALGNSLSA  289

Query  234  -------VTFIDFEYSGFNYQAFDIANHFAEFA---GVEEIDYSQYPDETYQRS--WLRI  281
                   +  IDFEY+ +NY+AFD ANHF E+     ++E  + +   E +  +   L  
Sbjct  290  FNPADPRLVLIDFEYASYNYRAFDFANHFIEWTIDYDIDEAPFYKIQTENFPENDQMLEF  349

Query  282  YLQAYKQSSNVSEDEV----TVLFKQINKFVLLAHFLWGCWALIQYEHSTIDFDFLNFAA  337
            +L   ++  N  E+E+      L ++   FV ++HF WG W L+Q E S + F F ++  
Sbjct  350  FLNYLREQGNTRENELYKKSEDLVQETLPFVPVSHFFWGVWGLLQVELSPVGFGFADYGR  409

Query  338  TRFNEYFKRR  347
             R + YFK +
Sbjct  410  DRLSLYFKHK  419



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933618.1 protein FAM92A-B isoform X1 [Chelonus insularis]

Length=351


***** No hits found *****



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933619.1 protein FAM92A-B isoform X2 [Chelonus insularis]

Length=340


***** No hits found *****



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933620.1 mucin-17-like isoform X10 [Chelonus insularis]

Length=1879
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PC41_DROME  unnamed protein product                                 65.9    4e-10
M9PB30_DROME  unnamed protein product                                 64.7    1e-09
M9PBZ0_DROME  unnamed protein product                                 64.7    1e-09


>M9PC41_DROME unnamed protein product
Length=22743

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 248/1228 (20%), Positives = 429/1228 (35%), Gaps = 183/1228 (15%)

Query  425   LSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAATSILTIKT  484
             LSS  +  T   + S   T      TT FT E+  +   +  T  P +     + +T ++
Sbjct  4014  LSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSES  4073

Query  485   LPKEKDLDDTLDFRGRKEFKQASYTTSITFSNQNTENLLNDISSTNLSNNRRRGNKLFNK  544
               +E       D          +   SITF            ++TN+     RG      
Sbjct  4074  TTREVYTIKPFDRSTPTPVSPDTTVPSITFE-----------TTTNIPIGTTRG------  4116

Query  545   ASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNERSELPKINKYIYYQDDEVTKIITR  604
                     ++  +  + P E +  +          E S LP                   
Sbjct  4117  --------QVTEQTTSSPSEKRTTIRV--------EESTLPS------------------  4142

Query  605   HLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKL  661
               RSTD+  P    SE+ E P ++ S+S   T S+      +  P T     ST S   L
Sbjct  4143  --RSTDRTTP----SESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASL  4196

Query  662   EEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVT  721
             E     V  E  + + +    G  T        E++ S     R       S  P     
Sbjct  4197  ETTVPSVTLETTTNDPIGSTGGQVT--------EQTTSSPSEVRTTIGLEESTLPSRSTD  4248

Query  722   ISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-  780
              + P         S+S E       + I    + +   +T   P     ++ T  ++ L 
Sbjct  4249  RTTP---------SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLE  4299

Query  781   TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQ  828
             TTV  + LET T  P+            SS +   TT+++  +T  SR+  A     +  
Sbjct  4300  TTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS--ADRTTPSES  4357

Query  829   EPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRV  887
               TP ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T     
Sbjct  4358  PETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETT-----  4412

Query  888   WNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHL  947
               +  I     + T ++  + ++   T R   S+L +    +T+   +  P T T     
Sbjct  4413  -TNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTT--PSESPETPTTLPSD  4469

Query  948   EVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNK---------  998
              +++P +  T  +    V  T  + A   +  S + ++   P+V+LE             
Sbjct  4470  FITRPHSEKT-TESTRDVPTTRPFEASTPSSASLETTV---PSVTLETTTNVPIGSTGGQ  4525

Query  999   ------TNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV---  1049
                   ++ +E    I +  S+  +     + +     T   + S+ ++    + T    
Sbjct  4526  VTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTEST  4585

Query  1050  --APLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDAN  1107
                P      A  P+ A +   V S  +      P GS      +  G       P++  
Sbjct  4586  RDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGST---GGQVTGQT--TAPPSEFR  4640

Query  1108  STGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQR  1167
             +T     ++  S S    +P        + PS               D  +RT       
Sbjct  4641  TTIRVEESTLPSRSTDRTTPSESPETPTILPS---------------DSTTRTYSDQTTE  4685

Query  1168  STVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGR  1227
             ST  +   +     T   A  ++ V SV + +  + +  G  G  ++       ++V+  
Sbjct  4686  STRDVPTTRPFEASTPSPASLETTVPSVTLETTTN-VPIGSTGGQVTEQTTSSPSEVRTT  4744

Query  1228  VTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITAR--PINRLLEVFT  1285
             +            D+     +ESP    ++ S+ +  P S ++  + R  P  R  E  T
Sbjct  4745  IRVEESTLPSRSADRT--TPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEAST  4802

Query  1286  P-------LLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTT  1338
             P        + +  L   T++ I +    V+    +S +   TT    +ST  SR    T
Sbjct  4803  PSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT  4862

Query  1339  TMTNS--APTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLN  1396
             T + S   PT + +  +  P    +T ST    TT  F     P   S  TT   +    
Sbjct  4863  TPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA-STPSSASLETTVPSV----  4917

Query  1397  TLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAG--PTRSPKAIQPSNASPNSLD  1454
             TL  +   P  I ST   +TE      +++ +    +    P+RS     PS  SP +  
Sbjct  4918  TLETTTNVP--IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSE-SPETPT  4974

Query  1455  ILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTT  1514
              LP+ F  ++ P      +ST   P     TT PF     +  +  T+     + T T  
Sbjct  4975  TLPSDF--TTRPHSEQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTLETTTNV  5027

Query  1515  SITST----TTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTT  1570
              I ST    T  +T +PS  +       +  P+ +S++  T   +  + TT+P+   T T
Sbjct  5028  PIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPS-RSADRTTPSESPETPTTLPSDFITRT  5086

Query  1571  VTPKVI--TRKPVAVRPAPPPTTTQAPL  1596
              + +    TR     RP    T + A L
Sbjct  5087  YSDQTTESTRDVPTTRPFEASTPSPASL  5114


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 259/1275 (20%), Positives = 457/1275 (36%), Gaps = 228/1275 (18%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RS D+  P    SE+ E P  + S+      SE      +  P T     ST S   LE 
Sbjct  4347  RSADRTTP----SESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  4402

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T           ++   P    T      T R + + +
Sbjct  4403  TVPSVTLETTTNVPIGSTGGQVT----------GQTTSSPSEVRT------TIRVEES-T  4445

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-TT  782
             LP         S+S E       + I    ++K   +T   P     ++ T  ++ L TT
Sbjct  4446  LPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETT  4505

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  + LET T  P+            SS +   TT+++  +T  SR+ +   + ++ + P
Sbjct  4506  VPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETP  4565

Query  831   TPRSID------SHNTSRSVVSKPLTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKR  884
             T    D      S  T+ S    P TR         + ST + ++ ETT  SVT + T  
Sbjct  4566  TTLPSDFTIRPHSEQTTESTRDVPTTRPF-------EASTPSPASLETTVPSVTSETT--  4616

Query  885   PRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYR  944
                  +  I     + T ++    ++   T R   S+L +  T +T+   +  P T T  
Sbjct  4617  ----TNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTP--SESPETPTIL  4670

Query  945   RHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANET  1004
                  ++  +  T  +    V  T  + A   +  S + ++   P+V+LE    T  N  
Sbjct  4671  PSDSTTRTYSDQT-TESTRDVPTTRPFEASTPSPASLETTV---PSVTLE----TTTNVP  4722

Query  1005  FNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFA  1064
                 G   + +  S  S                      ++++T+    S L +++    
Sbjct  4723  IGSTGGQVTEQTTSSPS----------------------EVRTTIRVEESTLPSRS----  4756

Query  1065  GVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNA----STTSFISS  1120
                         A R TPS SP   +        F+ +P+   +T +     +T  F +S
Sbjct  4757  ------------ADRTTPSESPETPTTLPSD---FITRPHSEKTTESTRDVPTTRPFEAS  4801

Query  1121  SITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINY  1180
             + ++AS     P   +  ++  P G    Q  E+  +S ++     R+T+ + +    + 
Sbjct  4802  TPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE----VRTTIRVEESTLPSR  4857

Query  1181  WTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPL  1240
               + T  ++S      +                 P D +     +    +    P   P 
Sbjct  4858  SADRTTPSESPETPTTL-----------------PSDFITRPHSEKTTESTRDVPTTRPF  4900

Query  1241  DQIFGITTESPIIRASVASNTLDEPS--------------SSRSPITARPINRLLEVFTP  1286
             +     T  S  +  +V S TL+  +              ++ SP   R   R+ E   P
Sbjct  4901  E---ASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP  4957

Query  1287  LLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT----  1339
                    +R T  T  +++P   TT+ +  TT   +  TT+ST +   +RP   +T    
Sbjct  4958  -------SRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPA  5010

Query  1340  ---MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLN  1396
                 T  + T+ TTT +P  +     T   ++S + + TTI + + T    + D      
Sbjct  5011  SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADR-----  5065

Query  1397  TLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDIL  1456
                       + S +P+T T +      +  S   +++  TR     +P  AS  S    
Sbjct  5066  ---------TTPSESPETPTTLPSDFITRTYSDQTTES--TRDVPTTRPFEASTPS----  5110

Query  1457  PASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPFTWKPVTDVTSIT-SSKQTEI  1508
             PAS   + P +     ++T+  P+ +T       TT  P  ++    V   T  S+ T+ 
Sbjct  5111  PASLETTVPSVTS---ETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDR  5167

Query  1509  STKTTTSITSTTTTSTMT--PSASQIIFDT--FPTHPPTIKSSNLATILNTVTSSTTIPT  1564
             +T + +  T TT  S  T  P + Q    T   PT  P   S+     L T   S T+  
Sbjct  5168  TTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLE-  5226

Query  1565  ISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLK  1624
                TTT  P   T   V  +    P+  +  +    S L          P  S  +    
Sbjct  5227  ---TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTL----------PSRSADRTTPS  5273

Query  1625  KVIQTTLRPVQTTPKPIS---TTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYS  1681
             +  +T   P   T +P S   T + R++ A            SL +   S + +ATT   
Sbjct  5274  ESPETPTLPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVP  5333

Query  1682  PEEDAKFLLELLEAS-ERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHA  1739
                    + E   +S   V+   + E   L +          S +    +P   TT  H+
Sbjct  5334  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHS  5393

Query  1740  SKNAVLLAELLKAQGIKPST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTT  1793
              +      ++   +  + ST SS  L   +  +++ +TT +     G Q+   ++  P+ 
Sbjct  5394  DQTTECTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS-  5452

Query  1794  PRPRPTVKAQSSTYP  1808
                R T++ + ST P
Sbjct  5453  -EVRTTIRVEESTLP  5466


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 125/538 (23%), Positives = 202/538 (38%), Gaps = 86/538 (16%)

Query  1294  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLL  1353
             +R T  T  +++P   TT+ +  TT   +  TT+ST   R V TT    ++     T   
Sbjct  7651  SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST---RDVPTTRPFEASTPRPVTLET  7707

Query  1354  PTPTIAASTTSTMST-STTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTP  1412
               P++ + TT+ +   ST +  TT  +P     G+T   +A   T   S+ R  +I    
Sbjct  7708  AVPSVTSETTTNVPIGSTVTSETTTNVP----IGSTGGQVAGQTTAPPSEVR-TTIRVEE  7762

Query  1413  KTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLL  1472
              TL                    P+RS     PS  SP +   LP+ F  ++ P      
Sbjct  7763  STL--------------------PSRSADRTTPSE-SPETPTTLPSDF--TTRPHSEQTT  7799

Query  1473  QSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQT---------EISTKTTTSIT  1517
             +ST   P     TT PF   T  P    T V S+TS   T         +++ ++T+S +
Sbjct  7800  ESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7854

Query  1518  STTTTSTMTPSA--SQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKV  1575
                TT  +  S   S+    TFP+  P  K + L       +  TT P +  TT  T  V
Sbjct  7855  EVRTTIRVEESTLPSRSTDRTFPSESPE-KPTTLP------SDFTTRPHLEQTTESTRDV  7907

Query  1576  ITRKPVAVRPAPP------------PTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPL  1623
             +T +P       P             T+T  P+G     +         APP+  T + +
Sbjct  7908  LTTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVT----EQTTAPPSVRTTETI  7963

Query  1624  KKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPE  1683
              K     + P  T P  I  T            +      S    + S  P  +T+ + E
Sbjct  7964  VKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSE  8023

Query  1684  EDAKFLLELLEASERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKATTEDHASKNA  1743
             E  +    +   S R        SL+ +   +        GQ   +  K+ +E    +++
Sbjct  8024  ESTETTRPVPTVSPRDALETTVTSLI-TETTKTTSGGTPRGQVTERTTKSVSELTTGRSS  8082

Query  1744  VLLAELLKAQGIKPSTSSNHLREPLQGISITSTTTIGPQIISTSSKRPTTPRPRPTVK  1801
              ++ E      I  +T+  +  EP+   ++ +T +I      T +  PTT  P PT K
Sbjct  8083  DVVTERTMPSNISSTTTVFNNSEPVSD-NLPTTISI------TVTDSPTTV-PVPTCK  8132


 Score = 58.2 bits (139),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 235/1091 (22%), Positives = 384/1091 (35%), Gaps = 176/1091 (16%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST S   LE 
Sbjct  6734  RSTDRTTP----SESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLET  6789

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                   P + SE   N   GS+      +  E++ S     R  T  L   T        
Sbjct  6790  TV----PSVTSETTTNVPIGSTGG----QVTEQTTSSPSEVR-TTIGLEEST--------  6832

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-TT  782
             LP         S+S E       + I    + +   +T   P     ++ T   + L TT
Sbjct  6833  LPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETT  6892

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  +  ET T  P+            SS +   TT+ +  +T  SR+ +     ++ + P
Sbjct  6893  VPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETP  6952

Query  831   TPRSIDSHNTSRSVVSKPLTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNS  890
             T    D      S  +   TR    T R  + ST + ++ ETT  SVT + T    + ++
Sbjct  6953  TTLPSDFITRPHSDQTTESTRDVP-TTRPFEASTPSSASLETTVPSVTLETTTNVPIGST  7011

Query  891   A--YIDKNWQEPTK-KSDVTSTQATVTSRN---TYSSLTAEKTVQTSRRGNSRP---RTA  941
                  ++    P++ ++ +   ++T+ SR+   T  S + E          +RP   +T 
Sbjct  7012  GGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  7071

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTE--NSTQQSIKKEPAVSLELLNKT  999
                R +  +QP  + T +      A+ P            ST   + ++   S   +  T
Sbjct  7072  ESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTT  7131

Query  1000  NANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNAS--------LLEQIKSTVAP  1051
                E   L   ST     S + ++    P+  T   +S+ +          +  +S+   
Sbjct  7132  IRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPR  7191

Query  1052  LLSVLGAKAPAFAGVYRNVSSNETAAQ---RVTPSGSPPRFSARYRGVELFVRKPNDANS  1108
              +++  A  P  +    NV    T  Q   + TPS S  R + R        R  +    
Sbjct  7192  PVTLETAVPPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTP  7251

Query  1109  TGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRS  1168
             + +  T + + S  T       RP S  T  S      R +      ++S  +    + +
Sbjct  7252  SESPETPTTLPSDFTT------RPHSDQTTEST-----RDVPTTRPFESSTPRPVTLEIA  7300

Query  1169  TVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAI---NEGLPGSSISPLDILPNNQVQ  1225
                +  E   N     T    +   +   + V + I      LP  S       P+   +
Sbjct  7301  VPPVTSETTTNVAIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTD--RTTPSESPE  7358

Query  1226  GRVTAPPGFPWKDPLDQIFGITTESPIIR-------------ASVASNTLDEPSS-----  1267
                T P  F  +   DQ    T + P  R              +V S TL+  +S     
Sbjct  7359  TPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGS  7418

Query  1268  ---------SRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTT  1318
                      +  P   R   R+ E   P       +R T  T  +++P   TT+ +  TT
Sbjct  7419  TGGQVTGQTTAPPSEVRTTIRVEESTLP-------SRSTDRTPPSESPETPTTLPSDFTT  7471

Query  1319  PTTTTSTTKS-----------TTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMS  1367
                +  TT+S           ++  RPVT         T  TTT +P  +     T   +
Sbjct  7472  RPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPV-TSETTTNVPIGSTGGQVTGQTT  7530

Query  1368  TSTTSLFTTIGI-----PKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTLTEVER  1420
              + + + TTIG+     P +++  TT  +     T L SD+  RP+S  +T         
Sbjct  7531  ATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTES-------  7583

Query  1421  LLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPV  1480
                             TR     +P  AS  S    PAS   + P +    L++T+  P+
Sbjct  7584  ----------------TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTNVPI  7620

Query  1481  AAT-------TTTEPFTWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT--PSAS  1530
              +T       TT  P   +    V   T  S+ T+ +T + +  T TT  S  T  P + 
Sbjct  7621  GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD  7680

Query  1531  QIIFDT--FPTHPP----TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVR  1584
             Q    T   PT  P    T +   L T + +VTS TT   +   +TVT +  T  P+   
Sbjct  7681  QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTT-NVPIGSTVTSETTTNVPIGST  7739

Query  1585  PAPPPTTTQAP  1595
                    T AP
Sbjct  7740  GGQVAGQTTAP  7750


 Score = 58.2 bits (139),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 266/1247 (21%), Positives = 450/1247 (36%), Gaps = 232/1247 (19%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  4898  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEVRTTIRVEE  4953

Query  478   SIL----TIKTLPKEKDLDDTL---DFRGRKEFKQASYTTS-------ITFSNQNTENLL  523
             S L    T +T P E     T    DF  R   +Q + +T           S  +  +L 
Sbjct  4954  STLPSRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLE  5013

Query  524   NDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNERSE  583
               + S  L               I  TG ++  +  + P E +  +          E S 
Sbjct  5014  TTVPSVTLETT--------TNVPIGSTGGQVTEQTTSSPSEVRTTIRV--------EEST  5057

Query  584   LPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQG  643
             LP                     RS D+  P    SE+ E P  + S+    T S+    
Sbjct  5058  LPS--------------------RSADRTTP----SESPETPTTLPSDFITRTYSDQTTE  5093

Query  644   QKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSL  700
               +  P T     ST S   LE     V  E  +   +    G  T           ++ 
Sbjct  5094  STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVT----------GQTT  5143

Query  701   QDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGE-TIRIRQNQKERI  759
               P  + T      T R + + +LP         S+S E       + T R   +Q    
Sbjct  5144  APPSEFRT------TIRVEES-TLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTES  5196

Query  760   TTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL------------SSRNIDTTTVK  807
             T        F  S  +  S  TTV  + LET T  P+            SS +   TT++
Sbjct  5197  TRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIR  5256

Query  808   MLSTTRRSRAWNAAYIDKNWQEPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTT  866
             +  +T  SR+ +     ++ + PT   + S  T+R    +    +R     R  + ST +
Sbjct  5257  VEESTLPSRSADRTTPSESPETPT---LPSDFTTRPHSEQTTESTRDVPATRPFEASTPS  5313

Query  867   MSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEK  926
              ++ ETT  SVT + T       +  I     + T+++  + ++   T R   S+L +  
Sbjct  5314  PASLETTVPSVTSEAT------TNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS  5367

Query  927   TVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIK  986
             T +TS   +  P T T       ++P +  T  +    V  T  + A   +  S + ++ 
Sbjct  5368  TDRTSP--SESPETPTTLPSDFTTRPHSDQT-TECTRDVPTTRPFEASTPSSASLETTV-  5423

Query  987   KEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIK  1046
               P+V+LE    T  N      G   + +  S  S                      +++
Sbjct  5424  --PSVTLE----TTTNVPIGSTGGQVTEQTTSSPS----------------------EVR  5455

Query  1047  STVAPLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSP--PRFSARYRGVELFVRKPN  1104
             +T+    S L +++                A R TPS SP  P   +       F  +P+
Sbjct  5456  TTIRVEESTLPSRS----------------ADRTTPSESPETPTLPSD------FTTRPH  5493

Query  1105  DANSTGNA----STTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRT  1160
                +T +     +T  F +S+ ++AS     P   +  ++  P G    Q  E+  +S +
Sbjct  5494  SEQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS  5553

Query  1161  KEAGGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILP  1220
             +     R+T+ + +    +   + T  ++S       +   +  +     ++ S  D+  
Sbjct  5554  E----FRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHS--EQTTESTRDVPT  5607

Query  1221  NNQVQGRVTAPPGFPWKDPLDQIFGITTESPI--IRASVASNTLDEPSSSRSPITARPIN  1278
                 +    +P       P       TT  PI      V   T   PS  R+ I      
Sbjct  5608  TRPFEASTPSPASLETTVP-SVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTI------  5660

Query  1279  RLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPV  1335
             R+ E   P       +R T  T  +++P   T + +  TT T +  TT+ST +   +RP 
Sbjct  5661  RVEESTLP-------SRSTDRTTPSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPF  5713

Query  1336  TTTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTT  1388
               +T        T  + T+ TTT +P  +     T   + + + + TTIG+ + T    +
Sbjct  5714  EASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRS  5773

Query  1389  FDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNA  1448
              D                S S +P+T T +      +  S   +++  TR     +P  A
Sbjct  5774  TDR--------------TSPSESPETPTTLPSDFTTRPHSDQTTES--TRDVPTTRPFEA  5817

Query  1449  SPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAAT--TTTEPFTWKPVTDVTSITSSKQT  1506
             S  S    PAS   + P +     ++T+  P+ +T    TE  T  P    T+I   + T
Sbjct  5818  STPS----PASLETTVPSVTS---ETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEEST  5870

Query  1507  EISTKTT-TSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSN--------LATILNTVT  1557
               S  T  TS + +  T T  PS     F T P    T +S+          A+  +  +
Sbjct  5871  LPSRSTDRTSPSESPETPTTLPSD----FITRPHSDQTTESTRDVPTTRPFEASTPSPAS  5926

Query  1558  SSTTIPTI-SFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLL  1603
               TT+P++ S TTT  P   T   V  +   PP+  +  +G   S L
Sbjct  5927  LETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTL  5973


 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 219/1073 (20%), Positives = 366/1073 (34%), Gaps = 192/1073 (18%)

Query  629   LSESNISTLSEIFQGQKKRTPGTNFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSST--  686
             ++E   S+ SE+      R   +   +RS  +   ++    P L S+    P +  +T  
Sbjct  6127  VTEQTTSSPSEV--RTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTES  6184

Query  687   TLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTISLPKIDKKIA----------RTSK  736
             T +         S   P   +T  + S+T  T   + +     ++           RT+ 
Sbjct  6185  TRDVPTTRPFEASTPSPASLET-TVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTI  6243

Query  737   SIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL  796
              +E   +    T R   ++     TT  P D   +  +   +E T       +  T RP 
Sbjct  6244  GVEESTLPSRSTDRTSPSESPETPTT-LPSDFITRPHSEQTTESTR------DVPTTRPF  6296

Query  797   SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSIDSHNTSRSVVSKPLTRSRGYT  856
              +      ++K    +  S A     I     + T ++  S +  R+ +     R    T
Sbjct  6297  EASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI-----RVEEST  6351

Query  857   NRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSR  916
               +R    TT S +  T  ++    T RP   +    +     PT +   TST +  +  
Sbjct  6352  LPSRSTDRTTPSESPETPTTLPSDFTTRPH--SEKTTESTRDVPTTRPFETSTPSPASLE  6409

Query  917   NTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIK  976
              T  S+T E T                      S P  S  G+    + A   +    I+
Sbjct  6410  TTVPSVTLETTT---------------------SVPMGSTGGQVTGQTTAPPSEVRTTIR  6448

Query  977   TENSTQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLIN  1036
              E ST       P+ S +  + + + ET   +     +R +S           +TT    
Sbjct  6449  VEESTL------PSRSTDRTSPSESPETPTTLPSDFITRPHS----------EKTTESTR  6492

Query  1037  SNASLLEQIKSTVAPLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSP--PRFSARYR  1094
                +      ST +   S        F   Y+  +    +A R TPS SP  P   +   
Sbjct  6493  DVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSD--  6550

Query  1095  GVELFVRKPND---ANSTGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQD  1151
                 F  +P+      ST +  TT    +S  + +      PS  + ++ N   G     
Sbjct  6551  ----FTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQ  6606

Query  1152  IERDKASRTKEAGGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGS  1211
             +     +   E    R+T+ + +    +  T+ T  ++S     E  ++  +     P S
Sbjct  6607  VTGQTTAPPSEV---RTTIRVEESTLPSRSTDRTTPSESP----ETPTILPSDFTTRPHS  6659

Query  1212  ---SISPLDILPNNQVQGRVTAPPGFPWKDPLDQIFGITTESPI--IRASVASNTLDEPS  1266
                + S  D+      +     P       P       TT  PI      V   T   PS
Sbjct  6660  DQTTESTRDVPTTRPFEASTPRPVTLETAVP-SVTLETTTNVPIGSTGGQVTGQTTATPS  6718

Query  1267  SSRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1326
               R+ I      R+ E   P       +R T  T  +++P   TT+ +  TT   +  TT
Sbjct  6719  EVRTTI------RVEESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  6765

Query  1327  KSTTN---SRPVTTTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTT  1376
             +ST +   +RP   +T        T  + T  TTT +P  +     T   ++S + + TT
Sbjct  6766  ESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTT  6825

Query  1377  IG-----IPKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTL--------------  1415
             IG     +P +++  T+  +     T L SD+  RP+S  +T  T               
Sbjct  6826  IGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  6885

Query  1416  -----TEVERLLANKILSLALSQAG-------------------------PTRSPKAIQP  1445
                  T V  + +    ++ +   G                         P+RS     P
Sbjct  6886  PASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSP  6945

Query  1446  SNASPNSLDILPASF---GHS------------SPPIIIDLLQSTSKKPVAATTTTEPFT  1490
             S  SP +   LP+ F    HS            + P       S S +    + T E  T
Sbjct  6946  SE-SPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTT  7004

Query  1491  WKPVTD----VTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTI  1544
               P+      VT  T+S  +E+ T  +   S   + +T   TPS S     T P+   T 
Sbjct  7005  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTR  7064

Query  1545  KSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
               S+      T  SS  +PT       TP+ +T +  AV P    TTT  P+G
Sbjct  7065  PHSD-----QTTESSRDVPTTQPFEASTPRPVTLQ-TAVLPVTSETTTNVPIG  7111


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 89/357 (25%), Positives = 142/357 (40%), Gaps = 50/357 (14%)

Query  1247  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1304
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7207  TTNVPIGSTGGQVTEQTTPSPSEVRTTI------RIEESTFP-------SRSTDRTTPSE  7253

Query  1305  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1364
             +P   TT+ +  TT   +  TT+ST +    TT    +S P  +T  +   P  + +TT+
Sbjct  7254  SPETPTTLPSDFTTRPHSDQTTESTRDVP--TTRPFESSTPRPVTLEIAVPPVTSETTTN  7311

Query  1365  TMSTSTTSLFT--TIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLL  1422
                 ST    T  T   P +       ++    +TL        + S +P+T T +    
Sbjct  7312  VAIGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLPSDF  7367

Query  1423  ANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAA  1482
               +  S   +++  TR     +P  AS  S    PAS   + P +    L++T+  P+ +
Sbjct  7368  TTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTSVPMGS  7418

Query  1483  TTTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTH  1540
             T             VT  T++  +E+ T  +   S   + +T    PS S     T P+ 
Sbjct  7419  TG----------GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSD  7468

Query  1541  PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
               T   S+      T  SS  +PT     + TP+ +T + +AV P    TTT  P+G
Sbjct  7469  FTTRPHSD-----QTTESSRDVPTTQPFESSTPRPVTLE-IAVPPVTSETTTNVPIG  7519


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 241/1091 (22%), Positives = 391/1091 (36%), Gaps = 153/1091 (14%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST S   LE 
Sbjct  5366  RSTDRTSP----SESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEASTPSSASLET  5421

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T        E++ S     R       S  P      +
Sbjct  5422  TVPSVTLETTTNVPIGSTGGQVT--------EQTTSSPSEVRTTIRVEESTLPSRSADRT  5473

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTTV  783
              P         S+S E   +    T R    Q    T        F  S  +  S  TTV
Sbjct  5474  TP---------SESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASLETTV  5524

Query  784   EKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPT  831
               + LET T  P+            SS +   TT+++  +T  SR+ +     ++ + PT
Sbjct  5525  PSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPT  5584

Query  832   PRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNS  890
                + S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T       +
Sbjct  5585  ---LPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETT------TN  5635

Query  891   AYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEVS  950
               I     + T ++    ++   T R   S+L +  T +T+   +  P T T       +
Sbjct  5636  VPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTP--SESPETPTILPSDSTT  5693

Query  951   QPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLEL-----LNKTNANETF  1005
             +  +  T  +    V  T  + A   +  S + ++   P+V+LE      +  T    T 
Sbjct  5694  RTYSDQT-TESTRDVPTTRPFEASTPSPASLETTV---PSVTLETTTNVPIGSTGGQVTG  5749

Query  1006  NLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFAG  1065
                   +  R   G  +S +  P+R+T   + + S   +  +T+    +           
Sbjct  5750  QTTATPSEVRTTIGVEESTL--PSRSTDRTSPSES--PETPTTLPSDFTT----------  5795

Query  1066  VYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDAN-STGNASTTSFISSSITN  1124
               R  S   T + R  P+  P   S            P+ A+  T   S TS  ++++  
Sbjct  5796  --RPHSDQTTESTRDVPTTRPFEAST-----------PSPASLETTVPSVTSETTTNVPI  5842

Query  1125  ASPGG-LRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
              S GG +   +  +PS +    G     +      RT  +    +   +  + FI    +
Sbjct  5843  GSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSD-FITRPHS  5901

Query  1184  DTAQNDSRVVSVEINSVAS-----AINEGLPGSSISPLDILP----NNQVQGRVTAPPGF  1234
             D     +R V       AS     ++   +P  +      +P      QV G+ TAPP  
Sbjct  5902  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPS-  5960

Query  1235  PWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLA  1294
                        + T   +  +++ S + D  S S SP T      L   F    ++ Q  
Sbjct  5961  ----------EVRTTIGVEESTLPSRSTDRTSPSESPETP---TTLPSDFITRPHSEQTT  6007

Query  1295  RDTSITITNDAPTVSTTVGASM--TTPTTTTSTTKS----TTNSRPVTTTTMTNSAPTMM  1348
               T    T      ST   AS+  T P+ T+  T +    +T  R  TT + +   PT +
Sbjct  6008  ESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESPETPTTL  6067

Query  1349  TTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSI  1408
              +     P    +T ST    TT  F T   P   S  TT   +    TL  +   P  I
Sbjct  6068  PSDFTTRPHSEKTTESTRDVPTTRPFET-STPSPASLETTVPSV----TLETTTNVP--I  6120

Query  1409  SSTPKTLTEVERLLANKILSLALSQAG--PTRSPKAIQPSNASPNSLDILPASFGHSSPP  1466
              ST   +TE      +++ +    +    P+RS     PS  SP +   LP+ F  ++ P
Sbjct  6121  GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSE-SPET-PTLPSDF--TTRP  6176

Query  1467  IIIDLLQSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQTEISTKTTTSITSTT  1520
                   +ST   P     TT PF   T  P    T V S+TS   T +   +T      T
Sbjct  6177  HSEQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGG--QVT  6229

Query  1521  TTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPT-------ISFTTTVTP  1573
               +T  PS  +       +  P+ +S++  +   +  + TT+P+          TT  T 
Sbjct  6230  GQTTAPPSEVRTTIGVEESTLPS-RSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTR  6288

Query  1574  KVITRKPV-AVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLR  1632
              V T +P  A  P+P    T  P     +      G         TT  P +  ++TT+R
Sbjct  6289  DVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE--VRTTIR  6346

Query  1633  PVQTTPKPIST  1643
               ++T    ST
Sbjct  6347  VEESTLPSRST  6357


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 290/1354 (21%), Positives = 473/1354 (35%), Gaps = 241/1354 (18%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  5508  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEFRTTIRVEE  5563

Query  478   SIL----TIKTLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTEN  521
             S L      +T P E     TL  DF  R   +Q + +T          + T S  + E 
Sbjct  5564  STLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  5623

Query  522   LLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNER  581
              +  ++S   +N             I  TG ++ G+    P E +  +          E 
Sbjct  5624  TVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEVRTTIRV--------EE  5664

Query  582   SELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIF  641
             S LP                     RSTD+  P    SE+ E P ++ S+S   T S+  
Sbjct  5665  STLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQT  5700

Query  642   QGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESK  698
                 +  P T     ST S   LE     V  E  +   +    G  T   +   +E   
Sbjct  5701  TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT  5760

Query  699   SL-----QDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQ  753
             ++       P R       S +P T  T  LP                      T R   
Sbjct  5761  TIGVEESTLPSRSTDRTSPSESPETPTT--LPS-------------------DFTTRPHS  5799

Query  754   NQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL------------SSRNI  801
             +Q    T        F  S  +  S  TTV  +  ET T  P+            SS + 
Sbjct  5800  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSE  5859

Query  802   DTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSID------SHNTSRSVVSKPLTRS-RG  854
               TT+ +  +T  SR+ +     ++ + PT    D      S  T+ S    P TR    
Sbjct  5860  VRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEA  5919

Query  855   YTNRNRQISTTTMS-NNETTQK--------SVTFKVTKRPRVWNSAYIDKNWQEPTKKSD  905
              T     + TT  S  +ETT           VT + T  P    +    +    P++ +D
Sbjct  5920  STPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTD  5979

Query  906   VTSTQATVTSRNTYSS--LTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVS  963
              TS   +  +  T  S  +T   + QT+      P T    R  E S P  + + K  V 
Sbjct  5980  RTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTT----RPFEASTPSPA-SLKTTVP  6034

Query  964   SVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDS  1023
             SV      +  I    ST Q I   P+ S E      ++ T        S +      D 
Sbjct  6035  SVTSEATTNVPI---GSTGQRIGTTPSESPETPTTLPSDFTTR----PHSEKTTESTRDV  6087

Query  1024  NIFNPARTTYLINSNASLLEQIKS------TVAPLLSVLG------AKAPAFAGVYRNVS  1071
                 P  T+    S ASL   + S      T  P+ S  G        +P+       V 
Sbjct  6088  PTTRPFETS--TPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVE  6145

Query  1072  SN---ETAAQRVTPSGSP--PRFSARYRGVELFVRKPND---ANSTGNASTTSFISSSIT  1123
              +     +A R TPS SP  P   +       F  +P+      ST +  TT    +S  
Sbjct  6146  ESTLPSRSADRTTPSESPETPTLPSD------FTTRPHSEQTTESTRDVPTTRPFEASTP  6199

Query  1124  NASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
             + +      PS  + ++ N   G     +     +   E    R+T+ + +    +  T+
Sbjct  6200  SPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEV---RTTIGVEESTLPSRSTD  6256

Query  1184  DTAQNDSRVVSVEINS--VASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLD  1241
              T+ ++S      + S  +    +E    ++ S  D+      +    +P       P  
Sbjct  6257  RTSPSESPETPTTLPSDFITRPHSEQ---TTESTRDVPTTRPFEASTPSPASLKTTVP-S  6312

Query  1242  QIFGITTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSI  1299
                  TT  PI      V   T   PS  R+ I      R+ E   P       +R T  
Sbjct  6313  VTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDR  6359

Query  1300  TITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMT  1349
             T  +++P   TT+ +  TT   +  TT+ST +   +RP  T+T        T  + T+ T
Sbjct  6360  TTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLET  6419

Query  1350  TTLLPTPTIAASTTSTMSTSTTSLFTTIGI-----PKQTSFGTTFDDLAFLNTLLESDY-  1403
             TT +P  +     T   +   + + TTI +     P +++  T+  +     T L SD+ 
Sbjct  6420  TTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFI  6479

Query  1404  -RPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGH  1462
              RP+S  +T  T                      TR  +A  PS+AS         S  +
Sbjct  6480  TRPHSEKTTEST-----------------RDVPTTRPFEASTPSSAS---------SGNN  6513

Query  1463  SSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITSTTTT  1522
              S     +  + +++   +A  TT   + +  T  +  T+   +E +T++T  + +T   
Sbjct  6514  CSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPF  6573

Query  1523  STMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVA  1582
                TPS + +          T  +  + +    VT  TT P     TT+  +  T    +
Sbjct  6574  EASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRS  6633

Query  1583  VRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQ-TTPKPI  1641
                  P  + + P     ++L + F      P +  T +  + V   T RP + +TP+P+
Sbjct  6634  TDRTTPSESPETP-----TILPSDFTTR---PHSDQTTESTRDV--PTTRPFEASTPRPV  6683

Query  1642  STTAAREMYAASEQIN-HIDYSNSLVSGSKSTSP  1674
             +   A          N  I  +   V+G  + +P
Sbjct  6684  TLETAVPSVTLETTTNVPIGSTGGQVTGQTTATP  6717


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 216/1021 (21%), Positives = 361/1021 (35%), Gaps = 122/1021 (12%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGTN---FSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST     LE 
Sbjct  7142  RSTDRTTP----SESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLET  7197

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQD-----PKRYDTFKLSSITPRT  718
             A   V  E  +   +    G  T   +   +E   +++      P R       S +P T
Sbjct  7198  AVPPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPET  7257

Query  719   KVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVF-------VQ  771
               T  LP        + ++ E            R     R   + TP  V        V 
Sbjct  7258  PTT--LPSDFTTRPHSDQTTES----------TRDVPTTRPFESSTPRPVTLEIAVPPVT  7305

Query  772   SKTAYNSELTTVEKIKLETVTIRPLSSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPT  831
             S+T  N  + +      E  T  P   R    TT+++  +T  SR+ +     ++ + PT
Sbjct  7306  SETTTNVAIGSTGGQVTEQTTSSPSEVR----TTIRVEESTLPSRSTDRTTPSESPETPT  7361

Query  832   PRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKR-PRVWN  889
               ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T   P    
Sbjct  7362  --TLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGST  7419

Query  890   SAYIDKNWQEPTK--KSDVTSTQATVTSRN---TYSSLTAEKTVQTSRRGNSRP---RTA  941
                +      P    ++ +   ++T+ SR+   T  S + E          +RP   +T 
Sbjct  7420  GGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTT  7479

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNA  1001
                R +  +QP  S T +     +A+ P     + +E +T   I    +   ++  +T A
Sbjct  7480  ESSRDVPTTQPFESSTPRPVTLEIAVPP-----VTSETTTNVPIG---STGGQVTGQTTA  7531

Query  1002  --NETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV-----APLLS  1054
               +E    IG+  S+  +     +       T   + S+ +       T       P   
Sbjct  7532  TPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTR  7591

Query  1055  VLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNAST  1114
                A  P+ A +   V S         P GS      +  G       P++  +T     
Sbjct  7592  PFEASTPSPASLETTVPSVTLETTTNVPIGST---GGQVTGQT--TATPSEVRTTIGVEE  7646

Query  1115  TSFISSSITNASPGGLRPPSGVTPS--SINPQGGRIIQDIERDKASRTKEAGGQRSTVYI  1172
             ++  S S    +P          PS  +  P   +  +       +R  EA   R    +
Sbjct  7647  STLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRP---V  7703

Query  1173  GQEKFINYWTNDTAQNDSRVVSVEINS-VASAINEGLPGSSISPLDILPNNQVQGRVTAP  1231
               E  +   T++T  N      V I S V S     +P  S          QV G+ TAP
Sbjct  7704  TLETAVPSVTSETTTN------VPIGSTVTSETTTNVPIGSTG-------GQVAGQTTAP  7750

Query  1232  PGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNAN  1291
             P             + T   +  +++ S + D  + S SP T      L   FT   ++ 
Sbjct  7751  PS-----------EVRTTIRVEESTLPSRSADRTTPSESPETP---TTLPSDFTTRPHSE  7796

Query  1292  QLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTT-----TTMTNSAPT  1346
             Q    T    T      ST   AS+   TT  S T  TT + P+ +     T  + S+P+
Sbjct  7797  QTTESTRDVPTTRPFEASTPSPASLE--TTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7854

Query  1347  MMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLES-----  1401
              + T      TI    ++  S ST   F +    K T+  + F     L    ES     
Sbjct  7855  EVRT------TIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVL  7908

Query  1402  DYRPNSISS-TPKTL-TEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPAS  1459
               RP   S+ +P +L T V  + +    ++ +   G   + +   P +       I+ ++
Sbjct  7909  TTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTE-TIVKST  7967

Query  1460  FGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITST  1519
                 SP   I      ++ P+ +TT        P       TSS++ + ST+ T+  ++ 
Sbjct  7968  HPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTE  8027

Query  1520  TTTSTMTPSASQIIFDTFPTH-PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITR  1578
             TT    T S    +  T  +    T K+++  T    VT  TT      TT  +  V+T 
Sbjct  8028  TTRPVPTVSPRDALETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTE  8087

Query  1579  K  1579
             +
Sbjct  8088  R  8088


 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 82/356 (23%), Positives = 134/356 (38%), Gaps = 48/356 (13%)

Query  1247  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1304
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7003  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  7049

Query  1305  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1364
             +P   TT+ +  TT   +  TT+S+ +         +   P  + T +LP  +   +   
Sbjct  7050  SPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVP  7109

Query  1365  TMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLAN  1424
               ST       T   P +       ++    +TL        + S +P+T T +      
Sbjct  7110  IGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLP-----  7160

Query  1425  KILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSP-PIIIDLLQSTSKKPVAAT  1483
                      +  T  P + Q + +S +     P  F  S+P P+ ++    T+  PV + 
Sbjct  7161  ---------SDFTTRPHSDQTTESSRDVPTTQP--FESSTPRPVTLE----TAVPPVTSE  7205

Query  1484  TTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHP  1541
             TTT          VT  T+   +E+ T  +   S   + +T   TPS S     T P+  
Sbjct  7206  TTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDF  7265

Query  1542  PTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
              T   S+      T  S+  +PT     + TP+ +T + +AV P    TTT   +G
Sbjct  7266  TTRPHSD-----QTTESTRDVPTTRPFESSTPRPVTLE-IAVPPVTSETTTNVAIG  7315


 Score = 44.7 bits (104),  Expect = 0.001, Method: Composition-based stats.
 Identities = 111/466 (24%), Positives = 170/466 (36%), Gaps = 74/466 (16%)

Query  1223  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1282
             QV G+ TAPP             + T   +  +++ S + D  + S SP T         
Sbjct  6606  QVTGQTTAPPS-----------EVRTTIRVEESTLPSRSTDRTTPSESPETP--------  6646

Query  1283  VFTPLLNANQLARDTSITITNDAPTV---STTVGASMTTPTTTTSTTKSTTNSRPVTTTT  1339
                P     +   D +   T D PT      +    +T  T   S T  TT + P+ +T 
Sbjct  6647  TILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTG  6706

Query  1340  -----MTNSAPTMMTTTL------LP--------------TPTIAASTTSTMSTSTTSLF  1374
                   T + P+ + TT+      LP              TPT   S  +T   S  +  
Sbjct  6707  GQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTE  6766

Query  1375  TTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNS----ISSTPKTLTEVERLLANKI-LSL  1429
             +T  +P    F  +    A L T + S     +    I ST   +TE      +++  ++
Sbjct  6767  STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTI  6826

Query  1430  ALSQAG-PTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEP  1488
              L ++  P+RS     PS  SP +   LP+ F   + P      +ST   P     TT P
Sbjct  6827  GLEESTLPSRSTDRTSPSE-SPETPTTLPSDF--ITRPHSDQTTESTRDVP-----TTRP  6878

Query  1489  F---TWKPV---TDVTSITSSKQTEISTKTTTSITSTTTTSTMTPSASQIIFD--TFPTH  1540
             F   T  P    T V S+TS   T +   +T    +  TTS+ +   + I  +  T P+ 
Sbjct  6879  FEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSR  6938

Query  1541  PP--TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV-AVRPAPPPTTTQAPLG  1597
                 T  S +  T     +   T P    TT  T  V T +P  A  P+     T  P  
Sbjct  6939  STDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSV  6998

Query  1598  FGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPIST  1643
                +      G         TT  P +  ++TT+R  ++T    ST
Sbjct  6999  TLETTTNVPIGSTGGQVTEQTTSSPSE--VRTTIRVEESTLPSRST  7042


 Score = 42.7 bits (99),  Expect = 0.004, Method: Composition-based stats.
 Identities = 121/593 (20%), Positives = 217/593 (37%), Gaps = 84/593 (14%)

Query  1242  QIFGITTESP--------IIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQL  1293
             Q+   TT SP        +  +++ S + D  + S SP T      L   FT   ++ Q 
Sbjct  4321  QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETP---TTLPSDFTTRPHSEQT  4377

Query  1294  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTT-----MTNSAPTMM  1348
                T    T      ST   AS+ T  T  S T  TT + P+ +T       T S+P+ +
Sbjct  4378  TESTRDVPTTRPFEASTPSPASLET--TVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEV  4435

Query  1349  TTTL------LPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESD  1402
              TT+      LP+ + A  TT + S  T +   +  I +  S  TT        T     
Sbjct  4436  RTTIRVEESTLPSRS-ADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTT-----  4489

Query  1403  YRPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGH  1462
              RP   +STP + + +E  + +  L    +    +   +  + + +SP+ +         
Sbjct  4490  -RPFE-ASTPSSAS-LETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVR--------  4538

Query  1463  SSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITSTTTT  1522
                   I + +ST     A  TT       P T  +  T    +E +T++T  + +T   
Sbjct  4539  ----TTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTESTRDVPTTRPF  4594

Query  1523  STMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVA  1582
                TPS + +          T  +  + +    VT  TT P   F TT+  +  T    +
Sbjct  4595  EASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRS  4654

Query  1583  VRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPIS  1642
                  P  + + P                  P  STT+    +  ++T     T P   S
Sbjct  4655  TDRTTPSESPETP---------------TILPSDSTTRTYSDQTTESTRDVPTTRPFEAS  4699

Query  1643  TTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKFLLELLEASERVKKG  1702
             T +   +      +  ++ + ++  GS        T  SP E  +  + + E++   +  
Sbjct  4700  TPSPASLETTVPSVT-LETTTNVPIGSTGGQVTEQTTSSPSE-VRTTIRVEESTLPSRSA  4757

Query  1703  DKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKPST-S  1760
             D+      +   E       S +    +P    T  H+ K      ++   +  + ST S
Sbjct  4758  DR------TTPSE-------SPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPS  4804

Query  1761  SNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1808
             S  L   +  +++ +TT +     G Q+   ++  P+    R T++ + ST P
Sbjct  4805  SASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIRVEESTLP  4855


 Score = 37.7 bits (86),  Expect = 0.15, Method: Composition-based stats.
 Identities = 46/172 (27%), Positives = 69/172 (40%), Gaps = 24/172 (14%)

Query  1493   PVTDVTSITSSKQTEISTKT--TTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLA  1550
              P + V +I S     IS  T    +I S    +   PS   I   + P   PT  S    
Sbjct  19088  PTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPG--  19145

Query  1551   TILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRN  1610
               I+N  +    +P+       TP VI    +  +P PPP   Q  +    S+ Q      
Sbjct  19146  -IINIPSVPQPLPS------PTPGVIN---IPQQPTPPPLVQQPGIINIPSVQQ------  19189

Query  1611   IFAPPTSTTQKPLKKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYS  1662
                 P T TTQ P++ V   T RP Q TP  I+  +  +    +++ ++ D S
Sbjct  19190  ---PSTPTTQHPIQDVQYETQRP-QPTPGVINIPSVSQPTYPTQKPSYQDTS  19237


 Score = 35.0 bits (79),  Expect = 0.93, Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 60/168 (36%), Gaps = 28/168 (17%)

Query  1223  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1282
             QV  + TAPP             + T   I++++  + + D    S  P T  P+     
Sbjct  7946  QVTEQTTAPPS------------VRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTR  7993

Query  1283  VFTPLL----------------NANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1326
             ++T                    + +L  + S   T   PTVS       T  +  T TT
Sbjct  7994  LYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETT  8053

Query  1327  KSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1374
             K+T+   P    T   +      TT   +  +   T  +  +STT++F
Sbjct  8054  KTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTVF  8101


>M9PB30_DROME unnamed protein product
Length=22949

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 248/1228 (20%), Positives = 429/1228 (35%), Gaps = 183/1228 (15%)

Query  425   LSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAATSILTIKT  484
             LSS  +  T   + S   T      TT FT E+  +   +  T  P +     + +T ++
Sbjct  4014  LSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSES  4073

Query  485   LPKEKDLDDTLDFRGRKEFKQASYTTSITFSNQNTENLLNDISSTNLSNNRRRGNKLFNK  544
               +E       D          +   SITF            ++TN+     RG      
Sbjct  4074  TTREVYTIKPFDRSTPTPVSPDTTVPSITFE-----------TTTNIPIGTTRG------  4116

Query  545   ASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNERSELPKINKYIYYQDDEVTKIITR  604
                     ++  +  + P E +  +          E S LP                   
Sbjct  4117  --------QVTEQTTSSPSEKRTTIRV--------EESTLPS------------------  4142

Query  605   HLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKL  661
               RSTD+  P    SE+ E P ++ S+S   T S+      +  P T     ST S   L
Sbjct  4143  --RSTDRTTP----SESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASL  4196

Query  662   EEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVT  721
             E     V  E  + + +    G  T        E++ S     R       S  P     
Sbjct  4197  ETTVPSVTLETTTNDPIGSTGGQVT--------EQTTSSPSEVRTTIGLEESTLPSRSTD  4248

Query  722   ISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-  780
              + P         S+S E       + I    + +   +T   P     ++ T  ++ L 
Sbjct  4249  RTTP---------SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLE  4299

Query  781   TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQ  828
             TTV  + LET T  P+            SS +   TT+++  +T  SR+  A     +  
Sbjct  4300  TTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS--ADRTTPSES  4357

Query  829   EPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRV  887
               TP ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T     
Sbjct  4358  PETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETT-----  4412

Query  888   WNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHL  947
               +  I     + T ++  + ++   T R   S+L +    +T+   +  P T T     
Sbjct  4413  -TNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTTP--SESPETPTTLPSD  4469

Query  948   EVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNK---------  998
              +++P +  T  +    V  T  + A   +  S + ++   P+V+LE             
Sbjct  4470  FITRPHSEKT-TESTRDVPTTRPFEASTPSSASLETTV---PSVTLETTTNVPIGSTGGQ  4525

Query  999   ------TNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV---  1049
                   ++ +E    I +  S+  +     + +     T   + S+ ++    + T    
Sbjct  4526  VTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTEST  4585

Query  1050  --APLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDAN  1107
                P      A  P+ A +   V S  +      P GS      +  G       P++  
Sbjct  4586  RDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGST---GGQVTGQT--TAPPSEFR  4640

Query  1108  STGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQR  1167
             +T     ++  S S    +P        + PS               D  +RT       
Sbjct  4641  TTIRVEESTLPSRSTDRTTPSESPETPTILPS---------------DSTTRTYSDQTTE  4685

Query  1168  STVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGR  1227
             ST  +   +     T   A  ++ V SV + +  + +  G  G  ++       ++V+  
Sbjct  4686  STRDVPTTRPFEASTPSPASLETTVPSVTLETTTN-VPIGSTGGQVTEQTTSSPSEVRTT  4744

Query  1228  VTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITAR--PINRLLEVFT  1285
             +            D+     +ESP    ++ S+ +  P S ++  + R  P  R  E  T
Sbjct  4745  IRVEESTLPSRSADRT--TPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEAST  4802

Query  1286  P-------LLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTT  1338
             P        + +  L   T++ I +    V+    +S +   TT    +ST  SR    T
Sbjct  4803  PSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT  4862

Query  1339  TMTNS--APTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLN  1396
             T + S   PT + +  +  P    +T ST    TT  F     P   S  TT   +    
Sbjct  4863  TPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA-STPSSASLETTVPSV----  4917

Query  1397  TLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAG--PTRSPKAIQPSNASPNSLD  1454
             TL  +   P  I ST   +TE      +++ +    +    P+RS     PS  SP +  
Sbjct  4918  TLETTTNVP--IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSE-SPETPT  4974

Query  1455  ILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTT  1514
              LP+ F  ++ P      +ST   P     TT PF     +  +  T+     + T T  
Sbjct  4975  TLPSDF--TTRPHSEQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTLETTTNV  5027

Query  1515  SITST----TTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTT  1570
              I ST    T  +T +PS  +       +  P+ +S++  T   +  + TT+P+   T T
Sbjct  5028  PIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPS-RSADRTTPSESPETPTTLPSDFITRT  5086

Query  1571  VTPKVI--TRKPVAVRPAPPPTTTQAPL  1596
              + +    TR     RP    T + A L
Sbjct  5087  YSDQTTESTRDVPTTRPFEASTPSPASL  5114


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 125/538 (23%), Positives = 202/538 (38%), Gaps = 86/538 (16%)

Query  1294  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLL  1353
             +R T  T  +++P   TT+ +  TT   +  TT+ST   R V TT    ++     T   
Sbjct  7651  SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST---RDVPTTRPFEASTPRPVTLET  7707

Query  1354  PTPTIAASTTSTMST-STTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTP  1412
               P++ + TT+ +   ST +  TT  +P     G+T   +A   T   S+ R  +I    
Sbjct  7708  AVPSVTSETTTNVPIGSTVTSETTTNVP----IGSTGGQVAGQTTAPPSEVR-TTIRVEE  7762

Query  1413  KTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLL  1472
              TL                    P+RS     PS  SP +   LP+ F  ++ P      
Sbjct  7763  STL--------------------PSRSADRTTPSE-SPETPTTLPSDF--TTRPHSEQTT  7799

Query  1473  QSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQT---------EISTKTTTSIT  1517
             +ST   P     TT PF   T  P    T V S+TS   T         +++ ++T+S +
Sbjct  7800  ESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7854

Query  1518  STTTTSTMTPSA--SQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKV  1575
                TT  +  S   S+    TFP+  P  K + L       +  TT P +  TT  T  V
Sbjct  7855  EVRTTIRVEESTLPSRSTDRTFPSESPE-KPTTLP------SDFTTRPHLEQTTESTRDV  7907

Query  1576  ITRKPVAVRPAPP------------PTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPL  1623
             +T +P       P             T+T  P+G     +         APP+  T + +
Sbjct  7908  LTTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVT----EQTTAPPSVRTTETI  7963

Query  1624  KKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPE  1683
              K     + P  T P  I  T            +      S    + S  P  +T+ + E
Sbjct  7964  VKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSE  8023

Query  1684  EDAKFLLELLEASERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKATTEDHASKNA  1743
             E  +    +   S R        SL+ +   +        GQ   +  K+ +E    +++
Sbjct  8024  ESTETTRPVPTVSPRDALETTVTSLI-TETTKTTSGGTPRGQVTERTTKSVSELTTGRSS  8082

Query  1744  VLLAELLKAQGIKPSTSSNHLREPLQGISITSTTTIGPQIISTSSKRPTTPRPRPTVK  1801
              ++ E      I  +T+  +  EP+   ++ +T +I      T +  PTT  P PT K
Sbjct  8083  DVVTERTMPSNISSTTTVFNNSEPVSD-NLPTTISI------TVTDSPTTV-PVPTCK  8132


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 259/1275 (20%), Positives = 457/1275 (36%), Gaps = 228/1275 (18%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RS D+  P    SE+ E P  + S+      SE      +  P T     ST S   LE 
Sbjct  4347  RSADRTTP----SESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  4402

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T           ++   P    T      T R + + +
Sbjct  4403  TVPSVTLETTTNVPIGSTGGQVT----------GQTTSSPSEVRT------TIRVEES-T  4445

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-TT  782
             LP         S+S E       + I    ++K   +T   P     ++ T  ++ L TT
Sbjct  4446  LPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETT  4505

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  + LET T  P+            SS +   TT+++  +T  SR+ +   + ++ + P
Sbjct  4506  VPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETP  4565

Query  831   TPRSID------SHNTSRSVVSKPLTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKR  884
             T    D      S  T+ S    P TR         + ST + ++ ETT  SVT + T  
Sbjct  4566  TTLPSDFTIRPHSEQTTESTRDVPTTRPF-------EASTPSPASLETTVPSVTSETT--  4616

Query  885   PRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYR  944
                  +  I     + T ++    ++   T R   S+L +  T +T+   +  P T T  
Sbjct  4617  ----TNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTP--SESPETPTIL  4670

Query  945   RHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANET  1004
                  ++  +  T  +    V  T  + A   +  S + ++   P+V+LE    T  N  
Sbjct  4671  PSDSTTRTYSDQT-TESTRDVPTTRPFEASTPSPASLETTV---PSVTLE----TTTNVP  4722

Query  1005  FNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFA  1064
                 G   + +  S  S                      ++++T+    S L +++    
Sbjct  4723  IGSTGGQVTEQTTSSPS----------------------EVRTTIRVEESTLPSRS----  4756

Query  1065  GVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNA----STTSFISS  1120
                         A R TPS SP   +        F+ +P+   +T +     +T  F +S
Sbjct  4757  ------------ADRTTPSESPETPTTLPSD---FITRPHSEKTTESTRDVPTTRPFEAS  4801

Query  1121  SITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINY  1180
             + ++AS     P   +  ++  P G    Q  E+  +S ++     R+T+ + +    + 
Sbjct  4802  TPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE----VRTTIRVEESTLPSR  4857

Query  1181  WTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPL  1240
               + T  ++S      +                 P D +     +    +    P   P 
Sbjct  4858  SADRTTPSESPETPTTL-----------------PSDFITRPHSEKTTESTRDVPTTRPF  4900

Query  1241  DQIFGITTESPIIRASVASNTLDEPS--------------SSRSPITARPINRLLEVFTP  1286
             +     T  S  +  +V S TL+  +              ++ SP   R   R+ E   P
Sbjct  4901  E---ASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP  4957

Query  1287  LLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT----  1339
                    +R T  T  +++P   TT+ +  TT   +  TT+ST +   +RP   +T    
Sbjct  4958  -------SRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPA  5010

Query  1340  ---MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLN  1396
                 T  + T+ TTT +P  +     T   ++S + + TTI + + T    + D      
Sbjct  5011  SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADR-----  5065

Query  1397  TLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDIL  1456
                       + S +P+T T +      +  S   +++  TR     +P  AS  S    
Sbjct  5066  ---------TTPSESPETPTTLPSDFITRTYSDQTTES--TRDVPTTRPFEASTPS----  5110

Query  1457  PASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPFTWKPVTDVTSIT-SSKQTEI  1508
             PAS   + P +     ++T+  P+ +T       TT  P  ++    V   T  S+ T+ 
Sbjct  5111  PASLETTVPSVTS---ETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDR  5167

Query  1509  STKTTTSITSTTTTSTMT--PSASQIIFDT--FPTHPPTIKSSNLATILNTVTSSTTIPT  1564
             +T + +  T TT  S  T  P + Q    T   PT  P   S+     L T   S T+  
Sbjct  5168  TTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLE-  5226

Query  1565  ISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLK  1624
                TTT  P   T   V  +    P+  +  +    S L          P  S  +    
Sbjct  5227  ---TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTL----------PSRSADRTTPS  5273

Query  1625  KVIQTTLRPVQTTPKPIS---TTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYS  1681
             +  +T   P   T +P S   T + R++ A            SL +   S + +ATT   
Sbjct  5274  ESPETPTLPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVP  5333

Query  1682  PEEDAKFLLELLEAS-ERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHA  1739
                    + E   +S   V+   + E   L +          S +    +P   TT  H+
Sbjct  5334  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHS  5393

Query  1740  SKNAVLLAELLKAQGIKPST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTT  1793
              +      ++   +  + ST SS  L   +  +++ +TT +     G Q+   ++  P+ 
Sbjct  5394  DQTTECTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS-  5452

Query  1794  PRPRPTVKAQSSTYP  1808
                R T++ + ST P
Sbjct  5453  -EVRTTIRVEESTLP  5466


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 89/357 (25%), Positives = 142/357 (40%), Gaps = 50/357 (14%)

Query  1247  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1304
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7207  TTNVPIGSTGGQVTEQTTPSPSEVRTTI------RIEESTFP-------SRSTDRTTPSE  7253

Query  1305  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1364
             +P   TT+ +  TT   +  TT+ST +    TT    +S P  +T  +   P  + +TT+
Sbjct  7254  SPETPTTLPSDFTTRPHSDQTTESTRDVP--TTRPFESSTPRPVTLEIAVPPVTSETTTN  7311

Query  1365  TMSTSTTSLFT--TIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLL  1422
                 ST    T  T   P +       ++    +TL        + S +P+T T +    
Sbjct  7312  VAIGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLPSDF  7367

Query  1423  ANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAA  1482
               +  S   +++  TR     +P  AS  S    PAS   + P +    L++T+  P+ +
Sbjct  7368  TTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTSVPMGS  7418

Query  1483  TTTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTH  1540
             T             VT  T++  +E+ T  +   S   + +T    PS S     T P+ 
Sbjct  7419  TG----------GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSD  7468

Query  1541  PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
               T   S+      T  SS  +PT     + TP+ +T + +AV P    TTT  P+G
Sbjct  7469  FTTRPHSD-----QTTESSRDVPTTQPFESSTPRPVTLE-IAVPPVTSETTTNVPIG  7519


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 235/1091 (22%), Positives = 384/1091 (35%), Gaps = 176/1091 (16%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST S   LE 
Sbjct  6734  RSTDRTTP----SESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLET  6789

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                   P + SE   N   GS+      +  E++ S     R  T  L   T        
Sbjct  6790  TV----PSVTSETTTNVPIGSTGG----QVTEQTTSSPSEVR-TTIGLEEST--------  6832

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-TT  782
             LP         S+S E       + I    + +   +T   P     ++ T   + L TT
Sbjct  6833  LPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETT  6892

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  +  ET T  P+            SS +   TT+ +  +T  SR+ +     ++ + P
Sbjct  6893  VPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETP  6952

Query  831   TPRSIDSHNTSRSVVSKPLTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNS  890
             T    D      S  +   TR    T R  + ST + ++ ETT  SVT + T    + ++
Sbjct  6953  TTLPSDFITRPHSDQTTESTRDVP-TTRPFEASTPSSASLETTVPSVTLETTTNVPIGST  7011

Query  891   A--YIDKNWQEPTK-KSDVTSTQATVTSRN---TYSSLTAEKTVQTSRRGNSRP---RTA  941
                  ++    P++ ++ +   ++T+ SR+   T  S + E          +RP   +T 
Sbjct  7012  GGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  7071

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTE--NSTQQSIKKEPAVSLELLNKT  999
                R +  +QP  + T +      A+ P            ST   + ++   S   +  T
Sbjct  7072  ESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTT  7131

Query  1000  NANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNAS--------LLEQIKSTVAP  1051
                E   L   ST     S + ++    P+  T   +S+ +          +  +S+   
Sbjct  7132  IRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPR  7191

Query  1052  LLSVLGAKAPAFAGVYRNVSSNETAAQ---RVTPSGSPPRFSARYRGVELFVRKPNDANS  1108
              +++  A  P  +    NV    T  Q   + TPS S  R + R        R  +    
Sbjct  7192  PVTLETAVPPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTP  7251

Query  1109  TGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRS  1168
             + +  T + + S  T       RP S  T  S      R +      ++S  +    + +
Sbjct  7252  SESPETPTTLPSDFTT------RPHSDQTTEST-----RDVPTTRPFESSTPRPVTLEIA  7300

Query  1169  TVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAI---NEGLPGSSISPLDILPNNQVQ  1225
                +  E   N     T    +   +   + V + I      LP  S       P+   +
Sbjct  7301  VPPVTSETTTNVAIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTD--RTTPSESPE  7358

Query  1226  GRVTAPPGFPWKDPLDQIFGITTESPIIR-------------ASVASNTLDEPSS-----  1267
                T P  F  +   DQ    T + P  R              +V S TL+  +S     
Sbjct  7359  TPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGS  7418

Query  1268  ---------SRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTT  1318
                      +  P   R   R+ E   P       +R T  T  +++P   TT+ +  TT
Sbjct  7419  TGGQVTGQTTAPPSEVRTTIRVEESTLP-------SRSTDRTPPSESPETPTTLPSDFTT  7471

Query  1319  PTTTTSTTKS-----------TTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMS  1367
                +  TT+S           ++  RPVT         T  TTT +P  +     T   +
Sbjct  7472  RPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPV-TSETTTNVPIGSTGGQVTGQTT  7530

Query  1368  TSTTSLFTTIGI-----PKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTLTEVER  1420
              + + + TTIG+     P +++  TT  +     T L SD+  RP+S  +T         
Sbjct  7531  ATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTES-------  7583

Query  1421  LLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPV  1480
                             TR     +P  AS  S    PAS   + P +    L++T+  P+
Sbjct  7584  ----------------TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTNVPI  7620

Query  1481  AAT-------TTTEPFTWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT--PSAS  1530
              +T       TT  P   +    V   T  S+ T+ +T + +  T TT  S  T  P + 
Sbjct  7621  GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD  7680

Query  1531  QIIFDT--FPTHPP----TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVR  1584
             Q    T   PT  P    T +   L T + +VTS TT   +   +TVT +  T  P+   
Sbjct  7681  QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTT-NVPIGSTVTSETTTNVPIGST  7739

Query  1585  PAPPPTTTQAP  1595
                    T AP
Sbjct  7740  GGQVAGQTTAP  7750


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 225/1044 (22%), Positives = 385/1044 (37%), Gaps = 178/1044 (17%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RS D+  P    SE+ E P  + S+    T S+      +  P T     ST S   LE 
Sbjct  5061  RSADRTTP----SESPETPTTLPSDFITRTYSDQTTESTRDVPTTRPFEASTPSPASLET  5116

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T           ++   P  + T      T R + + +
Sbjct  5117  TVPSVTSETTTNVPIGSTGGQVT----------GQTTAPPSEFRT------TIRVEES-T  5159

Query  724   LPKIDKKIARTSKSIERGNVTIGE-TIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTT  782
             LP         S+S E       + T R   +Q    T        F  S  +  S  TT
Sbjct  5160  LPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETT  5219

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  + LET T  P+            SS +   TT+++  +T  SR+ +     ++ + P
Sbjct  5220  VPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETP  5279

Query  831   TPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWN  889
             T   + S  T+R    +    +R     R  + ST + ++ ETT  SVT + T       
Sbjct  5280  T---LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEAT------T  5330

Query  890   SAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEV  949
             +  I     + T+++  + ++   T R   S+L +  T +TS   +  P T T       
Sbjct  5331  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSP--SESPETPTTLPSDFT  5388

Query  950   SQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANETFNLIG  1009
             ++P +  T  +    V  T  + A   +  S + ++   P+V+LE    T  N      G
Sbjct  5389  TRPHSDQT-TECTRDVPTTRPFEASTPSSASLETTV---PSVTLE----TTTNVPIGSTG  5440

Query  1010  ISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFAGVYRN  1069
                + +  S  S                      ++++T+    S L +++         
Sbjct  5441  GQVTEQTTSSPS----------------------EVRTTIRVEESTLPSRS---------  5469

Query  1070  VSSNETAAQRVTPSGSP--PRFSARYRGVELFVRKPNDANSTGNA----STTSFISSSIT  1123
                    A R TPS SP  P   +       F  +P+   +T +     +T  F +S+ +
Sbjct  5470  -------ADRTTPSESPETPTLPSD------FTTRPHSEQTTESTRDVPTTRPFEASTPS  5516

Query  1124  NASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
             +AS     P   +  ++  P G    Q  E+  +S ++     R+T+ + +    +   +
Sbjct  5517  SASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE----FRTTIRVEESTLPSRSAD  5572

Query  1184  DTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLDQI  1243
              T  ++S       +   +  +     ++ S  D+      +    +P       P    
Sbjct  5573  RTTPSESPETPTLPSDFTTRPHS--EQTTESTRDVPTTRPFEASTPSPASLETTVP-SVT  5629

Query  1244  FGITTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITI  1301
                TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T 
Sbjct  5630  SETTTNVPIGSTGGQVTGQTTAPPSEVRTTI------RVEESTLP-------SRSTDRTT  5676

Query  1302  TNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMTTT  1351
              +++P   T + +  TT T +  TT+ST +   +RP   +T        T  + T+ TTT
Sbjct  5677  PSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTT  5736

Query  1352  LLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISST  1411
              +P  +     T   + + + + TTIG+ + T    + D                S S +
Sbjct  5737  NVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDR--------------TSPSES  5782

Query  1412  PKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDL  1471
             P+T T +      +  S   +++  TR     +P  AS  S    PAS   + P +    
Sbjct  5783  PETPTTLPSDFTTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVTS--  5834

Query  1472  LQSTSKKPVAAT--TTTEPFTWKPVTDVTSITSSKQTEISTKTT-TSITSTTTTSTMTPS  1528
              ++T+  P+ +T    TE  T  P    T+I   + T  S  T  TS + +  T T  PS
Sbjct  5835  -ETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPS  5893

Query  1529  ASQIIFDTFPTHPPTIKSSN--------LATILNTVTSSTTIPTI-SFTTTVTPKVITRK  1579
                  F T P    T +S+          A+  +  +  TT+P++ S TTT  P   T  
Sbjct  5894  D----FITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGG  5949

Query  1580  PVAVRPAPPPTTTQAPLGFGASLL  1603
              V  +   PP+  +  +G   S L
Sbjct  5950  QVTGQTTAPPSEVRTTIGVEESTL  5973


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 219/1073 (20%), Positives = 366/1073 (34%), Gaps = 192/1073 (18%)

Query  629   LSESNISTLSEIFQGQKKRTPGTNFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSST--  686
             ++E   S+ SE+      R   +   +RS  +   ++    P L S+    P +  +T  
Sbjct  6127  VTEQTTSSPSEV--RTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTES  6184

Query  687   TLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTISLPKIDKKIA----------RTSK  736
             T +         S   P   +T  + S+T  T   + +     ++           RT+ 
Sbjct  6185  TRDVPTTRPFEASTPSPASLET-TVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTI  6243

Query  737   SIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL  796
              +E   +    T R   ++     TT  P D   +  +   +E T       +  T RP 
Sbjct  6244  GVEESTLPSRSTDRTSPSESPETPTT-LPSDFITRPHSEQTTESTR------DVPTTRPF  6296

Query  797   SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSIDSHNTSRSVVSKPLTRSRGYT  856
              +      ++K    +  S A     I     + T ++  S +  R+ +     R    T
Sbjct  6297  EASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI-----RVEEST  6351

Query  857   NRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSR  916
               +R    TT S +  T  ++    T RP   +    +     PT +   TST +  +  
Sbjct  6352  LPSRSTDRTTPSESPETPTTLPSDFTTRPH--SEKTTESTRDVPTTRPFETSTPSPASLE  6409

Query  917   NTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIK  976
              T  S+T E T                      S P  S  G+    + A   +    I+
Sbjct  6410  TTVPSVTLETTT---------------------SVPMGSTGGQVTGQTTAPPSEVRTTIR  6448

Query  977   TENSTQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLIN  1036
              E ST       P+ S +  + + + ET   +     +R +S           +TT    
Sbjct  6449  VEESTL------PSRSTDRTSPSESPETPTTLPSDFITRPHS----------EKTTESTR  6492

Query  1037  SNASLLEQIKSTVAPLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSP--PRFSARYR  1094
                +      ST +   S        F   Y+  +    +A R TPS SP  P   +   
Sbjct  6493  DVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSD--  6550

Query  1095  GVELFVRKPND---ANSTGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQD  1151
                 F  +P+      ST +  TT    +S  + +      PS  + ++ N   G     
Sbjct  6551  ----FTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQ  6606

Query  1152  IERDKASRTKEAGGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGS  1211
             +     +   E    R+T+ + +    +  T+ T  ++S     E  ++  +     P S
Sbjct  6607  VTGQTTAPPSEV---RTTIRVEESTLPSRSTDRTTPSESP----ETPTILPSDFTTRPHS  6659

Query  1212  ---SISPLDILPNNQVQGRVTAPPGFPWKDPLDQIFGITTESPI--IRASVASNTLDEPS  1266
                + S  D+      +     P       P       TT  PI      V   T   PS
Sbjct  6660  DQTTESTRDVPTTRPFEASTPRPVTLETAVP-SVTLETTTNVPIGSTGGQVTGQTTATPS  6718

Query  1267  SSRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1326
               R+ I      R+ E   P       +R T  T  +++P   TT+ +  TT   +  TT
Sbjct  6719  EVRTTI------RVEESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  6765

Query  1327  KSTTN---SRPVTTTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTT  1376
             +ST +   +RP   +T        T  + T  TTT +P  +     T   ++S + + TT
Sbjct  6766  ESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTT  6825

Query  1377  IG-----IPKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTL--------------  1415
             IG     +P +++  T+  +     T L SD+  RP+S  +T  T               
Sbjct  6826  IGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  6885

Query  1416  -----TEVERLLANKILSLALSQAG-------------------------PTRSPKAIQP  1445
                  T V  + +    ++ +   G                         P+RS     P
Sbjct  6886  PASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSP  6945

Query  1446  SNASPNSLDILPASF---GHS------------SPPIIIDLLQSTSKKPVAATTTTEPFT  1490
             S  SP +   LP+ F    HS            + P       S S +    + T E  T
Sbjct  6946  SE-SPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTT  7004

Query  1491  WKPVTD----VTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTI  1544
               P+      VT  T+S  +E+ T  +   S   + +T   TPS S     T P+   T 
Sbjct  7005  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTR  7064

Query  1545  KSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
               S+      T  SS  +PT       TP+ +T +  AV P    TTT  P+G
Sbjct  7065  PHSD-----QTTESSRDVPTTQPFEASTPRPVTLQ-TAVLPVTSETTTNVPIG  7111


 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 241/1091 (22%), Positives = 391/1091 (36%), Gaps = 153/1091 (14%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST S   LE 
Sbjct  5366  RSTDRTSP----SESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEASTPSSASLET  5421

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T        E++ S     R       S  P      +
Sbjct  5422  TVPSVTLETTTNVPIGSTGGQVT--------EQTTSSPSEVRTTIRVEESTLPSRSADRT  5473

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTTV  783
              P         S+S E   +    T R    Q    T        F  S  +  S  TTV
Sbjct  5474  TP---------SESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASLETTV  5524

Query  784   EKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPT  831
               + LET T  P+            SS +   TT+++  +T  SR+ +     ++ + PT
Sbjct  5525  PSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPT  5584

Query  832   PRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNS  890
                + S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T       +
Sbjct  5585  ---LPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETT------TN  5635

Query  891   AYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEVS  950
               I     + T ++    ++   T R   S+L +  T +T+   +  P T T       +
Sbjct  5636  VPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTP--SESPETPTILPSDSTT  5693

Query  951   QPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLEL-----LNKTNANETF  1005
             +  +  T  +    V  T  + A   +  S + ++   P+V+LE      +  T    T 
Sbjct  5694  RTYSDQT-TESTRDVPTTRPFEASTPSPASLETTV---PSVTLETTTNVPIGSTGGQVTG  5749

Query  1006  NLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFAG  1065
                   +  R   G  +S +  P+R+T   + + S   +  +T+    +           
Sbjct  5750  QTTATPSEVRTTIGVEESTL--PSRSTDRTSPSES--PETPTTLPSDFTT----------  5795

Query  1066  VYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDAN-STGNASTTSFISSSITN  1124
               R  S   T + R  P+  P   S            P+ A+  T   S TS  ++++  
Sbjct  5796  --RPHSDQTTESTRDVPTTRPFEAST-----------PSPASLETTVPSVTSETTTNVPI  5842

Query  1125  ASPGG-LRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
              S GG +   +  +PS +    G     +      RT  +    +   +  + FI    +
Sbjct  5843  GSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSD-FITRPHS  5901

Query  1184  DTAQNDSRVVSVEINSVAS-----AINEGLPGSSISPLDILP----NNQVQGRVTAPPGF  1234
             D     +R V       AS     ++   +P  +      +P      QV G+ TAPP  
Sbjct  5902  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPS-  5960

Query  1235  PWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLA  1294
                        + T   +  +++ S + D  S S SP T      L   F    ++ Q  
Sbjct  5961  ----------EVRTTIGVEESTLPSRSTDRTSPSESPETP---TTLPSDFITRPHSEQTT  6007

Query  1295  RDTSITITNDAPTVSTTVGASM--TTPTTTTSTTKS----TTNSRPVTTTTMTNSAPTMM  1348
               T    T      ST   AS+  T P+ T+  T +    +T  R  TT + +   PT +
Sbjct  6008  ESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESPETPTTL  6067

Query  1349  TTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSI  1408
              +     P    +T ST    TT  F T   P   S  TT   +    TL  +   P  I
Sbjct  6068  PSDFTTRPHSEKTTESTRDVPTTRPFET-STPSPASLETTVPSV----TLETTTNVP--I  6120

Query  1409  SSTPKTLTEVERLLANKILSLALSQAG--PTRSPKAIQPSNASPNSLDILPASFGHSSPP  1466
              ST   +TE      +++ +    +    P+RS     PS  SP +   LP+ F  ++ P
Sbjct  6121  GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSE-SPET-PTLPSDF--TTRP  6176

Query  1467  IIIDLLQSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQTEISTKTTTSITSTT  1520
                   +ST   P     TT PF   T  P    T V S+TS   T +   +T      T
Sbjct  6177  HSEQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGG--QVT  6229

Query  1521  TTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPT-------ISFTTTVTP  1573
               +T  PS  +       +  P+ +S++  +   +  + TT+P+          TT  T 
Sbjct  6230  GQTTAPPSEVRTTIGVEESTLPS-RSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTR  6288

Query  1574  KVITRKPV-AVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLR  1632
              V T +P  A  P+P    T  P     +      G         TT  P +  ++TT+R
Sbjct  6289  DVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE--VRTTIR  6346

Query  1633  PVQTTPKPIST  1643
               ++T    ST
Sbjct  6347  VEESTLPSRST  6357


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 216/1021 (21%), Positives = 361/1021 (35%), Gaps = 122/1021 (12%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGTN---FSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST     LE 
Sbjct  7142  RSTDRTTP----SESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLET  7197

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQD-----PKRYDTFKLSSITPRT  718
             A   V  E  +   +    G  T   +   +E   +++      P R       S +P T
Sbjct  7198  AVPPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPET  7257

Query  719   KVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVF-------VQ  771
               T  LP        + ++ E            R     R   + TP  V        V 
Sbjct  7258  PTT--LPSDFTTRPHSDQTTES----------TRDVPTTRPFESSTPRPVTLEIAVPPVT  7305

Query  772   SKTAYNSELTTVEKIKLETVTIRPLSSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPT  831
             S+T  N  + +      E  T  P   R    TT+++  +T  SR+ +     ++ + PT
Sbjct  7306  SETTTNVAIGSTGGQVTEQTTSSPSEVR----TTIRVEESTLPSRSTDRTTPSESPETPT  7361

Query  832   PRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKR-PRVWN  889
               ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T   P    
Sbjct  7362  --TLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGST  7419

Query  890   SAYIDKNWQEPTK--KSDVTSTQATVTSRN---TYSSLTAEKTVQTSRRGNSRP---RTA  941
                +      P    ++ +   ++T+ SR+   T  S + E          +RP   +T 
Sbjct  7420  GGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTT  7479

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNA  1001
                R +  +QP  S T +     +A+ P     + +E +T   I    +   ++  +T A
Sbjct  7480  ESSRDVPTTQPFESSTPRPVTLEIAVPP-----VTSETTTNVPIG---STGGQVTGQTTA  7531

Query  1002  --NETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV-----APLLS  1054
               +E    IG+  S+  +     +       T   + S+ +       T       P   
Sbjct  7532  TPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTR  7591

Query  1055  VLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNAST  1114
                A  P+ A +   V S         P GS      +  G       P++  +T     
Sbjct  7592  PFEASTPSPASLETTVPSVTLETTTNVPIGST---GGQVTGQT--TATPSEVRTTIGVEE  7646

Query  1115  TSFISSSITNASPGGLRPPSGVTPS--SINPQGGRIIQDIERDKASRTKEAGGQRSTVYI  1172
             ++  S S    +P          PS  +  P   +  +       +R  EA   R    +
Sbjct  7647  STLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRP---V  7703

Query  1173  GQEKFINYWTNDTAQNDSRVVSVEINS-VASAINEGLPGSSISPLDILPNNQVQGRVTAP  1231
               E  +   T++T  N      V I S V S     +P  S          QV G+ TAP
Sbjct  7704  TLETAVPSVTSETTTN------VPIGSTVTSETTTNVPIGSTG-------GQVAGQTTAP  7750

Query  1232  PGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNAN  1291
             P             + T   +  +++ S + D  + S SP T      L   FT   ++ 
Sbjct  7751  PS-----------EVRTTIRVEESTLPSRSADRTTPSESPETP---TTLPSDFTTRPHSE  7796

Query  1292  QLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTT-----TTMTNSAPT  1346
             Q    T    T      ST   AS+   TT  S T  TT + P+ +     T  + S+P+
Sbjct  7797  QTTESTRDVPTTRPFEASTPSPASLE--TTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7854

Query  1347  MMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLES-----  1401
              + T      TI    ++  S ST   F +    K T+  + F     L    ES     
Sbjct  7855  EVRT------TIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVL  7908

Query  1402  DYRPNSISS-TPKTL-TEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPAS  1459
               RP   S+ +P +L T V  + +    ++ +   G   + +   P +       I+ ++
Sbjct  7909  TTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTE-TIVKST  7967

Query  1460  FGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITST  1519
                 SP   I      ++ P+ +TT        P       TSS++ + ST+ T+  ++ 
Sbjct  7968  HPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTE  8027

Query  1520  TTTSTMTPSASQIIFDTFPTH-PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITR  1578
             TT    T S    +  T  +    T K+++  T    VT  TT      TT  +  V+T 
Sbjct  8028  TTRPVPTVSPRDALETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTE  8087

Query  1579  K  1579
             +
Sbjct  8088  R  8088


 Score = 55.1 bits (131),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 290/1354 (21%), Positives = 473/1354 (35%), Gaps = 241/1354 (18%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  5508  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEFRTTIRVEE  5563

Query  478   SIL----TIKTLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTEN  521
             S L      +T P E     TL  DF  R   +Q + +T          + T S  + E 
Sbjct  5564  STLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  5623

Query  522   LLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNER  581
              +  ++S   +N             I  TG ++ G+    P E +  +          E 
Sbjct  5624  TVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEVRTTIRV--------EE  5664

Query  582   SELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIF  641
             S LP                     RSTD+  P    SE+ E P ++ S+S   T S+  
Sbjct  5665  STLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQT  5700

Query  642   QGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESK  698
                 +  P T     ST S   LE     V  E  +   +    G  T   +   +E   
Sbjct  5701  TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT  5760

Query  699   SL-----QDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQ  753
             ++       P R       S +P T  T  LP                      T R   
Sbjct  5761  TIGVEESTLPSRSTDRTSPSESPETPTT--LPS-------------------DFTTRPHS  5799

Query  754   NQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL------------SSRNI  801
             +Q    T        F  S  +  S  TTV  +  ET T  P+            SS + 
Sbjct  5800  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSE  5859

Query  802   DTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSID------SHNTSRSVVSKPLTRS-RG  854
               TT+ +  +T  SR+ +     ++ + PT    D      S  T+ S    P TR    
Sbjct  5860  VRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEA  5919

Query  855   YTNRNRQISTTTMS-NNETTQK--------SVTFKVTKRPRVWNSAYIDKNWQEPTKKSD  905
              T     + TT  S  +ETT           VT + T  P    +    +    P++ +D
Sbjct  5920  STPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTD  5979

Query  906   VTSTQATVTSRNTYSS--LTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVS  963
              TS   +  +  T  S  +T   + QT+      P T    R  E S P  + + K  V 
Sbjct  5980  RTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTT----RPFEASTPSPA-SLKTTVP  6034

Query  964   SVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDS  1023
             SV      +  I    ST Q I   P+ S E      ++ T        S +      D 
Sbjct  6035  SVTSEATTNVPI---GSTGQRIGTTPSESPETPTTLPSDFTTR----PHSEKTTESTRDV  6087

Query  1024  NIFNPARTTYLINSNASLLEQIKS------TVAPLLSVLG------AKAPAFAGVYRNVS  1071
                 P  T+    S ASL   + S      T  P+ S  G        +P+       V 
Sbjct  6088  PTTRPFETS--TPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVE  6145

Query  1072  SN---ETAAQRVTPSGSP--PRFSARYRGVELFVRKPND---ANSTGNASTTSFISSSIT  1123
              +     +A R TPS SP  P   +       F  +P+      ST +  TT    +S  
Sbjct  6146  ESTLPSRSADRTTPSESPETPTLPSD------FTTRPHSEQTTESTRDVPTTRPFEASTP  6199

Query  1124  NASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
             + +      PS  + ++ N   G     +     +   E    R+T+ + +    +  T+
Sbjct  6200  SPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEV---RTTIGVEESTLPSRSTD  6256

Query  1184  DTAQNDSRVVSVEINS--VASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLD  1241
              T+ ++S      + S  +    +E    ++ S  D+      +    +P       P  
Sbjct  6257  RTSPSESPETPTTLPSDFITRPHSEQ---TTESTRDVPTTRPFEASTPSPASLKTTVP-S  6312

Query  1242  QIFGITTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSI  1299
                  TT  PI      V   T   PS  R+ I      R+ E   P       +R T  
Sbjct  6313  VTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDR  6359

Query  1300  TITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMT  1349
             T  +++P   TT+ +  TT   +  TT+ST +   +RP  T+T        T  + T+ T
Sbjct  6360  TTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLET  6419

Query  1350  TTLLPTPTIAASTTSTMSTSTTSLFTTIGI-----PKQTSFGTTFDDLAFLNTLLESDY-  1403
             TT +P  +     T   +   + + TTI +     P +++  T+  +     T L SD+ 
Sbjct  6420  TTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFI  6479

Query  1404  -RPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGH  1462
              RP+S  +T  T                      TR  +A  PS+AS         S  +
Sbjct  6480  TRPHSEKTTEST-----------------RDVPTTRPFEASTPSSAS---------SGNN  6513

Query  1463  SSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITSTTTT  1522
              S     +  + +++   +A  TT   + +  T  +  T+   +E +T++T  + +T   
Sbjct  6514  CSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPF  6573

Query  1523  STMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVA  1582
                TPS + +          T  +  + +    VT  TT P     TT+  +  T    +
Sbjct  6574  EASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRS  6633

Query  1583  VRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQ-TTPKPI  1641
                  P  + + P     ++L + F      P +  T +  + V   T RP + +TP+P+
Sbjct  6634  TDRTTPSESPETP-----TILPSDFTTR---PHSDQTTESTRDV--PTTRPFEASTPRPV  6683

Query  1642  STTAAREMYAASEQIN-HIDYSNSLVSGSKSTSP  1674
             +   A          N  I  +   V+G  + +P
Sbjct  6684  TLETAVPSVTLETTTNVPIGSTGGQVTGQTTATP  6717


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 82/356 (23%), Positives = 134/356 (38%), Gaps = 48/356 (13%)

Query  1247  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1304
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7003  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  7049

Query  1305  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1364
             +P   TT+ +  TT   +  TT+S+ +         +   P  + T +LP  +   +   
Sbjct  7050  SPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVP  7109

Query  1365  TMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLAN  1424
               ST       T   P +       ++    +TL        + S +P+T T +      
Sbjct  7110  IGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLP-----  7160

Query  1425  KILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSP-PIIIDLLQSTSKKPVAAT  1483
                      +  T  P + Q + +S +     P  F  S+P P+ ++    T+  PV + 
Sbjct  7161  ---------SDFTTRPHSDQTTESSRDVPTTQP--FESSTPRPVTLE----TAVPPVTSE  7205

Query  1484  TTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHP  1541
             TTT          VT  T+   +E+ T  +   S   + +T   TPS S     T P+  
Sbjct  7206  TTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDF  7265

Query  1542  PTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
              T   S+      T  S+  +PT     + TP+ +T + +AV P    TTT   +G
Sbjct  7266  TTRPHSD-----QTTESTRDVPTTRPFESSTPRPVTLE-IAVPPVTSETTTNVAIG  7315


 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 226/1047 (22%), Positives = 384/1047 (37%), Gaps = 131/1047 (13%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      SE      +  P T     ST S   LE 
Sbjct  4959  RSTDRTTP----SESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  5014

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQD-----PKRYDTFKLSSITPRT  718
                 V  E  +   +    G  T   +   +E   +++      P R       S +P T
Sbjct  5015  TVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPET  5074

Query  719   KVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNS  778
               T+            S  I R       T   +  +  R   T  P   F  S  +  S
Sbjct  5075  PTTLP-----------SDFITR-------TYSDQTTESTRDVPTTRP---FEASTPSPAS  5113

Query  779   ELTTVEKIKLETVTIRPLSSRNIDTT------------TVKMLSTTRRSRAWNAAYIDKN  826
               TTV  +  ET T  P+ S     T            T+++  +T  SR+ +     ++
Sbjct  5114  LETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSES  5173

Query  827   WQEPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRP  885
              + PT  ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T   
Sbjct  5174  PETPT--TLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNV  5231

Query  886   RVWNSA--YIDKNWQEPTK-KSDVTSTQATVTSRNTYSSLTAE--KTVQTSRRGNSRP--  938
              + ++     ++    P++ ++ +   ++T+ SR+   +  +E  +T        +RP  
Sbjct  5232  PIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHS  5291

Query  939   -RTATYRRHLEVSQPQNSLT---GKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLE  994
              +T    R +  ++P  + T      E +  ++T +    +   ++  Q  ++  +   E
Sbjct  5292  EQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE  5351

Query  995   LLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLS  1054
             +       E+  L   ST     S + ++    P+  T   +S+ +  E  +    P   
Sbjct  5352  VRTTIRVEES-TLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQT-TECTRDV--PTTR  5407

Query  1055  VLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNAST  1114
                A  P+ A +   V S         P G     S   +  E     P++  +T     
Sbjct  5408  PFEASTPSSASLETTVPSVTLETTTNVPIG-----STGGQVTEQTTSSPSEVRTTIRVEE  5462

Query  1115  TSFISSSITNASPGGLRPPSGVTPS--SINPQGGRIIQDIERDKASRTKEAGGQRSTVYI  1172
             ++  S S    +P    P +   PS  +  P   +  +       +R  EA    S    
Sbjct  5463  STLPSRSADRTTPSE-SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSA---  5518

Query  1173  GQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPP  1232
               E  +   T +T  N      V I S    + E    ++ SP +     +V+       
Sbjct  5519  SLETTVPSVTLETTTN------VPIGSTGGQVTE---QTTSSPSEFRTTIRVEESTLPSR  5569

Query  1233  GFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITAR--PINRLLEVFTPLLNA  1290
                   P +     + E+P    ++ S+    P S ++  + R  P  R  E  TP   +
Sbjct  5570  SADRTTPSE-----SPETP----TLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPAS  5620

Query  1291  --NQLARDTSITITNDAPTVST---TVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAP  1345
                 +   TS T TN  P  ST     G +   P+   +T +   ++ P  +T  T  + 
Sbjct  5621  LETTVPSVTSETTTN-VPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSE  5679

Query  1346  TMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRP  1405
             +  T T+LP+     STT T S  TT   +T  +P    F  +    A L T + S    
Sbjct  5680  SPETPTILPSD----STTRTYSDQTTE--STRDVPTTRPFEASTPSPASLETTVPSVTLE  5733

Query  1406  NS----ISSTPKTLTEVERLLANKI-LSLALSQAG-PTRSPKAIQPSNASPNSLDILPAS  1459
              +    I ST   +T       +++  ++ + ++  P+RS     PS  SP +   LP+ 
Sbjct  5734  TTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTSPSE-SPETPTTLPSD  5792

Query  1460  FGHSSPPIIIDLLQSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQTEISTKTT  1513
             F  ++ P      +ST   P     TT PF   T  P    T V S+TS   T +   +T
Sbjct  5793  F--TTRPHSDQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGST  5845

Query  1514  TSITSTTTTSTMTPSASQIIFD--TFPTHPP--TIKSSNLATILNTVTSSTTIPTISFTT  1569
                 +  TTS+ +   + I  +  T P+     T  S +  T     +   T P    TT
Sbjct  5846  GGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTT  5905

Query  1570  TVTPKVITRKPV-AVRPAPPPTTTQAP  1595
               T  V T +P  A  P+P    T  P
Sbjct  5906  ESTRDVPTTRPFEASTPSPASLETTVP  5932


 Score = 43.9 bits (102),  Expect = 0.002, Method: Composition-based stats.
 Identities = 111/466 (24%), Positives = 170/466 (36%), Gaps = 74/466 (16%)

Query  1223  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1282
             QV G+ TAPP             + T   +  +++ S + D  + S SP T         
Sbjct  6606  QVTGQTTAPPS-----------EVRTTIRVEESTLPSRSTDRTTPSESPETP--------  6646

Query  1283  VFTPLLNANQLARDTSITITNDAPTV---STTVGASMTTPTTTTSTTKSTTNSRPVTTTT  1339
                P     +   D +   T D PT      +    +T  T   S T  TT + P+ +T 
Sbjct  6647  TILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTG  6706

Query  1340  -----MTNSAPTMMTTTL------LP--------------TPTIAASTTSTMSTSTTSLF  1374
                   T + P+ + TT+      LP              TPT   S  +T   S  +  
Sbjct  6707  GQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTE  6766

Query  1375  TTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNS----ISSTPKTLTEVERLLANKI-LSL  1429
             +T  +P    F  +    A L T + S     +    I ST   +TE      +++  ++
Sbjct  6767  STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTI  6826

Query  1430  ALSQAG-PTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEP  1488
              L ++  P+RS     PS  SP +   LP+ F   + P      +ST   P     TT P
Sbjct  6827  GLEESTLPSRSTDRTSPSE-SPETPTTLPSDF--ITRPHSDQTTESTRDVP-----TTRP  6878

Query  1489  F---TWKPV---TDVTSITSSKQTEISTKTTTSITSTTTTSTMTPSASQIIFD--TFPTH  1540
             F   T  P    T V S+TS   T +   +T    +  TTS+ +   + I  +  T P+ 
Sbjct  6879  FEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSR  6938

Query  1541  PP--TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV-AVRPAPPPTTTQAPLG  1597
                 T  S +  T     +   T P    TT  T  V T +P  A  P+     T  P  
Sbjct  6939  STDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSV  6998

Query  1598  FGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPIST  1643
                +      G         TT  P +  ++TT+R  ++T    ST
Sbjct  6999  TLETTTNVPIGSTGGQVTEQTTSSPSE--VRTTIRVEESTLPSRST  7042


 Score = 42.0 bits (97),  Expect = 0.007, Method: Composition-based stats.
 Identities = 121/594 (20%), Positives = 214/594 (36%), Gaps = 86/594 (14%)

Query  1242  QIFGITTESP--------IIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQL  1293
             Q+   TT SP        +  +++ S + D  + S SP T      L   FT   ++ Q 
Sbjct  4321  QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETP---TTLPSDFTTRPHSEQT  4377

Query  1294  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTT-----MTNSAPTMM  1348
                T    T      ST   AS+ T  T  S T  TT + P+ +T       T S+P+ +
Sbjct  4378  TESTRDVPTTRPFEASTPSPASLET--TVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEV  4435

Query  1349  TTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDY--RPN  1406
              TT+    +   S ++  +T + S  T   +P                    SD+  RP+
Sbjct  4436  RTTIRVEESTLPSRSADRTTPSESPETPTTLP--------------------SDFITRPH  4475

Query  1407  SISSTPKT--LTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSS  1464
             S  +T  T  +       A+   S +L    P+ + +    +N    S          SS
Sbjct  4476  SEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETT--TNVPIGSTGGQVTEQTTSS  4533

Query  1465  PPII---IDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITSTTT  1521
             P  +   I + +ST     A  TT       P T  +  T    +E +T++T  + +T  
Sbjct  4534  PSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTESTRDVPTTRP  4593

Query  1522  TSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV  1581
                 TPS + +          T  +  + +    VT  TT P   F TT+  +  T    
Sbjct  4594  FEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSR  4653

Query  1582  AVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPI  1641
             +     P  + + P                  P  STT+    +  ++T     T P   
Sbjct  4654  STDRTTPSESPETP---------------TILPSDSTTRTYSDQTTESTRDVPTTRPFEA  4698

Query  1642  STTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKFLLELLEASERVKK  1701
             ST +   +      +  ++ + ++  GS        T  SP E  +  + + E++   + 
Sbjct  4699  STPSPASLETTVPSVT-LETTTNVPIGSTGGQVTEQTTSSPSE-VRTTIRVEESTLPSRS  4756

Query  1702  GDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKPST-  1759
              D+      +   E       S +    +P    T  H+ K      ++   +  + ST 
Sbjct  4757  ADR------TTPSE-------SPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTP  4803

Query  1760  SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1808
             SS  L   +  +++ +TT +     G Q+   ++  P+    R T++ + ST P
Sbjct  4804  SSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIRVEESTLP  4855


 Score = 37.4 bits (85),  Expect = 0.18, Method: Composition-based stats.
 Identities = 46/172 (27%), Positives = 69/172 (40%), Gaps = 24/172 (14%)

Query  1493   PVTDVTSITSSKQTEISTKT--TTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLA  1550
              P + V +I S     IS  T    +I S    +   PS   I   + P   PT  S    
Sbjct  19294  PTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPG--  19351

Query  1551   TILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRN  1610
               I+N  +    +P+       TP VI    +  +P PPP   Q  +    S+ Q      
Sbjct  19352  -IINIPSVPQPLPS------PTPGVIN---IPQQPTPPPLVQQPGIINIPSVQQ------  19395

Query  1611   IFAPPTSTTQKPLKKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYS  1662
                 P T TTQ P++ V   T RP Q TP  I+  +  +    +++ ++ D S
Sbjct  19396  ---PSTPTTQHPIQDVQYETQRP-QPTPGVINIPSVSQPTYPTQKPSYQDTS  19443


 Score = 34.7 bits (78),  Expect = 1.2, Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 60/168 (36%), Gaps = 28/168 (17%)

Query  1223  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1282
             QV  + TAPP             + T   I++++  + + D    S  P T  P+     
Sbjct  7946  QVTEQTTAPPS------------VRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTR  7993

Query  1283  VFTPLL----------------NANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1326
             ++T                    + +L  + S   T   PTVS       T  +  T TT
Sbjct  7994  LYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETT  8053

Query  1327  KSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1374
             K+T+   P    T   +      TT   +  +   T  +  +STT++F
Sbjct  8054  KTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTVF  8101


>M9PBZ0_DROME unnamed protein product
Length=22830

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 248/1228 (20%), Positives = 429/1228 (35%), Gaps = 183/1228 (15%)

Query  425   LSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAATSILTIKT  484
             LSS  +  T   + S   T      TT FT E+  +   +  T  P +     + +T ++
Sbjct  3895  LSSNPETETPTTLPSRPTTRPFTDQTTEFTSEIPTITPMEGSTPTPSHLETTVASITSES  3954

Query  485   LPKEKDLDDTLDFRGRKEFKQASYTTSITFSNQNTENLLNDISSTNLSNNRRRGNKLFNK  544
               +E       D          +   SITF            ++TN+     RG      
Sbjct  3955  TTREVYTIKPFDRSTPTPVSPDTTVPSITFE-----------TTTNIPIGTTRG------  3997

Query  545   ASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNERSELPKINKYIYYQDDEVTKIITR  604
                     ++  +  + P E +  +          E S LP                   
Sbjct  3998  --------QVTEQTTSSPSEKRTTIRV--------EESTLPS------------------  4023

Query  605   HLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKL  661
               RSTD+  P    SE+ E P ++ S+S   T S+      +  P T     ST S   L
Sbjct  4024  --RSTDRTTP----SESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASL  4077

Query  662   EEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVT  721
             E     V  E  + + +    G  T        E++ S     R       S  P     
Sbjct  4078  ETTVPSVTLETTTNDPIGSTGGQVT--------EQTTSSPSEVRTTIGLEESTLPSRSTD  4129

Query  722   ISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-  780
              + P         S+S E       + I    + +   +T   P     ++ T  ++ L 
Sbjct  4130  RTTP---------SESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLE  4180

Query  781   TTVEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQ  828
             TTV  + LET T  P+            SS +   TT+++  +T  SR+  A     +  
Sbjct  4181  TTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRS--ADRTTPSES  4238

Query  829   EPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRV  887
               TP ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T     
Sbjct  4239  PETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETT-----  4293

Query  888   WNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHL  947
               +  I     + T ++  + ++   T R   S+L +    +T+   +  P T T     
Sbjct  4294  -TNVPIGSTGGQVTGQTTSSPSEVRTTIRVEESTLPSRSADRTTP--SESPETPTTLPSD  4350

Query  948   EVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNK---------  998
              +++P +  T  +    V  T  + A   +  S + ++   P+V+LE             
Sbjct  4351  FITRPHSEKT-TESTRDVPTTRPFEASTPSSASLETTV---PSVTLETTTNVPIGSTGGQ  4406

Query  999   ------TNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV---  1049
                   ++ +E    I +  S+  +     + +     T   + S+ ++    + T    
Sbjct  4407  VTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTEST  4466

Query  1050  --APLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDAN  1107
                P      A  P+ A +   V S  +      P GS      +  G       P++  
Sbjct  4467  RDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGST---GGQVTGQT--TAPPSEFR  4521

Query  1108  STGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQR  1167
             +T     ++  S S    +P        + PS               D  +RT       
Sbjct  4522  TTIRVEESTLPSRSTDRTTPSESPETPTILPS---------------DSTTRTYSDQTTE  4566

Query  1168  STVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGR  1227
             ST  +   +     T   A  ++ V SV + +  + +  G  G  ++       ++V+  
Sbjct  4567  STRDVPTTRPFEASTPSPASLETTVPSVTLETTTN-VPIGSTGGQVTEQTTSSPSEVRTT  4625

Query  1228  VTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITAR--PINRLLEVFT  1285
             +            D+     +ESP    ++ S+ +  P S ++  + R  P  R  E  T
Sbjct  4626  IRVEESTLPSRSADRT--TPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEAST  4683

Query  1286  P-------LLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTT  1338
             P        + +  L   T++ I +    V+    +S +   TT    +ST  SR    T
Sbjct  4684  PSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT  4743

Query  1339  TMTNS--APTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLN  1396
             T + S   PT + +  +  P    +T ST    TT  F     P   S  TT   +    
Sbjct  4744  TPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEA-STPSSASLETTVPSV----  4798

Query  1397  TLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAG--PTRSPKAIQPSNASPNSLD  1454
             TL  +   P  I ST   +TE      +++ +    +    P+RS     PS  SP +  
Sbjct  4799  TLETTTNVP--IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSE-SPETPT  4855

Query  1455  ILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTT  1514
              LP+ F  ++ P      +ST   P     TT PF     +  +  T+     + T T  
Sbjct  4856  TLPSDF--TTRPHSEQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTLETTTNV  4908

Query  1515  SITST----TTTSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTT  1570
              I ST    T  +T +PS  +       +  P+ +S++  T   +  + TT+P+   T T
Sbjct  4909  PIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPS-RSADRTTPSESPETPTTLPSDFITRT  4967

Query  1571  VTPKVI--TRKPVAVRPAPPPTTTQAPL  1596
              + +    TR     RP    T + A L
Sbjct  4968  YSDQTTESTRDVPTTRPFEASTPSPASL  4995


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 125/538 (23%), Positives = 202/538 (38%), Gaps = 86/538 (16%)

Query  1294  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLL  1353
             +R T  T  +++P   TT+ +  TT   +  TT+ST   R V TT    ++     T   
Sbjct  7532  SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTEST---RDVPTTRPFEASTPRPVTLET  7588

Query  1354  PTPTIAASTTSTMST-STTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTP  1412
               P++ + TT+ +   ST +  TT  +P     G+T   +A   T   S+ R  +I    
Sbjct  7589  AVPSVTSETTTNVPIGSTVTSETTTNVP----IGSTGGQVAGQTTAPPSEVR-TTIRVEE  7643

Query  1413  KTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLL  1472
              TL                    P+RS     PS  SP +   LP+ F  ++ P      
Sbjct  7644  STL--------------------PSRSADRTTPSE-SPETPTTLPSDF--TTRPHSEQTT  7680

Query  1473  QSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQT---------EISTKTTTSIT  1517
             +ST   P     TT PF   T  P    T V S+TS   T         +++ ++T+S +
Sbjct  7681  ESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7735

Query  1518  STTTTSTMTPSA--SQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKV  1575
                TT  +  S   S+    TFP+  P  K + L       +  TT P +  TT  T  V
Sbjct  7736  EVRTTIRVEESTLPSRSTDRTFPSESPE-KPTTLP------SDFTTRPHLEQTTESTRDV  7788

Query  1576  ITRKPVAVRPAPP------------PTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPL  1623
             +T +P       P             T+T  P+G     +         APP+  T + +
Sbjct  7789  LTTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVT----EQTTAPPSVRTTETI  7844

Query  1624  KKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPE  1683
              K     + P  T P  I  T            +      S    + S  P  +T+ + E
Sbjct  7845  VKSTHPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSE  7904

Query  1684  EDAKFLLELLEASERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKATTEDHASKNA  1743
             E  +    +   S R        SL+ +   +        GQ   +  K+ +E    +++
Sbjct  7905  ESTETTRPVPTVSPRDALETTVTSLI-TETTKTTSGGTPRGQVTERTTKSVSELTTGRSS  7963

Query  1744  VLLAELLKAQGIKPSTSSNHLREPLQGISITSTTTIGPQIISTSSKRPTTPRPRPTVK  1801
              ++ E      I  +T+  +  EP+   ++ +T +I      T +  PTT  P PT K
Sbjct  7964  DVVTERTMPSNISSTTTVFNNSEPVSD-NLPTTISI------TVTDSPTTV-PVPTCK  8013


 Score = 58.5 bits (140),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 259/1275 (20%), Positives = 457/1275 (36%), Gaps = 228/1275 (18%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RS D+  P    SE+ E P  + S+      SE      +  P T     ST S   LE 
Sbjct  4228  RSADRTTP----SESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  4283

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T           ++   P    T      T R + + +
Sbjct  4284  TVPSVTLETTTNVPIGSTGGQVT----------GQTTSSPSEVRT------TIRVEES-T  4326

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-TT  782
             LP         S+S E       + I    ++K   +T   P     ++ T  ++ L TT
Sbjct  4327  LPSRSADRTTPSESPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTPSSASLETT  4386

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  + LET T  P+            SS +   TT+++  +T  SR+ +   + ++ + P
Sbjct  4387  VPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTLSESPETP  4446

Query  831   TPRSID------SHNTSRSVVSKPLTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKR  884
             T    D      S  T+ S    P TR         + ST + ++ ETT  SVT + T  
Sbjct  4447  TTLPSDFTIRPHSEQTTESTRDVPTTRPF-------EASTPSPASLETTVPSVTSETT--  4497

Query  885   PRVWNSAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYR  944
                  +  I     + T ++    ++   T R   S+L +  T +T+   +  P T T  
Sbjct  4498  ----TNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTP--SESPETPTIL  4551

Query  945   RHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANET  1004
                  ++  +  T  +    V  T  + A   +  S + ++   P+V+LE    T  N  
Sbjct  4552  PSDSTTRTYSDQT-TESTRDVPTTRPFEASTPSPASLETTV---PSVTLE----TTTNVP  4603

Query  1005  FNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFA  1064
                 G   + +  S  S                      ++++T+    S L +++    
Sbjct  4604  IGSTGGQVTEQTTSSPS----------------------EVRTTIRVEESTLPSRS----  4637

Query  1065  GVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNA----STTSFISS  1120
                         A R TPS SP   +        F+ +P+   +T +     +T  F +S
Sbjct  4638  ------------ADRTTPSESPETPTTLPSD---FITRPHSEKTTESTRDVPTTRPFEAS  4682

Query  1121  SITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINY  1180
             + ++AS     P   +  ++  P G    Q  E+  +S ++     R+T+ + +    + 
Sbjct  4683  TPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE----VRTTIRVEESTLPSR  4738

Query  1181  WTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPL  1240
               + T  ++S      +                 P D +     +    +    P   P 
Sbjct  4739  SADRTTPSESPETPTTL-----------------PSDFITRPHSEKTTESTRDVPTTRPF  4781

Query  1241  DQIFGITTESPIIRASVASNTLDEPS--------------SSRSPITARPINRLLEVFTP  1286
             +     T  S  +  +V S TL+  +              ++ SP   R   R+ E   P
Sbjct  4782  E---ASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLP  4838

Query  1287  LLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT----  1339
                    +R T  T  +++P   TT+ +  TT   +  TT+ST +   +RP   +T    
Sbjct  4839  -------SRSTDRTTPSESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPA  4891

Query  1340  ---MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLN  1396
                 T  + T+ TTT +P  +     T   ++S + + TTI + + T    + D      
Sbjct  4892  SLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADR-----  4946

Query  1397  TLLESDYRPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDIL  1456
                       + S +P+T T +      +  S   +++  TR     +P  AS  S    
Sbjct  4947  ---------TTPSESPETPTTLPSDFITRTYSDQTTES--TRDVPTTRPFEASTPS----  4991

Query  1457  PASFGHSSPPIIIDLLQSTSKKPVAAT-------TTTEPFTWKPVTDVTSIT-SSKQTEI  1508
             PAS   + P +     ++T+  P+ +T       TT  P  ++    V   T  S+ T+ 
Sbjct  4992  PASLETTVPSVTS---ETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDR  5048

Query  1509  STKTTTSITSTTTTSTMT--PSASQIIFDT--FPTHPPTIKSSNLATILNTVTSSTTIPT  1564
             +T + +  T TT  S  T  P + Q    T   PT  P   S+     L T   S T+  
Sbjct  5049  TTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLE-  5107

Query  1565  ISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLK  1624
                TTT  P   T   V  +    P+  +  +    S L          P  S  +    
Sbjct  5108  ---TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTL----------PSRSADRTTPS  5154

Query  1625  KVIQTTLRPVQTTPKPIS---TTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYS  1681
             +  +T   P   T +P S   T + R++ A            SL +   S + +ATT   
Sbjct  5155  ESPETPTLPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVP  5214

Query  1682  PEEDAKFLLELLEAS-ERVKKGDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHA  1739
                    + E   +S   V+   + E   L +          S +    +P   TT  H+
Sbjct  5215  IGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFTTRPHS  5274

Query  1740  SKNAVLLAELLKAQGIKPST-SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTT  1793
              +      ++   +  + ST SS  L   +  +++ +TT +     G Q+   ++  P+ 
Sbjct  5275  DQTTECTRDVPTTRPFEASTPSSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS-  5333

Query  1794  PRPRPTVKAQSSTYP  1808
                R T++ + ST P
Sbjct  5334  -EVRTTIRVEESTLP  5347


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 89/357 (25%), Positives = 142/357 (40%), Gaps = 50/357 (14%)

Query  1247  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1304
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  7088  TTNVPIGSTGGQVTEQTTPSPSEVRTTI------RIEESTFP-------SRSTDRTTPSE  7134

Query  1305  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1364
             +P   TT+ +  TT   +  TT+ST +    TT    +S P  +T  +   P  + +TT+
Sbjct  7135  SPETPTTLPSDFTTRPHSDQTTESTRDVP--TTRPFESSTPRPVTLEIAVPPVTSETTTN  7192

Query  1365  TMSTSTTSLFT--TIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLL  1422
                 ST    T  T   P +       ++    +TL        + S +P+T T +    
Sbjct  7193  VAIGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLPSDF  7248

Query  1423  ANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAA  1482
               +  S   +++  TR     +P  AS  S    PAS   + P +    L++T+  P+ +
Sbjct  7249  TTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTSVPMGS  7299

Query  1483  TTTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTH  1540
             T             VT  T++  +E+ T  +   S   + +T    PS S     T P+ 
Sbjct  7300  TG----------GQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSD  7349

Query  1541  PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
               T   S+      T  SS  +PT     + TP+ +T + +AV P    TTT  P+G
Sbjct  7350  FTTRPHSD-----QTTESSRDVPTTQPFESSTPRPVTLE-IAVPPVTSETTTNVPIG  7400


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 235/1091 (22%), Positives = 384/1091 (35%), Gaps = 176/1091 (16%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST S   LE 
Sbjct  6615  RSTDRTTP----SESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLET  6670

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                   P + SE   N   GS+      +  E++ S     R  T  L   T        
Sbjct  6671  TV----PSVTSETTTNVPIGSTGG----QVTEQTTSSPSEVR-TTIGLEEST--------  6713

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSEL-TT  782
             LP         S+S E       + I    + +   +T   P     ++ T   + L TT
Sbjct  6714  LPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSPASLETT  6773

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  +  ET T  P+            SS +   TT+ +  +T  SR+ +     ++ + P
Sbjct  6774  VPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETP  6833

Query  831   TPRSIDSHNTSRSVVSKPLTRSRGYTNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNS  890
             T    D      S  +   TR    T R  + ST + ++ ETT  SVT + T    + ++
Sbjct  6834  TTLPSDFITRPHSDQTTESTRDVP-TTRPFEASTPSSASLETTVPSVTLETTTNVPIGST  6892

Query  891   A--YIDKNWQEPTK-KSDVTSTQATVTSRN---TYSSLTAEKTVQTSRRGNSRP---RTA  941
                  ++    P++ ++ +   ++T+ SR+   T  S + E          +RP   +T 
Sbjct  6893  GGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  6952

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTE--NSTQQSIKKEPAVSLELLNKT  999
                R +  +QP  + T +      A+ P            ST   + ++   S   +  T
Sbjct  6953  ESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTT  7012

Query  1000  NANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNAS--------LLEQIKSTVAP  1051
                E   L   ST     S + ++    P+  T   +S+ +          +  +S+   
Sbjct  7013  IRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPR  7072

Query  1052  LLSVLGAKAPAFAGVYRNVSSNETAAQ---RVTPSGSPPRFSARYRGVELFVRKPNDANS  1108
              +++  A  P  +    NV    T  Q   + TPS S  R + R        R  +    
Sbjct  7073  PVTLETAVPPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTP  7132

Query  1109  TGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRS  1168
             + +  T + + S  T       RP S  T  S      R +      ++S  +    + +
Sbjct  7133  SESPETPTTLPSDFTT------RPHSDQTTEST-----RDVPTTRPFESSTPRPVTLEIA  7181

Query  1169  TVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAI---NEGLPGSSISPLDILPNNQVQ  1225
                +  E   N     T    +   +   + V + I      LP  S       P+   +
Sbjct  7182  VPPVTSETTTNVAIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTD--RTTPSESPE  7239

Query  1226  GRVTAPPGFPWKDPLDQIFGITTESPIIR-------------ASVASNTLDEPSS-----  1267
                T P  F  +   DQ    T + P  R              +V S TL+  +S     
Sbjct  7240  TPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGS  7299

Query  1268  ---------SRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTT  1318
                      +  P   R   R+ E   P       +R T  T  +++P   TT+ +  TT
Sbjct  7300  TGGQVTGQTTAPPSEVRTTIRVEESTLP-------SRSTDRTPPSESPETPTTLPSDFTT  7352

Query  1319  PTTTTSTTKS-----------TTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMS  1367
                +  TT+S           ++  RPVT         T  TTT +P  +     T   +
Sbjct  7353  RPHSDQTTESSRDVPTTQPFESSTPRPVTLEIAVPPV-TSETTTNVPIGSTGGQVTGQTT  7411

Query  1368  TSTTSLFTTIGI-----PKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTLTEVER  1420
              + + + TTIG+     P +++  TT  +     T L SD+  RP+S  +T         
Sbjct  7412  ATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTES-------  7464

Query  1421  LLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPV  1480
                             TR     +P  AS  S    PAS   + P +    L++T+  P+
Sbjct  7465  ----------------TRDVPTTRPFEASTPS----PASLETTVPSVT---LETTTNVPI  7501

Query  1481  AAT-------TTTEPFTWKPVTDVTSIT-SSKQTEISTKTTTSITSTTTTSTMT--PSAS  1530
              +T       TT  P   +    V   T  S+ T+ +T + +  T TT  S  T  P + 
Sbjct  7502  GSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSD  7561

Query  1531  QIIFDT--FPTHPP----TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVR  1584
             Q    T   PT  P    T +   L T + +VTS TT   +   +TVT +  T  P+   
Sbjct  7562  QTTESTRDVPTTRPFEASTPRPVTLETAVPSVTSETTT-NVPIGSTVTSETTTNVPIGST  7620

Query  1585  PAPPPTTTQAP  1595
                    T AP
Sbjct  7621  GGQVAGQTTAP  7631


 Score = 56.6 bits (135),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 225/1044 (22%), Positives = 385/1044 (37%), Gaps = 178/1044 (17%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RS D+  P    SE+ E P  + S+    T S+      +  P T     ST S   LE 
Sbjct  4942  RSADRTTP----SESPETPTTLPSDFITRTYSDQTTESTRDVPTTRPFEASTPSPASLET  4997

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T           ++   P  + T      T R + + +
Sbjct  4998  TVPSVTSETTTNVPIGSTGGQVT----------GQTTAPPSEFRT------TIRVEES-T  5040

Query  724   LPKIDKKIARTSKSIERGNVTIGE-TIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTT  782
             LP         S+S E       + T R   +Q    T        F  S  +  S  TT
Sbjct  5041  LPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETT  5100

Query  783   VEKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEP  830
             V  + LET T  P+            SS +   TT+++  +T  SR+ +     ++ + P
Sbjct  5101  VPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETP  5160

Query  831   TPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWN  889
             T   + S  T+R    +    +R     R  + ST + ++ ETT  SVT + T       
Sbjct  5161  T---LPSDFTTRPHSEQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEAT------T  5211

Query  890   SAYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEV  949
             +  I     + T+++  + ++   T R   S+L +  T +TS   +  P T T       
Sbjct  5212  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTSP--SESPETPTTLPSDFT  5269

Query  950   SQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANETFNLIG  1009
             ++P +  T  +    V  T  + A   +  S + ++   P+V+LE    T  N      G
Sbjct  5270  TRPHSDQT-TECTRDVPTTRPFEASTPSSASLETTV---PSVTLE----TTTNVPIGSTG  5321

Query  1010  ISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFAGVYRN  1069
                + +  S  S                      ++++T+    S L +++         
Sbjct  5322  GQVTEQTTSSPS----------------------EVRTTIRVEESTLPSRS---------  5350

Query  1070  VSSNETAAQRVTPSGSP--PRFSARYRGVELFVRKPNDANSTGNA----STTSFISSSIT  1123
                    A R TPS SP  P   +       F  +P+   +T +     +T  F +S+ +
Sbjct  5351  -------ADRTTPSESPETPTLPSD------FTTRPHSEQTTESTRDVPTTRPFEASTPS  5397

Query  1124  NASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
             +AS     P   +  ++  P G    Q  E+  +S ++     R+T+ + +    +   +
Sbjct  5398  SASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSE----FRTTIRVEESTLPSRSAD  5453

Query  1184  DTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLDQI  1243
              T  ++S       +   +  +     ++ S  D+      +    +P       P    
Sbjct  5454  RTTPSESPETPTLPSDFTTRPHS--EQTTESTRDVPTTRPFEASTPSPASLETTVP-SVT  5510

Query  1244  FGITTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITI  1301
                TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T 
Sbjct  5511  SETTTNVPIGSTGGQVTGQTTAPPSEVRTTI------RVEESTLP-------SRSTDRTT  5557

Query  1302  TNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMTTT  1351
              +++P   T + +  TT T +  TT+ST +   +RP   +T        T  + T+ TTT
Sbjct  5558  PSESPETPTILPSDSTTRTYSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTT  5617

Query  1352  LLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISST  1411
              +P  +     T   + + + + TTIG+ + T    + D                S S +
Sbjct  5618  NVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDR--------------TSPSES  5663

Query  1412  PKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDL  1471
             P+T T +      +  S   +++  TR     +P  AS  S    PAS   + P +    
Sbjct  5664  PETPTTLPSDFTTRPHSDQTTES--TRDVPTTRPFEASTPS----PASLETTVPSVTS--  5715

Query  1472  LQSTSKKPVAAT--TTTEPFTWKPVTDVTSITSSKQTEISTKTT-TSITSTTTTSTMTPS  1528
              ++T+  P+ +T    TE  T  P    T+I   + T  S  T  TS + +  T T  PS
Sbjct  5716  -ETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPS  5774

Query  1529  ASQIIFDTFPTHPPTIKSSN--------LATILNTVTSSTTIPTI-SFTTTVTPKVITRK  1579
                  F T P    T +S+          A+  +  +  TT+P++ S TTT  P   T  
Sbjct  5775  D----FITRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGG  5830

Query  1580  PVAVRPAPPPTTTQAPLGFGASLL  1603
              V  +   PP+  +  +G   S L
Sbjct  5831  QVTGQTTAPPSEVRTTIGVEESTL  5854


 Score = 56.2 bits (134),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 219/1073 (20%), Positives = 366/1073 (34%), Gaps = 192/1073 (18%)

Query  629   LSESNISTLSEIFQGQKKRTPGTNFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSST--  686
             ++E   S+ SE+      R   +   +RS  +   ++    P L S+    P +  +T  
Sbjct  6008  VTEQTTSSPSEV--RTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTES  6065

Query  687   TLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTISLPKIDKKIA----------RTSK  736
             T +         S   P   +T  + S+T  T   + +     ++           RT+ 
Sbjct  6066  TRDVPTTRPFEASTPSPASLET-TVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTI  6124

Query  737   SIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL  796
              +E   +    T R   ++     TT  P D   +  +   +E T       +  T RP 
Sbjct  6125  GVEESTLPSRSTDRTSPSESPETPTT-LPSDFITRPHSEQTTESTR------DVPTTRPF  6177

Query  797   SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSIDSHNTSRSVVSKPLTRSRGYT  856
              +      ++K    +  S A     I     + T ++  S +  R+ +     R    T
Sbjct  6178  EASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI-----RVEEST  6232

Query  857   NRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNSAYIDKNWQEPTKKSDVTSTQATVTSR  916
               +R    TT S +  T  ++    T RP   +    +     PT +   TST +  +  
Sbjct  6233  LPSRSTDRTTPSESPETPTTLPSDFTTRPH--SEKTTESTRDVPTTRPFETSTPSPASLE  6290

Query  917   NTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIK  976
              T  S+T E T                      S P  S  G+    + A   +    I+
Sbjct  6291  TTVPSVTLETTT---------------------SVPMGSTGGQVTGQTTAPPSEVRTTIR  6329

Query  977   TENSTQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLIN  1036
              E ST       P+ S +  + + + ET   +     +R +S           +TT    
Sbjct  6330  VEESTL------PSRSTDRTSPSESPETPTTLPSDFITRPHS----------EKTTESTR  6373

Query  1037  SNASLLEQIKSTVAPLLSVLGAKAPAFAGVYRNVSSNETAAQRVTPSGSP--PRFSARYR  1094
                +      ST +   S        F   Y+  +    +A R TPS SP  P   +   
Sbjct  6374  DVPTTRPFEASTPSSASSGNNCSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSD--  6431

Query  1095  GVELFVRKPND---ANSTGNASTTSFISSSITNASPGGLRPPSGVTPSSINPQGGRIIQD  1151
                 F  +P+      ST +  TT    +S  + +      PS  + ++ N   G     
Sbjct  6432  ----FTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQ  6487

Query  1152  IERDKASRTKEAGGQRSTVYIGQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGS  1211
             +     +   E    R+T+ + +    +  T+ T  ++S     E  ++  +     P S
Sbjct  6488  VTGQTTAPPSEV---RTTIRVEESTLPSRSTDRTTPSESP----ETPTILPSDFTTRPHS  6540

Query  1212  ---SISPLDILPNNQVQGRVTAPPGFPWKDPLDQIFGITTESPI--IRASVASNTLDEPS  1266
                + S  D+      +     P       P       TT  PI      V   T   PS
Sbjct  6541  DQTTESTRDVPTTRPFEASTPRPVTLETAVP-SVTLETTTNVPIGSTGGQVTGQTTATPS  6599

Query  1267  SSRSPITARPINRLLEVFTPLLNANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1326
               R+ I      R+ E   P       +R T  T  +++P   TT+ +  TT   +  TT
Sbjct  6600  EVRTTI------RVEESTLP-------SRSTDRTTPSESPETPTTLPSDFTTRPHSDQTT  6646

Query  1327  KSTTN---SRPVTTTT-------MTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLFTT  1376
             +ST +   +RP   +T        T  + T  TTT +P  +     T   ++S + + TT
Sbjct  6647  ESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTT  6706

Query  1377  IG-----IPKQTSFGTTFDDLAFLNTLLESDY--RPNSISSTPKTL--------------  1415
             IG     +P +++  T+  +     T L SD+  RP+S  +T  T               
Sbjct  6707  IGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  6766

Query  1416  -----TEVERLLANKILSLALSQAG-------------------------PTRSPKAIQP  1445
                  T V  + +    ++ +   G                         P+RS     P
Sbjct  6767  PASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSP  6826

Query  1446  SNASPNSLDILPASF---GHS------------SPPIIIDLLQSTSKKPVAATTTTEPFT  1490
             S  SP +   LP+ F    HS            + P       S S +    + T E  T
Sbjct  6827  SE-SPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETTT  6885

Query  1491  WKPVTD----VTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHPPTI  1544
               P+      VT  T+S  +E+ T  +   S   + +T   TPS S     T P+   T 
Sbjct  6886  NVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTR  6945

Query  1545  KSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
               S+      T  SS  +PT       TP+ +T +  AV P    TTT  P+G
Sbjct  6946  PHSD-----QTTESSRDVPTTQPFEASTPRPVTLQ-TAVLPVTSETTTNVPIG  6992


 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 242/1088 (22%), Positives = 388/1088 (36%), Gaps = 147/1088 (14%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST S   LE 
Sbjct  5247  RSTDRTSP----SESPETPTTLPSDFTTRPHSDQTTECTRDVPTTRPFEASTPSSASLET  5302

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQDPKRYDTFKLSSITPRTKVTIS  723
                 V  E  +   +    G  T        E++ S     R       S  P      +
Sbjct  5303  TVPSVTLETTTNVPIGSTGGQVT--------EQTTSSPSEVRTTIRVEESTLPSRSADRT  5354

Query  724   LPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNSELTTV  783
              P         S+S E   +    T R    Q    T        F  S  +  S  TTV
Sbjct  5355  TP---------SESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSASLETTV  5405

Query  784   EKIKLETVTIRPL------------SSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPT  831
               + LET T  P+            SS +   TT+++  +T  SR+ +     ++ + PT
Sbjct  5406  PSVTLETTTNVPIGSTGGQVTEQTTSSPSEFRTTIRVEESTLPSRSADRTTPSESPETPT  5465

Query  832   PRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRPRVWNS  890
                + S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T       +
Sbjct  5466  ---LPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETT------TN  5516

Query  891   AYIDKNWQEPTKKSDVTSTQATVTSRNTYSSLTAEKTVQTSRRGNSRPRTATYRRHLEVS  950
               I     + T ++    ++   T R   S+L +  T +T+   +  P T T       +
Sbjct  5517  VPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTP--SESPETPTILPSDSTT  5574

Query  951   QPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLEL-----LNKTNANETF  1005
             +  +  T  +    V  T  + A   +  S + ++   P+V+LE      +  T    T 
Sbjct  5575  RTYSDQT-TESTRDVPTTRPFEASTPSPASLETTV---PSVTLETTTNVPIGSTGGQVTG  5630

Query  1006  NLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLSVLGAKAPAFAG  1065
                   +  R   G  +S +  P+R+T   + + S   +  +T+    +           
Sbjct  5631  QTTATPSEVRTTIGVEESTL--PSRSTDRTSPSES--PETPTTLPSDFTT----------  5676

Query  1066  VYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDAN-STGNASTTSFISSSITN  1124
               R  S   T + R  P+  P   S            P+ A+  T   S TS  ++++  
Sbjct  5677  --RPHSDQTTESTRDVPTTRPFEAST-----------PSPASLETTVPSVTSETTTNVPI  5723

Query  1125  ASPGG-LRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
              S GG +   +  +PS +    G     +      RT  +    +   +  + FI    +
Sbjct  5724  GSTGGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSD-FITRPHS  5782

Query  1184  DTAQNDSRVVSVEINSVAS-----AINEGLPGSSISPLDILP----NNQVQGRVTAPPGF  1234
             D     +R V       AS     ++   +P  +      +P      QV G+ TAPP  
Sbjct  5783  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPS-  5841

Query  1235  PWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLA  1294
                        + T   +  +++ S + D  S S SP T      L   F    ++ Q  
Sbjct  5842  ----------EVRTTIGVEESTLPSRSTDRTSPSESPETP---TTLPSDFITRPHSEQTT  5888

Query  1295  RDTSITITNDAPTVSTTVGASM--TTPTTTTSTTKS----TTNSRPVTTTTMTNSAPTMM  1348
               T    T      ST   AS+  T P+ T+  T +    +T  R  TT + +   PT +
Sbjct  5889  ESTRDVPTTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGQRIGTTPSESPETPTTL  5948

Query  1349  TTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSI  1408
              +     P    +T ST    TT  F T   P   S  TT   +    TL  +   P  I
Sbjct  5949  PSDFTTRPHSEKTTESTRDVPTTRPFET-STPSPASLETTVPSV----TLETTTNVP--I  6001

Query  1409  SSTPKTLTEVERLLANKILSLALSQAG--PTRSPKAIQPSNASPNSLDILPASFGHSSPP  1466
              ST   +TE      +++ +    +    P+RS     PS  SP +   LP+ F  ++ P
Sbjct  6002  GSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSE-SPET-PTLPSDF--TTRP  6057

Query  1467  IIIDLLQSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQTEISTKTTTSITSTT  1520
                   +ST   P     TT PF   T  P    T V S+TS   T +   +T    +  
Sbjct  6058  HSEQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQ  6112

Query  1521  TTSTMTPSASQIIFD--TFPTHPP--TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVI  1576
             TT+  +   + I  +  T P+     T  S +  T     +   T P    TT  T  V 
Sbjct  6113  TTAPPSEVRTTIGVEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSEQTTESTRDVP  6172

Query  1577  TRKPV-AVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQ  1635
             T +P  A  P+P    T  P     +      G         TT  P +  ++TT+R  +
Sbjct  6173  TTRPFEASTPSPASLKTTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE--VRTTIRVEE  6230

Query  1636  TTPKPIST  1643
             +T    ST
Sbjct  6231  STLPSRST  6238


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 216/1021 (21%), Positives = 361/1021 (35%), Gaps = 122/1021 (12%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGTN---FSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      S+      +  P T     ST     LE 
Sbjct  7023  RSTDRTTP----SESPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFESSTPRPVTLET  7078

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQD-----PKRYDTFKLSSITPRT  718
             A   V  E  +   +    G  T   +   +E   +++      P R       S +P T
Sbjct  7079  AVPPVTSETTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPET  7138

Query  719   KVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVF-------VQ  771
               T  LP        + ++ E            R     R   + TP  V        V 
Sbjct  7139  PTT--LPSDFTTRPHSDQTTES----------TRDVPTTRPFESSTPRPVTLEIAVPPVT  7186

Query  772   SKTAYNSELTTVEKIKLETVTIRPLSSRNIDTTTVKMLSTTRRSRAWNAAYIDKNWQEPT  831
             S+T  N  + +      E  T  P   R    TT+++  +T  SR+ +     ++ + PT
Sbjct  7187  SETTTNVAIGSTGGQVTEQTTSSPSEVR----TTIRVEESTLPSRSTDRTTPSESPETPT  7242

Query  832   PRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKR-PRVWN  889
               ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T   P    
Sbjct  7243  --TLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTSVPMGST  7300

Query  890   SAYIDKNWQEPTK--KSDVTSTQATVTSRN---TYSSLTAEKTVQTSRRGNSRP---RTA  941
                +      P    ++ +   ++T+ SR+   T  S + E          +RP   +T 
Sbjct  7301  GGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTPPSESPETPTTLPSDFTTRPHSDQTT  7360

Query  942   TYRRHLEVSQPQNSLTGKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNA  1001
                R +  +QP  S T +     +A+ P     + +E +T   I    +   ++  +T A
Sbjct  7361  ESSRDVPTTQPFESSTPRPVTLEIAVPP-----VTSETTTNVPIG---STGGQVTGQTTA  7412

Query  1002  --NETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTV-----APLLS  1054
               +E    IG+  S+  +     +       T   + S+ +       T       P   
Sbjct  7413  TPSEVRTTIGVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTR  7472

Query  1055  VLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNAST  1114
                A  P+ A +   V S         P GS      +  G       P++  +T     
Sbjct  7473  PFEASTPSPASLETTVPSVTLETTTNVPIGST---GGQVTGQT--TATPSEVRTTIGVEE  7527

Query  1115  TSFISSSITNASPGGLRPPSGVTPS--SINPQGGRIIQDIERDKASRTKEAGGQRSTVYI  1172
             ++  S S    +P          PS  +  P   +  +       +R  EA   R    +
Sbjct  7528  STLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRP---V  7584

Query  1173  GQEKFINYWTNDTAQNDSRVVSVEINS-VASAINEGLPGSSISPLDILPNNQVQGRVTAP  1231
               E  +   T++T  N      V I S V S     +P  S          QV G+ TAP
Sbjct  7585  TLETAVPSVTSETTTN------VPIGSTVTSETTTNVPIGSTG-------GQVAGQTTAP  7631

Query  1232  PGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNAN  1291
             P             + T   +  +++ S + D  + S SP T      L   FT   ++ 
Sbjct  7632  PS-----------EVRTTIRVEESTLPSRSADRTTPSESPETP---TTLPSDFTTRPHSE  7677

Query  1292  QLARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTT-----TTMTNSAPT  1346
             Q    T    T      ST   AS+   TT  S T  TT + P+ +     T  + S+P+
Sbjct  7678  QTTESTRDVPTTRPFEASTPSPASLE--TTVPSVTSETTTNVPIGSTGGQLTEQSTSSPS  7735

Query  1347  MMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLES-----  1401
              + T      TI    ++  S ST   F +    K T+  + F     L    ES     
Sbjct  7736  EVRT------TIRVEESTLPSRSTDRTFPSESPEKPTTLPSDFTTRPHLEQTTESTRDVL  7789

Query  1402  DYRPNSISS-TPKTL-TEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPAS  1459
               RP   S+ +P +L T V  + +    ++ +   G   + +   P +       I+ ++
Sbjct  7790  TTRPFETSTPSPVSLETTVPSVTSETSTNVPIGSTGGQVTEQTTAPPSVRTTE-TIVKST  7848

Query  1460  FGHSSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITST  1519
                 SP   I      ++ P+ +TT        P       TSS++ + ST+ T+  ++ 
Sbjct  7849  HPAVSPDTTIPSEIPATRVPLESTTRLYTDQTIPPGSTDRTTSSERPDESTRLTSEESTE  7908

Query  1520  TTTSTMTPSASQIIFDTFPTH-PPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITR  1578
             TT    T S    +  T  +    T K+++  T    VT  TT      TT  +  V+T 
Sbjct  7909  TTRPVPTVSPRDALETTVTSLITETTKTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTE  7968

Query  1579  K  1579
             +
Sbjct  7969  R  7969


 Score = 54.7 bits (130),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 290/1354 (21%), Positives = 473/1354 (35%), Gaps = 241/1354 (18%)

Query  418   RPRKHNGLSSLSKKSTKELVSSSINTVTTVPTTTAFTKEVVFLLSSKKPTEAPGNRRAAT  477
             RP + +  SS S ++T  + S ++ T T VP  +  T   V   ++  P+E     R   
Sbjct  5389  RPFEASTPSSASLETT--VPSVTLETTTNVPIGS--TGGQVTEQTTSSPSEFRTTIRVEE  5444

Query  478   SIL----TIKTLPKEKDLDDTL--DFRGRKEFKQASYTT----------SITFSNQNTEN  521
             S L      +T P E     TL  DF  R   +Q + +T          + T S  + E 
Sbjct  5445  STLPSRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  5504

Query  522   LLNDISSTNLSNNRRRGNKLFNKASITKTGKEIVGENDNYPPEFKAKLAQLDNSDKSNER  581
              +  ++S   +N             I  TG ++ G+    P E +  +          E 
Sbjct  5505  TVPSVTSETTTN-----------VPIGSTGGQVTGQTTAPPSEVRTTIRV--------EE  5545

Query  582   SELPKINKYIYYQDDEVTKIITRHLRSTDQADPLDIQSETDEIPDLILSESNISTLSEIF  641
             S LP                     RSTD+  P    SE+ E P ++ S+S   T S+  
Sbjct  5546  STLPS--------------------RSTDRTTP----SESPETPTILPSDSTTRTYSDQT  5581

Query  642   QGQKKRTPGT---NFSTRSKQKLEEAKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESK  698
                 +  P T     ST S   LE     V  E  +   +    G  T   +   +E   
Sbjct  5582  TESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNVPIGSTGGQVTGQTTATPSEVRT  5641

Query  699   SL-----QDPKRYDTFKLSSITPRTKVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQ  753
             ++       P R       S +P T  T  LP                      T R   
Sbjct  5642  TIGVEESTLPSRSTDRTSPSESPETPTT--LPS-------------------DFTTRPHS  5680

Query  754   NQKERITTTGTPDDVFVQSKTAYNSELTTVEKIKLETVTIRPL------------SSRNI  801
             +Q    T        F  S  +  S  TTV  +  ET T  P+            SS + 
Sbjct  5681  DQTTESTRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSE  5740

Query  802   DTTTVKMLSTTRRSRAWNAAYIDKNWQEPTPRSID------SHNTSRSVVSKPLTRS-RG  854
               TT+ +  +T  SR+ +     ++ + PT    D      S  T+ S    P TR    
Sbjct  5741  VRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEA  5800

Query  855   YTNRNRQISTTTMS-NNETTQK--------SVTFKVTKRPRVWNSAYIDKNWQEPTKKSD  905
              T     + TT  S  +ETT           VT + T  P    +    +    P++ +D
Sbjct  5801  STPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIGVEESTLPSRSTD  5860

Query  906   VTSTQATVTSRNTYSS--LTAEKTVQTSRRGNSRPRTATYRRHLEVSQPQNSLTGKKEVS  963
              TS   +  +  T  S  +T   + QT+      P T    R  E S P  + + K  V 
Sbjct  5861  RTSPSESPETPTTLPSDFITRPHSEQTTESTRDVPTT----RPFEASTPSPA-SLKTTVP  5915

Query  964   SVAITPKYHALIKTENSTQQSIKKEPAVSLELLNKTNANETFNLIGISTSSRGNSGNSDS  1023
             SV      +  I    ST Q I   P+ S E      ++ T        S +      D 
Sbjct  5916  SVTSEATTNVPI---GSTGQRIGTTPSESPETPTTLPSDFTTR----PHSEKTTESTRDV  5968

Query  1024  NIFNPARTTYLINSNASLLEQIKS------TVAPLLSVLG------AKAPAFAGVYRNVS  1071
                 P  T+    S ASL   + S      T  P+ S  G        +P+       V 
Sbjct  5969  PTTRPFETS--TPSPASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVE  6026

Query  1072  SN---ETAAQRVTPSGSP--PRFSARYRGVELFVRKPND---ANSTGNASTTSFISSSIT  1123
              +     +A R TPS SP  P   +       F  +P+      ST +  TT    +S  
Sbjct  6027  ESTLPSRSADRTTPSESPETPTLPSD------FTTRPHSEQTTESTRDVPTTRPFEASTP  6080

Query  1124  NASPGGLRPPSGVTPSSINPQGGRIIQDIERDKASRTKEAGGQRSTVYIGQEKFINYWTN  1183
             + +      PS  + ++ N   G     +     +   E    R+T+ + +    +  T+
Sbjct  6081  SPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEV---RTTIGVEESTLPSRSTD  6137

Query  1184  DTAQNDSRVVSVEINS--VASAINEGLPGSSISPLDILPNNQVQGRVTAPPGFPWKDPLD  1241
              T+ ++S      + S  +    +E    ++ S  D+      +    +P       P  
Sbjct  6138  RTSPSESPETPTTLPSDFITRPHSEQ---TTESTRDVPTTRPFEASTPSPASLKTTVP-S  6193

Query  1242  QIFGITTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSI  1299
                  TT  PI      V   T   PS  R+ I      R+ E   P       +R T  
Sbjct  6194  VTSEATTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDR  6240

Query  1300  TITNDAPTVSTTVGASMTTPTTTTSTTKSTTN---SRPVTTTT-------MTNSAPTMMT  1349
             T  +++P   TT+ +  TT   +  TT+ST +   +RP  T+T        T  + T+ T
Sbjct  6241  TTPSESPETPTTLPSDFTTRPHSEKTTESTRDVPTTRPFETSTPSPASLETTVPSVTLET  6300

Query  1350  TTLLPTPTIAASTTSTMSTSTTSLFTTIGI-----PKQTSFGTTFDDLAFLNTLLESDY-  1403
             TT +P  +     T   +   + + TTI +     P +++  T+  +     T L SD+ 
Sbjct  6301  TTSVPMGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTSPSESPETPTTLPSDFI  6360

Query  1404  -RPNSISSTPKTLTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGH  1462
              RP+S  +T  T                      TR  +A  PS+AS         S  +
Sbjct  6361  TRPHSEKTTEST-----------------RDVPTTRPFEASTPSSAS---------SGNN  6394

Query  1463  SSPPIIIDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITSTTTT  1522
              S     +  + +++   +A  TT   + +  T  +  T+   +E +T++T  + +T   
Sbjct  6395  CSISYFRNHYKCSNRFNRSADRTTPSESPETPTLPSDFTTRPHSEQTTESTRDVPTTRPF  6454

Query  1523  STMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVA  1582
                TPS + +          T  +  + +    VT  TT P     TT+  +  T    +
Sbjct  6455  EASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRS  6514

Query  1583  VRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQ-TTPKPI  1641
                  P  + + P     ++L + F      P +  T +  + V   T RP + +TP+P+
Sbjct  6515  TDRTTPSESPETP-----TILPSDFTTR---PHSDQTTESTRDV--PTTRPFEASTPRPV  6564

Query  1642  STTAAREMYAASEQIN-HIDYSNSLVSGSKSTSP  1674
             +   A          N  I  +   V+G  + +P
Sbjct  6565  TLETAVPSVTLETTTNVPIGSTGGQVTGQTTATP  6598


 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 82/356 (23%), Positives = 134/356 (38%), Gaps = 48/356 (13%)

Query  1247  TTESPI--IRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQLARDTSITITND  1304
             TT  PI      V   T   PS  R+ I      R+ E   P       +R T  T  ++
Sbjct  6884  TTNVPIGSTGGQVTEQTTSSPSEVRTTI------RVEESTLP-------SRSTDRTTPSE  6930

Query  1305  APTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTS  1364
             +P   TT+ +  TT   +  TT+S+ +         +   P  + T +LP  +   +   
Sbjct  6931  SPETPTTLPSDFTTRPHSDQTTESSRDVPTTQPFEASTPRPVTLQTAVLPVTSETTTNVP  6990

Query  1365  TMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNSISSTPKTLTEVERLLAN  1424
               ST       T   P +       ++    +TL        + S +P+T T +      
Sbjct  6991  IGSTGGQVTEQTTSSPSEVRTTIRVEE----STLPSRSTDRTTPSESPETPTTLP-----  7041

Query  1425  KILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSSP-PIIIDLLQSTSKKPVAAT  1483
                      +  T  P + Q + +S +     P  F  S+P P+ ++    T+  PV + 
Sbjct  7042  ---------SDFTTRPHSDQTTESSRDVPTTQP--FESSTPRPVTLE----TAVPPVTSE  7086

Query  1484  TTTEPFTWKPVTDVTSITSSKQTEIST--KTTTSITSTTTTSTMTPSASQIIFDTFPTHP  1541
             TTT          VT  T+   +E+ T  +   S   + +T   TPS S     T P+  
Sbjct  7087  TTTNVPIGSTGGQVTEQTTPSPSEVRTTIRIEESTFPSRSTDRTTPSESPETPTTLPSDF  7146

Query  1542  PTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLG  1597
              T   S+      T  S+  +PT     + TP+ +T + +AV P    TTT   +G
Sbjct  7147  TTRPHSD-----QTTESTRDVPTTRPFESSTPRPVTLE-IAVPPVTSETTTNVAIG  7196


 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 226/1047 (22%), Positives = 384/1047 (37%), Gaps = 131/1047 (13%)

Query  607   RSTDQADPLDIQSETDEIPDLILSESNISTLSEIFQGQKKRTPGT---NFSTRSKQKLEE  663
             RSTD+  P    SE+ E P  + S+      SE      +  P T     ST S   LE 
Sbjct  4840  RSTDRTTP----SESPETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLET  4895

Query  664   AKKLVKPELKSEEKVNPDNGSSTTLNSVKFNEESKSLQD-----PKRYDTFKLSSITPRT  718
                 V  E  +   +    G  T   +   +E   +++      P R       S +P T
Sbjct  4896  TVPSVTLETTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPET  4955

Query  719   KVTISLPKIDKKIARTSKSIERGNVTIGETIRIRQNQKERITTTGTPDDVFVQSKTAYNS  778
               T+            S  I R       T   +  +  R   T  P   F  S  +  S
Sbjct  4956  PTTLP-----------SDFITR-------TYSDQTTESTRDVPTTRP---FEASTPSPAS  4994

Query  779   ELTTVEKIKLETVTIRPLSSRNIDTT------------TVKMLSTTRRSRAWNAAYIDKN  826
               TTV  +  ET T  P+ S     T            T+++  +T  SR+ +     ++
Sbjct  4995  LETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSRSTDRTTPSES  5054

Query  827   WQEPTPRSIDSHNTSRSVVSKPLTRSRGY-TNRNRQISTTTMSNNETTQKSVTFKVTKRP  885
              + PT  ++ S  T+R    +    +R   T R  + ST + ++ ETT  SVT + T   
Sbjct  5055  PETPT--TLPSDFTTRPHSDQTTESTRDVPTTRPFEASTPSPASLETTVPSVTLETTTNV  5112

Query  886   RVWNSA--YIDKNWQEPTK-KSDVTSTQATVTSRNTYSSLTAE--KTVQTSRRGNSRP--  938
              + ++     ++    P++ ++ +   ++T+ SR+   +  +E  +T        +RP  
Sbjct  5113  PIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETPTLPSDFTTRPHS  5172

Query  939   -RTATYRRHLEVSQPQNSLT---GKKEVSSVAITPKYHALIKTENSTQQSIKKEPAVSLE  994
              +T    R +  ++P  + T      E +  ++T +    +   ++  Q  ++  +   E
Sbjct  5173  EQTTESTRDVPATRPFEASTPSPASLETTVPSVTSEATTNVPIGSTGGQVTEQTTSSPSE  5232

Query  995   LLNKTNANETFNLIGISTSSRGNSGNSDSNIFNPARTTYLINSNASLLEQIKSTVAPLLS  1054
             +       E+  L   ST     S + ++    P+  T   +S+ +  E  +    P   
Sbjct  5233  VRTTIRVEES-TLPSRSTDRTSPSESPETPTTLPSDFTTRPHSDQT-TECTRDV--PTTR  5288

Query  1055  VLGAKAPAFAGVYRNVSSNETAAQRVTPSGSPPRFSARYRGVELFVRKPNDANSTGNAST  1114
                A  P+ A +   V S         P G     S   +  E     P++  +T     
Sbjct  5289  PFEASTPSSASLETTVPSVTLETTTNVPIG-----STGGQVTEQTTSSPSEVRTTIRVEE  5343

Query  1115  TSFISSSITNASPGGLRPPSGVTPS--SINPQGGRIIQDIERDKASRTKEAGGQRSTVYI  1172
             ++  S S    +P    P +   PS  +  P   +  +       +R  EA    S    
Sbjct  5344  STLPSRSADRTTPSE-SPETPTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSSA---  5399

Query  1173  GQEKFINYWTNDTAQNDSRVVSVEINSVASAINEGLPGSSISPLDILPNNQVQGRVTAPP  1232
               E  +   T +T  N      V I S    + E    ++ SP +     +V+       
Sbjct  5400  SLETTVPSVTLETTTN------VPIGSTGGQVTE---QTTSSPSEFRTTIRVEESTLPSR  5450

Query  1233  GFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITAR--PINRLLEVFTPLLNA  1290
                   P +     + E+P    ++ S+    P S ++  + R  P  R  E  TP   +
Sbjct  5451  SADRTTPSE-----SPETP----TLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPAS  5501

Query  1291  --NQLARDTSITITNDAPTVST---TVGASMTTPTTTTSTTKSTTNSRPVTTTTMTNSAP  1345
                 +   TS T TN  P  ST     G +   P+   +T +   ++ P  +T  T  + 
Sbjct  5502  LETTVPSVTSETTTN-VPIGSTGGQVTGQTTAPPSEVRTTIRVEESTLPSRSTDRTTPSE  5560

Query  1346  TMMTTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDYRP  1405
             +  T T+LP+     STT T S  TT   +T  +P    F  +    A L T + S    
Sbjct  5561  SPETPTILPSD----STTRTYSDQTTE--STRDVPTTRPFEASTPSPASLETTVPSVTLE  5614

Query  1406  NS----ISSTPKTLTEVERLLANKI-LSLALSQAG-PTRSPKAIQPSNASPNSLDILPAS  1459
              +    I ST   +T       +++  ++ + ++  P+RS     PS  SP +   LP+ 
Sbjct  5615  TTTNVPIGSTGGQVTGQTTATPSEVRTTIGVEESTLPSRSTDRTSPSE-SPETPTTLPSD  5673

Query  1460  FGHSSPPIIIDLLQSTSKKPVAATTTTEPF---TWKPV---TDVTSITSSKQTEISTKTT  1513
             F  ++ P      +ST   P     TT PF   T  P    T V S+TS   T +   +T
Sbjct  5674  F--TTRPHSDQTTESTRDVP-----TTRPFEASTPSPASLETTVPSVTSETTTNVPIGST  5726

Query  1514  TSITSTTTTSTMTPSASQIIFD--TFPTHPP--TIKSSNLATILNTVTSSTTIPTISFTT  1569
                 +  TTS+ +   + I  +  T P+     T  S +  T     +   T P    TT
Sbjct  5727  GGQVTEQTTSSPSEVRTTIGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTT  5786

Query  1570  TVTPKVITRKPV-AVRPAPPPTTTQAP  1595
               T  V T +P  A  P+P    T  P
Sbjct  5787  ESTRDVPTTRPFEASTPSPASLETTVP  5813


 Score = 43.9 bits (102),  Expect = 0.002, Method: Composition-based stats.
 Identities = 111/466 (24%), Positives = 170/466 (36%), Gaps = 74/466 (16%)

Query  1223  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1282
             QV G+ TAPP             + T   +  +++ S + D  + S SP T         
Sbjct  6487  QVTGQTTAPPS-----------EVRTTIRVEESTLPSRSTDRTTPSESPETP--------  6527

Query  1283  VFTPLLNANQLARDTSITITNDAPTV---STTVGASMTTPTTTTSTTKSTTNSRPVTTTT  1339
                P     +   D +   T D PT      +    +T  T   S T  TT + P+ +T 
Sbjct  6528  TILPSDFTTRPHSDQTTESTRDVPTTRPFEASTPRPVTLETAVPSVTLETTTNVPIGSTG  6587

Query  1340  -----MTNSAPTMMTTTL------LP--------------TPTIAASTTSTMSTSTTSLF  1374
                   T + P+ + TT+      LP              TPT   S  +T   S  +  
Sbjct  6588  GQVTGQTTATPSEVRTTIRVEESTLPSRSTDRTTPSESPETPTTLPSDFTTRPHSDQTTE  6647

Query  1375  TTIGIPKQTSFGTTFDDLAFLNTLLESDYRPNS----ISSTPKTLTEVERLLANKI-LSL  1429
             +T  +P    F  +    A L T + S     +    I ST   +TE      +++  ++
Sbjct  6648  STRDVPTTRPFEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTI  6707

Query  1430  ALSQAG-PTRSPKAIQPSNASPNSLDILPASFGHSSPPIIIDLLQSTSKKPVAATTTTEP  1488
              L ++  P+RS     PS  SP +   LP+ F   + P      +ST   P     TT P
Sbjct  6708  GLEESTLPSRSTDRTSPSE-SPETPTTLPSDF--ITRPHSDQTTESTRDVP-----TTRP  6759

Query  1489  F---TWKPV---TDVTSITSSKQTEISTKTTTSITSTTTTSTMTPSASQIIFD--TFPTH  1540
             F   T  P    T V S+TS   T +   +T    +  TTS+ +   + I  +  T P+ 
Sbjct  6760  FEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTEQTTSSPSEVRTTIGLEESTLPSR  6819

Query  1541  PP--TIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV-AVRPAPPPTTTQAPLG  1597
                 T  S +  T     +   T P    TT  T  V T +P  A  P+     T  P  
Sbjct  6820  STDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPSSASLETTVPSV  6879

Query  1598  FGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPIST  1643
                +      G         TT  P +  ++TT+R  ++T    ST
Sbjct  6880  TLETTTNVPIGSTGGQVTEQTTSSPSE--VRTTIRVEESTLPSRST  6923


 Score = 42.0 bits (97),  Expect = 0.007, Method: Composition-based stats.
 Identities = 121/594 (20%), Positives = 214/594 (36%), Gaps = 86/594 (14%)

Query  1242  QIFGITTESP--------IIRASVASNTLDEPSSSRSPITARPINRLLEVFTPLLNANQL  1293
             Q+   TT SP        +  +++ S + D  + S SP T      L   FT   ++ Q 
Sbjct  4202  QVTEQTTSSPSEVRTTIRVEESTLPSRSADRTTPSESPETP---TTLPSDFTTRPHSEQT  4258

Query  1294  ARDTSITITNDAPTVSTTVGASMTTPTTTTSTTKSTTNSRPVTTTT-----MTNSAPTMM  1348
                T    T      ST   AS+ T  T  S T  TT + P+ +T       T S+P+ +
Sbjct  4259  TESTRDVPTTRPFEASTPSPASLET--TVPSVTLETTTNVPIGSTGGQVTGQTTSSPSEV  4316

Query  1349  TTTLLPTPTIAASTTSTMSTSTTSLFTTIGIPKQTSFGTTFDDLAFLNTLLESDY--RPN  1406
              TT+    +   S ++  +T + S  T   +P                    SD+  RP+
Sbjct  4317  RTTIRVEESTLPSRSADRTTPSESPETPTTLP--------------------SDFITRPH  4356

Query  1407  SISSTPKT--LTEVERLLANKILSLALSQAGPTRSPKAIQPSNASPNSLDILPASFGHSS  1464
             S  +T  T  +       A+   S +L    P+ + +    +N    S          SS
Sbjct  4357  SEKTTESTRDVPTTRPFEASTPSSASLETTVPSVTLETT--TNVPIGSTGGQVTEQTTSS  4414

Query  1465  PPII---IDLLQSTSKKPVAATTTTEPFTWKPVTDVTSITSSKQTEISTKTTTSITSTTT  1521
             P  +   I + +ST     A  TT       P T  +  T    +E +T++T  + +T  
Sbjct  4415  PSEVRTTIRVEESTLPSRSADRTTLSESPETPTTLPSDFTIRPHSEQTTESTRDVPTTRP  4474

Query  1522  TSTMTPSASQIIFDTFPTHPPTIKSSNLATILNTVTSSTTIPTISFTTTVTPKVITRKPV  1581
                 TPS + +          T  +  + +    VT  TT P   F TT+  +  T    
Sbjct  4475  FEASTPSPASLETTVPSVTSETTTNVPIGSTGGQVTGQTTAPPSEFRTTIRVEESTLPSR  4534

Query  1582  AVRPAPPPTTTQAPLGFGASLLQAIFGRNIFAPPTSTTQKPLKKVIQTTLRPVQTTPKPI  1641
             +     P  + + P                  P  STT+    +  ++T     T P   
Sbjct  4535  STDRTTPSESPETP---------------TILPSDSTTRTYSDQTTESTRDVPTTRPFEA  4579

Query  1642  STTAAREMYAASEQINHIDYSNSLVSGSKSTSPQATTKYSPEEDAKFLLELLEASERVKK  1701
             ST +   +      +  ++ + ++  GS        T  SP E  +  + + E++   + 
Sbjct  4580  STPSPASLETTVPSVT-LETTTNVPIGSTGGQVTEQTTSSPSE-VRTTIRVEESTLPSRS  4637

Query  1702  GDKKESLVLSNDDEVFLRAILSGQAKVKIPKA-TTEDHASKNAVLLAELLKAQGIKPST-  1759
              D+      +   E       S +    +P    T  H+ K      ++   +  + ST 
Sbjct  4638  ADR------TTPSE-------SPETPTTLPSDFITRPHSEKTTESTRDVPTTRPFEASTP  4684

Query  1760  SSNHLREPLQGISITSTTTI-----GPQIISTSSKRPTTPRPRPTVKAQSSTYP  1808
             SS  L   +  +++ +TT +     G Q+   ++  P+    R T++ + ST P
Sbjct  4685  SSASLETTVPSVTLETTTNVPIGSTGGQVTEQTTSSPS--EVRTTIRVEESTLP  4736


 Score = 37.4 bits (85),  Expect = 0.18, Method: Composition-based stats.
 Identities = 46/172 (27%), Positives = 69/172 (40%), Gaps = 24/172 (14%)

Query  1493   PVTDVTSITSSKQTEISTKT--TTSITSTTTTSTMTPSASQIIFDTFPTHPPTIKSSNLA  1550
              P + V +I S     IS  T    +I S    +   PS   I   + P   PT  S    
Sbjct  19175  PTSGVINIPSQASPPISVPTPGIVNIPSIPQPTPQRPSPGIINVPSVPQPIPTAPSPG--  19232

Query  1551   TILNTVTSSTTIPTISFTTTVTPKVITRKPVAVRPAPPPTTTQAPLGFGASLLQAIFGRN  1610
               I+N  +    +P+       TP VI    +  +P PPP   Q  +    S+ Q      
Sbjct  19233  -IINIPSVPQPLPS------PTPGVIN---IPQQPTPPPLVQQPGIINIPSVQQ------  19276

Query  1611   IFAPPTSTTQKPLKKVIQTTLRPVQTTPKPISTTAAREMYAASEQINHIDYS  1662
                 P T TTQ P++ V   T RP Q TP  I+  +  +    +++ ++ D S
Sbjct  19277  ---PSTPTTQHPIQDVQYETQRP-QPTPGVINIPSVSQPTYPTQKPSYQDTS  19324


 Score = 34.7 bits (78),  Expect = 1.2, Method: Composition-based stats.
 Identities = 36/168 (21%), Positives = 60/168 (36%), Gaps = 28/168 (17%)

Query  1223  QVQGRVTAPPGFPWKDPLDQIFGITTESPIIRASVASNTLDEPSSSRSPITARPINRLLE  1282
             QV  + TAPP             + T   I++++  + + D    S  P T  P+     
Sbjct  7827  QVTEQTTAPPS------------VRTTETIVKSTHPAVSPDTTIPSEIPATRVPLESTTR  7874

Query  1283  VFTPLL----------------NANQLARDTSITITNDAPTVSTTVGASMTTPTTTTSTT  1326
             ++T                    + +L  + S   T   PTVS       T  +  T TT
Sbjct  7875  LYTDQTIPPGSTDRTTSSERPDESTRLTSEESTETTRPVPTVSPRDALETTVTSLITETT  7934

Query  1327  KSTTNSRPVTTTTMTNSAPTMMTTTLLPTPTIAASTTSTMSTSTTSLF  1374
             K+T+   P    T   +      TT   +  +   T  +  +STT++F
Sbjct  7935  KTTSGGTPRGQVTERTTKSVSELTTGRSSDVVTERTMPSNISSTTTVF  7982



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933621.1 RING finger protein 121 isoform X1 [Chelonus
insularis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RN121_CAEEL  unnamed protein product                                  347     3e-118
Q8ILM8_PLAF7  unnamed protein product                                 45.4    4e-05 
HRD1_DROME  unnamed protein product                                   44.7    7e-05 


>RN121_CAEEL unnamed protein product
Length=409

 Score = 347 bits (889),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 160/315 (51%), Positives = 217/315 (69%), Gaps = 12/315 (4%)

Query  12   EEMTPEERSRAEHIMAHKLHQGHEKMHAEMLFILLVTLIIFQISLVAWKKRHFRSYQLVT  71
             E+T EE+   EH   H+ H+GHE MH EM+ I ++++I+ QI LV WK++HF+SYQ+ T
Sbjct  95   HELTEEEQWAEEHRKMHEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCT  154

Query  72   LIAIWIIPLGMSLRNYWWRFIFSWLLFSCVTALVVRKALQKPIQGTTPRLVYKWFYFIYR  131
            LI +  IP+ +     W+RF+ +WL+F   +A +  KA  + I G TPR VYKWF F+++
Sbjct  155  LIGMLTIPVYVCFNRSWYRFLATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHK  214

Query  132  LSYVLGIIGYVVVLATFFGLNLVFNAKASAWMDCGLLFLFYGLYFGVLGRDIAEICADKM  191
            LSYVLG++GY++++    G +++F       MD G+LF+FYG+Y+GVLGRD A IC  +M
Sbjct  215  LSYVLGVVGYLIMMGALLGFHVLFGVSQPTLMDAGILFMFYGVYYGVLGRDFAHICTARM  274

Query  192  ASHIGYYAPGSMPTRTLDPGVCAVCGNKILVSEH------------EEGVIENTYKLSCE  239
            AS IGYY P  +P + L+ GVCAVCG ++  SEH             E   E  YKLSC 
Sbjct  275  ASRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCG  334

Query  240  HVFHEFCIRGWCIVGKKQTCPYCKEKVDLKKMFCNPWERPHVLYGQLLDWIGWLVAWQPL  299
            HVFHEFCIRGW +VGK QTCPYCKE+VDL++MF NPWE+PH+ YG+LLDWI +LV WQPL
Sbjct  335  HVFHEFCIRGWVVVGKLQTCPYCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPL  394

Query  300  ILFLVQGINWMFGLD  314
            I+  VQG+    GL+
Sbjct  395  IVTAVQGLTTWMGLE  409


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 45.4 bits (106),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 32/58 (55%), Gaps = 11/58 (19%)

Query  209  DPGVCAVCGNKILVSEHEEGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
            + G C +C          + + E + KLSC H+FH  C++ W I  ++QTCP C+ ++
Sbjct  294  EAGTCIIC---------RDDLKEGSKKLSCSHIFHVDCLKSWFI--QQQTCPICRTEI  340


>HRD1_DROME unnamed protein product
Length=626

 Score = 44.7 bits (104),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (48%), Gaps = 21/103 (20%)

Query  168  LFLFYGLYFGVLGRDIAEICADKMAS-----HIGYYAPGSMPT--RTLDPGVCAVCGNKI  220
            +F+F  ++F +  R+  +   D + S     ++    P + P   R  D  +C +C    
Sbjct  240  MFVFRPMFFTI--RNFRKALNDVIMSRRAIRNMNTLYPDATPEELRQSD-NICIIC----  292

Query  221  LVSEHEEGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCK  263
                  E ++ ++ KL C H+FH  C+R W    ++QTCP C+
Sbjct  293  -----REDMVNHSKKLPCGHIFHTTCLRSW--FQRQQTCPTCR  328



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933622.1 RING finger protein 121 isoform X2 [Chelonus
insularis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RN121_CAEEL  unnamed protein product                                  347     2e-118
Q8ILM8_PLAF7  unnamed protein product                                 45.4    4e-05 
HRD1_DROME  unnamed protein product                                   45.1    6e-05 


>RN121_CAEEL unnamed protein product
Length=409

 Score = 347 bits (889),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 217/314 (69%), Gaps = 12/314 (4%)

Query  13   EMTPEERSRAEHIMAHKLHQGHEKMHAEMLFILLVTLIIFQISLVAWKKRHFRSYQLVTL  72
            E+T EE+   EH   H+ H+GHE MH EM+ I ++++I+ QI LV WK++HF+SYQ+ TL
Sbjct  96   ELTEEEQWAEEHRKMHEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTL  155

Query  73   IAIWIIPLGMSLRNYWWRFIFSWLLFSCVTALVVRKALQKPIQGTTPRLVYKWFYFIYRL  132
            I +  IP+ +     W+RF+ +WL+F   +A +  KA  + I G TPR VYKWF F+++L
Sbjct  156  IGMLTIPVYVCFNRSWYRFLATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKL  215

Query  133  SYVLGIIGYVVVLATFFGLNLVFNAKASAWMDCGLLFLFYGLYFGVLGRDIAEICADKMA  192
            SYVLG++GY++++    G +++F       MD G+LF+FYG+Y+GVLGRD A IC  +MA
Sbjct  216  SYVLGVVGYLIMMGALLGFHVLFGVSQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMA  275

Query  193  SHIGYYAPGSMPTRTLDPGVCAVCGNKILVSEH------------EEGVIENTYKLSCEH  240
            S IGYY P  +P + L+ GVCAVCG ++  SEH             E   E  YKLSC H
Sbjct  276  SRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGH  335

Query  241  VFHEFCIRGWCIVGKKQTCPYCKEKVDLKKMFCNPWERPHVLYGQLLDWIGWLVAWQPLI  300
            VFHEFCIRGW +VGK QTCPYCKE+VDL++MF NPWE+PH+ YG+LLDWI +LV WQPLI
Sbjct  336  VFHEFCIRGWVVVGKLQTCPYCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLI  395

Query  301  LFLVQGINWMFGLE  314
            +  VQG+    GLE
Sbjct  396  VTAVQGLTTWMGLE  409


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 45.4 bits (106),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 32/58 (55%), Gaps = 11/58 (19%)

Query  209  DPGVCAVCGNKILVSEHEEGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  266
            + G C +C          + + E + KLSC H+FH  C++ W I  ++QTCP C+ ++
Sbjct  294  EAGTCIIC---------RDDLKEGSKKLSCSHIFHVDCLKSWFI--QQQTCPICRTEI  340


>HRD1_DROME unnamed protein product
Length=626

 Score = 45.1 bits (105),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (48%), Gaps = 21/103 (20%)

Query  168  LFLFYGLYFGVLGRDIAEICADKMAS-----HIGYYAPGSMPT--RTLDPGVCAVCGNKI  220
            +F+F  ++F +  R+  +   D + S     ++    P + P   R  D  +C +C    
Sbjct  240  MFVFRPMFFTI--RNFRKALNDVIMSRRAIRNMNTLYPDATPEELRQSD-NICIIC----  292

Query  221  LVSEHEEGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCK  263
                  E ++ ++ KL C H+FH  C+R W    ++QTCP C+
Sbjct  293  -----REDMVNHSKKLPCGHIFHTTCLRSW--FQRQQTCPTCR  328



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933623.1 RING finger protein 121 isoform X3 [Chelonus
insularis]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RN121_CAEEL  unnamed protein product                                  337     1e-114
Q8ILM8_PLAF7  unnamed protein product                                 45.1    4e-05 
HRD1_DROME  unnamed protein product                                   45.1    5e-05 


>RN121_CAEEL unnamed protein product
Length=409

 Score = 337 bits (863),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 154/299 (52%), Positives = 209/299 (70%), Gaps = 12/299 (4%)

Query  3    HKLHQGHEKMHAEMLFILLVTLIIFQISLVAWKKRHFRSYQLVTLIAIWIIPLGMSLRNY  62
            H+ H+GHE MH EM+ I ++++I+ QI LV WK++HF+SYQ+ TLI +  IP+ +     
Sbjct  111  HEKHKGHEAMHMEMMVIFMISVIVGQIFLVTWKRKHFKSYQMCTLIGMLTIPVYVCFNRS  170

Query  63   WWRFIFSWLLFSCVTALVVRKALQKPIQGTTPRLVYKWFYFIYRLSYVLGIIGYVVVLAT  122
            W+RF+ +WL+F   +A +  KA  + I G TPR VYKWF F+++LSYVLG++GY++++  
Sbjct  171  WYRFLATWLVFCIFSAFIWLKASAQHISGGTPRFVYKWFLFLHKLSYVLGVVGYLIMMGA  230

Query  123  FFGLNLVFNAKASAWMDCGLLFLFYGLYFGVLGRDIAEICADKMASHIGYYAPGSMPTRT  182
              G +++F       MD G+LF+FYG+Y+GVLGRD A IC  +MAS IGYY P  +P + 
Sbjct  231  LLGFHVLFGVSQPTLMDAGILFMFYGVYYGVLGRDFAHICTARMASRIGYYTPEGLPKKH  290

Query  183  LDPGVCAVCGNKILVSEH------------EEGVIENTYKLSCEHVFHEFCIRGWCIVGK  230
            L+ GVCAVCG ++  SEH             E   E  YKLSC HVFHEFCIRGW +VGK
Sbjct  291  LEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEDEKLYKLSCGHVFHEFCIRGWVVVGK  350

Query  231  KQTCPYCKEKVDLKKMFCNPWERPHVLYGQLLDWIGWLVAWQPLILFLVQGINWMFGLD  289
             QTCPYCKE+VDL++MF NPWE+PH+ YG+LLDWI +LV WQPLI+  VQG+    GL+
Sbjct  351  LQTCPYCKERVDLQRMFKNPWEKPHLFYGKLLDWIRYLVCWQPLIVTAVQGLTTWMGLE  409


>Q8ILM8_PLAF7 unnamed protein product
Length=510

 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 32/58 (55%), Gaps = 11/58 (19%)

Query  184  DPGVCAVCGNKILVSEHEEGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCKEKV  241
            + G C +C          + + E + KLSC H+FH  C++ W I  ++QTCP C+ ++
Sbjct  294  EAGTCIIC---------RDDLKEGSKKLSCSHIFHVDCLKSWFI--QQQTCPICRTEI  340


>HRD1_DROME unnamed protein product
Length=626

 Score = 45.1 bits (105),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 49/103 (48%), Gaps = 21/103 (20%)

Query  143  LFLFYGLYFGVLGRDIAEICADKMAS-----HIGYYAPGSMPT--RTLDPGVCAVCGNKI  195
            +F+F  ++F +  R+  +   D + S     ++    P + P   R  D  +C +C    
Sbjct  240  MFVFRPMFFTI--RNFRKALNDVIMSRRAIRNMNTLYPDATPEELRQSD-NICIIC----  292

Query  196  LVSEHEEGVIENTYKLSCEHVFHEFCIRGWCIVGKKQTCPYCK  238
                  E ++ ++ KL C H+FH  C+R W    ++QTCP C+
Sbjct  293  -----REDMVNHSKKLPCGHIFHTTCLRSW--FQRQQTCPTCR  328



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933624.1 protein farnesyltransferase/geranylgeranyltransferase
type-1 subunit alpha [Chelonus insularis]

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VR31_DROME  unnamed protein product                                 340     9e-117
O44501_CAEEL  unnamed protein product                                 211     3e-66 
Q9VN77_DROME  unnamed protein product                                 54.7    4e-08 


>Q9VR31_DROME unnamed protein product
Length=331

 Score = 340 bits (872),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 165/326 (51%), Positives = 224/326 (69%), Gaps = 6/326 (2%)

Query  1    MSDSSDEGADNGTWVFYKDREEWKDVTPVPQDDGPYPIVAIAYSDKFRDSYDYFRAVLKS  60
            M DSSDE      W+ Y +R +W+DV P+ QDDGP P+V+IAYS KFR+ +DY RA++  
Sbjct  1    MGDSSDEEYLGTDWLAYSERSDWEDVQPLAQDDGPNPVVSIAYSQKFREVFDYMRAIIAR  60

Query  61   GEKSERALALTATCLSLNPANYTVWQYRRDILKELNKDLYEELAYIDSIIGDNTKNYQIW  120
            GEKS+RAL LT   L LNPANYTVWQYRRD+L+EL  DLY EL Y+  +IG N+KNYQ+W
Sbjct  61   GEKSQRALDLTTDALRLNPANYTVWQYRRDVLRELKADLYAELDYLTEVIGQNSKNYQVW  120

Query  121  HHRKAIVELLKDPSKELEFTARML--EKDSKNYHTWQYRQWCIKTFNLFDSELEYVEQLL  178
            HHR+ IVE+L DPS ELE T   L  + D+KNYH WQ+RQW I++FNL+D EL +V++L+
Sbjct  121  HHRRVIVEMLNDPSNELELTENALVNDGDAKNYHAWQHRQWAIRSFNLYDDELSFVDRLI  180

Query  179  TEDIRNNSAWNQRYFVLSNTTKFEPEVIDREVDFALGKISIVKGNESAWNYLRGILMHDK  238
            +ED RNNSAWNQR+FV+ +   F PE+I RE+ + + +I I+K NESAWNYL G++    
Sbjct  181  SEDQRNNSAWNQRFFVIKHFG-FTPELIQRELSYTMNRIRIIKNNESAWNYLVGVMRQGD  239

Query  239  NGG--LAFNEKVLNKCEELYTKDCRVNHLLACIIDICDERHEKAPNHPLYNIDNALM-LC  295
            +G   L+    V++  EELY    R  +LLA +ID+  E+  +        +   +  LC
Sbjct  240  SGNALLSSYPDVVDFVEELYQAGNRSPYLLAFLIDLYQEQALQLKASDSDQLARKVYGLC  299

Query  296  NELGEKYDKIRKKYWDYVASQLSEKL  321
             ++  K+D IR+KYW YVA+ L  +L
Sbjct  300  EDMATKHDVIRRKYWQYVANHLKNQL  325


>O44501_CAEEL unnamed protein product
Length=328

 Score = 211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/285 (42%), Positives = 171/285 (60%), Gaps = 15/285 (5%)

Query  1    MSDSSDEGADNGTWVFYKDREEWKDVTPVPQDDGPYPIVAIAYSDKFRDSYDYFRAVLKS  60
            MSDS     D  +   YKD  +WKD+TP+         V IA ++ F D++ YFRA+L  
Sbjct  1    MSDS-----DIPSSTLYKDNVDWKDITPIYPSKEEEVAVKIAVTEDFTDAFAYFRAILIK  55

Query  61   GEKSERALALTATCLSLNPANYTVWQYRRDILKELNKDLYEELAYIDSIIGDNTKNYQIW  120
             EKS+R +AL   C+ LNPANYTVWQYRR  L EL  DL +E+ Y+  II ++ KNYQ+W
Sbjct  56   NEKSDRVMALLEDCIRLNPANYTVWQYRRVCLTELGWDLKKEMRYLSDIIQESPKNYQVW  115

Query  121  HHRKAIVELLKDPS--KELEFTARMLEKDSKNYHTWQYRQWCIKTFNL-FDSELEYVEQL  177
            HHR+ IVE + + +   EL F + ++  ++KNYH WQ+RQW ++TF +  + EL +   +
Sbjct  116  HHRRFIVETIGESAVNDELHFCSEVIRDENKNYHAWQHRQWVVRTFKVPLEKELTFALHM  175

Query  178  LTEDIRNNSAWNQRYFVLSNTTKFE-PEVIDREVDFALGKISIVKGNESAWNYLRGILMH  236
            L  D RNNSA+N RYF+++   K E    +D E++ A   I  +  NESAWNYL G+L+ 
Sbjct  176  LLLDNRNNSAYNYRYFLMTLYDKTEDASQLDIEINLAKKFIENIPNNESAWNYLAGLLI-  234

Query  237  DKNGGLAFNEKVLNKCEELY---TKDCRVNHLLACIIDICDERHE  278
                G+  N  V++  E+LY    ++ R   LLA I D+  E  E
Sbjct  235  --TNGVTSNSDVVSFVEDLYETTPEEKRSPFLLAFIADMMLENIE  277


>Q9VN77_DROME unnamed protein product
Length=515

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/145 (27%), Positives = 69/145 (48%), Gaps = 14/145 (10%)

Query  102  ELAYIDSIIGDNTKNYQIWHHRKAIVELLKDP----SKELEFTARMLEKDSKNYHTWQYR  157
            EL   +  +  N K+Y  WHHR   +E  ++P     +E++   + L+ D +N+HTW YR
Sbjct  124  ELDLTEQCLMVNPKSYNAWHHRCWTLE--QNPRADWQQEVKLCNKYLKFDERNFHTWDYR  181

Query  158  QWCI-KTFNLFDSELEYVEQLLTEDIRNNSAWNQRYFVL----SNTTKFEP---EVIDRE  209
            ++   K       EL++  + +  +  N S+W+ R  +L     N  +  P   E + +E
Sbjct  182  RYVTGKAMVPATQELDFCTEKIRANFSNYSSWHHRSLLLPELYPNQQRDRPMSEEKLQKE  241

Query  210  VDFALGKISIVKGNESAWNYLRGIL  234
            ++  L        + SAW Y R +L
Sbjct  242  LEMVLTAAFTDPNDSSAWFYQRWLL  266


 Score = 38.9 bits (89),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 26/106 (25%), Positives = 40/106 (38%), Gaps = 12/106 (11%)

Query  75   LSLNPANYTVWQYRRDILKELNKDLYEELAYIDSIIGDNTKNYQIWHHRKAIVELL----  130
            L  +  N+  W YRR +  +      +EL +    I  N  NY  WHHR  ++  L    
Sbjct  168  LKFDERNFHTWDYRRYVTGKAMVPATQELDFCTEKIRANFSNYSSWHHRSLLLPELYPNQ  227

Query  131  --------KDPSKELEFTARMLEKDSKNYHTWQYRQWCIKTFNLFD  168
                    +   KELE        D  +   W Y++W + +    D
Sbjct  228  QRDRPMSEEKLQKELEMVLTAAFTDPNDSSAWFYQRWLLGSGAQLD  273



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933625.1 partitioning defective 6 homolog gamma [Chelonus
insularis]

Length=310
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O97111_DROME  unnamed protein product                                 363     1e-125
PAR6_CAEEL  unnamed protein product                                   269     2e-89 
A0A0B4LF49_DROME  unnamed protein product                             53.5    9e-08 


>O97111_DROME unnamed protein product
Length=351

 Score = 363 bits (931),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 190/297 (64%), Positives = 230/297 (77%), Gaps = 9/297 (3%)

Query  11   DSNIIAVKSKFDADIIRFSINKNE-EITYDEFRKLLAKKHELHQDENFLIRYTDPTDGDS  69
            D+N+I VKSKFDA+  R+S  +NE E ++D+F  L+ + H+L  +  FLI Y DP D D 
Sbjct  16   DTNLIEVKSKFDAEFRRWSFKRNEAEQSFDKFASLIEQLHKL-TNIQFLILYIDPRDNDL  74

Query  70   LPINNDNNLARAILTAKPLLKVFITRHGESLEDINGGGTLKPKNLISSIL-GGTPGKPKS  128
            LPINND+N  RA+ TA+PLL+V + R  + L + +G GT+KP+NLI SIL G TP K K+
Sbjct  75   LPINNDDNFGRALKTARPLLRVIVQRK-DDLNEYSGFGTMKPRNLIGSILMGHTPVKTKA  133

Query  129  LAISNPHDFRQVSAIIDVDILPETCRRVRLLKHGSDKPLGFYIKDGESFRILPPSAGGGI  188
             +IS PHDFRQVSAIIDVDI+PET RRVRLLKHGSDKPLGFYI+DG S R+       G+
Sbjct  134  PSISIPHDFRQVSAIIDVDIVPETHRRVRLLKHGSDKPLGFYIRDGTSVRV----TASGL  189

Query  189  EKVPGVFISRLVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANSSNLIITV  248
            EK PG+FISRLVPGGLAESTGLLAVNDEV+EVNGIEVAGKTLDQVTDMM+ANSSNLIITV
Sbjct  190  EKQPGIFISRLVPGGLAESTGLLAVNDEVIEVNGIEVAGKTLDQVTDMMVANSSNLIITV  249

Query  249  KPANQRAAMAAPRRGSYSRNSQLSSGSHQSTQSVATGSASDEEADEIVDLTGVALHE  305
            KPANQR  + +  RGS+SRNSQLSSGSH +  +  +     ++ D+IVDLTGV L E
Sbjct  250  KPANQR-TLTSTHRGSFSRNSQLSSGSHHTNNTNTSDEIEHDDQDDIVDLTGVTLDE  305


>PAR6_CAEEL unnamed protein product
Length=309

 Score = 269 bits (687),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 184/262 (70%), Gaps = 11/262 (4%)

Query  1    MSKSKLHHHFDSNIIAVKSKFDADIIRFSI--NKNEEITYDEFRKLLAKKHELHQDENFL  58
            MS +  +H    + + VKSKFD++  RFSI  +    ++YD FR L+ K H L +   F 
Sbjct  1    MSYNGSYHQNHHSTLQVKSKFDSEWRRFSIPMHSASGVSYDGFRSLVEKLHHL-ESVQFT  59

Query  59   IRYTDPTDGDSLPINNDNNLARAILTAKPLLKVFITRHGESLEDINGGGTLKPKNL--IS  116
            + Y + T GD LPI ND+NL ++  +A+PLL++ I R GES E+  G GT   K    IS
Sbjct  60   LCY-NSTGGDLLPITNDDNLRKSFESARPLLRLLIQRRGESWEEKYGYGTDSDKRWKGIS  118

Query  117  SILGGTPGKPKSLAISNPHDFRQVSAIIDVDILPETCRRVRLLKHGSDKPLGFYIKDGES  176
            S++   P K +S +ISNP DFRQVSAIIDVDI+PE  RRVRL KHG ++PLGFYI+DG S
Sbjct  119  SLMAQKPPK-RSYSISNPEDFRQVSAIIDVDIVPEAHRRVRLCKHGQERPLGFYIRDGTS  177

Query  177  FRILPPSAGGGIEKVPGVFISRLVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDM  236
             R+       G+ KV G+FISRLV GGLAESTGLL VNDEVLEVNGIEV GKTLDQVTDM
Sbjct  178  VRVTER----GVVKVSGIFISRLVDGGLAESTGLLGVNDEVLEVNGIEVLGKTLDQVTDM  233

Query  237  MIANSSNLIITVKPANQRAAMA  258
            M+AN+ NLIITVKPANQR  ++
Sbjct  234  MVANAHNLIITVKPANQRNTLS  255


>A0A0B4LF49_DROME unnamed protein product
Length=546

 Score = 53.5 bits (127),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 64/116 (55%), Gaps = 18/116 (16%)

Query  142  AIIDVDILPETCRRVRLLKHGSDKPLGFYIK-DGESFRILPPSAGGGIEKVPGVFISRLV  200
            A +++D   ET + V+L+K  S++PLG  IK D ES +I+               I+R++
Sbjct  128  APVEMDEDEETIKIVQLVK--SNEPLGATIKTDEESGKII---------------IARIM  170

Query  201  PGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANSSNLIITVKPANQRAA  256
             GG A+ +GL+ V DEV+EVN I V GKT   V  ++  +   +   + PA+ + A
Sbjct  171  HGGAADRSGLIHVGDEVIEVNNINVEGKTPGDVLTILQNSEGTITFKLVPADNKGA  226



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933626.1 uncharacterized protein LOC118063634 [Chelonus
insularis]

Length=308
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38EW2_TRYB2  unnamed protein product                                 33.9    0.11 
EXC6_CAEEL  unnamed protein product                                   33.5    0.26 
Q960J6_DROME  unnamed protein product                                 29.3    4.8  


>Q38EW2_TRYB2 unnamed protein product
Length=273

 Score = 33.9 bits (76),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 52/124 (42%), Gaps = 18/124 (15%)

Query  170  EKLEKIKLERNDWSLDKWGRAYWNFLHSLSILVQYTNQKYPERLVMEYYAALMLNFDVIL  229
            E L+KI  E    +  + G+A W  LHS + +  Y     P     E +   +  +    
Sbjct  5    EPLQKIPGECP--TPRELGKAGWIILHSAAAVFPYN----PTPTQQEAFRNFLHGWSHAY  58

Query  230  PCAVCA---DNYQKKNPLMSVSLPIIYSKDAI-KVTYDLHNSVRINNGNDIYDF--RDFL  283
             C+ CA     Y  +NP      P++  K A+ +   + HN+V    GN IYD    + L
Sbjct  59   ACSHCAYHMRRYFHQNP------PVVTDKLALNRYLCEFHNAVNERVGNKIYDCDPMNVL  112

Query  284  NDWH  287
              WH
Sbjct  113  RRWH  116


>EXC6_CAEEL unnamed protein product
Length=843

 Score = 33.5 bits (75),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 28/104 (27%), Positives = 47/104 (45%), Gaps = 17/104 (16%)

Query  10   NVDSIIEDVDENGNTVVQSFKLSDVWDFIRNKFNKEQASKEEEY--NYYSDQSIITNNFH  67
            N+D +I+DV +N        K     D ++N F     S+EEE    Y  D S+++    
Sbjct  220  NIDELIDDVSQN--------KPVAEIDALQNLFGMLPQSEEEEALRRYTGDISLLSPPSS  271

Query  68   FNQTVSECNYKINYIAFKRVRYYFDEHLNNFLAYLRAYEPNIDL  111
            F        Y++  I F R+R      L++F   +R   PN+++
Sbjct  272  FF-------YRLVQIQFYRLRIETQIFLSDFSRLMRELAPNVEI  308


>Q960J6_DROME unnamed protein product
Length=1183

 Score = 29.3 bits (64),  Expect = 4.8, Method: Composition-based stats.
 Identities = 35/143 (24%), Positives = 58/143 (41%), Gaps = 24/143 (17%)

Query  154  CHSMMYDACRELFGISEKLEKIKLERNDWSLDKW--------GRAYWNFLHSLSI----L  201
            C +M++D         E+  K+    ND SL  W        G+++    HS  I     
Sbjct  12   CIAMVFD---------EQRSKVSCVYNDHSLYIWDLRDISRVGKSHSFLYHSTCIWGVET  62

Query  202  VQYTNQKYPERLVMEYYAALMLNFDVILPCAV--CADN-YQKKNPLMSVSLPIIYSKDAI  258
            V Y  ++ P + + E       + D I    +  C +N   ++N      L I+YS D +
Sbjct  63   VPYNVEREPSQTLPEECFVTCSSDDTIRVWGLDGCTNNDIYRRNIYSKELLKIVYSDDEL  122

Query  259  KVTYDLHNSVRINNGNDIYDFRD  281
            +   D  +S+    GN  YD R+
Sbjct  123  QFIKDQGSSLFDKAGNSSYDGRN  145



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933627.1 pre-mRNA-splicing factor 38 [Chelonus insularis]

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRP38_DROME  unnamed protein product                                  340     3e-117
SPEN_DROME  unnamed protein product                                   42.7    3e-04 
A8JNI2_DROME  unnamed protein product                                 33.1    0.31  


>PRP38_DROME unnamed protein product
Length=330

 Score = 340 bits (873),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 152/197 (77%), Positives = 180/197 (91%), Gaps = 0/197 (0%)

Query  1    MANRTVKDAKSIRGTNPQYLVEKIIRSRIYDSKYWKEECFALTAELLVDKAMELRFIGGV  60
            MANRTVK+AK++ GTNPQYL+EKIIRSRIYDSKYWKE+CFALTAELLVDKAMELRF+GGV
Sbjct  1    MANRTVKEAKNVHGTNPQYLIEKIIRSRIYDSKYWKEQCFALTAELLVDKAMELRFVGGV  60

Query  61   FGGNIKPTPFLCLILKMLQIQPEKDIIVEFIKNEEFKYVRALGALYMRLTGTSLDCYKYL  120
            +GGNIKPT FLCL LKMLQIQPEKDI+VEFIKNEEFKYVRALGA Y+RLTG +LDCYKYL
Sbjct  61   YGGNIKPTQFLCLTLKMLQIQPEKDIVVEFIKNEEFKYVRALGAFYLRLTGAALDCYKYL  120

Query  121  EPLFNDNRKLRIQNKQGQFELIHMDEFIDHLLREERACDVILPRIQKRHVLEENNELEAK  180
            EPL+ DNRKLR QN+ GQFE+++MDE+ID LLR +R CD+ILPRIQKR +LEENNE+E K
Sbjct  121  EPLYIDNRKLRRQNRAGQFEIVYMDEYIDELLRNDRVCDIILPRIQKRSILEENNEIEPK  180

Query  181  ISALEDDMDEGMETSED  197
            +S L++D+D+ + + E+
Sbjct  181  VSVLDEDLDDELPSDEE  197


>SPEN_DROME unnamed protein product
Length=5560

 Score = 42.7 bits (99),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 46/83 (55%), Gaps = 5/83 (6%)

Query  220   DRDKKHSRVDKKSDREKARSRSRDRERDRDRDRDRRERK-RSKSPKYSSSHKDRHRRDDR  278
             D+++K   + +K  REK + R RD      RD+D RE++ R K  +    H+++ +R+  
Sbjct  1997  DKEQKEKEIREKDLREKEQ-RERDNREKELRDKDLREKEMREKEQREKELHREKDQRERE  2055

Query  279   DRERDRER---DRDRERRRERDR  298
              RE+++ R   D ++E R  R R
Sbjct  2056  HREKEQSRRAMDVEQEGRGGRMR  2078


 Score = 40.4 bits (93),  Expect = 0.002, Method: Composition-based stats.
 Identities = 23/79 (29%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query  204   KEESRKKDDYDRDRHRDRDKKHSRVDKKSDREKARSRSRDRERDRDRDRDRRERK-RSKS  262
             KE+  ++ D      R+RD +   +  K  REK       RE++  R++D+RER+ R K 
Sbjct  2001  KEKEIREKDLREKEQRERDNREKELRDKDLREKEMREKEQREKELHREKDQREREHREKE  2060

Query  263   PKYSSSHKDRHRRDDRDRE  281
                 +   ++  R  R RE
Sbjct  2061  QSRRAMDVEQEGRGGRMRE  2079


 Score = 28.5 bits (62),  Expect = 9.0, Method: Composition-based stats.
 Identities = 20/75 (27%), Positives = 40/75 (53%), Gaps = 12/75 (16%)

Query  197   DEDLPPSKEESRKKDDYDRDRHRDRDKKHSRVDKKSDREKARSRSRDRERDRDRDRDRRE  256
             D+DL   ++E R+K+  +++ HR++D++     ++  REK +SR     R  D +++ R 
Sbjct  2027  DKDL--REKEMREKEQREKELHREKDQR-----EREHREKEQSR-----RAMDVEQEGRG  2074

Query  257   RKRSKSPKYSSSHKD  271
              +  +   Y  S  D
Sbjct  2075  GRMRELSSYQKSKMD  2089


>A8JNI2_DROME unnamed protein product
Length=1655

 Score = 33.1 bits (74),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 56/95 (59%), Gaps = 2/95 (2%)

Query  203  SKEESRKKDDYDR-DRHRDRDKKHSRVDKKSDREKARSRSRDRERDRDRDRDRRERKRSK  261
            SKE+ R KD+    D+ RDR    S+ +++S+ E+ RS+ R R ++R+R +DR+  +  +
Sbjct  730  SKEKHRPKDEQQSVDKRRDRSTDRSKENQRSN-ERQRSKERQRSKERERSKDRQRSRERR  788

Query  262  SPKYSSSHKDRHRRDDRDRERDRERDRDRERRRER  296
              K     KDR    +R R  +R+R ++R+  +E+
Sbjct  789  RSKEGQLSKDRQGLKERQRSNERKRSKERQPSKEK  823


 Score = 30.0 bits (66),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 33/98 (34%), Positives = 51/98 (52%), Gaps = 19/98 (19%)

Query  207  SRKKDDYDRDRHRDRDKKHSRVDKKSDREK--ARSRSRDRERDRD----------RDRDR  254
            SRK++  DR R      K S+ D+K+ +++   RSRSR+R+  R           R R  
Sbjct  555  SRKENKSDRSR----GAKASKSDEKAPQQENVMRSRSRERKDTRSSRPLEASIDSRQRKP  610

Query  255  RERKRSKSPKYSSSHKDRHRRDDRDRERDRERDRDRER  292
            RER  +  P+      +RHR   +DR+R +E+ R R+R
Sbjct  611  RERSAATPPRK---EPERHRERSKDRQRSKEKHRSRDR  645



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933628.1 regulator of microtubule dynamics protein 1-like
[Chelonus insularis]

Length=292
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54XR4_DICDI  unnamed protein product                                 154     8e-46
RMD1_CAEEL  unnamed protein product                                   110     8e-29
Q387R8_TRYB2  unnamed protein product                                 87.4    3e-20


>Q54XR4_DICDI unnamed protein product
Length=229

 Score = 154 bits (389),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/219 (38%), Positives = 129/219 (59%), Gaps = 4/219 (2%)

Query  69   IIAKADALYENGEYQKLYGILNNYRNSH--DDEILWRLSRAVYSL-AKTASDSEAKKMFN  125
            I+ K D L+   E+ K+  +L      +  D EI+WRL+R+ +    + A+  E KK+  
Sbjct  7    IVDKVDQLHLEREFVKISELLTEGHKQYPEDVEIMWRLARSYFDKNEEVANKDEKKKLIE  66

Query  126  DAYDIITEALSINPNNWAVHKWMAVIIDKKSSYDGMKARIKELNRVKEHMLKASELNPND  185
             A ++  +A +INPN+WAVHKW+A++I     +   K +I    ++K+H +KA+EL PND
Sbjct  67   QALELTNKASTINPNHWAVHKWLAILISALGDHISSKEKIANAFKIKDHAVKANELKPND  126

Query  186  ATVLYMLGHWCYSVSDLAWYQRKIASTIFGKVPDSSFEEALQYFKAAEKVEPMFYGDNLL  245
            AT L++LG WC+S+S + W +R  AS +FG  P S+++EAL YF  A K +P     N L
Sbjct  127  ATTLHLLGRWCFSISSIGWIERTAASALFGTPPTSTYDEALTYFLEAYKCDPTNIR-NAL  185

Query  246  FLGKTYLKLNQKDEAIKYLKMAAEYPAKNDDDHKAKQEA  284
            F G TY  L    +A ++ K+AA    K++ D    +EA
Sbjct  186  FTGDTYAALKDNAKAKEFYKIAAAIEPKSEFDKNLVKEA  224


>RMD1_CAEEL unnamed protein product
Length=226

 Score = 110 bits (274),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 121/220 (55%), Gaps = 3/220 (1%)

Query  71   AKADALYENGEYQKLYGILNNYRNSHD--DEILWRLSRAVYSLAKTASDSEAKKMFNDAY  128
            A +D L+E+ E+ K    L   R   +   ++LWR+ R  + L+ T S  + +KM  +  
Sbjct  5    ATSDKLFESREFVKGLEELKKRREDGEMTCDLLWRMCRFCHELSTTMSGEQRRKMLIEGR  64

Query  129  DIITEALSINPNNWAVHKWMAVIIDKKSSYDGMKARIKELNRVKEHMLKASELNPNDATV  188
            D   EA+ ++P+++   KW A++          K +I +  R+K+ + KA EL+P D  +
Sbjct  65   DYGLEAMDLDPSSFLAAKWTAIMFGLVVDQLPTKEKINDGGRLKDMLDKALELDPTDFAL  124

Query  189  LYMLGHWCYSVSDLAWYQRKIASTIFGKVPDSSFEEALQYFKAAEKVEPMFYGDNLLFLG  248
            L++   + Y++++L+W +RK AS ++ +VP ++ ++AL  FKAA   +   + +NLLFL 
Sbjct  125  LHLRARFSYTIANLSWLERKAASMLYSEVPKATIDDALVDFKAAYN-QNADWIENLLFLS  183

Query  249  KTYLKLNQKDEAIKYLKMAAEYPAKNDDDHKAKQEATKIL  288
            K +L   +K +A + L  A   PA + +D +   E   +L
Sbjct  184  KCHLAKKEKQQAREMLNKAIVLPAASSNDAQFVTECKSLL  223


>Q387R8_TRYB2 unnamed protein product
Length=230

 Score = 87.4 bits (215),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 101/194 (52%), Gaps = 3/194 (2%)

Query  99   EILWRLSRAVYSLAKTASD-SEAKKMFNDAYDIITEALSINPNNWAVHKWMAVIIDKKSS  157
            +++WR +RA+++L   + D SE ++   DA      A+  +P +   + W A+ I     
Sbjct  39   QLMWRRARALHTLGDESLDKSEKERYARDAAVAAERAVEEDPTSAEANLWKAICIGILCD  98

Query  158  YDGMKARIKELNRVKEHMLKASELNPNDATVLYMLGHWCYSVSDLAWYQRKIASTIFGKV  217
            Y   K R+  +  +++H+L++ EL  ++   L+ +G W  S+  ++W++R  AS +FG +
Sbjct  99   YLTTKERMSNVYVIRDHLLRSLELKSDNPDALHGMGMWSLSLLQISWFERSAASLLFGSL  158

Query  218  PDSSFEEALQYFKAAEKVEPMFYGDNLLFLGKTYLKLNQKDEAIKYLKMAAEYPAKNDDD  277
            P  S EE L+YF A+ ++ P     N L LG  +       EA  + + A + PA+    
Sbjct  159  PTVSHEECLKYFLASHELRPSIR--NCLALGNLFRYQGNWTEAKTWYQKALDIPAETHAH  216

Query  278  HKAKQEATKILGTL  291
             + + EA ++L + 
Sbjct  217  KQKQDEAVQLLNSC  230



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933629.1 ADP-ribose pyrophosphatase, mitochondrial [Chelonus
insularis]

Length=291
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A7T1N0_NEMVE  unnamed protein product                                 275     4e-84
CED11_CAEEL  unnamed protein product                                  54.7    4e-08
Q8IDD3_PLAF7  unnamed protein product                                 31.2    0.96 


>A7T1N0_NEMVE unnamed protein product
Length=1551

 Score = 275 bits (704),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/290 (49%), Positives = 192/290 (66%), Gaps = 16/290 (6%)

Query  9     SLLHYKCRQKFYSTTKIKRFVVPDELVPWEVEFPGYDPAYYTA---TDGKPWADKNIGDV  65
             +LLHYK R   Y  +  KRF V D +V W+V FP Y P  YTA        WADK++  +
Sbjct  1271  TLLHYKARSSPYPGSTAKRFAVQDNMVDWQVPFPDYKPVNYTAPVVLANPVWADKDLMAM  1330

Query  66    GFQPK--WNAQD--GDINRQSLTKTYRITQDGYPLNPIGRTGIKGRGLLGRWGPNHAADP  121
               +P+  +N  D   ++NR S   TY + +DG PLNP+GRTG++GRGLLGR+GPNHAADP
Sbjct  1331  SPRPELPYNQMDHTCNVNRVSYNGTY-VVKDGLPLNPMGRTGMQGRGLLGRFGPNHAADP  1389

Query  122   IVTRWKRENNGDKEIKMDPTTQKPVLQFIGIQRRDTREWAIPGGMVEGNEVISSTLKREF  181
             +VTRWKR + G     +     K VL+F+ IQR+D  +WAIPGGMVE  ++++  LK EF
Sbjct  1390  VVTRWKRTSAG-----VMLQGGKKVLEFVAIQRKDNNQWAIPGGMVEPGQLVTQALKAEF  1444

Query  182   MEEALNLLEKQDKNPEEVKGFKKEVDKLFEKGEKIFQGYVDDPRNTDNSWMETRVFNFHD  241
              EEA+    K + + EE +   K++++LF++G++I++GYVDDPRNTDN+WMET   NFHD
Sbjct  1445  GEEAM---AKLNVSQEEKERIAKQIERLFQQGQEIYKGYVDDPRNTDNAWMETVAVNFHD  1501

Query  242   NDGSLLDKITLEAGDDAADVRWMDIDNKLNLYASHSKFLQLVAQKHDAHW  291
             + G L   ITL+AGDDAA VRW  +   + LYASH   L+ VA+  DA +
Sbjct  1502  DKGDLFGDITLQAGDDAAAVRWQRVSGNIPLYASHVSILEKVAKMRDAAF  1551


>CED11_CAEEL unnamed protein product
Length=1418

 Score = 54.7 bits (130),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 29/91 (32%), Positives = 49/91 (54%), Gaps = 12/91 (13%)

Query  36    PWEVEFPGYDPAYYTA------TDGKPWAD----KNIGDVGFQPKWNAQDGDINRQSLTK  85
             PW V  P Y+P +Y        +D + + D    +N+G++  +  W ++  +    S  K
Sbjct  1180  PWTVLVPRYNPPFYCKPAEDFPSDVQKYVDIATEQNVGEL--KRIWRSRQANDVTSSNDK  1237

Query  86    TYRITQDGYPLNPIGRTGIKGRGLLGRWGPN  116
              ++++  G+PLNP GRTG+ GRG   R+G N
Sbjct  1238  CWKLSAAGFPLNPNGRTGMAGRGNHPRFGAN  1268


>Q8IDD3_PLAF7 unnamed protein product
Length=574

 Score = 31.2 bits (69),  Expect = 0.96, Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 42/87 (48%), Gaps = 14/87 (16%)

Query  155  RDTREWAIPGGMVEGNEVISSTLKREFMEEALNLLEKQDKNPEEVKGFKKEVDKLFEKGE  214
            R+  E+ I       N ++SS   +EF+E  +++ + +  N  E+K       K      
Sbjct  411  REAEEYMI------NNNILSSNEYKEFVELCVDIFKYEVHNYSELKECILNALK------  458

Query  215  KIFQGYVDDPRNTDNSWMETRVFNFHD  241
              ++ +V+DP NTD+ +++   F  +D
Sbjct  459  --YEHHVNDPLNTDDIYLKQVSFLLYD  483



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933630.1 proteasome subunit alpha type-5 [Chelonus insularis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PSA5_DROME  unnamed protein product                                   383     2e-136
PSA5_CAEEL  unnamed protein product                                   313     1e-108
PSA5_DICDI  unnamed protein product                                   311     5e-108


>PSA5_DROME unnamed protein product
Length=244

 Score = 383 bits (983),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 186/244 (76%), Positives = 213/244 (87%), Gaps = 2/244 (1%)

Query  1    MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTVIGISTCEGVVLAAERRITSPLME  60
            MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGST IGI T EGVVLA E+RITSPLM 
Sbjct  1    MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGICTPEGVVLAVEKRITSPLMV  60

Query  61   PTTIEKIVEVDKHIGCAGSGLMADSRMMIDRARAECQNHWFIYNEKMSVESVAQAVSNLA  120
            P+T+EKIVEVDKHIGCA SGLMAD+R +I+RAR ECQNHWF+YNE+MS+ES AQAVS LA
Sbjct  61   PSTVEKIVEVDKHIGCATSGLMADARTLIERARVECQNHWFVYNERMSIESCAQAVSTLA  120

Query  121  IQFGDS-DDDG-SAMSRPFGVAILFAGIDEKGPQLFHMDPSGTFVQFDAKAIGSGSEGAQ  178
            IQFGDS D DG +AMSRPFGVAILFAGI+   PQL+HMDPSGTFV+  AKAIGSGSEGAQ
Sbjct  121  IQFGDSGDSDGAAAMSRPFGVAILFAGIEAGQPQLWHMDPSGTFVRHGAKAIGSGSEGAQ  180

Query  179  QSLQEVYHKSMTLKEAIKSALTILKQVMEEKLNETNVELMTMTPESMYHMYTKEELQEVI  238
            Q+LQ+++   +TL EAI  +L  LKQVMEEKLN TNVE+MTMT E  ++M+TKEE+++ I
Sbjct  181  QNLQDLFRPDLTLDEAIDISLNTLKQVMEEKLNSTNVEVMTMTKEREFYMFTKEEVEQHI  240

Query  239  KDIA  242
            K+IA
Sbjct  241  KNIA  244


>PSA5_CAEEL unnamed protein product
Length=248

 Score = 313 bits (802),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/246 (61%), Positives = 191/246 (78%), Gaps = 9/246 (4%)

Query  1    MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTVIGISTCEGVVLAAERRITSPLME  60
            MFLTRSEYDRGVNTFSPEGRLFQVEYAIEA+KLGST IGI T EGV+LAAE+R TS LM 
Sbjct  1    MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAVKLGSTSIGIKTSEGVLLAAEKRSTSKLMV  60

Query  61   PTTIEKIVEVDKHIGCAGSGLMADSRMMIDRARAECQNHWFIYNEKMSVESVAQAVSNLA  120
               IEKI +VD+HIG   +GL+ADSR +++RA+ E QN WF YN K+ VE V Q+V+NLA
Sbjct  61   NDAIEKISKVDQHIGVTFAGLIADSRTLVERAQIEAQNFWFTYNRKIRVEDVTQSVANLA  120

Query  121  IQFGDSDDDGSAMSRPFGVAILFAGIDEKGPQLFHMDPSGTFVQFDAKAIGSGSEGAQQS  180
            +QFGD DD  ++MSRPFGVA+LFAG+D++G +LFH+DPSGTF+   AK+IG+ S+GA+Q+
Sbjct  121  LQFGD-DDVKASMSRPFGVAMLFAGVDQEGAKLFHLDPSGTFIDCKAKSIGAASDGAEQN  179

Query  181  LQEVYHKSMTLKEAIKSALTILKQVMEEKLNETNVELMTMTPE--------SMYHMYTKE  232
            L+E YH ++T+KE +K AL ILKQVMEEKLN  NVE++ + P           +   + E
Sbjct  180  LKEQYHDALTIKEGLKMALAILKQVMEEKLNSANVEVVVIKPTVDAKGRPIGEFTRVSNE  239

Query  233  ELQEVI  238
            EL +VI
Sbjct  240  ELDQVI  245


>PSA5_DICDI unnamed protein product
Length=241

 Score = 311 bits (797),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 190/243 (78%), Gaps = 5/243 (2%)

Query  1    MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTVIGISTCEGVVLAAERRITSPLME  60
            MFLTRSEYDRGVNTFSPEGRLFQVEYA+EAIKLG   IG+   EGVVLA E+R+TSPL+E
Sbjct  1    MFLTRSEYDRGVNTFSPEGRLFQVEYALEAIKLG---IGVQCEEGVVLAVEKRLTSPLLE  57

Query  61   PTTIEKIVEVDKHIGCAGSGLMADSRMMIDRARAECQNHWFIYNEKMSVESVAQAVSNLA  120
            P++I+K+VE+D H+ CA SGL+AD+R +ID AR E QNH F YNE M VES  Q++ +LA
Sbjct  58   PSSIQKVVEIDYHLICALSGLVADARTIIDHARIETQNHRFNYNEPMGVESCVQSICDLA  117

Query  121  IQFGDSDDDGS-AMSRPFGVAILFAGIDEKGPQLFHMDPSGTFVQFDAKAIGSGSEGAQQ  179
            ++FG++ + G   MSRPFGVA+L AGIDEKGP L++ DPSGTF QF AKAIG+GSEGAQ 
Sbjct  118  LRFGENRNSGEERMSRPFGVALLIAGIDEKGPSLYYSDPSGTFTQFHAKAIGAGSEGAQT  177

Query  180  SLQEVYHKSMTLKEAIKSALTILKQVMEEKLNETNVELMTMT-PESMYHMYTKEELQEVI  238
            +LQE Y K++T+ E  K ALT LKQVMEE +  TNVEL  +T  +  + +Y KEEL  VI
Sbjct  178  TLQEKYSKTLTIAECQKLALTTLKQVMEEAITTTNVELAVITKADQKFKIYNKEELATVI  237

Query  239  KDI  241
            + +
Sbjct  238  QTL  240



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933631.1 DNA replication ATP-dependent helicase/nuclease DNA2
isoform X1 [Chelonus insularis]

Length=1182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3F2_CAEEL  unnamed protein product                                 339     8e-99
Q582F1_TRYB2  unnamed protein product                                 149     3e-36
RENT1_DROME  unnamed protein product                                  136     5e-32


>Q9U3F2_CAEEL unnamed protein product
Length=1069

 Score = 339 bits (869),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 284/966 (29%), Positives = 465/966 (48%), Gaps = 86/966 (9%)

Query  207   WRDVRIKVGDLV-VIKAKKLVD-EFVVNNDFGMIVSQPDELVAGTTVVQGIFCERKGVLL  264
             W ++ I+ G  + +I A+   D +F+VN+D G+++  PD LV  T V    FC RK VL 
Sbjct  137   WSEMSIEAGSTINLIGAQAWGDRDFLVNDDVGIVILNPDALVPCTAVASATFCARKTVLN  196

Query  265   QKYSGINSLPNIPATDAVMTCGIIVHEFLQTALK------MEIYDLESLWKLLETILQYP  318
              K+   N      A++  M  G I+HE  QTA+       ME  DL  +W       Q P
Sbjct  197   DKFKFGN------ASNKAMLLGTIMHEIFQTAITSKKRPVME-NDLMKIWNK-----QAP  244

Query  319   HIIQILYTSNLTIKAIKEMVDEYVLKVFQFL-KRYVLGIYPEGQDENFQGKIECIR--DI  375
                + L   + T   +   +  Y   +  ++ K Y L      + E    K E +   DI
Sbjct  245   KYAEELVALSFTPSCLDAELQPYFSIICGWINKHYPLSNSFFSKREPLPSKSELLEVYDI  304

Query  376   EEDVWLPSLGVKGKVDVTVEVSLNKCARRVLPLEIKTGRAIFSHEHKGQLHLYCMMMES-  434
             EE++W   LG+KGK+DVT+     K    +  LE+KTG++  S EH GQ+ LYCMM  S 
Sbjct  305   EENIWDSKLGLKGKIDVTMRT---KSRGGMESLELKTGKSSCSSEHTGQVLLYCMMQSSR  361

Query  435   LGYKLNSGLLLYIKENQMREIKSTRHEARDLILLRNSLAYYLSRDPYKVEKNLIGIKDKV  494
                 +  G +LY+K+     +     +   ++  RN L+ +   DP              
Sbjct  362   YEQPIGPGNILYLKDGASHCVTPRAADLLGVLQQRNKLSVHF-EDP--------------  406

Query  495   KVWTLPELPEPINHAAGCKRCPFNTICCVYAKEAKLEFQEDHHYNKVLKEALAHLTHAHI  554
                T   LP+P   +  C +C   T+C  Y K  +   + +       +  +AHL   HI
Sbjct  407   ---TTSNLPDPRQDSRFCDKCDHKTMCSFYQKTEENFSKSNDKMKNFAENEMAHLEQNHI  463

Query  555   EYVVQWISMLQIEYA--HNKSLEGNRIIWSQKPVVRETQRTCLSYLKIDGPVQQEKNEFH  612
             EY   WI  +  E+     +    N+ +W +    R  + TCLS L    PV +E +   
Sbjct  464   EYAANWIRWISAEWKCERERMTSQNKDLWLKSVQERVEEGTCLSDLH---PVSEEMSNSQ  520

Query  613   HTFLRASIKDLKIKPPVKNFNDVFAIEDYIMINTCTRINIITGKVIAITKDSITVSLKKN  672
                +  S K LK      +    F   D  +++    I I    +  ++ D   V +  +
Sbjct  521   KIIISFSRKFLK-----SSNTPTFRPGDVCLLSNKKHIAIGFALIDEVSDDQQIVKISTD  575

Query  673   IT-KFSTQTYYHIDAVAPLTMPYQLLGTVATLLADNNITKRLREMIIDKIPAQFSDEIPE  731
              T K   +  +H+D    ++     LG +  LL ++ I KRLR +++D +P    D    
Sbjct  576   KTIKSRYEAPFHLDKYTSMSTHSTTLGNLVYLLQNDEIGKRLRNILVDLLPPIIMDATGF  635

Query  732   SL-KTKKAKIIMERLNKYQQEALRAAVQTKDYVMIKGMPGTGKTQTLVALIELYSTLGYS  790
             +L    K  II  +LN  Q++A+  A+ T+D++M++G+PG+GKT  +  LI+        
Sbjct  636   NLTPAIKKIIIKAKLNNEQRKAVVHALATEDFMMVEGLPGSGKTTLISVLIQCLVATNKK  695

Query  791   VLISAHTHIAVDNILLKLRNK--GLNFLRLGSKNRIHPLLHEYSDENLLKQCKTPEILES  848
             VL++A TH AVDNIL KL  +      LRLGS + I   + + +    LK     E  E 
Sbjct  696   VLLAAFTHSAVDNILTKLTKEVAAEKILRLGSSSSIKDDIKKMT----LKAKLENETSEE  751

Query  849   KYNKIK-------IVGVTCLGSNHPLL-SRRIFDYCVIDECTQILQPIIIRPLFNAEKYV  900
              Y  ++       IV  TC      LL S R FD  ++DE + +L+P+++  L  + K+V
Sbjct  752   YYAAVRKVMKTTPIVACTCHHVPRELLFSYRHFDVVIVDEASMVLEPLLLPVLATSNKFV  811

Query  901   IVGDPDQLSAVVKSKEARSIMSNLGMSEDMFSRLDSKNNTRVLKQQYRMNKPIMDLANDL  960
             +VGD  QL+ +V S++A+   + +   E +  +         L  QYRMN+ I  L++ L
Sbjct  812   LVGDCKQLTPLVVSRKAKQEGAGISTMEKL--QQSHPGVVVSLTSQYRMNREISVLSSKL  869

Query  961   TYKGELLMGNDKISNAILQFTNTKI--LESCEEWVKKALINDLEHAIVVLNTQELRNLNL  1018
              Y+  L+ GN+ +S + L  T   I  ++   + ++KAL  D++ + V L+TQ    +N 
Sbjct  870   FYENRLICGNESVSRSSLDRTGDYIVAMDDGSDHIRKALSGDIKDSCVFLDTQS--TINS  927

Query  1019  KINFETIPHNDTSHCTNYFEAGIVMRLLNVLIQVGVKTDDIGIIAPFTHQVNLLKRLVKK  1078
             K+  E     +     N  EA ++  L    +  GVK  +IG+++ +  QV+ ++ ++  
Sbjct  928   KMQCE---DGEGGGMCNDGEAKLISELCQQFVMSGVKPHEIGVMSAYRRQVDHIRGILNS  984

Query  1079  -QVEINTVDQYQGRDKSVILLSCTKNDVKDFYSQKREYEILEDHTRLNVALTRAKNKLII  1137
              ++E+NT+D YQGR+K VI+ S T  +     +  ++ E+L+D  R+NVALTRA+ KL++
Sbjct  985   DELEVNTIDSYQGREKRVIIWSLTWTN-----NSTKKSELLKDERRVNVALTRARQKLVV  1039

Query  1138  IGNKES  1143
             +G K S
Sbjct  1040  VGCKNS  1045


>Q582F1_TRYB2 unnamed protein product
Length=842

 Score = 149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 137/475 (29%), Positives = 216/475 (45%), Gaps = 84/475 (18%)

Query  745   LNKYQQEALRAAVQTKDYVMIKGMPGTGKTQTLVALI-ELYSTLGYSVLISAHTHIAVDN  803
             LN  Q++ALR A++     +I+G PGTGKT T VA+I EL+S +   +L+ A +++AVD+
Sbjct  372   LNYSQEQALRVALRNP-LTLIQGPPGTGKTSTSVAIIRELHSHVKSRILVCAPSNVAVDH  430

Query  804   ILLKLRNKGLNFLRLGSKNR-----------IHPLLHEYSDEN--------LLKQCKTPE  844
             +  ++   GL  +RL +K R           +   + +Y + +        LL   +T +
Sbjct  431   LAQRVSGTGLKVVRLQAKYRNDIPCSVESIGLERQVGDYINASSGLERLKELLDSMQTGK  490

Query  845   ILESK-YNKIK---------------IVGVTCLGSNHPLLSRRIFDYCVIDECTQILQPI  888
              L  K Y   K               +V  TC+G+    L    F + +IDE TQ  +P 
Sbjct  491   SLNDKDYGTYKDGVEKIERLILRNADVVCCTCIGAGDYRLKTMKFKHVLIDEATQGTEPE  550

Query  889   IIRPLFNAEKYVI-VGDPDQLSAVVKSKEARSIMSNLGMSEDMFSRLDSKNNTRV-LKQQ  946
             ++ PL    K VI VGD  QL  +V S  A       G    +F RL    +  V L  Q
Sbjct  551   VLIPLVRGAKQVILVGDHCQLRPLVFSTAAE----KAGYQRSLFERLVLMGHRPVRLDVQ  606

Query  947   YRMNKPIMDLANDLTYKGELLMGNDKISNAILQFTNTKILESCEEWVKKALINDLEHAIV  1006
             YRMN  +    +   Y+G L  G         Q   +++      W       D+   I 
Sbjct  607   YRMNPSLSFFPSHHYYEGTLQNGV-----TAEQRDASEVFP----W------PDVTKPIF  651

Query  1007  VLNTQELRNLNLKINFETIPHNDTSHCTNYFEAGIVMRLLNVLIQVGVKTDDIGIIAPFT  1066
               N             E +  N  S+  N  EA +  +++  LIQ GV+  DIG+I P+ 
Sbjct  652   FYNA---------TGNEELGSNGRSYL-NRAEAALTEQIVTKLIQGGVEPGDIGVITPYR  701

Query  1067  HQVNLLKRLVKK----------QVEINTVDQYQGRDKSVILLSCTKNDVKDFYSQKREYE  1116
              Q   L+  + +          +VEI++VD +QGR+K  I+LSC +++       ++   
Sbjct  702   SQCRYLRSYLSRSGRLPMEVYDRVEISSVDAFQGREKEFIILSCVRSN------HRQGAG  755

Query  1117  ILEDHTRLNVALTRAKNKLIIIGNKESLIRYTPFQKLFSLIKKEEIVLKNNFDDF  1171
              + D  RLNV+LTRAK  LII+GN +   RY  + +L   +    ++++   DD 
Sbjct  756   FVTDGRRLNVSLTRAKRGLIIMGNVQLFSRYPGWHELLVHMNSLSLIVEGPIDDL  810


>RENT1_DROME unnamed protein product
Length=1180

 Score = 136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 127/471 (27%), Positives = 221/471 (47%), Gaps = 80/471 (17%)

Query  745   LNKYQQEALRAAVQTKDYVMIKGMPGTGKTQTLVALI-ELYSTLGYSVLISAHTHIAVDN  803
             LN+ Q  A++ A+Q +   +I+G PGTGKT T   ++ +L    G +VL+ A ++ AVD 
Sbjct  452   LNRSQVYAVKHALQ-RPLSLIQGPPGTGKTVTSATIVYQLVKLHGGTVLVCAPSNTAVDQ  510

Query  804   ILLKLRNKGLNFLRLGSKNR-----------IHPLLHEYSDENLLKQCK-----TPEIL-  846
             +  K+    L  +R+ +K+R           +H  +      + LK+ +     T E+  
Sbjct  511   LTEKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSS  570

Query  847   --ESKYNKIK------------IVGVTCLGSNHPLLSRRIFDYCVIDECTQILQPIIIRP  892
               E +Y  +K            ++  TC+G+    LSR  F   +IDE  Q  +P  + P
Sbjct  571   ADEKRYRNLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVP  630

Query  893   -LFNAEKYVIVGDPDQLSAVVKSKEARSIMSNLGMSEDMFSRLDSKN-NTRVLKQQYRMN  950
              +  A++ ++VGD  QL  VV  K+A    +  G+S+ +F RL         L+ QYRM+
Sbjct  631   VVLGAKQLILVGDHCQLGPVVMCKKA----ARAGLSQSLFERLVVLGIRPFRLEVQYRMH  686

Query  951   KPIMDLANDLTYKGELLMGNDKISNAILQFTNTKILESCEEWVKKALINDLEHAIVVLNT  1010
               +    ++  Y+G L        N +      + L+    W +       E  +  L T
Sbjct  687   PELSQFPSNFFYEGSL-------QNGVC--AEDRRLKLDFPWPQP------ERPMFFLVT  731

Query  1011  QELRNLNLKINFETIPHNDTSHCTNYFEAGIVMRLLNVLIQVGVKTDDIGIIAPFTHQVN  1070
             Q           E I  + TS   N  EA  V ++    ++ G+K + IGII P+  Q  
Sbjct  732   Q---------GQEEIAGSGTSFL-NRTEAANVEKITTRFLKAGIKPEQIGIITPYEGQRA  781

Query  1071  LLKRLVKKQ----------VEINTVDQYQGRDKSVILLSCTKNDVKDFYSQKREYEILED  1120
              L + ++ Q          +EI +VD +QGR+K +I++SC +++      +++    L D
Sbjct  782   YLVQYMQYQGSLHSRLYQEIEIASVDAFQGREKDIIIMSCVRSN------ERQGIGFLND  835

Query  1121  HTRLNVALTRAKNKLIIIGNKESLIRYTPFQKLFSLIKKEEIVLKNNFDDF  1171
               RLNVALTRAK  +II+GN + L +   +  L +  K  +++++ + ++ 
Sbjct  836   PRRLNVALTRAKFGIIIVGNPKVLAKQQLWNHLLNFYKDRKVLVEGSLNNL  886



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933632.1 RNA-binding protein pno1 [Chelonus insularis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DL0_TRYB2  unnamed protein product                                 209     2e-68
M9NF14_DROME  unnamed protein product                                 36.2    0.020
Q8IGK4_DROME  unnamed protein product                                 36.2    0.021


>Q38DL0_TRYB2 unnamed protein product
Length=200

 Score = 209 bits (532),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 139/185 (75%), Gaps = 7/185 (4%)

Query  63   EMRKVAVPAHRYTPLKENWIKIFPPIVEHLKLQIRFNLKTRNVEIRTVPGETQDISN---  119
            EMR V VP HR+  LK+ W+ ++ PIVE  KL+IR NL+ R+VE+RT P   +   N   
Sbjct  14   EMRTVKVPHHRFPALKKVWMDVYTPIVEQCKLEIRMNLRGRSVELRTCPATVEAAGNEGS  73

Query  120  ---LQKGADFVKAFILGFEVDDALALLRLDDLFIESFEIQDVKP-LKGDHLSRAIGRLAG  175
               LQK  DFVKA + GF+V DA+ALLR+DD++IE FE++DV+  L+GD+LSR IGR++G
Sbjct  74   KALLQKAEDFVKAVVAGFDVKDAVALLRMDDVYIEGFEVKDVRANLQGDNLSRCIGRMSG  133

Query  176  KGGRTKFTIENVTRTRIVLADSKIHVLGSFQNIQLARRAICNLILGTPPSKVYGQLRNVA  235
              G+TK TIENVTRTRIV+AD+ I ++G+ QNI++AR A+C+LI G+P +KVY ++R V 
Sbjct  134  SHGKTKHTIENVTRTRIVIADTHICIMGTTQNIRVARDALCDLIRGSPATKVYTRVRAVM  193

Query  236  SRVSE  240
            +RV++
Sbjct  194  NRVND  198


>M9NF14_DROME unnamed protein product
Length=638

 Score = 36.2 bits (82),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 38/73 (52%), Gaps = 12/73 (16%)

Query  167  SRAIGRLAGKGGRTKFTIENVTRTRIVLA------------DSKIHVLGSFQNIQLARRA  214
            S  +GR+ GKGG+    ++ VT + I L             ++ +H++G F ++Q A+R 
Sbjct  462  SSQVGRIIGKGGQNVRELQRVTGSVIKLPEHALAPPSGGDEETPVHIIGLFYSVQSAQRR  521

Query  215  ICNLILGTPPSKV  227
            I  ++L T P  +
Sbjct  522  IRAMMLSTNPPPI  534


>Q8IGK4_DROME unnamed protein product
Length=580

 Score = 36.2 bits (82),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 38/73 (52%), Gaps = 12/73 (16%)

Query  167  SRAIGRLAGKGGRTKFTIENVTRTRIVLA------------DSKIHVLGSFQNIQLARRA  214
            S  +GR+ GKGG+    ++ VT + I L             ++ +H++G F ++Q A+R 
Sbjct  404  SSQVGRIIGKGGQNVRELQRVTGSVIKLPEHALAPPSGGDEETPVHIIGLFYSVQSAQRR  463

Query  215  ICNLILGTPPSKV  227
            I  ++L T P  +
Sbjct  464  IRAMMLSTNPPPI  476



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933633.1 hsp70-Hsp90 organizing protein 1-like [Chelonus
insularis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZX0_TRYB2  unnamed protein product                                 90.5    1e-20
Q385S7_TRYB2  unnamed protein product                                 88.2    5e-20
STIP1_DICDI  unnamed protein product                                  88.6    6e-20


>Q57ZX0_TRYB2 unnamed protein product
Length=550

 Score = 90.5 bits (223),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 60/107 (56%), Gaps = 0/107 (0%)

Query  11   KLKQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFAMDDALMTI  70
            +LK +GN  F   +Y EA   ++ AI LDP NH LYSNRS  F  L QY  A+ DA   +
Sbjct  5    ELKNKGNQEFSSGRYREAAEFFSQAINLDPSNHVLYSNRSACFASLHQYAQALSDAEKCV  64

Query  71   NLKPDWIKGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAI  117
            +LKPDW+KGY R         R++EA   Y++ L + P+     + I
Sbjct  65   SLKPDWVKGYVRHGAALHGLRRYDEAAAVYKKGLTVDPSSTACSEGI  111


 Score = 83.2 bits (204),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 67/111 (60%), Gaps = 0/111 (0%)

Query  10   QKLKQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFAMDDALMT  69
            Q+ K +GN  F Q K+ EA+  YT +IK +P  H+ YSNR+  +LKL  Y+ A+ DA   
Sbjct  363  QEKKDEGNSLFKQDKFPEAVAAYTESIKRNPMEHTTYSNRAAAYLKLGAYNEALADAEKC  422

Query  70   INLKPDWIKGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAINRT  120
            I +KPD++K + R+    F T ++N+A+++Y++ L+    + +      RT
Sbjct  423  IEIKPDFVKAHARRGHAFFWTKQYNKAMQAYDEGLKYDKENAECKDGRMRT  473


 Score = 42.4 bits (98),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 58/123 (47%), Gaps = 8/123 (7%)

Query  11   KLKQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFAMDDALMTI  70
            + K++GN  + Q+K+ EA+  Y  A  LDP N     N + VF +  +Y   M+     +
Sbjct  229  RAKEEGNALYKQRKFDEALAKYDEASSLDPTNTVYLLNITAVFYEKGEYELCMEKCENAL  288

Query  71   NL----KPDWI---KGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAINRTSRS  123
                  K D+    K   R+A       RF+EA+  +++AL ++  +PD L  +N   + 
Sbjct  289  EHGRENKCDYTVIAKLMTRQALCLQKLKRFDEAIALFKKAL-VEHRNPDTLAKLNACEKE  347

Query  124  LIK  126
              K
Sbjct  348  KAK  350


>Q385S7_TRYB2 unnamed protein product
Length=392

 Score = 88.2 bits (217),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 66/118 (56%), Gaps = 0/118 (0%)

Query  6    EDKIQKLKQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFAMDD  65
            +++  + K QGN  F   +  +A  +YT AI++D  NH  +SNR+  +   + Y  A  D
Sbjct  274  KEEANRFKMQGNKVFEDGENVKAAKYYTLAIRMDNTNHVFFSNRAAAYFNQRHYSGAYWD  333

Query  66   ALMTINLKPDWIKGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAINRTSRS  123
            +L  I L P W KGY+RKA  E    + +EAL++ E+ L+L P + D+L     T RS
Sbjct  334  SLRCITLAPQWAKGYFRKAATELAMKKRDEALRTCEEGLRLDPQNKDLLTIREETRRS  391


>STIP1_DICDI unnamed protein product
Length=564

 Score = 88.6 bits (218),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 62/115 (54%), Gaps = 0/115 (0%)

Query  3    TEIEDKIQKLKQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFA  62
            +E   K  + K QGN  F  + Y  A+  +  AI+LDP NH LYSNRS   L L +   A
Sbjct  2    SENAQKATEFKNQGNAAFSSKDYNSAVKCFDQAIELDPSNHILYSNRSASLLALDKNEDA  61

Query  63   MDDALMTINLKPDWIKGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAI  117
            + DA   I LKPDW KGY R+    +   RF EA KS E  L++ P +  +  A+
Sbjct  62   LTDAKKAIELKPDWSKGYLRETNALYKLGRFEEAEKSAEAGLKIDPTNQQLEDAL  116


 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 72/116 (62%), Gaps = 0/116 (0%)

Query  13   KQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFAMDDALMTINL  72
            K +G + F + ++ EA+  +  AI+ +PK+H++YSNRS  + KL +Y  A+ DA   I L
Sbjct  383  KNKGVEHFKKGEFPEAIKCFEEAIRRNPKDHTIYSNRSAAYSKLLEYKLAIKDADKCIEL  442

Query  73   KPDWIKGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAINRTSRSLIKDQ  128
            +P +IKGY RK    F    + +AL+ Y+Q L+++ N+P++L    +T  +L K Q
Sbjct  443  EPTFIKGYIRKGTALFAMREYQQALEVYDQGLRIEANNPELLDLSRKTVAALTKLQ  498


 Score = 36.6 bits (83),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 33/146 (23%), Positives = 70/146 (48%), Gaps = 20/146 (14%)

Query  10   QKLKQQGNDCFHQQKYAEAMFHYTHAIKLDPKNHSLYSNRSYVFLKLQQYHFAMDDALMT  69
            QK +  GN  + ++++ +A+ HY  A++LD  +    +N++ V ++ Q+    +D+A+ T
Sbjct  245  QKERDLGNKAYAKKEFEQAIVHYDKAVELDSSDILAMNNKAAVLIEQQK----LDEAIET  300

Query  70   I--------NLKPDW---IKGYYRKAEVEFHTFRFNEALKSYEQALQLQPNDPDILKAIN  118
                      ++ D+    K Y R   +     + ++A K+Y  A+ L+  + D    + 
Sbjct  301  CKKALEKAQEIRADYRVKSKVYTRLGNIYLKKNQLDDAYKAYSSAV-LEDKNADTTANMK  359

Query  119  RTSRSLIKDQRADQQIPWLGAGIGII  144
            +  +  +K QR D+   +L     II
Sbjct  360  KIEK--LKKQRDDE--AYLSVDQSII  381



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933634.1 protein slowmo [Chelonus insularis]

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLMO_DROME  unnamed protein product                                   247     2e-83
PREL_DROME  unnamed protein product                                   58.5    3e-10
RETM_DROME  unnamed protein product                                   44.7    3e-05


>SLMO_DROME unnamed protein product
Length=215

 Score = 247 bits (631),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 153/205 (75%), Gaps = 5/205 (2%)

Query  1    MKIWSIEHTFNHPWETVVAAALKKYPNPLNEAVLGTDIIDRKIVNGILYTHRLVVSEFKF  60
            MKIW+ EH FNHPWETV  AA +KYPNP+  +++GTD+++R++V+G+L+THRLV S++ F
Sbjct  1    MKIWTSEHIFNHPWETVTQAAWRKYPNPMTPSIIGTDVVERRVVDGVLHTHRLVQSKWYF  60

Query  61   PSYAQAIIGSANAHYASEKSEVDPARREMVLRTRNLSFSKFIDVGETLRYIPHPQDKNKT  120
            P +  A+IG+A   +ASE+S VDP R++MVL+T NL+F + I V E L Y PHP D +KT
Sbjct  61   PKWTHALIGTAKTCFASERSTVDPERKQMVLKTNNLTFCRNISVDEVLYYEPHPSDASKT  120

Query  121  LLKQEAIVTVQGAPLASYMEDILTKKISFNAGMGRQAVEWVIKL-DAEMKDLANTAVKST  179
            LLKQEA VTV G PL+ YMED+LT  IS NAG GRQ +EWVI L + E+K +A    + T
Sbjct  121  LLKQEATVTVFGVPLSHYMEDLLTSTISTNAGKGRQGLEWVIGLINTEVKGIA----RGT  176

Query  180  DELLSQTRRQLDDITTKTKRGMDDL  204
            DELL  TRR +D++T   ++ MD++
Sbjct  177  DELLHNTRRSIDEVTESARKSMDEI  201


>PREL_DROME unnamed protein product
Length=236

 Score = 58.5 bits (140),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/157 (25%), Positives = 67/157 (43%), Gaps = 3/157 (2%)

Query  7    EHTFNHPWETVVAAALKKYPNPLNEAVLGTDIIDRKIVNGILYTHRLVVSEFKFPSYAQA  66
            E  F++ W  VV A   +YPNP +  VL  D I R++ +G L++ RL+      P +   
Sbjct  11   ETVFDYSWMNVVVAYWNRYPNPSSTHVLTEDTIQREVRDGKLFSRRLLSKTNPVPKWGAR  70

Query  67   IIGSANAHYASEKSEVDPARREMVLRTRNLSFSKFIDVGETLRYIPHPQDKNKTLLKQEA  126
               +       E S +DP ++     TRNL  +K + V E + Y    Q    TL  + A
Sbjct  71   FYNNVPVKIV-EDSVLDPVKKTFTTFTRNLGMTKIMKVDEIVVY--SEQKDGSTLAVRRA  127

Query  127  IVTVQGAPLASYMEDILTKKISFNAGMGRQAVEWVIK  163
             ++ Q    +  +     ++   N         +V++
Sbjct  128  YISSQVFGFSRAIRAFGIERFKANGNKASNGFNYVLR  164


>RETM_DROME unnamed protein product
Length=659

 Score = 44.7 bits (104),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 72/158 (46%), Gaps = 5/158 (3%)

Query  9    TFNHPWETVVAAALKKYPN-PLNEAVLGTDII-DRKIVNGI-LYTHRLVVSEFKFPSYAQ  65
             + +P+E V+ A  +++P  P    VL  ++I D  + +G    T R        P   +
Sbjct  11   VYKYPFELVMKAYERRFPTCPQMPIVLDCEVIKDESLEDGAKRNTSRRCKLAVDAPYIFK  70

Query  66   AIIGSANAHYASEKSEVDPARREMVLRTRNLSFSKFIDVGETLRYIPHPQDKNKTLLKQE  125
             +IG  + ++  + + +D A R + +   N SFS  I++ E  RY  HP +   T   Q 
Sbjct  71   KLIGVDHVYFL-QHNFLDLANRTLSIEAVNESFSSRIEIFERCRYYAHPDNSEWTCFDQS  129

Query  126  AIVTVQG-APLASYMEDILTKKISFNAGMGRQAVEWVI  162
            A + ++        ME +  K+ +     G++ +E+ I
Sbjct  130  ATLDIKNFFGFEHSMEKMGMKQYTQTTLKGKEIIEFFI  167



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933635.1 trafficking protein particle complex subunit 4
[Chelonus insularis]

Length=217
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q20100_CAEEL  unnamed protein product                                 200     9e-65
Q381J3_TRYB2  unnamed protein product                                 47.4    1e-06
SC6A4_DROME  unnamed protein product                                  33.1    0.16 


>Q20100_CAEEL unnamed protein product
Length=224

 Score = 200 bits (508),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 144/211 (68%), Gaps = 4/211 (2%)

Query  6    VYIVSKSGGLIFNYDHNVPKIEHERTFTYPLDIKLINENKKIVVSFGQRDGINVGHVLMS  65
            ++I++++G LI++++      E E+T+ +P+D+ L   ++K VV FG++DGI + + + S
Sbjct  8    LFIINRAGSLIYSWEARTETPEVEKTYEWPIDVHLEEVDQKAVVVFGEKDGIKLRYYVKS  67

Query  66   VNGNPVVGKELEDGT---DVLEYLNKPQNFPVTLKFGRAKMTTNEKIFLASMFYPLFAIA  122
            VNG  V G  L+ G    +VLEYL +  ++PVT+KF    ++TNEKI L+SMF+ LF IA
Sbjct  68   VNGETVSGTRLQLGAQQVNVLEYLQEEDHYPVTVKFAAPTVSTNEKIILSSMFHSLFTIA  127

Query  123  SQLSPEPRCSGIEVLEADTFRLYCFQTLTGVKFMIV-AEPSQAGMDILTKRVYELYADYA  181
             QLSP  + SG+EVLE   F+L+C Q+ TGVKF+++ +  S    D L  ++YELY D+A
Sbjct  128  VQLSPCQKSSGVEVLETTQFKLFCLQSRTGVKFVVITSAASNIAADSLLSKMYELYTDFA  187

Query  182  LKNPFYSLDMPIRCELFDTHLVNLLETVEKS  212
            LKNPFYS+DMPIR + FD  +  LLE  EK+
Sbjct  188  LKNPFYSIDMPIRAQKFDEAIKTLLERAEKN  218


>Q381J3_TRYB2 unnamed protein product
Length=157

 Score = 47.4 bits (111),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 55/99 (56%), Gaps = 8/99 (8%)

Query  108  KIFLASMFYPLFAIASQLSPEPR---CSGIEVLEADTFRLYCFQTLTGVKFMIVAEPSQA  164
            ++ ++S+ +  F ++ +L+P       +G+ +LE     ++ ++T + VKF++V++    
Sbjct  37   QLTMSSILFSTFGMSQELTPNANPVDSAGMTLLEFAEHNVHIYETPSLVKFVLVSDHHTY  96

Query  165  GMDILTKRVYELYADYALKNPFYSLD-----MPIRCELF  198
              + L ++++ LY +Y +KNPF  +D      PIR   F
Sbjct  97   ECNALFRQLHSLYVEYVVKNPFNIIDEGGIGQPIRIPAF  135


>SC6A4_DROME unnamed protein product
Length=622

 Score = 33.1 bits (74),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 66/184 (36%), Gaps = 31/184 (17%)

Query  20   DHNVPKIEHERTFTYPLDIKLINENKKIVVSFGQRDGINVGH---VLMSVNGNPVVGKEL  76
            DH  P        T PL  KL N  + +VVS  +R     G     L++V G  V     
Sbjct  43   DHTTPA-----KVTDPLAPKLANNERILVVSVTERTRETWGQKAEFLLAVIGFAVD----  93

Query  77   EDGTDVLEYLNKPQNFP-VTLKFGRAKMTTNEKIFLASMFYPLFAIASQLSPEPRCSGIE  135
                     L     FP +  + G         +FL     PLF +   L    RC  + 
Sbjct  94   ---------LGNVWRFPYICYQNGGGAFLVPYCLFLIFGGLPLFYMELALGQFHRCGCLS  144

Query  136  VLEADTFRLYCFQTLTGVKFMIVAEPSQAGM---DILTKRVYELYADYALKNPFYSLDMP  192
            +     ++  C   L GV + I       GM    I+   VY L+A +  K P+ S D P
Sbjct  145  I-----WKRIC-PALKGVGYAICLIDIYMGMYYNTIIGWAVYYLFASFTSKLPWTSCDNP  198

Query  193  IRCE  196
               E
Sbjct  199  WNTE  202



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933636.1 adrenodoxin-like protein 2, mitochondrial [Chelonus
insularis]

Length=167
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SZA8_DROME  unnamed protein product                                 185     1e-60
ADXH_DROME  unnamed protein product                                   84.0    8e-21
Q584K7_TRYB2  unnamed protein product                                 82.4    3e-20


>Q8SZA8_DROME unnamed protein product
Length=152

 Score = 185 bits (469),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 106/128 (83%), Gaps = 0/128 (0%)

Query  40   VPKRFTSSTQPLCNPKEVKVTFIRASGERIEAKGKVGDSLLDIVVNNEIDLDGYGACEGT  99
            +  R  S+   L     V +TF+RA+G++I+  GKVGDSLLD+VVNN +DLDG+GACEGT
Sbjct  24   IATRTFSTGLALKTKDVVNITFVRANGDKIKTSGKVGDSLLDVVVNNNVDLDGFGACEGT  83

Query  100  LTCSTCHLIFSKEVYDSLPDKPTDEELDMLDLAYDLTETSRLGCQITMTKELDGLEVHVP  159
            LTCSTCHLIF    ++ LPDKP DEELDMLDLAY+LT+TSRLGCQIT++K+++GLEVHVP
Sbjct  84   LTCSTCHLIFKTSDFEKLPDKPGDEELDMLDLAYELTDTSRLGCQITLSKDMEGLEVHVP  143

Query  160  ATINDARS  167
            +TINDAR+
Sbjct  144  STINDARA  151


>ADXH_DROME unnamed protein product
Length=172

 Score = 84.0 bits (206),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 47/136 (35%), Positives = 79/136 (58%), Gaps = 6/136 (4%)

Query  31   TYQDCQHYVVPKRFTS--STQPLCNPKEVKVTFIRASGERIEAKGKVGDSLLDIVVNNEI  88
            T  +  H  +P+R        P    + V +T++   G+R + +GKVGD++L +   + I
Sbjct  29   TPHNALHTTIPRRHGEFEWQDPKSTDEIVNITYVDKDGKRTKVQGKVGDNVLYLAHRHGI  88

Query  89   DLDGYGACEGTLTCSTCHLIFSKEVYDSLPDKPTDEELDMLDLAYDLTETSRLGCQITMT  148
            +++G  ACE +L C+TCH+    +    L +   ++E D+LD+A  L E SRLGCQI + 
Sbjct  89   EMEG--ACEASLACTTCHVYVQHDYLQKLKE-AEEQEDDLLDMAPFLRENSRLGCQILLD  145

Query  149  KELDGLEVHVP-ATIN  163
            K ++G+E+ +P AT N
Sbjct  146  KSMEGMELELPKATRN  161


>Q584K7_TRYB2 unnamed protein product
Length=167

 Score = 82.4 bits (202),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 70/115 (61%), Gaps = 3/115 (3%)

Query  53   NPKEVKVTFIRASGERIEAKGKVGDSLLDIVVNNEIDLDGYGACEGTLTCSTCHLIFSKE  112
             P  ++V    A GE+I      G +L++  + +   +D   AC+GT  CSTCH+I  +E
Sbjct  55   TPGAIRVNVTTAEGEKITFSAPSGLTLME-ALRDVARVDIEAACDGTCACSTCHVILREE  113

Query  113  VYDSLPDKPTDEELDMLDLAYDLTETSRLGCQITMTKELDGLEVHVPA-TINDAR  166
             +  L    +++E+DMLDLA  +T TSRL CQ+ ++KELDG+ + +P+ T N+ R
Sbjct  114  DFGKL-TAASEDEMDMLDLAPQVTPTSRLACQVKLSKELDGITLQMPSETTNEMR  167



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933637.1 uncharacterized protein LOC118063645 [Chelonus
insularis]

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86P36_DROME  unnamed protein product                                 28.5    3.0  
UNC58_CAEEL  unnamed protein product                                  26.9    8.0  
ABCGF_DICDI  unnamed protein product                                  26.9    9.9  


>Q86P36_DROME unnamed protein product
Length=1169

 Score = 28.5 bits (62),  Expect = 3.0, Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 8/102 (8%)

Query  30   NTFIITRYSVLF--YEIQAPENLSFVVIAAISVCTCSFMIVGSMMENHWMLIPHILWKTV  87
            N  I   Y V F  +E+  P +L  +VI AI +   SF+ + +++ + W+    I  +  
Sbjct  685  NASIFHPYFVFFDQFELVRPVSLQAMVIGAIIMMIISFVFIPNILCSLWVAFSVISIELG  744

Query  88   LIGCLAVLVVMLNLMLIENRNEKGLLPVIIIFSIIFVISIPY  129
            + G +A+  V L+ + + N      L + I FS+ F   I Y
Sbjct  745  VAGYMALWDVNLDSISMIN------LIMCIGFSVDFTAHICY  780


>UNC58_CAEEL unnamed protein product
Length=591

 Score = 26.9 bits (58),  Expect = 8.0, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 6/35 (17%)

Query  77   MLIPHILWKTVLIG--CLAVLVVMLNLMLIENRNE  109
            +L PH++  +VLIG  CL   +    LML+E R E
Sbjct  179  ILTPHVILVSVLIGYLCLGAWI----LMLLETRTE  209


>ABCGF_DICDI unnamed protein product
Length=1475

 Score = 26.9 bits (58),  Expect = 9.9, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 40/86 (47%), Gaps = 13/86 (15%)

Query  50    LSFVVIAAISVCTCSFMIVG-----SMMENHWMLIPHILWKTVLIGCLAVLVVMLNLMLI  104
             L FV+++      CSF   G     S     W++    L+  V  G  A+  V +N+ + 
Sbjct  1265  LPFVLVSGTIFFFCSFWTAGLNSDASTNFFFWLIFMLFLFYCVGFG-QAIGAVCINITVA  1323

Query  105   ENRNEKGLLPVIIIFSIIF--VISIP  128
              N     LLPV+IIF  +F  V+ IP
Sbjct  1324  LN-----LLPVLIIFLFLFCGVLVIP  1344



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


Query= XP_034933638.1 uncharacterized protein LOC118063645 [Chelonus
insularis]

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86P36_DROME  unnamed protein product                                 28.5    3.0  
UNC58_CAEEL  unnamed protein product                                  26.9    8.0  
ABCGF_DICDI  unnamed protein product                                  26.9    9.9  


>Q86P36_DROME unnamed protein product
Length=1169

 Score = 28.5 bits (62),  Expect = 3.0, Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 49/102 (48%), Gaps = 8/102 (8%)

Query  30   NTFIITRYSVLF--YEIQAPENLSFVVIAAISVCTCSFMIVGSMMENHWMLIPHILWKTV  87
            N  I   Y V F  +E+  P +L  +VI AI +   SF+ + +++ + W+    I  +  
Sbjct  685  NASIFHPYFVFFDQFELVRPVSLQAMVIGAIIMMIISFVFIPNILCSLWVAFSVISIELG  744

Query  88   LIGCLAVLVVMLNLMLIENRNEKGLLPVIIIFSIIFVISIPY  129
            + G +A+  V L+ + + N      L + I FS+ F   I Y
Sbjct  745  VAGYMALWDVNLDSISMIN------LIMCIGFSVDFTAHICY  780


>UNC58_CAEEL unnamed protein product
Length=591

 Score = 26.9 bits (58),  Expect = 8.0, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 21/35 (60%), Gaps = 6/35 (17%)

Query  77   MLIPHILWKTVLIG--CLAVLVVMLNLMLIENRNE  109
            +L PH++  +VLIG  CL   +    LML+E R E
Sbjct  179  ILTPHVILVSVLIGYLCLGAWI----LMLLETRTE  209


>ABCGF_DICDI unnamed protein product
Length=1475

 Score = 26.9 bits (58),  Expect = 9.9, Method: Composition-based stats.
 Identities = 27/86 (31%), Positives = 40/86 (47%), Gaps = 13/86 (15%)

Query  50    LSFVVIAAISVCTCSFMIVG-----SMMENHWMLIPHILWKTVLIGCLAVLVVMLNLMLI  104
             L FV+++      CSF   G     S     W++    L+  V  G  A+  V +N+ + 
Sbjct  1265  LPFVLVSGTIFFFCSFWTAGLNSDASTNFFFWLIFMLFLFYCVGFG-QAIGAVCINITVA  1323

Query  105   ENRNEKGLLPVIIIFSIIF--VISIP  128
              N     LLPV+IIF  +F  V+ IP
Sbjct  1324  LN-----LLPVLIIFLFLFCGVLVIP  1344



Lambda      K        H
   0.324    0.137    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4150185960


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933639.1 DNA replication ATP-dependent helicase/nuclease DNA2
isoform X2 [Chelonus insularis]

Length=930
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3F2_CAEEL  unnamed protein product                                 243     7e-67
Q582F1_TRYB2  unnamed protein product                                 74.3    3e-13
RENT1_DROME  unnamed protein product                                  67.8    4e-11


>Q9U3F2_CAEEL unnamed protein product
Length=1069

 Score = 243 bits (620),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 215/738 (29%), Positives = 342/738 (46%), Gaps = 71/738 (10%)

Query  207  WRDVRIKVGDLV-VIKAKKLVD-EFVVNNDFGMIVSQPDELVAGTTVVQGIFCERKGVLL  264
            W ++ I+ G  + +I A+   D +F+VN+D G+++  PD LV  T V    FC RK VL 
Sbjct  137  WSEMSIEAGSTINLIGAQAWGDRDFLVNDDVGIVILNPDALVPCTAVASATFCARKTVLN  196

Query  265  QKYSGINSLPNIPATDAVMTCGIIVHEFLQTALK------MEIYDLESLWKLLETILQYP  318
             K+   N      A++  M  G I+HE  QTA+       ME  DL  +W       Q P
Sbjct  197  DKFKFGN------ASNKAMLLGTIMHEIFQTAITSKKRPVME-NDLMKIWNK-----QAP  244

Query  319  HIIQILYTSNLTIKAIKEMVDEYVLKVFQFL-KRYVLGIYPEGQDENFQGKIECIR--DI  375
               + L   + T   +   +  Y   +  ++ K Y L      + E    K E +   DI
Sbjct  245  KYAEELVALSFTPSCLDAELQPYFSIICGWINKHYPLSNSFFSKREPLPSKSELLEVYDI  304

Query  376  EEDVWLPSLGVKGKVDVTVEVSLNKCARRVLPLEIKTGRAIFSHEHKGQLHLYCMMMES-  434
            EE++W   LG+KGK+DVT+     K    +  LE+KTG++  S EH GQ+ LYCMM  S 
Sbjct  305  EENIWDSKLGLKGKIDVTMRT---KSRGGMESLELKTGKSSCSSEHTGQVLLYCMMQSSR  361

Query  435  LGYKLNSGLLLYIKENQMREIKSTRHEARDLILLRNSLAYYLSRDPYKVEKNLIGIKDKV  494
                +  G +LY+K+     +     +   ++  RN L+ +   DP              
Sbjct  362  YEQPIGPGNILYLKDGASHCVTPRAADLLGVLQQRNKLSVHF-EDP--------------  406

Query  495  KVWTLPELPEPINHAAGCKRCPFNTICCVYAKEAKLEFQEDHHYNKVLKEALAHLTHAHI  554
               T   LP+P   +  C +C   T+C  Y K  +   + +       +  +AHL   HI
Sbjct  407  ---TTSNLPDPRQDSRFCDKCDHKTMCSFYQKTEENFSKSNDKMKNFAENEMAHLEQNHI  463

Query  555  EYVVQWISMLQIEYA--HNKSLEGNRIIWSQKPVVRETQRTCLSYLKIDGPVQQEKNEFH  612
            EY   WI  +  E+     +    N+ +W +    R  + TCLS L    PV +E +   
Sbjct  464  EYAANWIRWISAEWKCERERMTSQNKDLWLKSVQERVEEGTCLSDLH---PVSEEMSNSQ  520

Query  613  HTFLRASIKDLKIKPPVKNFNDVFAIEDYIMINTCTRINIITGKVIAITKDSITVSLKKN  672
               +  S K LK      +    F   D  +++    I I    +  ++ D   V +  +
Sbjct  521  KIIISFSRKFLK-----SSNTPTFRPGDVCLLSNKKHIAIGFALIDEVSDDQQIVKISTD  575

Query  673  IT-KFSTQTYYHIDAVAPLTMPYQLLGTVATLLADNNITKRLREMIIDKIPAQFSDEIPE  731
             T K   +  +H+D    ++     LG +  LL ++ I KRLR +++D +P    D    
Sbjct  576  KTIKSRYEAPFHLDKYTSMSTHSTTLGNLVYLLQNDEIGKRLRNILVDLLPPIIMDATGF  635

Query  732  SL-KTKKAKIIMERLNKYQQEALRAAVQTKDYVMIKGMPGTGKTQTLVALIELYSTLGYS  790
            +L    K  II  +LN  Q++A+  A+ T+D++M++G+PG+GKT  +  LI+        
Sbjct  636  NLTPAIKKIIIKAKLNNEQRKAVVHALATEDFMMVEGLPGSGKTTLISVLIQCLVATNKK  695

Query  791  VLISAHTHIAVDNILLKLRNK--GLNFLRLGSKNRIHPLLHEYSDENLLKQCKTPEILES  848
            VL++A TH AVDNIL KL  +      LRLGS + I   + + +    LK     E  E 
Sbjct  696  VLLAAFTHSAVDNILTKLTKEVAAEKILRLGSSSSIKDDIKKMT----LKAKLENETSEE  751

Query  849  KYNKIK-------IVGVTCLGSNHPLL-SRRIFDYCVIDECTQILQPIIIRPLFNAEKYV  900
             Y  ++       IV  TC      LL S R FD  ++DE + +L+P+++  L  + K+V
Sbjct  752  YYAAVRKVMKTTPIVACTCHHVPRELLFSYRHFDVVIVDEASMVLEPLLLPVLATSNKFV  811

Query  901  IVGDPDQLSAVVKSKEAR  918
            +VGD  QL+ +V S++A+
Sbjct  812  LVGDCKQLTPLVVSRKAK  829


>Q582F1_TRYB2 unnamed protein product
Length=842

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 102/210 (49%), Gaps = 38/210 (18%)

Query  745  LNKYQQEALRAAVQTKDYVMIKGMPGTGKTQTLVALI-ELYSTLGYSVLISAHTHIAVDN  803
            LN  Q++ALR A++     +I+G PGTGKT T VA+I EL+S +   +L+ A +++AVD+
Sbjct  372  LNYSQEQALRVALRNP-LTLIQGPPGTGKTSTSVAIIRELHSHVKSRILVCAPSNVAVDH  430

Query  804  ILLKLRNKGLNFLRLGSKNR-----------IHPLLHEYSDEN--------LLKQCKTPE  844
            +  ++   GL  +RL +K R           +   + +Y + +        LL   +T +
Sbjct  431  LAQRVSGTGLKVVRLQAKYRNDIPCSVESIGLERQVGDYINASSGLERLKELLDSMQTGK  490

Query  845  ILESK-YNKIK---------------IVGVTCLGSNHPLLSRRIFDYCVIDECTQILQPI  888
             L  K Y   K               +V  TC+G+    L    F + +IDE TQ  +P 
Sbjct  491  SLNDKDYGTYKDGVEKIERLILRNADVVCCTCIGAGDYRLKTMKFKHVLIDEATQGTEPE  550

Query  889  IIRPLFNAEKYVI-VGDPDQLSAVVKSKEA  917
            ++ PL    K VI VGD  QL  +V S  A
Sbjct  551  VLIPLVRGAKQVILVGDHCQLRPLVFSTAA  580


>RENT1_DROME unnamed protein product
Length=1180

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 104/216 (48%), Gaps = 34/216 (16%)

Query  745  LNKYQQEALRAAVQTKDYVMIKGMPGTGKTQTLVALI-ELYSTLGYSVLISAHTHIAVDN  803
            LN+ Q  A++ A+Q +   +I+G PGTGKT T   ++ +L    G +VL+ A ++ AVD 
Sbjct  452  LNRSQVYAVKHALQ-RPLSLIQGPPGTGKTVTSATIVYQLVKLHGGTVLVCAPSNTAVDQ  510

Query  804  ILLKLRNKGLNFLRLGSKNR-----------IHPLLHEYSDENLLKQCK-----TPEIL-  846
            +  K+    L  +R+ +K+R           +H  +      + LK+ +     T E+  
Sbjct  511  LTEKIHRTNLKVVRVCAKSREAIDSPVSFLALHNQIRNMETNSELKKLQQLKDETGELSS  570

Query  847  --ESKYNKIK------------IVGVTCLGSNHPLLSRRIFDYCVIDECTQILQPIIIRP  892
              E +Y  +K            ++  TC+G+    LSR  F   +IDE  Q  +P  + P
Sbjct  571  ADEKRYRNLKRAAENQLLEAADVICCTCVGAGDGRLSRVKFTSILIDESMQSTEPECMVP  630

Query  893  -LFNAEKYVIVGDPDQLSAVVKSKEARSSMLLQGVL  927
             +  A++ ++VGD  QL  VV  K+A  + L Q + 
Sbjct  631  VVLGAKQLILVGDHCQLGPVVMCKKAARAGLSQSLF  666



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933640.1 uncharacterized protein LOC118063646 [Chelonus
insularis]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY27_CAEEL  unnamed protein product                                  29.6    1.2  


>GCY27_CAEEL unnamed protein product
Length=735

 Score = 29.6 bits (65),  Expect = 1.2, Method: Composition-based stats.
 Identities = 18/63 (29%), Positives = 29/63 (46%), Gaps = 0/63 (0%)

Query  27   LVLSAIMIIVCALNFYKYHVVDDIVLLITVAIGIFTCLLMIAGSKWEKRWLIFPHLAWAI  86
             V+ AI  I  A N Y++  +   ++L       F C  ++A   W   ++ FP L  AI
Sbjct  39   FVVVAIWTINGASNSYRFPFLQTYMILTDRFWLFFRCFTIVAWCGWCSNYIFFPCLMNAI  98

Query  87   LRV  89
            L +
Sbjct  99   LYI  101



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933641.1 succinate dehydrogenase assembly factor 2,
mitochondrial-like [Chelonus insularis]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDF2A_DROME  unnamed protein product                                  138     3e-42
Q584Q5_TRYB2  unnamed protein product                                 53.9    1e-09
TTL3E_TETTS  unnamed protein product                                  26.9    8.4  


>SDF2A_DROME unnamed protein product
Length=163

 Score = 138 bits (347),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (71%), Gaps = 2/126 (2%)

Query  24   SSFKNYSNDFHHPEGNEPPIPVYSAREGESTQLKKARLIYQSRKRGMLENGLVLSTFAKK  83
            S+F +   D+  P+    P+P Y  R  E  + +K RL+YQSRKRGMLEN L+LSTFA K
Sbjct  38   STFNDVIVDYEDPDY--LPLPEYPVRPNEPLETRKQRLLYQSRKRGMLENDLLLSTFAAK  95

Query  84   YLDTFNEQQLILYDRLINLPSNDWDLFYWAVGVKPTPAEFDNEVMNLLKKHVRNDDRQSR  143
            +L  F+ +Q   YD+LIN  SNDWD++YWA  VKPTP E+D E+M LLK+HV+N +R +R
Sbjct  96   HLQNFSAEQTAQYDQLINGVSNDWDIYYWATEVKPTPKEYDTEIMGLLKEHVKNAERVTR  155

Query  144  IVQPDL  149
            + QPDL
Sbjct  156  LRQPDL  161


>Q584Q5_TRYB2 unnamed protein product
Length=146

 Score = 53.9 bits (128),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)

Query  51   GESTQLKKARLIYQSRKRGMLENGLVLSTFAKKYLDTFNEQQLILYDRLINLPSNDWDLF  110
            GES + K+ RL+YQS  RGM+E  ++L  FA++ ++T +  QL  YD +  L   D DL+
Sbjct  51   GESNEAKRRRLLYQSTYRGMVEMDIILGAFARQNIETLSAPQLEEYDAV--LRHFDNDLY  108

Query  111  YWAVGVKPTPAE  122
             W V     PAE
Sbjct  109  KWLVMDVEAPAE  120


>TTL3E_TETTS unnamed protein product
Length=1394

 Score = 26.9 bits (58),  Expect = 8.4, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (53%), Gaps = 13/51 (25%)

Query  99   LINLPSN-----DWDLFY---WAVGVKPTPAEFDNE-----VMNLLKKHVR  136
            L NL +N     + +LF+   + +G      EF NE     VMNLLKKH++
Sbjct  804  LYNLKNNTQFGVNQELFFPRCYDLGNDQERGEFSNEFNRMNVMNLLKKHIQ  854



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933642.1 heat shock factor-binding protein 1 [Chelonus
insularis]

Length=84
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U3B7_CAEEL  unnamed protein product                                 68.2    9e-17
Q556J3_DICDI  unnamed protein product                                 52.8    2e-10
Q8IIF8_PLAF7  unnamed protein product                                 42.0    3e-06


>Q9U3B7_CAEEL unnamed protein product
Length=80

 Score = 68.2 bits (165),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 41/57 (72%), Gaps = 0/57 (0%)

Query  26  NMQELTQFVQTLLQGMQDKFQSMSDQIIGRIDEMGNRIDDLEKNIADLMTQAGVENA  82
           NM +LT  +Q +LQ  QD+FQ MSDQII RID+M  RIDDLEKNI DL+    VE+ 
Sbjct  20  NMNDLTSLIQGVLQQTQDRFQHMSDQIIRRIDDMTTRIDDLEKNINDLLQSNQVEHP  76


>Q556J3_DICDI unnamed protein product
Length=102

 Score = 52.8 bits (125),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)

Query  33  FVQTLLQGMQDKFQSMSDQIIGRIDEMGNRIDDLEKNIADLM  74
            VQ LL+ MQ +F+ +S+ I+ RIDEMG RID+L+K+I+DLM
Sbjct  32  VVQNLLEQMQSRFEKVSESILTRIDEMGQRIDELDKSISDLM  73


>Q8IIF8_PLAF7 unnamed protein product
Length=113

 Score = 42.0 bits (97),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 36/59 (61%), Gaps = 0/59 (0%)

Query  22   ADPKNMQELTQFVQTLLQGMQDKFQSMSDQIIGRIDEMGNRIDDLEKNIADLMTQAGVE  80
             +PK  +EL  +V+ +L  ++ K QS+SD ++ ++D M   +D+LE  + +  TQ  ++
Sbjct  55   VEPKAGEELEIYVENMLNELKTKMQSLSDNLLNKVDNMEKYLDELENTMMNYTTQNNLQ  113



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933643.1 phospholipid phosphatase 5-like isoform X1 [Chelonus
insularis]

Length=269
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388K6_TRYB2  unnamed protein product                                 89.0    3e-20
Q9VNU2_DROME  unnamed protein product                                 85.1    6e-19
WUN_DROME  unnamed protein product                                    75.5    2e-15


>Q388K6_TRYB2 unnamed protein product
Length=332

 Score = 89.0 bits (219),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 75/138 (54%), Gaps = 12/138 (9%)

Query  92   VLAVTLALGLNGLITNVIKIIVGRPRPDFFWRCFPDGLANVELNCTGNPNEI----RDGK  147
            +L+V  A   +  I +V+KI  GR RPDF  R   +G      N T  P+      R+G+
Sbjct  164  ILSVVFAFFFSLGIVDVLKIYAGRLRPDFLDRLRREGF-----NATSPPSNACSLAREGR  218

Query  148  KSFPSGHSSFAFVSFGFTALYLAGKLKTFSLSGKGNSWTLCCFLLPLIGALCIAISRTCD  207
             SFPSGHSS AF +F    +Y  G  + F+    G  W +   + P+  A+C+A SRT D
Sbjct  219  LSFPSGHSSCAFAAFTPLTMYFLGLSRAFN---SGPVWRIILSMFPIYLAICVAASRTRD  275

Query  208  YHHHWQDVVAGSLIGFLI  225
              HH+ D++ GS+IG +I
Sbjct  276  NRHHFSDILGGSVIGLVI  293


>Q9VNU2_DROME unnamed protein product
Length=334

 Score = 85.1 bits (209),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 76/142 (54%), Gaps = 25/142 (18%)

Query  104  LITNVIKIIVGRPRPDFFWRCFP---DG-----LANVEL-----NCTGN---PNEIRDGK  147
            L T + K  VGR RP FF  C P   DG     L N EL     +CT N     +IR+  
Sbjct  78   LTTELAKHAVGRLRPHFFHGCQPRLDDGSSCSDLQNAELYVEQFHCTNNNLSTRQIRELH  137

Query  148  KSFPSGHSSFAFVSFGFTALYLAGKLKTFSLSGKGNSWTLCCFL--LPLIGALCIAISRT  205
             SFPS HSS +F S    ALY+ G  +     G+G    L   L  L L+ ALC+++SR 
Sbjct  138  VSFPSAHSSLSFYSMVLLALYVHGVWR-----GRGGVRVLRHVLQFLLLMAALCVSLSRV  192

Query  206  CDYHHHWQDVVAGSLIGFLITY  227
             DY HHW DV+AG+L+G  +TY
Sbjct  193  ADYWHHWSDVLAGALLG--VTY  212


>WUN_DROME unnamed protein product
Length=379

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 69/138 (50%), Gaps = 20/138 (14%)

Query  101  LNGLITNVIKIIVGRPRPDFFWRCFP--------DGLANV-----ELNCTG---NPNEIR  144
            L+ L T++ K  +GR RP F   C P        D   N      E  C G   +   ++
Sbjct  202  LSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAINAGKYIQEFTCKGVGSSARMLK  261

Query  145  DGKKSFPSGHSSFAFVSFGFTALYLAGKLKTFSLSGKGNSWTLCCFLLPLIGALCIAISR  204
            + + SFPSGHSSF F +  + ALYL  ++   +  G      L  FL  ++ A   A+SR
Sbjct  262  EMRLSFPSGHSSFTFFAMVYLALYLQARM---TWRGSKLLRHLLQFLFIMV-AWYTALSR  317

Query  205  TCDYHHHWQDVVAGSLIG  222
              DY HHW DV+AGSLIG
Sbjct  318  VSDYKHHWSDVLAGSLIG  335



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933644.1 putative metabolite transport protein HI_1104
[Chelonus insularis]

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPIN_DROME  unnamed protein product                                   59.7    3e-09
O96156_PLAF7  unnamed protein product                                 49.3    6e-06
Q9XXQ9_CAEEL  unnamed protein product                                 40.4    0.003


>SPIN_DROME unnamed protein product
Length=605

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 76/337 (23%), Positives = 140/337 (42%), Gaps = 22/337 (7%)

Query  96   LGLDYQILAGPSFIAVFTVVGVILGIAADKYHRVRMLTVCTLIFSIAIILMGSVKEYWQL  155
            +G D   L    F+  + V   I G   D+Y R  ++ V   ++S   +L   +K++   
Sbjct  147  IGNDSAGLLQTVFVISYMVCAPIFGYLGDRYSRPWIMAVGVGLWSTTTLLGSFMKQFGWF  206

Query  156  VVLRMILAAGEAGCNPLATGLMSDLFEEDQRGLVMSIFNWGIYGGYGIAFPVGRYITQL-  214
            +  R ++  GEA  + +A  ++SDLF  D R  ++++F + I  G G+ + VG     L 
Sbjct  207  IAFRALVGIGEASYSTIAPTIISDLFVHDMRSKMLALFYFAIPVGSGLGYIVGSKTAHLA  266

Query  215  NAWDLGWRVCYYGAGIIGLIITVLTAFTLVEPERKSIGEETMNASNETKPSTWKVLFQPR  274
            N W    RV      I+G I+ V     + +P R    E + N    T     K L + R
Sbjct  267  NDWRWALRVT----PILG-IVAVFLILLIKDPVRGH-SEGSHNLEATTYKQDIKALVRNR  320

Query  275  VILLCLAA--SIRHCGGMCFAYNCDLYY--------RDYFPDYDLGWWLFAVTIVVGSIG  324
              +L  A    +    G    +     Y         +     D+ +    +T++ G +G
Sbjct  321  SFMLSTAGFTCVAFVAGALAWWGPSFIYLGMKMQPGNENIVQDDVAFNFGVITMLAGLLG  380

Query  325  VVAGGIISDKFVAKLGIRSRVAVLAISQLVATPFSFGSVYFNPLWAMITLGISYFFAEMW  384
            V  G  +S   V +      V + A   LV+ P   G+       ++ T  +  FF ++ 
Sbjct  381  VPLGSFLSQYLVKRYPTADPV-ICAFGLLVSAPLLTGACLLVNSNSVGTYAL-IFFGQLA  438

Query  385  FGIVFAVMVEI---VPLSMRSTTIGVFLFVMNNIGGN  418
              + +A++ +I   V +  R +T   F  ++++  G+
Sbjct  439  LNLNWAIVADILLYVVVPTRRSTAEAFQILISHALGD  475


>O96156_PLAF7 unnamed protein product
Length=565

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 75/165 (45%), Gaps = 12/165 (7%)

Query  98   LDYQILAGPSFIAVFTVVGVILGIAADKYHRVRMLTVCTLIFSIAIILMGSVKEYWQLVV  157
            L Y  LA    +++F+    I G  +DKY R  ML   T ++ +A IL+ ++ ++  ++ 
Sbjct  96   LGYITLAQTLMLSLFSP---IWGFLSDKYSRKWMLVFGTALWGVATILLANINDFAHILF  152

Query  158  LRMILAAGEAGCNPLATGLMSDLFEEDQRGLVMSIFNWG-----IYGGYGIAFPVGRYIT  212
             R I         P++  +++D  + +  GL   +         + GG        +Y  
Sbjct  153  FRAINGLALGSIGPISQSILADAAKNESLGLSFGLVQLSSSLGRLIGGVVTTTVALKYFG  212

Query  213  QLNAWDLGWRVCYYGAGIIGLIITVLTAFTLVEPERKSIGEETMN  257
             +     GWR+C+   GI+ ++++++ A  + +  R+    + M+
Sbjct  213  GIR----GWRLCFIVVGILSVLLSIIVALFVEDAPRQVRKNKKMD  253


>Q9XXQ9_CAEEL unnamed protein product
Length=613

 Score = 40.4 bits (93),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 47/216 (22%), Positives = 75/216 (35%), Gaps = 35/216 (16%)

Query  120  GIAADKYHRVRMLTVCTLIFSIAIILMGSVKEYWQLVVLRMILAAGEAGCNPLATGLMSD  179
            G  +D+Y R  ++   TLIF    ++         +++ R+ L  G    + +    + +
Sbjct  87   GAGSDRYGRKPIIIGSTLIFVCGAVICAVAWTKIVMLIGRIFLGVGIGFASMVVPVYLGE  146

Query  180  LFEEDQRGLVMSIFNWGIYGGYGIAFPVGRYITQLNAWDLGWRVCYYGAGIIGLIITVLT  239
                  RG ++S F   I  G  +A  +G   +    + +GWR+ +  AGI  LI  V  
Sbjct  147  ASPTHVRGTLVSAFAMMISFGQVVANIMGGVFSYWEPYTIGWRLMFAFAGIPALIQFVCF  206

Query  240  AFTLVEP--------------------------------ERKSIGEETMNASNETK---P  264
             F    P                                E K+  EE      E K   P
Sbjct  207  IFLPETPRWLYENGHTEQAEQVLEKIYGGNTEWIEYELAEIKTYAEERQKQMEEEKKSGP  266

Query  265  STWKVLFQPRVILLCLAASIRHCGGMCFAYNCDLYY  300
              W++L  P V+  C   S+          N  LYY
Sbjct  267  VIWRILKTPHVLKACFIGSMLQAFQQLAGINTILYY  302



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933645.1 uncharacterized protein LOC118063657 [Chelonus
insularis]

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BAB2_DROME  unnamed protein product                                   142     7e-37
LOLAL_DROME  unnamed protein product                                  130     8e-37
BRC1_DROME  unnamed protein product                                   134     2e-34


>BAB2_DROME unnamed protein product
Length=1067

 Score = 142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 93/120 (78%), Gaps = 2/120 (2%)

Query  4    QICLKWNSFLNNIVKSFENLWEEDSLVDVTLASDGKCLTAHKIILSASSPFFKKIFETNP  63
            Q CL+WN++ +N+   F+ L + +S VDVTL+ +G  + AHK++LSA SP+F+ +F  NP
Sbjct  197  QFCLRWNNYQSNLTNVFDELLQSESFVDVTLSCEGHSIKAHKMVLSACSPYFQALFYDNP  256

Query  64   CQHPVIILQDVHFSELEALLIFIYKGEVNIEQDQLPILLKAAETLQIRGLSGGEISANKS  123
            CQHP+II++DV +S+L+AL+ F+YKGE+N+ QDQ+  LLK AETL+IRGL+  E+SA + 
Sbjct  257  CQHPIIIMRDVSWSDLKALVEFMYKGEINVCQDQINPLLKVAETLKIRGLA--EVSAGRG  314


>LOLAL_DROME unnamed protein product
Length=127

 Score = 130 bits (326),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 84/116 (72%), Gaps = 2/116 (2%)

Query  1    MSS--QICLKWNSFLNNIVKSFENLWEEDSLVDVTLASDGKCLTAHKIILSASSPFFKKI  58
            MSS  Q  LKWN F  N+V SF +L +E S  DVTLA +G+   AHK++LSA SP+FK +
Sbjct  2    MSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKAL  61

Query  59   FETNPCQHPVIILQDVHFSELEALLIFIYKGEVNIEQDQLPILLKAAETLQIRGLS  114
             E NP +HP+IIL+DV +  L+A+L F+Y GEVN+ Q+QLP  LK A+ L+++GL+
Sbjct  62   LEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLA  117


>BRC1_DROME unnamed protein product
Length=727

 Score = 134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 85/111 (77%), Gaps = 0/111 (0%)

Query  4    QICLKWNSFLNNIVKSFENLWEEDSLVDVTLASDGKCLTAHKIILSASSPFFKKIFETNP  63
              CL+WN++ ++I  +FENL ++++ VDVTLA +G+ + AH+++LSA SP+F+++ ++ P
Sbjct  6    HFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKSTP  65

Query  64   CQHPVIILQDVHFSELEALLIFIYKGEVNIEQDQLPILLKAAETLQIRGLS  114
            C+HPVI+LQDV+F +L AL+ FIY GEVN+ Q  L   LK AE L++ GL+
Sbjct  66   CKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGLT  116



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933646.1 phospholipase D1 [Chelonus insularis]

Length=1138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BP34_DROME  unnamed protein product                                 1130    0.0  
Q9BP35_DROME  unnamed protein product                                 1128    0.0  
B7YZT5_DROME  unnamed protein product                                 1128    0.0  


>Q9BP34_DROME unnamed protein product
Length=1278

 Score = 1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/1223 (49%), Positives = 776/1223 (63%), Gaps = 125/1223 (10%)

Query  28    DSEFDDGLGVPDSLEMAS-------LDEPNETVNSNNKIS---DDKLTIVKTIPFSAIYS  77
             DSE+D+ L  PDS+ + S       L E  ET +   +     ++ + +   IPF++IY 
Sbjct  69    DSEYDETLAFPDSVTILSNVGDKPVLVERKETDDDEEEFDDEENNSVVLRHEIPFTSIYG  128

Query  78    PPIKGTGRSYNIFIPGEAIHVKIIDNERNITTHPLNPNLYTIELQHGPFVWTIKKRYKHI  137
             P +K       +FIPG  IHV+I+D ER++TTH LNPNLYTIEL HGPF WTIK+RYKH 
Sbjct  129   PSVKFNSFQRKVFIPGREIHVRIVDTERSVTTHLLNPNLYTIELTHGPFKWTIKRRYKHF  188

Query  138   QNLHNQLKIFRASLNIPFPTKSHRERRNSLRS-----LDENKIK----------------  176
              +LH QL  FR SLNIPFP++SH+E+R +L++      DE+ +K                
Sbjct  189   NSLHQQLSFFRTSLNIPFPSRSHKEKRTTLKATAREMADESTLKDLPSHTKVKQTSTPLR  248

Query  177   ---RKSRCA--------------------------------------LPRFPNKPDCLVF  195
                R S+ A                                      LPRFPN+P+ LV 
Sbjct  249   AEGRSSKIAGSNANNAMAMISPNHSSILAGLTPRRIQKKRKKKKKRKLPRFPNRPESLVT  308

Query  196   YENFNHRIKTLEEYLRNLLQIEIYKRHPETIQFLEVSRLSFIKDLGDKGKESAVLKRTGS  255
              EN + RIK LE+YL NLL I +Y+ H ET+ F+EVS +SF+  +G KGKE  +LKRTGS
Sbjct  309   VENLSVRIKQLEDYLYNLLNISLYRSHHETLNFVEVSNVSFVPGMGIKGKEGVILKRTGS  368

Query  256   S--ANAGCMLCGL----GGLTCGYMCTSL-CGTWHVRHLVVKETFILYMTPKDGEIQSVI  308
             +    AGC   G       + C Y C+ + CGTW  R   VKET   Y+ P DG I++VI
Sbjct  369   TRPGQAGCNFFGCFQKNCCVRCNYFCSDVVCGTWRNRWFFVKETCFGYIRPTDGSIRAVI  428

Query  309   LMDNSFEVSSGMYVTGLRHGLQIMNSSRHIVVKCWTRRKAREWLSFIQDTANSHGKYFIQ  368
             L D  F+VS+G+Y TG+R GLQ++ ++RHIV+KCWTRRK +EW+ ++++TANS+ + F  
Sbjct  429   LFDQGFDVSTGIYQTGMRKGLQVLTNNRHIVLKCWTRRKCKEWMQYLKNTANSYARDFTL  488

Query  369   VNPHRSFAPYRTPTPASWFVDGSSYMSAIADALENAKEEIFIADWWLSPEIYMKRPIIHG  428
              NPH SFAP R  T A+W+VDG+ YMSA+AD LE A EEI+IADWWLSPEIYMKRP + G
Sbjct  489   PNPHMSFAPMRANTHATWYVDGAQYMSAVADGLEAALEEIYIADWWLSPEIYMKRPALDG  548

Query  429   NYWRLDKILQRKALSGVKVFVMIYKEVELALGINSYYSKQKLVSACPENIKVFRHPDHAR  488
             +YWRLDKIL RKA  GV+VFV++YKEVE+ALGINSYYSK  L  A  ENIKV RHPDHAR
Sbjct  549   DYWRLDKILLRKAEQGVRVFVLLYKEVEMALGINSYYSKSTL--AKHENIKVMRHPDHAR  606

Query  489   VGIFLWAHHEKIVVVDQTVAFVGGIDLCYGRWDTEEHRLTDLGST----------HQSSI  538
              GI LWAHHEKIVV+DQT AF+GGIDLCYGRWD   HRLTDLGS              S+
Sbjct  607   GGILLWAHHEKIVVIDQTYAFMGGIDLCYGRWDDHHHRLTDLGSISTSSFSGSTRRTPSL  666

Query  539   YIP---TKGKITNTSSKRIVAVRT---DKHVILPLAIATNTILMATTGCLPVIPMPGKCI  592
             Y     T     +  S R     T   ++    P      +I + T      + +P   +
Sbjct  667   YFTKDDTDSAFGSRKSSRNAHYDTSAKERPPSPPPDEPNTSIELKTLKPGDRLLIPSTLV  726

Query  593   SSSSQPDFSSSTLLIPSKETQVFKCNTPDSQKKNLINM--------ARTTVDRVKQNVKI  644
             SS  +    S   L      +  K NTP+ ++KN+++         AR   D + +    
Sbjct  727   SSPGETPAESGIAL------EGMKLNTPEMERKNVLDRLKNNAMKGARMGKDFMHRLTAT  780

Query  645   KRQELINMVYNPNEMDNSSDSEDEIDNVVIREPVDVEGVLKNNADILSGLPGAAKLWLGK  704
             + +E    VY   E + ++D E  ++     + V    +  ++  ILS   G AK W GK
Sbjct  781   ETEEKSAEVYTI-ESEEATDHEVNLNMASGGQEV---AITTSSTQILSEFCGQAKYWFGK  836

Query  705   DYMNLIVKDFYDLERPYHDLVDRSTTPRMPWHDIGVMVQGAAARDIARHFIQRWNAIKME  764
             DY N I+KD+ +L  P+ D++DR+TTPRMPWHD+G+ V G +ARD+ARHFIQRWNA+K+E
Sbjct  837   DYSNFILKDWMNLNSPFVDIIDRTTTPRMPWHDVGLCVVGTSARDVARHFIQRWNAMKLE  896

Query  765   KAKLNKAYPFLLPKSYRDCSSNTPFISSKLIHNVKCQVLRSVSSWSAGFLESDAVEESIH  824
             K + N  +P+L+PKSY     N P I       V CQ+LRSVS+WS GF+E+D VE+SIH
Sbjct  897   KLRDNTRFPYLMPKSYHQVRLN-PNIQQNRQQRVTCQLLRSVSAWSCGFIEADLVEQSIH  955

Query  825   EAYIEAITNSEKFIYIENQFFITL-----ATMERSTVKNRIGETLLKRILRAHREGSVFR  879
             +AYI+ IT ++ ++YIENQFFIT+          + V+N+IGETL KRI+RAH+E   FR
Sbjct  956   DAYIQTITKAQHYVYIENQFFITMQLGMGVPGAYNNVRNQIGETLFKRIVRAHKERKPFR  1015

Query  880   VYVIMPLLPGFEGEVGGSSGTALHAITHWNYQSISRGRCSILNRLIESGVENPSEYITFH  939
             VYVIMPLLPGFEG+VGGS+G A+ AITHWNY SISRGR SIL RL E+G+ NP  YI+FH
Sbjct  1016  VYVIMPLLPGFEGDVGGSTGIAVRAITHWNYASISRGRTSILTRLQEAGIANPENYISFH  1075

Query  940   GLRTHSILNGTMVTELIYVHSKLMIVDDKIVICGSANINDRSMIATRDSEIAVIIHDEEF  999
              LR HS LN T +TELIYVHSKL+I DD++VICGSANINDRSMI  RDSEIA I+ DEEF
Sbjct  1076  SLRNHSFLNNTPITELIYVHSKLLIADDRVVICGSANINDRSMIGKRDSEIAAILMDEEF  1135

Query  1000  EEGKMNSTPYPCGKFVGSLRKQLFREHLGLL----CYPRTINIDDVIDKSFYYELWKARS  1055
             E+G+MN   YP G F G LRK LF+EHLGLL         ++I+D + + F++  W+  S
Sbjct  1136  EDGRMNGKKYPSGVFAGRLRKYLFKEHLGLLESEGSSRSDLDINDPVCEKFWHGTWRRIS  1195

Query  1056  KDNTEIFEKVFKCIPSDEATDFITLKNYQNSIPLSISDPIIAQEMLTNVKGHLVDLPLEF  1115
               NTEI+++VFKCIP+D    F +L+ YQ   PL+ + P +A     +++G+LVDLPLEF
Sbjct  1196  MQNTEIYDEVFKCIPTDFVKTFASLRKYQEEPPLAKTAPDLAANRANDIQGYLVDLPLEF  1255

Query  1116  LRDEVLTPGVNTVEGMMPTSLWT  1138
             L  EVLTP V + EG++PTS+WT
Sbjct  1256  LNKEVLTPPVTSKEGLIPTSVWT  1278


>Q9BP35_DROME unnamed protein product
Length=1278

 Score = 1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/1223 (48%), Positives = 775/1223 (63%), Gaps = 125/1223 (10%)

Query  28    DSEFDDGLGVPDSLEMAS-------LDEPNETVNSNNKIS---DDKLTIVKTIPFSAIYS  77
             DSE+D+ L  PDS+ + S       L E  ET +   +     ++ + +   IPF++IY 
Sbjct  69    DSEYDETLAFPDSVTILSNVGDKPVLVERKETDDDEEEFDDEENNSVVLRHEIPFTSIYG  128

Query  78    PPIKGTGRSYNIFIPGEAIHVKIIDNERNITTHPLNPNLYTIELQHGPFVWTIKKRYKHI  137
             P +K       +FIPG  IHV+I+D ER++TTH LNPNLYTIEL HGPF WTIK+RYKH 
Sbjct  129   PSVKFNSFQRKVFIPGREIHVRIVDTERSVTTHLLNPNLYTIELTHGPFKWTIKRRYKHF  188

Query  138   QNLHNQLKIFRASLNIPFPTKSHRERRNSLRS-----LDENKIK----------------  176
              +LH QL  FR SLNIPFP++SH+E+R +L++      DE+ +K                
Sbjct  189   NSLHQQLSFFRTSLNIPFPSRSHKEKRTTLKATAREMADESTLKDLPSHTKVKQTSTPLR  248

Query  177   ---RKSRCA--------------------------------------LPRFPNKPDCLVF  195
                R S+ A                                      LPRFPN+P+ LV 
Sbjct  249   AEGRSSKIAGSNANNAMAIISPNHSSILAGLTPRRIQKKRKKKKKRKLPRFPNRPESLVT  308

Query  196   YENFNHRIKTLEEYLRNLLQIEIYKRHPETIQFLEVSRLSFIKDLGDKGKESAVLKRTGS  255
              EN + RIK LE+YL NLL I +Y+ H ET+ F+EVS +SF+  +G KGKE  +LKRTGS
Sbjct  309   VENLSVRIKQLEDYLYNLLNISLYRSHHETLNFVEVSNVSFVPGMGIKGKEGVILKRTGS  368

Query  256   S--ANAGCMLCGL----GGLTCGYMCTSL-CGTWHVRHLVVKETFILYMTPKDGEIQSVI  308
             +    AGC   G       + C Y C+ + CGTW  R   VKET   Y+ P DG I++VI
Sbjct  369   TRPGQAGCNFFGCFQKNCCVRCNYFCSDVVCGTWRNRWFFVKETCFGYIRPTDGSIRAVI  428

Query  309   LMDNSFEVSSGMYVTGLRHGLQIMNSSRHIVVKCWTRRKAREWLSFIQDTANSHGKYFIQ  368
             L D  F+VS+G+Y TG+R GLQ++ ++RHIV+KCWTRRK +EW+ ++++TANS+ + F  
Sbjct  429   LFDQGFDVSTGIYQTGMRKGLQVLTNNRHIVLKCWTRRKCKEWMQYLKNTANSYARDFTL  488

Query  369   VNPHRSFAPYRTPTPASWFVDGSSYMSAIADALENAKEEIFIADWWLSPEIYMKRPIIHG  428
              NPH SFAP R  T A+W+VDG+ YMSA+AD LE A EEI+IADWWLSPEIYMKRP + G
Sbjct  489   PNPHMSFAPMRANTHATWYVDGAQYMSAVADGLEAALEEIYIADWWLSPEIYMKRPALDG  548

Query  429   NYWRLDKILQRKALSGVKVFVMIYKEVELALGINSYYSKQKLVSACPENIKVFRHPDHAR  488
             +YWRLDKIL RKA  GV+VFV++YKEVE+ALGINSYYSK  L  A  ENIKV RHPDHAR
Sbjct  549   DYWRLDKILLRKAEQGVRVFVLLYKEVEMALGINSYYSKSTL--AKHENIKVMRHPDHAR  606

Query  489   VGIFLWAHHEKIVVVDQTVAFVGGIDLCYGRWDTEEHRLTDLGST----------HQSSI  538
              GI LWAHHEKIVV+DQT AF+GGIDLCYGRWD   HRLTDLGS              S+
Sbjct  607   GGILLWAHHEKIVVIDQTYAFMGGIDLCYGRWDDHHHRLTDLGSISTSSFSGSTRRTPSL  666

Query  539   YIP---TKGKITNTSSKRIVAVRT---DKHVILPLAIATNTILMATTGCLPVIPMPGKCI  592
             Y     T     +  S R     T   ++    P      +I + T      + +P   +
Sbjct  667   YFTKDDTDSAFGSRKSSRNAHYDTSAKERPPSPPPDEPNTSIELKTLKPGDRLLIPSTLV  726

Query  593   SSSSQPDFSSSTLLIPSKETQVFKCNTPDSQKKNLINM--------ARTTVDRVKQNVKI  644
             SS  +    S   L      +  K NTP+ ++KN+++         AR   D + +    
Sbjct  727   SSPGETPAESGIAL------EGMKLNTPEMERKNVLDRLKNNAMKGARMGKDFMHRLTAT  780

Query  645   KRQELINMVYNPNEMDNSSDSEDEIDNVVIREPVDVEGVLKNNADILSGLPGAAKLWLGK  704
             + +E    VY   E + ++D E  ++     + V    +  ++  ILS   G AK W GK
Sbjct  781   ETEEKSAEVYTI-ESEEATDHEVNLNMASGGQEV---AITTSSTQILSEFCGQAKYWFGK  836

Query  705   DYMNLIVKDFYDLERPYHDLVDRSTTPRMPWHDIGVMVQGAAARDIARHFIQRWNAIKME  764
             DY N I+KD+ +L  P+ D++DR+TTPRMPWHD+G+ V G +ARD+ARHFIQRWNA+K+E
Sbjct  837   DYSNFILKDWMNLNSPFVDIIDRTTTPRMPWHDVGLCVVGTSARDVARHFIQRWNAMKLE  896

Query  765   KAKLNKAYPFLLPKSYRDCSSNTPFISSKLIHNVKCQVLRSVSSWSAGFLESDAVEESIH  824
             K + N  +P+L+PKSY     N P I       V CQ+LRSVS+WS GF+E+D VE+SIH
Sbjct  897   KLRDNTRFPYLMPKSYHQVRLN-PNIQQNRQQRVTCQLLRSVSAWSCGFIEADLVEQSIH  955

Query  825   EAYIEAITNSEKFIYIENQFFITL-----ATMERSTVKNRIGETLLKRILRAHREGSVFR  879
             +AYI+ IT ++ ++YIENQFFIT+          + V+N+IGETL KRI+RAH+E   FR
Sbjct  956   DAYIQTITKAQHYVYIENQFFITMQLGMGVPGAYNNVRNQIGETLFKRIVRAHKERKPFR  1015

Query  880   VYVIMPLLPGFEGEVGGSSGTALHAITHWNYQSISRGRCSILNRLIESGVENPSEYITFH  939
             VYVIMPLLPGFEG+VGGS+G A+ AITHWNY SISRGR SIL RL E+G+ NP  YI+FH
Sbjct  1016  VYVIMPLLPGFEGDVGGSTGIAVRAITHWNYASISRGRTSILTRLQEAGIANPENYISFH  1075

Query  940   GLRTHSILNGTMVTELIYVHSKLMIVDDKIVICGSANINDRSMIATRDSEIAVIIHDEEF  999
              LR HS LN T +TELIYVHSKL+I DD++VICGSANINDRSMI  RDSEIA I+ DEEF
Sbjct  1076  SLRNHSFLNNTPITELIYVHSKLLIADDRVVICGSANINDRSMIGKRDSEIAAILMDEEF  1135

Query  1000  EEGKMNSTPYPCGKFVGSLRKQLFREHLGLL----CYPRTINIDDVIDKSFYYELWKARS  1055
             E+G+MN   YP G F G LRK LF+EHLGLL         ++I+D + + F++  W+  S
Sbjct  1136  EDGRMNGKKYPSGVFAGRLRKYLFKEHLGLLESEGSSRSDLDINDPVCEKFWHGTWRRIS  1195

Query  1056  KDNTEIFEKVFKCIPSDEATDFITLKNYQNSIPLSISDPIIAQEMLTNVKGHLVDLPLEF  1115
               NTEI+++VFKCIP+D    F +L+ YQ   PL+ + P +A     +++G+LVDLPLEF
Sbjct  1196  MQNTEIYDEVFKCIPTDFVKTFASLRKYQEEPPLAKTAPDLAANRANDIQGYLVDLPLEF  1255

Query  1116  LRDEVLTPGVNTVEGMMPTSLWT  1138
             L  EVLTP   + EG++PTS+WT
Sbjct  1256  LNKEVLTPPGTSKEGLIPTSVWT  1278


>B7YZT5_DROME unnamed protein product
Length=1364

 Score = 1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/1223 (48%), Positives = 775/1223 (63%), Gaps = 125/1223 (10%)

Query  28    DSEFDDGLGVPDSLEMAS-------LDEPNETVNSNNKIS---DDKLTIVKTIPFSAIYS  77
             DSE+D+ L  PDS+ + S       L E  ET +   +     ++ + +   IPF++IY 
Sbjct  155   DSEYDETLAFPDSVTILSNVGDKPVLVERKETDDDEEEFDDEENNSVVLRHEIPFTSIYG  214

Query  78    PPIKGTGRSYNIFIPGEAIHVKIIDNERNITTHPLNPNLYTIELQHGPFVWTIKKRYKHI  137
             P +K       +FIPG  IHV+I+D ER++TTH LNPNLYTIEL HGPF WTIK+RYKH 
Sbjct  215   PSVKFNSFQRKVFIPGREIHVRIVDTERSVTTHLLNPNLYTIELTHGPFKWTIKRRYKHF  274

Query  138   QNLHNQLKIFRASLNIPFPTKSHRERRNSLRS-----LDENKIK----------------  176
              +LH QL  FR SLNIPFP++SH+E+R +L++      DE+ +K                
Sbjct  275   NSLHQQLSFFRTSLNIPFPSRSHKEKRTTLKATAREMADESTLKDLPSHTKVKQTSTPLR  334

Query  177   ---RKSRCA--------------------------------------LPRFPNKPDCLVF  195
                R S+ A                                      LPRFPN+P+ LV 
Sbjct  335   AEGRSSKIAGSNANNAMAMISPNHSSILAGLTPRRIQKKRKKKKKRKLPRFPNRPESLVT  394

Query  196   YENFNHRIKTLEEYLRNLLQIEIYKRHPETIQFLEVSRLSFIKDLGDKGKESAVLKRTGS  255
              EN + RIK LE+YL NLL I +Y+ H ET+ F+EVS +SF+  +G KGKE  +LKRTGS
Sbjct  395   VENLSVRIKQLEDYLYNLLNISLYRSHHETLNFVEVSNVSFVPGMGIKGKEGVILKRTGS  454

Query  256   S--ANAGCMLCGL----GGLTCGYMCTSL-CGTWHVRHLVVKETFILYMTPKDGEIQSVI  308
             +    AGC   G       + C Y C+ + CGTW  R   VKET   Y+ P DG I++VI
Sbjct  455   TRPGQAGCNFFGCFQKNCCVRCNYFCSDVVCGTWRNRWFFVKETCFGYIRPTDGSIRAVI  514

Query  309   LMDNSFEVSSGMYVTGLRHGLQIMNSSRHIVVKCWTRRKAREWLSFIQDTANSHGKYFIQ  368
             L D  F+VS+G+Y TG+R GLQ++ ++RHIV+KCWTRRK +EW+ ++++TANS+ + F  
Sbjct  515   LFDQGFDVSTGIYQTGMRKGLQVLTNNRHIVLKCWTRRKCKEWMQYLKNTANSYARDFTL  574

Query  369   VNPHRSFAPYRTPTPASWFVDGSSYMSAIADALENAKEEIFIADWWLSPEIYMKRPIIHG  428
              NPH SFAP R  T A+W+VDG+ YMSA+AD LE A EEI+IADWWLSPEIYMKRP + G
Sbjct  575   PNPHMSFAPMRANTHATWYVDGAQYMSAVADGLEAALEEIYIADWWLSPEIYMKRPALDG  634

Query  429   NYWRLDKILQRKALSGVKVFVMIYKEVELALGINSYYSKQKLVSACPENIKVFRHPDHAR  488
             +YWRLDKIL RKA  GV+VFV++YKEVE+ALGINSYYSK  L  A  ENIKV RHPDHAR
Sbjct  635   DYWRLDKILLRKAEQGVRVFVLLYKEVEMALGINSYYSKSTL--AKHENIKVMRHPDHAR  692

Query  489   VGIFLWAHHEKIVVVDQTVAFVGGIDLCYGRWDTEEHRLTDLGST----------HQSSI  538
              GI LWAHHEKIVV+DQT AF+GGIDLCYGRWD   HRLTDLGS              S+
Sbjct  693   GGILLWAHHEKIVVIDQTYAFMGGIDLCYGRWDDHHHRLTDLGSISTSSFSGSTRRTPSL  752

Query  539   YIP---TKGKITNTSSKRIVAVRT---DKHVILPLAIATNTILMATTGCLPVIPMPGKCI  592
             Y     T     +  S R     T   ++    P      +I + T      + +P   +
Sbjct  753   YFTKDDTDSAFGSRKSSRNAHYDTSAKERPPSPPPDEPNTSIELKTLKPGDRLLIPSTLV  812

Query  593   SSSSQPDFSSSTLLIPSKETQVFKCNTPDSQKKNLINM--------ARTTVDRVKQNVKI  644
             SS  +    S   L      +  K NTP+ ++KN+++         AR   D + +    
Sbjct  813   SSPGETPAESGIAL------EGMKLNTPEMERKNVLDRLKNNAMKGARMGKDFMHRLTAT  866

Query  645   KRQELINMVYNPNEMDNSSDSEDEIDNVVIREPVDVEGVLKNNADILSGLPGAAKLWLGK  704
             + +E    VY   E + ++D E  ++     + V    +  ++  ILS   G AK W GK
Sbjct  867   ETEEKSAEVYTI-ESEEATDHEVNLNMASGGQEV---AITTSSTQILSEFCGQAKYWFGK  922

Query  705   DYMNLIVKDFYDLERPYHDLVDRSTTPRMPWHDIGVMVQGAAARDIARHFIQRWNAIKME  764
             DY N I+KD+ +L  P+ D++DR+TTPRMPWHD+G+ V G +ARD+ARHFIQRWNA+K+E
Sbjct  923   DYSNFILKDWMNLNSPFVDIIDRTTTPRMPWHDVGLCVVGTSARDVARHFIQRWNAMKLE  982

Query  765   KAKLNKAYPFLLPKSYRDCSSNTPFISSKLIHNVKCQVLRSVSSWSAGFLESDAVEESIH  824
             K + N  +P+L+PKSY     N P I       V CQ+LRSVS+WS GF+E+D VE+SIH
Sbjct  983   KLRDNTRFPYLMPKSYHQVRLN-PNIQQNRQQRVTCQLLRSVSAWSCGFIEADLVEQSIH  1041

Query  825   EAYIEAITNSEKFIYIENQFFITL-----ATMERSTVKNRIGETLLKRILRAHREGSVFR  879
             +AYI+ IT ++ ++YIENQFFIT+          + V+N+IGETL KRI+RAH+E   FR
Sbjct  1042  DAYIQTITKAQHYVYIENQFFITMQLGMGVPGAYNNVRNQIGETLFKRIVRAHKERKPFR  1101

Query  880   VYVIMPLLPGFEGEVGGSSGTALHAITHWNYQSISRGRCSILNRLIESGVENPSEYITFH  939
             VYVIMPLLPGFEG+VGGS+G A+ AITHWNY SISRGR SIL RL E+G+ NP  YI+FH
Sbjct  1102  VYVIMPLLPGFEGDVGGSTGIAVRAITHWNYASISRGRTSILTRLQEAGIANPENYISFH  1161

Query  940   GLRTHSILNGTMVTELIYVHSKLMIVDDKIVICGSANINDRSMIATRDSEIAVIIHDEEF  999
              LR HS LN T +TELIYVHSKL+I DD++VICGSANINDRSMI  RDSEIA I+ DEEF
Sbjct  1162  SLRNHSFLNNTPITELIYVHSKLLIADDRVVICGSANINDRSMIGKRDSEIAAILMDEEF  1221

Query  1000  EEGKMNSTPYPCGKFVGSLRKQLFREHLGLL----CYPRTINIDDVIDKSFYYELWKARS  1055
             E+G+MN   YP G F G LRK LF+EHLGLL         ++I+D + + F++  W+  S
Sbjct  1222  EDGRMNGKKYPSGVFAGRLRKYLFKEHLGLLESEGSSRSDLDINDPVCEKFWHGTWRRIS  1281

Query  1056  KDNTEIFEKVFKCIPSDEATDFITLKNYQNSIPLSISDPIIAQEMLTNVKGHLVDLPLEF  1115
               NTEI+++VFKCIP+D    F +L+ YQ   PL+ + P +A     +++G+LVDLPLEF
Sbjct  1282  MQNTEIYDEVFKCIPTDFVKTFASLRKYQEEPPLAKTAPDLAANRANDIQGYLVDLPLEF  1341

Query  1116  LRDEVLTPGVNTVEGMMPTSLWT  1138
             L  EVLTP   + EG++PTS+WT
Sbjct  1342  LNKEVLTPPGTSKEGLIPTSVWT  1364



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933647.1 40S ribosomal protein S16 [Chelonus insularis]

Length=148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS16_DROME  unnamed protein product                                   271     5e-95
RS16_CAEEL  unnamed protein product                                   222     6e-76
RS16_DICDI  unnamed protein product                                   195     5e-65


>RS16_DROME unnamed protein product
Length=148

 Score = 271 bits (692),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 129/148 (87%), Positives = 144/148 (97%), Gaps = 0/148 (0%)

Query  1    MQKKQKEPIHSVQVFGRKKSATAVAYCKRGRGILRVNGRPLELIEPRVLQYKLQEPILLL  60
            MQ+K++EP+ +VQVFGRKK+ATAVAYCKRG G+L+VNGRPLE IEP+VLQYKLQEP+LLL
Sbjct  1    MQQKRREPVQAVQVFGRKKTATAVAYCKRGNGLLKVNGRPLEQIEPKVLQYKLQEPLLLL  60

Query  61   GKEKFSGVDIRVRVNGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEVKDILIQYDRT  120
            GKEKF+GVDIRVRV+GGGHVAQIYAIRQAISKALVA+YQKYVDEASKKE+KDIL+QYDRT
Sbjct  61   GKEKFAGVDIRVRVSGGGHVAQIYAIRQAISKALVAFYQKYVDEASKKEIKDILVQYDRT  120

Query  121  LLVADPRRCEPKKFGGPGARARYQKSYR  148
            LLV DPRRCEPKKFGGPGARARYQKSYR
Sbjct  121  LLVGDPRRCEPKKFGGPGARARYQKSYR  148


>RS16_CAEEL unnamed protein product
Length=144

 Score = 222 bits (566),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 127/140 (91%), Gaps = 0/140 (0%)

Query  9    IHSVQVFGRKKSATAVAYCKRGRGILRVNGRPLELIEPRVLQYKLQEPILLLGKEKFSGV  68
            + SVQ FGRKK+ATAVA+CK+G+G+++VNGRPLE +EP++L+ KLQEP+LL+GKE+F  V
Sbjct  5    VQSVQTFGRKKTATAVAHCKKGQGLIKVNGRPLEFLEPQILRIKLQEPLLLVGKERFQDV  64

Query  69   DIRVRVNGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEVKDILIQYDRTLLVADPRR  128
            DIR+RV+GGGHVAQIYA+RQA++KALVAYY KYVDE SK+E+K+I   YD++LLVADPRR
Sbjct  65   DIRIRVSGGGHVAQIYAVRQALAKALVAYYHKYVDEQSKRELKNIFAAYDKSLLVADPRR  124

Query  129  CEPKKFGGPGARARYQKSYR  148
             E KKFGGPGARARYQKSYR
Sbjct  125  RESKKFGGPGARARYQKSYR  144


>RS16_DICDI unnamed protein product
Length=147

 Score = 195 bits (495),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)

Query  12   VQVFGRKKSATAVAYCKRGRGILRVNGRPLELIEPRVLQYKLQEPILLLGKEKFSGVDIR  71
            VQ  G+K++A AVAY   G+G+++VNG PLE I+P+ L+ K+ EP+L++GK+ FS VDIR
Sbjct  11   VQTHGKKRTAVAVAYATNGKGLIKVNGVPLEFIQPKNLKLKVYEPVLIVGKDVFSQVDIR  70

Query  72   VRVNGGGHVAQIYAIRQAISKALVAYYQKYVDEASKKEVKDILIQYDRTLLVADPRRCEP  131
            VRV GGG VAQIYAIRQAI+K++VAY+QKYVDE SK E+K  ++ YDR+LLVADPRRCEP
Sbjct  71   VRVRGGGSVAQIYAIRQAIAKSIVAYHQKYVDEESKNEIKKKILDYDRSLLVADPRRCEP  130

Query  132  KKFGGPGARARYQKSYR  148
            KKFGG GARAR+QKSYR
Sbjct  131  KKFGGRGARARFQKSYR  147



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933648.1 putative ankyrin repeat protein RF_0381 [Chelonus
insularis]

Length=895
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SWY2_DROME  unnamed protein product                                 198     2e-52
M9PHP8_DROME  unnamed protein product                                 198     4e-52
Q9NCP8_DROME  unnamed protein product                                 197     6e-52


>Q8SWY2_DROME unnamed protein product
Length=1009

 Score = 198 bits (504),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 160/588 (27%), Positives = 271/588 (46%), Gaps = 61/588 (10%)

Query  150  NKVDCLLLCRAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNG  209
             KV    L  A K+ D+K   + L+ + + +  +++  TPLH+A   G  ++ +LLI  G
Sbjct  19   GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKG  78

Query  210  ADVNASNEHRRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVN  269
            ADVN S +H   PLH A     + +  +L++    +  K  +  TPLH A  +G+ + V+
Sbjct  79   ADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVD  138

Query  270  ILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSR  329
            +LL+RGA  + K     APLH+A +  ++D  +  L     ++       T LHV+    
Sbjct  139  MLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCG  198

Query  330  KKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLH  389
               +  LL+   AD NA       PLH A K+  LK+++ LL++  +       G TPLH
Sbjct  199  HVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLH  258

Query  390  LAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSC  449
            +A     ++ V   L+   +  +      TPLHLAA     D+I++ L N    +     
Sbjct  259  VAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARARE  318

Query  450  NQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIITLLEKGADLNFQDKGGNT  509
             QTPLH+             R GN             +  ++ LL+ GA ++   K   T
Sbjct  319  QQTPLHIAS-----------RLGN-------------VDIVMLLLQHGAQVDATTKDMYT  354

Query  510  PYNNAVKNGRRILAKAFQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKA  569
              + A K G+  +A    E    NG  A+    + G   LH+T +  ++  K+ Q +++ 
Sbjct  355  ALHIAAKEGQDEVAAVLIE----NGA-ALDAATKKGFTPLHLTAKYGHI--KVAQLLLQK  407

Query  570  TSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYTERIEYLLRNKANINAVDNDMSTP  629
             +D+DA+ + G T LH+A   H ++  V              LL   A+ +A   +  TP
Sbjct  408  EADVDAQGKNGVTPLHVAC--HYNNQQV-----------ALLLLEKGASPHATAKNGHTP  454

Query  630  LHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYACMMDWRYSQSSSHRRKDVQSKII  689
            LH A R   + +   L+E GA      K G T LH +               ++  ++I 
Sbjct  455  LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSS--------------QEGHAEIS  500

Query  690  SILVKNGVSVNWDDKFGKTPLHYVVEENDDTSFYLYQLLLQNGADINI  737
            ++L+++  +VN   K G TP+H   +E++     + ++L +NGA+I++
Sbjct  501  NLLIEHKAAVNHPAKNGLTPMHLCAQEDN---VNVAEILEKNGANIDM  545


 Score = 179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 133/506 (26%), Positives = 217/506 (43%), Gaps = 77/506 (15%)

Query  166  MKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHRRVPLHS  225
            +++ K+ L+ N D NAR     TPLH+A       VV+LL+ +GA ++A+ E    PLH 
Sbjct  200  VRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHV  259

Query  226  AVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANCNLKDSCK  285
            A       I   L+++ A  +       TPLH A      + + ILL+ GA  + +   +
Sbjct  260  AAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQ  319

Query  286  NAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVN  345
              PLH+A    N+D++   L     ++A      T LH++ K  +  +  +LI NGA ++
Sbjct  320  QTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALD  379

Query  346  ASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLK  405
            A+ K+   PLH   K  ++K+   LL+ + + D Q + G TPLH+A    N     + L+
Sbjct  380  AATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  439

Query  406  KGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHIKT  465
            KG +         TPLH+AA +  +D+    L+     N  +    TPLH+  Q      
Sbjct  440  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQ------  493

Query  466  YGYRRFGNRSLGDGPRNTEFYLPFIITLLEKGADLNFQDKGGNTPYNNAVKNGRRILAKA  525
             G+    N                   L+E  A +N   K G TP               
Sbjct  494  EGHAEISN------------------LLIEHKAAVNHPAKNGLTP---------------  520

Query  526  FQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKATSDIDAKDERGRTALH  585
                                   +H+  +  NV   + + + K  ++ID   + G T LH
Sbjct  521  -----------------------MHLCAQEDNV--NVAEILEKNGANIDMATKAGYTPLH  555

Query  586  IATINHLDSSTVHHSHKFLYTERIEYLLRNKANINAVDNDMSTPLHHACRNKNVHVVEYL  645
            +A            SH F     + +LL+N AN++A  +   TPLH   +  + H+V  L
Sbjct  556  VA------------SH-FGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLL  602

Query  646  IEKGADPRIRDKDGKTVLHYACMMDW  671
            +E  A+   +  +G+T LH A  + +
Sbjct  603  LEHKANANAQTVNGQTPLHIARKLGY  628


 Score = 152 bits (384),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 157/337 (47%), Gaps = 33/337 (10%)

Query  160  AIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHR  219
            A +     +I++ L     ++AR    +TPLH+A  LG  D+V LL+ +GA V+A+ +  
Sbjct  293  AARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDM  352

Query  220  RVPLHSAVINANSTIFDILIKNQAKLN----------------------------EKDDE  251
               LH A       +  +LI+N A L+                            E D +
Sbjct  353  YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD  412

Query  252  AR-----TPLHYAVDTGNMEFVNILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLN  306
            A+     TPLH A    N +   +LL++GA+ +      + PLH+A  +N +D+    L 
Sbjct  413  AQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE  472

Query  307  FNLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKI  366
            +    NA + AG TPLH+S +     I +LLI + A VN   K    P+H   +E N+ +
Sbjct  473  YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNV  532

Query  367  LDTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAE  426
             + L KN  N D   + G TPLH+A      + V   L+ G N     +   TPLH  A+
Sbjct  533  AEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQ  592

Query  427  RMHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHI  463
            + H  ++ + L++  + N      QTPLH+  +L +I
Sbjct  593  QGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYI  629


 Score = 142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 122/490 (25%), Positives = 213/490 (43%), Gaps = 44/490 (9%)

Query  102  IIHIDTKNESDCHYLFEKSIEDNCTVIFAMKLMI---VDANDSSRQLVLYLNKVDCLLLC  158
            + H    +E    YL    +  +C  +   KL++    DAN  +      LN    L + 
Sbjct  174  LYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA------LNGFTPLHI-  226

Query  159  RAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEH  218
             A K+  +K++++ L     I+A  E+  TPLHVA  +G  ++V  L+ + A  +     
Sbjct  227  -ACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVR  285

Query  219  RRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANC  278
               PLH A     + I  IL++N A+++ +  E +TPLH A   GN++ V +LL+ GA  
Sbjct  286  GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV  345

Query  279  NLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLLI  338
            +         LH+A ++   ++    +     ++A    G TPLH++ K     +  LL+
Sbjct  346  DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL  405

Query  339  SNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLHLAVGAENLD  398
               ADV+A  K    PLH A    N ++   LL+   +     + G TPLH+A     +D
Sbjct  406  QKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMD  465

Query  399  AVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSCNQTPLHVID  458
                 L+ G           TPLHL+++  H ++  + +++    N       TP+H+  
Sbjct  466  IATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCA  525

Query  459  QLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIITLLEK-GADLNFQDKGGNTPYNNAVKN  517
            Q  ++                          +  +LEK GA+++   K G TP + A   
Sbjct  526  QEDNVN-------------------------VAEILEKNGANIDMATKAGYTPLHVASHF  560

Query  518  GRRILAKAFQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKATSDIDAKD  577
            G+  + +   +    NG   V      G   LH T +  +    I+  +++  ++ +A+ 
Sbjct  561  GQANMVRFLLQ----NGA-NVDAATSIGYTPLHQTAQQGHCH--IVNLLLEHKANANAQT  613

Query  578  ERGRTALHIA  587
              G+T LHIA
Sbjct  614  VNGQTPLHIA  623


 Score = 112 bits (279),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 124/497 (25%), Positives = 206/497 (41%), Gaps = 91/497 (18%)

Query  263  GNMEFVNILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPL  322
            G+ + V +LL+     + +   +   LH+A +++++      L+ + + +  + +G TPL
Sbjct  4    GHDKVVAVLLE----SDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPL  59

Query  323  HVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDR  382
            H++     +NI +LLI  GADVN S K            +N+                  
Sbjct  60   HIASHYGNQNIANLLIQKGADVNYSAK------------HNI------------------  89

Query  383  EGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVD  442
               +PLH+A      + V + L+KG N +       TPLH AA   H  ++ + L+    
Sbjct  90   ---SPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAP  146

Query  443  PNIVNSCNQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIIT----------  492
             +        PLH+  Q  H+       + +R+  D    T  YL  +            
Sbjct  147  ISAKTKNGLAPLHMAAQGEHVDAARILLY-HRAPVD--EVTVDYLTALHVAAHCGHVRVA  203

Query  493  --LLEKGADLNFQDKGGNTPYNNAVKNGR-RILAKAFQECECINGVIAVKNKAQSGKFTL  549
              LL++ AD N +   G TP + A K  R +++    +    I+         +SG   L
Sbjct  204  KLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT------ESGLTPL  257

Query  550  HVTLETSNVEMKIIQCIVKATSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYTERI  609
            HV        M I+  +++  +  D    RG T LH+A              +   T+ I
Sbjct  258  HVAAFMGC--MNIVIYLLQHDASPDVPTVRGETPLHLAA-------------RANQTDII  302

Query  610  EYLLRNKANINAVDNDMSTPLHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYACMM  669
              LLRN A ++A   +  TPLH A R  NV +V  L++ GA      KD  T LH A   
Sbjct  303  RILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA--  360

Query  670  DWRYSQSSSHRRKDVQSKIISILVKNGVSVNWDDKFGKTPLHYVVEENDDTSFYLYQLLL  729
                        K+ Q ++ ++L++NG +++   K G TPLH   +        + QLLL
Sbjct  361  ------------KEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH---IKVAQLLL  405

Query  730  QNGADINIEDNDRDTAF  746
            Q  AD++ +  +  T  
Sbjct  406  QKEADVDAQGKNGVTPL  422


 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 87/178 (49%), Gaps = 0/178 (0%)

Query  160  AIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHR  219
            A ++  M +    L +    NA ++A  TPLH++   G +++ +LLI + A VN   ++ 
Sbjct  458  AARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG  517

Query  220  RVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANCN  279
              P+H      N  + +IL KN A ++       TPLH A   G    V  LL+ GAN +
Sbjct  518  LTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD  577

Query  280  LKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLL  337
               S    PLH   +Q +  ++   L    + NA+   G+TPLH++ K    +++D L
Sbjct  578  AATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL  635


>M9PHP8_DROME unnamed protein product
Length=1309

 Score = 198 bits (504),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 160/588 (27%), Positives = 271/588 (46%), Gaps = 61/588 (10%)

Query  150  NKVDCLLLCRAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNG  209
             KV    L  A K+ D+K   + L+ + + +  +++  TPLH+A   G  ++ +LLI  G
Sbjct  319  GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKG  378

Query  210  ADVNASNEHRRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVN  269
            ADVN S +H   PLH A     + +  +L++    +  K  +  TPLH A  +G+ + V+
Sbjct  379  ADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVD  438

Query  270  ILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSR  329
            +LL+RGA  + K     APLH+A +  ++D  +  L     ++       T LHV+    
Sbjct  439  MLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCG  498

Query  330  KKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLH  389
               +  LL+   AD NA       PLH A K+  LK+++ LL++  +       G TPLH
Sbjct  499  HVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLH  558

Query  390  LAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSC  449
            +A     ++ V   L+   +  +      TPLHLAA     D+I++ L N    +     
Sbjct  559  VAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARARE  618

Query  450  NQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIITLLEKGADLNFQDKGGNT  509
             QTPLH+             R GN             +  ++ LL+ GA ++   K   T
Sbjct  619  QQTPLHIAS-----------RLGN-------------VDIVMLLLQHGAQVDATTKDMYT  654

Query  510  PYNNAVKNGRRILAKAFQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKA  569
              + A K G+  +A    E    NG  A+    + G   LH+T +  ++  K+ Q +++ 
Sbjct  655  ALHIAAKEGQDEVAAVLIE----NGA-ALDAATKKGFTPLHLTAKYGHI--KVAQLLLQK  707

Query  570  TSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYTERIEYLLRNKANINAVDNDMSTP  629
             +D+DA+ + G T LH+A   H ++  V              LL   A+ +A   +  TP
Sbjct  708  EADVDAQGKNGVTPLHVAC--HYNNQQV-----------ALLLLEKGASPHATAKNGHTP  754

Query  630  LHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYACMMDWRYSQSSSHRRKDVQSKII  689
            LH A R   + +   L+E GA      K G T LH +               ++  ++I 
Sbjct  755  LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSS--------------QEGHAEIS  800

Query  690  SILVKNGVSVNWDDKFGKTPLHYVVEENDDTSFYLYQLLLQNGADINI  737
            ++L+++  +VN   K G TP+H   +E++     + ++L +NGA+I++
Sbjct  801  NLLIEHKAAVNHPAKNGLTPMHLCAQEDN---VNVAEILEKNGANIDM  845


 Score = 184 bits (468),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 164/620 (26%), Positives = 263/620 (42%), Gaps = 96/620 (15%)

Query  159  RAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEH  218
            RA +  +++ +  +L  N+DIN  N      LH+A   G   VV  L+  GA V+++ + 
Sbjct  167  RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKK  226

Query  219  RRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANC  278
                LH A +     +  +L+++ A +N +     TPL+ A    +   V +LL  GAN 
Sbjct  227  GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ  286

Query  279  NLKDSCKNAPLHLAVEQNNLDMIKAFL-------------------------------NF  307
            +L       PL +A++Q +  ++   L                               + 
Sbjct  287  SLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH  346

Query  308  NLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKIL  367
            N D+ ++  +G TPLH++     +NI +LLI  GADVN S K    PLH A K     ++
Sbjct  347  NPDVTSK--SGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMV  404

Query  368  DTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAER  427
              LL+   N + + R+G TPLH A  + +   VDM L++G            PLH+AA+ 
Sbjct  405  SLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQG  464

Query  428  MHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYL  487
             H+D  ++ L +    + V     T LHV     H++                       
Sbjct  465  EHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKL-------------------  505

Query  488  PFIITLLEKGADLNFQDKGGNTPYNNAVKNGR-RILAKAFQECECINGVIAVKNKAQSGK  546
                 LL++ AD N +   G TP + A K  R +++    +    I+         +SG 
Sbjct  506  -----LLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT------ESGL  554

Query  547  FTLHVTLETSNVEMKIIQCIVKATSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYT  606
              LHV        M I+  +++  +  D    RG T LH+A              +   T
Sbjct  555  TPLHVAAFMGC--MNIVIYLLQHDASPDVPTVRGETPLHLAA-------------RANQT  599

Query  607  ERIEYLLRNKANINAVDNDMSTPLHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYA  666
            + I  LLRN A ++A   +  TPLH A R  NV +V  L++ GA      KD  T LH A
Sbjct  600  DIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIA  659

Query  667  CMMDWRYSQSSSHRRKDVQSKIISILVKNGVSVNWDDKFGKTPLHYVVEENDDTSFYLYQ  726
                           K+ Q ++ ++L++NG +++   K G TPLH   +        + Q
Sbjct  660  A--------------KEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH---IKVAQ  702

Query  727  LLLQNGADINIEDNDRDTAF  746
            LLLQ  AD++ +  +  T  
Sbjct  703  LLLQKEADVDAQGKNGVTPL  722


 Score = 178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 138/538 (26%), Positives = 227/538 (42%), Gaps = 83/538 (15%)

Query  140  DSSRQLVLYLNKVD------CLLLCRAIKEKDMKMIKMYLNFNLDINARNEASETPLHVA  193
            D++R L+ +   VD         L  A     +++ K+ L+ N D NAR     TPLH+A
Sbjct  468  DAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIA  527

Query  194  VDLGMSDVVDLLISNGADVNASNEHRRVPLHSAVINANSTIFDILIKNQAKLNEKDDEAR  253
                   VV+LL+ +GA ++A+ E    PLH A       I   L+++ A  +       
Sbjct  528  CKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGE  587

Query  254  TPLHYAVDTGNMEFVNILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINA  313
            TPLH A      + + ILL+ GA  + +   +  PLH+A    N+D++   L     ++A
Sbjct  588  TPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDA  647

Query  314  RNNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKN  373
                  T LH++ K  +  +  +LI NGA ++A+ K+   PLH   K  ++K+   LL+ 
Sbjct  648  TTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQK  707

Query  374  QVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMI  433
            + + D Q + G TPLH+A    N     + L+KG +         TPLH+AA +  +D+ 
Sbjct  708  EADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIA  767

Query  434  KVFLDNNVDPNIVNSCNQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIITL  493
               L+     N  +    TPLH+  Q       G+    N                   L
Sbjct  768  TTLLEYGALANAESKAGFTPLHLSSQ------EGHAEISN------------------LL  803

Query  494  LEKGADLNFQDKGGNTPYNNAVKNGRRILAKAFQECECINGVIAVKNKAQSGKFTLHVTL  553
            +E  A +N   K G TP                                      +H+  
Sbjct  804  IEHKAAVNHPAKNGLTP--------------------------------------MHLCA  825

Query  554  ETSNVEMKIIQCIVKATSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYTERIEYLL  613
            +  NV   + + + K  ++ID   + G T LH+A+              F     + +LL
Sbjct  826  QEDNV--NVAEILEKNGANIDMATKAGYTPLHVAS-------------HFGQANMVRFLL  870

Query  614  RNKANINAVDNDMSTPLHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYACMMDW  671
            +N AN++A  +   TPLH   +  + H+V  L+E  A+   +  +G+T LH A  + +
Sbjct  871  QNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGY  928


 Score = 152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 157/337 (47%), Gaps = 33/337 (10%)

Query  160  AIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHR  219
            A +     +I++ L     ++AR    +TPLH+A  LG  D+V LL+ +GA V+A+ +  
Sbjct  593  AARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDM  652

Query  220  RVPLHSAVINANSTIFDILIKNQAKLN----------------------------EKDDE  251
               LH A       +  +LI+N A L+                            E D +
Sbjct  653  YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD  712

Query  252  AR-----TPLHYAVDTGNMEFVNILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLN  306
            A+     TPLH A    N +   +LL++GA+ +      + PLH+A  +N +D+    L 
Sbjct  713  AQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE  772

Query  307  FNLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKI  366
            +    NA + AG TPLH+S +     I +LLI + A VN   K    P+H   +E N+ +
Sbjct  773  YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNV  832

Query  367  LDTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAE  426
             + L KN  N D   + G TPLH+A      + V   L+ G N     +   TPLH  A+
Sbjct  833  AEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQ  892

Query  427  RMHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHI  463
            + H  ++ + L++  + N      QTPLH+  +L +I
Sbjct  893  QGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYI  929


 Score = 142 bits (359),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/478 (25%), Positives = 210/478 (44%), Gaps = 46/478 (10%)

Query  115  YLFEKSIEDNCTVIFAMKLMI---VDANDSSRQLVLYLNKVDCLLLCRAIKEKDMKMIKM  171
            YL    +  +C  +   KL++    DAN  +      LN    L +  A K+  +K++++
Sbjct  487  YLTALHVAAHCGHVRVAKLLLDRNADANARA------LNGFTPLHI--ACKKNRLKVVEL  538

Query  172  YLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHRRVPLHSAVINAN  231
             L     I+A  E+  TPLHVA  +G  ++V  L+ + A  +        PLH A     
Sbjct  539  LLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQ  598

Query  232  STIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANCNLKDSCKNAPLHL  291
            + I  IL++N A+++ +  E +TPLH A   GN++ V +LL+ GA  +         LH+
Sbjct  599  TDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHI  658

Query  292  AVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQR  351
            A ++   ++    +     ++A    G TPLH++ K     +  LL+   ADV+A  K  
Sbjct  659  AAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNG  718

Query  352  QVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYK  411
              PLH A    N ++   LL+   +     + G TPLH+A     +D     L+ G    
Sbjct  719  VTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALAN  778

Query  412  LIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHIKTYGYRRF  471
                   TPLHL+++  H ++  + +++    N       TP+H+  Q  ++        
Sbjct  779  AESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVN-------  831

Query  472  GNRSLGDGPRNTEFYLPFIITLLEK-GADLNFQDKGGNTPYNNAVKNGRRILAK-AFQEC  529
                              +  +LEK GA+++   K G TP + A   G+  + +   Q  
Sbjct  832  ------------------VAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNG  873

Query  530  ECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKATSDIDAKDERGRTALHIA  587
              ++   ++      G   LH T +  +    I+  +++  ++ +A+   G+T LHIA
Sbjct  874  ANVDAATSI------GYTPLHQTAQQGHCH--IVNLLLEHKANANAQTVNGQTPLHIA  923


 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 87/178 (49%), Gaps = 0/178 (0%)

Query  160  AIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHR  219
            A ++  M +    L +    NA ++A  TPLH++   G +++ +LLI + A VN   ++ 
Sbjct  758  AARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG  817

Query  220  RVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANCN  279
              P+H      N  + +IL KN A ++       TPLH A   G    V  LL+ GAN +
Sbjct  818  LTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD  877

Query  280  LKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLL  337
               S    PLH   +Q +  ++   L    + NA+   G+TPLH++ K    +++D L
Sbjct  878  AATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL  935


>Q9NCP8_DROME unnamed protein product
Length=1159

 Score = 197 bits (502),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 160/588 (27%), Positives = 271/588 (46%), Gaps = 61/588 (10%)

Query  150  NKVDCLLLCRAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNG  209
             KV    L  A K+ D+K   + L+ + + +  +++  TPLH+A   G  ++ +LLI  G
Sbjct  169  GKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKG  228

Query  210  ADVNASNEHRRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVN  269
            ADVN S +H   PLH A     + +  +L++    +  K  +  TPLH A  +G+ + V+
Sbjct  229  ADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVD  288

Query  270  ILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSR  329
            +LL+RGA  + K     APLH+A +  ++D  +  L     ++       T LHV+    
Sbjct  289  MLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCG  348

Query  330  KKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLH  389
               +  LL+   AD NA       PLH A K+  LK+++ LL++  +       G TPLH
Sbjct  349  HVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLH  408

Query  390  LAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSC  449
            +A     ++ V   L+   +  +      TPLHLAA     D+I++ L N    +     
Sbjct  409  VAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARARE  468

Query  450  NQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIITLLEKGADLNFQDKGGNT  509
             QTPLH+             R GN             +  ++ LL+ GA ++   K   T
Sbjct  469  QQTPLHIAS-----------RLGN-------------VDIVMLLLQHGAQVDATTKDMYT  504

Query  510  PYNNAVKNGRRILAKAFQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKA  569
              + A K G+  +A    E    NG  A+    + G   LH+T +  ++  K+ Q +++ 
Sbjct  505  ALHIAAKEGQDEVAAVLIE----NGA-ALDAATKKGFTPLHLTAKYGHI--KVAQLLLQK  557

Query  570  TSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYTERIEYLLRNKANINAVDNDMSTP  629
             +D+DA+ + G T LH+A   H ++  V              LL   A+ +A   +  TP
Sbjct  558  EADVDAQGKNGVTPLHVAC--HYNNQQV-----------ALLLLEKGASPHATAKNGHTP  604

Query  630  LHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYACMMDWRYSQSSSHRRKDVQSKII  689
            LH A R   + +   L+E GA      K G T LH +               ++  ++I 
Sbjct  605  LHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSS--------------QEGHAEIS  650

Query  690  SILVKNGVSVNWDDKFGKTPLHYVVEENDDTSFYLYQLLLQNGADINI  737
            ++L+++  +VN   K G TP+H   +E++     + ++L +NGA+I++
Sbjct  651  NLLIEHKAAVNHPAKNGLTPMHLCAQEDN---VNVAEILEKNGANIDM  695


 Score = 184 bits (468),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 165/618 (27%), Positives = 263/618 (43%), Gaps = 92/618 (15%)

Query  159  RAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEH  218
            RA +  +++ +  +L  N+DIN  N      LH+A   G   VV  L+  GA V+++ + 
Sbjct  17   RAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKK  76

Query  219  RRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANC  278
                LH A +     +  +L+++ A +N +     TPL+ A    +   V +LL  GAN 
Sbjct  77   GNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQ  136

Query  279  NLKDSCKNAPLHLAVEQNNLDMIKAFLNFN---------LDINAR---------------  314
            +L       PL +A++Q +  ++   L  +         L I A+               
Sbjct  137  SLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDH  196

Query  315  -----NNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKILDT  369
                 + +G TPLH++     +NI +LLI  GADVN S K    PLH A K     ++  
Sbjct  197  NPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSL  256

Query  370  LLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAERMH  429
            LL+   N + + R+G TPLH A  + +   VDM L++G            PLH+AA+  H
Sbjct  257  LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEH  316

Query  430  LDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHIKTYGYRRFGNRSLGDGPRNTEFYLPF  489
            +D  ++ L +    + V     T LHV     H++                         
Sbjct  317  VDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKL---------------------  355

Query  490  IITLLEKGADLNFQDKGGNTPYNNAVKNGR-RILAKAFQECECINGVIAVKNKAQSGKFT  548
               LL++ AD N +   G TP + A K  R +++    +    I+         +SG   
Sbjct  356  ---LLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATT------ESGLTP  406

Query  549  LHVTLETSNVEMKIIQCIVKATSDIDAKDERGRTALHIATINHLDSSTVHHSHKFLYTER  608
            LHV        M I+  +++  +  D    RG T LH+A              +   T+ 
Sbjct  407  LHVAAFMGC--MNIVIYLLQHDASPDVPTVRGETPLHLAA-------------RANQTDI  451

Query  609  IEYLLRNKANINAVDNDMSTPLHHACRNKNVHVVEYLIEKGADPRIRDKDGKTVLHYACM  668
            I  LLRN A ++A   +  TPLH A R  NV +V  L++ GA      KD  T LH A  
Sbjct  452  IRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAA-  510

Query  669  MDWRYSQSSSHRRKDVQSKIISILVKNGVSVNWDDKFGKTPLHYVVEENDDTSFYLYQLL  728
                         K+ Q ++ ++L++NG +++   K G TPLH   +        + QLL
Sbjct  511  -------------KEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH---IKVAQLL  554

Query  729  LQNGADINIEDNDRDTAF  746
            LQ  AD++ +  +  T  
Sbjct  555  LQKEADVDAQGKNGVTPL  572


 Score = 178 bits (452),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 133/506 (26%), Positives = 217/506 (43%), Gaps = 77/506 (15%)

Query  166  MKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHRRVPLHS  225
            +++ K+ L+ N D NAR     TPLH+A       VV+LL+ +GA ++A+ E    PLH 
Sbjct  350  VRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHV  409

Query  226  AVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANCNLKDSCK  285
            A       I   L+++ A  +       TPLH A      + + ILL+ GA  + +   +
Sbjct  410  AAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQ  469

Query  286  NAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVN  345
              PLH+A    N+D++   L     ++A      T LH++ K  +  +  +LI NGA ++
Sbjct  470  QTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALD  529

Query  346  ASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLK  405
            A+ K+   PLH   K  ++K+   LL+ + + D Q + G TPLH+A    N     + L+
Sbjct  530  AATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589

Query  406  KGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHIKT  465
            KG +         TPLH+AA +  +D+    L+     N  +    TPLH+  Q      
Sbjct  590  KGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQ------  643

Query  466  YGYRRFGNRSLGDGPRNTEFYLPFIITLLEKGADLNFQDKGGNTPYNNAVKNGRRILAKA  525
             G+    N                   L+E  A +N   K G TP               
Sbjct  644  EGHAEISN------------------LLIEHKAAVNHPAKNGLTP---------------  670

Query  526  FQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKATSDIDAKDERGRTALH  585
                                   +H+  +  NV   + + + K  ++ID   + G T LH
Sbjct  671  -----------------------MHLCAQEDNV--NVAEILEKNGANIDMATKAGYTPLH  705

Query  586  IATINHLDSSTVHHSHKFLYTERIEYLLRNKANINAVDNDMSTPLHHACRNKNVHVVEYL  645
            +A            SH F     + +LL+N AN++A  +   TPLH   +  + H+V  L
Sbjct  706  VA------------SH-FGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLL  752

Query  646  IEKGADPRIRDKDGKTVLHYACMMDW  671
            +E  A+   +  +G+T LH A  + +
Sbjct  753  LEHKANANAQTVNGQTPLHIARKLGY  778


 Score = 152 bits (383),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 157/337 (47%), Gaps = 33/337 (10%)

Query  160  AIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHR  219
            A +     +I++ L     ++AR    +TPLH+A  LG  D+V LL+ +GA V+A+ +  
Sbjct  443  AARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDM  502

Query  220  RVPLHSAVINANSTIFDILIKNQAKLN----------------------------EKDDE  251
               LH A       +  +LI+N A L+                            E D +
Sbjct  503  YTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVD  562

Query  252  AR-----TPLHYAVDTGNMEFVNILLKRGANCNLKDSCKNAPLHLAVEQNNLDMIKAFLN  306
            A+     TPLH A    N +   +LL++GA+ +      + PLH+A  +N +D+    L 
Sbjct  563  AQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLE  622

Query  307  FNLDINARNNAGETPLHVSVKSRKKNIVDLLISNGADVNASNKQRQVPLHSAVKEYNLKI  366
            +    NA + AG TPLH+S +     I +LLI + A VN   K    P+H   +E N+ +
Sbjct  623  YGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNV  682

Query  367  LDTLLKNQVNFDKQDREGQTPLHLAVGAENLDAVDMFLKKGVNYKLIDAWDRTPLHLAAE  426
             + L KN  N D   + G TPLH+A      + V   L+ G N     +   TPLH  A+
Sbjct  683  AEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQ  742

Query  427  RMHLDMIKVFLDNNVDPNIVNSCNQTPLHVIDQLIHI  463
            + H  ++ + L++  + N      QTPLH+  +L +I
Sbjct  743  QGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYI  779


 Score = 141 bits (355),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 122/490 (25%), Positives = 213/490 (43%), Gaps = 44/490 (9%)

Query  102  IIHIDTKNESDCHYLFEKSIEDNCTVIFAMKLMI---VDANDSSRQLVLYLNKVDCLLLC  158
            + H    +E    YL    +  +C  +   KL++    DAN  +      LN    L + 
Sbjct  324  LYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARA------LNGFTPLHI-  376

Query  159  RAIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEH  218
             A K+  +K++++ L     I+A  E+  TPLHVA  +G  ++V  L+ + A  +     
Sbjct  377  -ACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVR  435

Query  219  RRVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANC  278
               PLH A     + I  IL++N A+++ +  E +TPLH A   GN++ V +LL+ GA  
Sbjct  436  GETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQV  495

Query  279  NLKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLLI  338
            +         LH+A ++   ++    +     ++A    G TPLH++ K     +  LL+
Sbjct  496  DATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLL  555

Query  339  SNGADVNASNKQRQVPLHSAVKEYNLKILDTLLKNQVNFDKQDREGQTPLHLAVGAENLD  398
               ADV+A  K    PLH A    N ++   LL+   +     + G TPLH+A     +D
Sbjct  556  QKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMD  615

Query  399  AVDMFLKKGVNYKLIDAWDRTPLHLAAERMHLDMIKVFLDNNVDPNIVNSCNQTPLHVID  458
                 L+ G           TPLHL+++  H ++  + +++    N       TP+H+  
Sbjct  616  IATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCA  675

Query  459  QLIHIKTYGYRRFGNRSLGDGPRNTEFYLPFIITLLEK-GADLNFQDKGGNTPYNNAVKN  517
            Q  ++                          +  +LEK GA+++   K G TP + A   
Sbjct  676  QEDNVN-------------------------VAEILEKNGANIDMATKAGYTPLHVASHF  710

Query  518  GRRILAKAFQECECINGVIAVKNKAQSGKFTLHVTLETSNVEMKIIQCIVKATSDIDAKD  577
            G+  + +   +    NG   V      G   LH T +  +    I+  +++  ++ +A+ 
Sbjct  711  GQANMVRFLLQ----NGA-NVDAATSIGYTPLHQTAQQGHCH--IVNLLLEHKANANAQT  763

Query  578  ERGRTALHIA  587
              G+T LHIA
Sbjct  764  VNGQTPLHIA  773


 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 87/178 (49%), Gaps = 0/178 (0%)

Query  160  AIKEKDMKMIKMYLNFNLDINARNEASETPLHVAVDLGMSDVVDLLISNGADVNASNEHR  219
            A ++  M +    L +    NA ++A  TPLH++   G +++ +LLI + A VN   ++ 
Sbjct  608  AARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNG  667

Query  220  RVPLHSAVINANSTIFDILIKNQAKLNEKDDEARTPLHYAVDTGNMEFVNILLKRGANCN  279
              P+H      N  + +IL KN A ++       TPLH A   G    V  LL+ GAN +
Sbjct  668  LTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVD  727

Query  280  LKDSCKNAPLHLAVEQNNLDMIKAFLNFNLDINARNNAGETPLHVSVKSRKKNIVDLL  337
               S    PLH   +Q +  ++   L    + NA+   G+TPLH++ K    +++D L
Sbjct  728  AATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL  785



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933649.1 transmembrane protein 41B [Chelonus insularis]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TM41_DROME  unnamed protein product                                   305     3e-104
Q4GYC8_TRYB2  unnamed protein product                                 91.7    1e-21 
Q23419_CAEEL  unnamed protein product                                 33.1    0.23  


>TM41_DROME unnamed protein product
Length=320

 Score = 305 bits (782),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 196/247 (79%), Gaps = 0/247 (0%)

Query  14   DSTQDISTRRSLLTVVLIFLTSLAALCYVYANFPDLDESEKKYIKLPLHIEDAQNLGRVL  73
             + +  +T++SL+ V  IF+ SL  +CYVYA FP+L+ SEK+++K+P  I+DA+ L +VL
Sbjct  71   SADEKKATKKSLVIVAGIFVASLVTMCYVYAIFPELNASEKQHLKIPRDIQDAKMLAKVL  130

Query  74   ERYKQLYYLEVLTGLFITYIFLQTFAIPGSIFLSILSGFLFSFPLALLLVCTCSAIGASL  133
            +RYK +YY EV+ G+ + Y+FLQTFAIPGS+FLSIL GFL+ FP+AL L+C CSA+GA+L
Sbjct  131  DRYKDMYYFEVMFGVVVAYVFLQTFAIPGSLFLSILLGFLYKFPIALFLICFCSALGATL  190

Query  134  CYLLSSLLGRKLLFKYFPDRANQWSLTIEKHKNNLLNYIIFLRITPFLPNWFINLASPVI  193
            CY LS+L+GR+L+  ++P + ++WS  +E+++++L NY++FLR+TP LPNWFINLASPVI
Sbjct  191  CYTLSNLVGRRLIRHFWPKKTSEWSKHVEEYRDSLFNYMLFLRMTPILPNWFINLASPVI  250

Query  194  GVPMIPFIVGTFIGVAPPSFVAIQAGQTLNKLTSSSDAWSWTSIIILFIFALLSLVPVLF  253
            GVP+  F +GTF GVAPPS +AIQAG+TL K+TSSS+A+SWTS+ IL   A  SL+P L 
Sbjct  251  GVPLHIFALGTFCGVAPPSVIAIQAGKTLQKMTSSSEAFSWTSMGILMACACASLLPGLL  310

Query  254  KKSFRQK  260
            K  F+ K
Sbjct  311  KNKFKHK  317


>Q4GYC8_TRYB2 unnamed protein product
Length=295

 Score = 91.7 bits (226),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 92/185 (50%), Gaps = 10/185 (5%)

Query  68   NLGRVLERYKQLYYLEVLTGLFITYIFLQTFAIPGSIFLSILSGFLFSFPLALLLVCTCS  127
            +L R L    +     V+  L + Y+FLQ+F +PGS  ++   G +   PL +       
Sbjct  98   HLCRDLHELAETERARVMFVLTLVYVFLQSFCLPGSALINAAIGAVIGLPLGVPYCVLMG  157

Query  128  AIGASLCYLLSSLLGRKLLFKYFPDRANQ--WSLTIEKHKNNLLNYIIFLRITPFLPNWF  185
              GAS CY +S ++  +       +R  Q       E+  ++L  Y + LR+TP +PNW 
Sbjct  158  TAGASSCYTISHIIAGRC--NGHNNRLVQKLRKQVEERTPSDLFAYFLLLRLTPVVPNWL  215

Query  186  INLASPVIGVPMIPFIVGTFIGVAPPSFVAIQAGQTLNKLTSSSD----AWS--WTSIII  239
            +N+ASPV GVP+  +  GT IG+ P ++++++ G+      S  +     W   W  I+ 
Sbjct  216  LNMASPVAGVPLPTYAAGTLIGIIPQTYISVRFGEAALTTLSGEELMMTPWDMMWIGILC  275

Query  240  LFIFA  244
            + +FA
Sbjct  276  IVVFA  280


>Q23419_CAEEL unnamed protein product
Length=908

 Score = 33.1 bits (74),  Expect = 0.23, Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 29/67 (43%), Gaps = 14/67 (21%)

Query  78   QLYYLEVLTGLFITYIFLQTFA--IPGSIFLSILSGF-------LFSFPLALLLVC----  124
             L  LEV   LF    FL  F   +P SI+L+I   F       LF F LAL  +C    
Sbjct  789  HLRALEVDLSLFALSWFLTCFVDVLPHSIYLTIFDAFLYEGNKVLFRFALALFKICEPHV  848

Query  125  -TCSAIG  130
              C  IG
Sbjct  849  LQCKTIG  855



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933650.1 transmembrane protein 272-like [Chelonus insularis]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED13_DROME  unnamed protein product                                  35.0    0.062
Q27GU4_CAEEL  unnamed protein product                                 32.0    0.42 
PIRA_DICDI  unnamed protein product                                   30.0    2.3  


>MED13_DROME unnamed protein product
Length=2618

 Score = 35.0 bits (79),  Expect = 0.062, Method: Composition-based stats.
 Identities = 17/75 (23%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query  15   NNIINNTNIPSIIVPNITCPPPPPYPT---------------INLPPGHPASIINDRGAP  59
            N++  ++++P   V +   P P P+P                +N+ P  P S+ N +  P
Sbjct  586  NSLGGDSSMPVASVESPATPAPSPHPNSAHSQPTSVPPAEQLLNMSPHAPTSVSNLQQPP  645

Query  60   PSYEEVIDRNAPPPS  74
               + ++D+N P P+
Sbjct  646  TPIDHLLDKNTPAPT  660


>Q27GU4_CAEEL unnamed protein product
Length=348

 Score = 32.0 bits (71),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 35/71 (49%), Gaps = 3/71 (4%)

Query  191  WFIIGSMWVYKEYE-PNYDPSL--GKYCNKTLYLFAFWLITLVYIFLGILTVGLCCISVI  247
            W I+G +WVY      +++  +    YC+ T+Y  AF+  T   IF  ++   + C+ ++
Sbjct  275  WLILGCVWVYGSKAFVHFNEGMFERHYCDPTIYWSAFFACTAFLIFYCVIIFLVICLLIV  334

Query  248  TITFQSRPLDR  258
                +S   D+
Sbjct  335  GSVKESSSQDQ  345


>PIRA_DICDI unnamed protein product
Length=1336

 Score = 30.0 bits (66),  Expect = 2.3, Method: Composition-based stats.
 Identities = 13/31 (42%), Positives = 15/31 (48%), Gaps = 0/31 (0%)

Query  17    IINNTNIPSIIVPNITCPPPPPYPTINLPPG  47
             II + N     + N  CPPPPP   I  PP 
Sbjct  1212  IIKDINNQIFSILNTYCPPPPPSNMILSPPA  1242



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933651.1 probable ATP-dependent RNA helicase Dbp73D [Chelonus
insularis]

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VASA1_DROME  unnamed protein product                                  157     2e-40
M9PBB5_DROME  unnamed protein product                                 157     2e-40
DDX49_DROME  unnamed protein product                                  154     5e-40


>VASA1_DROME unnamed protein product
Length=661

 Score = 157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/379 (30%), Positives = 188/379 (50%), Gaps = 59/379 (16%)

Query  190  MQKCSEDRMKGWWVRDTCVSAPTGSGKTLAYVLPIIQYL-----KNQLTREIRCLIVVPV  244
            +QKCS   +     RD    A TGSGKT A++LPI+  L     + +L R  + +IV P 
Sbjct  271  IQKCSIPVISSG--RDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRP-QVVIVSPT  327

Query  245  QELAAQIYKVLTTYSTQSNLKIGLISGASTLEIEQKNLIKTTERGQFISRVDILVATPGR  304
            +ELA QI+     ++ +S LKIG++ G ++   + + + +            +++ATPGR
Sbjct  328  RELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCH---------VVIATPGR  378

Query  305  LIDHIERTNGFSLQSLEFLVIDEADRATDWLKFIPEYHHTPPYLTIKNLNSHPIKPAQKL  364
            L+D ++RT   + +   F+V+DEADR  D + F  +      ++T++          Q L
Sbjct  379  LLDFVDRTF-ITFEDTRFVVLDEADRMLD-MGFSEDMRRIMTHVTMR-------PEHQTL  429

Query  365  LFSATLSQDPEKLSRLS--LFNPILFTSVSGTNQTDEDIDLDNQMNKFIGKYTSPNELIE  422
            +FSAT    PE++ R++       +F ++        D+    Q    + KY   ++LIE
Sbjct  430  MFSATF---PEEIQRMAGEFLKNYVFVAIGIVGGACSDV---KQTIYEVNKYAKRSKLIE  483

Query  423  RAYESPPEYKPIVLYELIKQYQKPTDKILIFTNSGESAHRLAILLASFLEQLQINFNVSE  482
                        +L E         D  ++F  +     R A  LASFL + +  F  + 
Sbjct  484  ------------ILSE-------QADGTIVFVET----KRGADFLASFLSEKE--FPTTS  518

Query  483  LSAQLIPKQRAQILEKFRAGESRILVSSDALARGLDIHDIKLVVSYDLPKSVKGYIHRVG  542
            +    +  QR Q L  F+ G  ++L+++   +RGLDI +IK V++YD+P  +  Y+HR+G
Sbjct  519  IHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIG  578

Query  543  RTGRAGVSGTAISILTPNQ  561
            RTGR G +G A S   P +
Sbjct  579  RTGRVGNNGRATSFFDPEK  597


>M9PBB5_DROME unnamed protein product
Length=661

 Score = 157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 113/379 (30%), Positives = 188/379 (50%), Gaps = 59/379 (16%)

Query  190  MQKCSEDRMKGWWVRDTCVSAPTGSGKTLAYVLPIIQYL-----KNQLTREIRCLIVVPV  244
            +QKCS   +     RD    A TGSGKT A++LPI+  L     + +L R  + +IV P 
Sbjct  271  IQKCSIPVISSG--RDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRP-QVVIVSPT  327

Query  245  QELAAQIYKVLTTYSTQSNLKIGLISGASTLEIEQKNLIKTTERGQFISRVDILVATPGR  304
            +ELA QI+     ++ +S LKIG++ G ++   + + + +            +++ATPGR
Sbjct  328  RELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCH---------VVIATPGR  378

Query  305  LIDHIERTNGFSLQSLEFLVIDEADRATDWLKFIPEYHHTPPYLTIKNLNSHPIKPAQKL  364
            L+D ++RT   + +   F+V+DEADR  D + F  +      ++T++          Q L
Sbjct  379  LLDFVDRTF-ITFEDTRFVVLDEADRMLD-MGFSEDMRRIMTHVTMR-------PEHQTL  429

Query  365  LFSATLSQDPEKLSRLS--LFNPILFTSVSGTNQTDEDIDLDNQMNKFIGKYTSPNELIE  422
            +FSAT    PE++ R++       +F ++        D+    Q    + KY   ++LIE
Sbjct  430  MFSATF---PEEIQRMAGEFLKNYVFVAIGIVGGACSDV---KQTIYEVNKYAKRSKLIE  483

Query  423  RAYESPPEYKPIVLYELIKQYQKPTDKILIFTNSGESAHRLAILLASFLEQLQINFNVSE  482
                        +L E         D  ++F  +     R A  LASFL + +  F  + 
Sbjct  484  ------------ILSE-------QADGTIVFVET----KRGADFLASFLSEKE--FPTTS  518

Query  483  LSAQLIPKQRAQILEKFRAGESRILVSSDALARGLDIHDIKLVVSYDLPKSVKGYIHRVG  542
            +    +  QR Q L  F+ G  ++L+++   +RGLDI +IK V++YD+P  +  Y+HR+G
Sbjct  519  IHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIG  578

Query  543  RTGRAGVSGTAISILTPNQ  561
            RTGR G +G A S   P +
Sbjct  579  RTGRVGNNGRATSFFDPEK  597


>DDX49_DROME unnamed protein product
Length=521

 Score = 154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 118/396 (30%), Positives = 198/396 (50%), Gaps = 63/396 (16%)

Query  167  LIQLLKANGINKLFPVQEKLINWMQKCSEDRMKGWWVRDTCVSAPTGSGKTLAYVLPIIQ  226
            L++ L   G+    P+Q       QKC    + G   +D   +A TGSGKT A+ LPI++
Sbjct  18   LVKQLTKLGLKGATPIQ-------QKCIPAILAG---QDCIGAAKTGSGKTFAFALPILE  67

Query  227  YLKNQLTREIRCLIVVPVQELAAQIYKVLTTYSTQSNLKIGLISGASTLEIEQKNLIKTT  286
             L  +       L++ P  ELA QI +          +++ ++SG +   +E + L++  
Sbjct  68   RLSEEPVSHF-ALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLMQ--  124

Query  287  ERGQFISRVDILVATPGRLIDHIERTNGFSLQSLEFLVIDEADRA--TDWLKFIPEYHHT  344
                   R  I+VA PGRL DH+   + FS  +L++LV+DEADR    D+ + +      
Sbjct  125  -------RPHIVVAMPGRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESLSIIERC  177

Query  345  PPYLTIKNLNSHPIKPAQKLLFSATLSQDPEKLSRLSLFNPILFTSVSGTNQTDEDIDLD  404
             P            K  Q L FSAT+    ++ S        +F   S   +  +D D+ 
Sbjct  178  LP------------KTRQNLFFSATMKDFIKESS--------IFPIASDCFEWSQDSDV-  216

Query  405  NQMNKFIGKYTSPNELIERAYESPPEY-KPIVLYELIKQYQKPTDK--ILIFTNSGESAH  461
                       +  E +++ Y    +Y + +VL E +++Y++  +   ++IFTN+ +   
Sbjct  217  -----------ATVETLDQRYLLCADYDRDMVLIEALRKYREENENANVMIFTNTKKYCQ  265

Query  462  RLAILLASFLEQLQINFNVSELSAQLIPKQRAQILEKFRAGESRILVSSDALARGLDIHD  521
                LL+  L+ ++I+ NV  L   +  K+R   L +F++ + R L+++D  ARGLDI  
Sbjct  266  ----LLSMTLKNMEID-NVC-LHGFMRQKERVAALSRFKSNQIRTLIATDVAARGLDIPS  319

Query  522  IKLVVSYDLPKSVKGYIHRVGRTGRAGVSGTAISIL  557
            ++LV+++ LP++ K YIHRVGRT RAG  G +ISI 
Sbjct  320  VELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIF  355



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933652.1 UNC93-like protein isoform X1 [Chelonus insularis]

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZU1_DROME  unnamed protein product                                 124     5e-30
Q7K3V9_DROME  unnamed protein product                                 123     7e-30
UNC93_CAEEL  unnamed protein product                                  90.9    6e-19


>B7YZU1_DROME unnamed protein product
Length=536

 Score = 124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 109/466 (23%), Positives = 204/466 (44%), Gaps = 30/466 (6%)

Query  118  VIAKHCAVLFFGHMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSPM-I  176
            +I K+  V+    MI          LQ+   A + +LG   L ++Y    L++ F PM +
Sbjct  76   IITKNVVVIGLAFMIHFTAFHGTSNLQSSVNA-DKALGTTTLAVIYGSLILSNIFLPMTV  134

Query  177  IQKFGINLVISLSHLITTIFISTHLFPKWYILLPSYALLGITISPSFVARILHIDICAAN  236
            I+ FG  L ++L+      +I+   +P++  L+P+  ++G    P + ++  ++   +  
Sbjct  135  IRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEA  194

Query  237  LSIISPDSEDSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSP----  292
            L+ +       ++SR++    +      +   +    G LI++ ++T+  P   S     
Sbjct  195  LTQVR-----GNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDS  249

Query  293  IESDVQYT---------CGAKYCPQETFLYNETLFMPSITSETTKLLLSVLL-----GLC  338
             E +VQ           CGA++CP      N  L  P+   E  +LL S+ L      + 
Sbjct  250  FELEVQRELERNRVAELCGARFCPGVGAEANPNLVPPA--PEQIQLLNSIFLTCMAAAVV  307

Query  339  LLAFGISCTFLDSRIKKSQTLGDGSRKIAHLKSIKASFQDPKLQLAAPLTLFIGLEQGFI  398
            ++ FG+S +     +K+  T GDG   +  L       +  +  L  P+T+FIGLE+ F+
Sbjct  308  MMIFGVS-SLKRYGVKRGDT-GDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFL  365

Query  399  FCDFTEAFVGCALGNAGTITTCFLSFALLQALAGVTLSMLIRHIRRYLVVAVGFAFHACL  458
              DFT +FV C  G    I    + F +  A+A      L+  I R  + A+    + CL
Sbjct  366  AVDFTRSFVACGWG-ISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVNLCL  424

Query  459  LLTLITWKPAIDDPALFNVISAAWGVCNAIWEALILTLLLGLYPCTWQGPLSTSIFWKCL  518
            L  + TW+    D   +   +A WG+C+ +W  ++      L+P       S    W+  
Sbjct  425  LTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVVVNAFYGILFPNHLIAAYSNFRLWEST  484

Query  519  GIFLALGLHGLVCTRFRVFGLAGMLVLSAIPYAWLEIRLSKRVKCL  564
            G  +   +   +CT  ++  L   +++  + Y  +E R  ++ K L
Sbjct  485  GSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQKQKNL  530


>Q7K3V9_DROME unnamed protein product
Length=522

 Score = 123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 109/469 (23%), Positives = 205/469 (44%), Gaps = 30/469 (6%)

Query  115  PKKVIAKHCAVLFFGHMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSP  174
             + +I K+  V+    MI          LQ+   A + +LG   L ++Y    L++ F P
Sbjct  59   ERFIITKNVVVIGLAFMIHFTAFHGTSNLQSSVNA-DKALGTTTLAVIYGSLILSNIFLP  117

Query  175  M-IIQKFGINLVISLSHLITTIFISTHLFPKWYILLPSYALLGITISPSFVARILHIDIC  233
            M +I+ FG  L ++L+      +I+   +P++  L+P+  ++G    P + ++  ++   
Sbjct  118  MTVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTV  177

Query  234  AANLSIISPDSEDSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSP-  292
            +  L+ +       ++SR++    +      +   +    G LI++ ++T+  P   S  
Sbjct  178  SEALTQVR-----GNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAA  232

Query  293  ---IESDVQYT---------CGAKYCPQETFLYNETLFMPSITSETTKLLLSVLL-----  335
                E +VQ           CGA++CP      N  L  P+   E  +LL S+ L     
Sbjct  233  NDSFELEVQRELERNRVAELCGARFCPGVGAEANPNLVPPA--PEQIQLLNSIFLTCMAA  290

Query  336  GLCLLAFGISCTFLDSRIKKSQTLGDGSRKIAHLKSIKASFQDPKLQLAAPLTLFIGLEQ  395
             + ++ FG+S +     +K+  T GDG   +  L       +  +  L  P+T+FIGLE+
Sbjct  291  AVVMMIFGVS-SLKRYGVKRGDT-GDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEE  348

Query  396  GFIFCDFTEAFVGCALGNAGTITTCFLSFALLQALAGVTLSMLIRHIRRYLVVAVGFAFH  455
             F+  DFT +FV C  G    I    + F +  A+A      L+  I R  + A+    +
Sbjct  349  AFLAVDFTRSFVACGWG-ISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVN  407

Query  456  ACLLLTLITWKPAIDDPALFNVISAAWGVCNAIWEALILTLLLGLYPCTWQGPLSTSIFW  515
             CLL  + TW+    D   +   +A WG+C+ +W  ++      L+P       S    W
Sbjct  408  LCLLTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVVVNAFYGILFPNHLIAAYSNFRLW  467

Query  516  KCLGIFLALGLHGLVCTRFRVFGLAGMLVLSAIPYAWLEIRLSKRVKCL  564
            +  G  +   +   +CT  ++  L   +++  + Y  +E R  ++ K L
Sbjct  468  ESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQKQKNL  516


>UNC93_CAEEL unnamed protein product
Length=705

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 122/533 (23%), Positives = 223/533 (42%), Gaps = 67/533 (13%)

Query  16   DSSLYRPTPTSNITQTKLPPHPTPLAQTNRR------VRSTTHHHALWDDTMLEHMMTYS  69
            D     PT T  + +     H  P+  + RR      V   T  H++ DD   E +   +
Sbjct  159  DDHFELPTETGRVPEYD---HFCPIHGSRRRLPRNKLVTMQTLMHSV-DDEDNEDL---A  211

Query  70   PISCQSARASTLSCRRRESMTSSAGTSSVRKLIAAVRATPSGPRLPKKVIAKHCAVLFFG  129
             I      A  +  ++RE M+   GT   R             ++ +K+++ +  +L   
Sbjct  212  YIYGHDFLAKLVRKKKREMMS---GTEKER-----------ANKIKRKIMS-NLWILSVA  256

Query  130  HMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSP-MIIQKFGINLVISL  188
             + +      +  LQ    + N  LG   L  LY    ++S F P  +I + G  L   +
Sbjct  257  FLFLFTAFNGLQNLQT---SVNGDLGSDSLVALYLSLAISSLFVPSFMINRLGCKLTFLI  313

Query  189  SHLITTIFISTHLFPKWYILLPSYALLGITISPSFVAR---ILHIDICAANLSIISPDSE  245
            +  +  ++I  +L P +  ++P+    GI  S  + A+   I  + I  A+L+       
Sbjct  314  AIFVYFLYIVINLRPTYSSMIPASIFCGIAASCIWGAKCAYITEMGIRYASLNF------  367

Query  246  DSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSPIESDVQYTCGAKY  305
               ES+   ++R       +    G  +G ++++ I T+     L   E  +  +CG ++
Sbjct  368  ---ESQTTVIVRFFGYFFMIVH-CGQVVGNMVSSYIFTLSYSQALRGPEDSIYDSCGYQF  423

Query  306  CPQETFLYNETLFMPSITSETTKLLLSVLLGL--CLLAFG-ISCTFLDSRIKKSQTLGDG  362
             P+      E L   ++     K+ ++V L    C++  G I   FL++  K ++     
Sbjct  424  -PKNLSDLTE-LAESNLARPPQKVYVAVCLAYLACVIISGMIMSMFLNALAKDAR-----  476

Query  363  SRKIAHLKSIKASFQ------DPKLQLAAPLTLFIGLEQGFIFCDFTEAFVGCALG--NA  414
            +RK+A   + +  +       + K  L  PLT+F GLEQ F+   +T+AFVGC LG    
Sbjct  477  NRKMAQKFNSEIFYLMLKHLINIKFMLLVPLTIFNGLEQAFLVGVYTKAFVGCGLGIWQI  536

Query  415  GTITTCFLSFALLQALAGVTLSMLIRHIRRYLVVAVGFAFHACLLLTLITWKPAIDDPAL  474
            G +  C   F +  A+  +    LI+   R  +   G   +  +++TL+ W     D  +
Sbjct  537  GFVMAC---FGISDAVCSLVFGPLIKLFGRMPLFVFGAVVNLLMIVTLMVWPLNAADTQI  593

Query  475  FNVISAAWGVCNAIWEALILTLLLGLY-PCTWQGPLSTSIFWKCLGIFLALGL  526
            F V++A WG+ + +W   I    + L    + Q   +   FW+ LGI +   L
Sbjct  594  FYVVAAMWGMADGVWNTQINGFWVALVGRQSLQFAFTKYRFWESLGIAIGFAL  646



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933653.1 UNC93-like protein isoform X1 [Chelonus insularis]

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZU1_DROME  unnamed protein product                                 124     5e-30
Q7K3V9_DROME  unnamed protein product                                 123     7e-30
UNC93_CAEEL  unnamed protein product                                  90.9    6e-19


>B7YZU1_DROME unnamed protein product
Length=536

 Score = 124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 109/466 (23%), Positives = 204/466 (44%), Gaps = 30/466 (6%)

Query  118  VIAKHCAVLFFGHMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSPM-I  176
            +I K+  V+    MI          LQ+   A + +LG   L ++Y    L++ F PM +
Sbjct  76   IITKNVVVIGLAFMIHFTAFHGTSNLQSSVNA-DKALGTTTLAVIYGSLILSNIFLPMTV  134

Query  177  IQKFGINLVISLSHLITTIFISTHLFPKWYILLPSYALLGITISPSFVARILHIDICAAN  236
            I+ FG  L ++L+      +I+   +P++  L+P+  ++G    P + ++  ++   +  
Sbjct  135  IRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEA  194

Query  237  LSIISPDSEDSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSP----  292
            L+ +       ++SR++    +      +   +    G LI++ ++T+  P   S     
Sbjct  195  LTQVR-----GNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDS  249

Query  293  IESDVQYT---------CGAKYCPQETFLYNETLFMPSITSETTKLLLSVLL-----GLC  338
             E +VQ           CGA++CP      N  L  P+   E  +LL S+ L      + 
Sbjct  250  FELEVQRELERNRVAELCGARFCPGVGAEANPNLVPPA--PEQIQLLNSIFLTCMAAAVV  307

Query  339  LLAFGISCTFLDSRIKKSQTLGDGSRKIAHLKSIKASFQDPKLQLAAPLTLFIGLEQGFI  398
            ++ FG+S +     +K+  T GDG   +  L       +  +  L  P+T+FIGLE+ F+
Sbjct  308  MMIFGVS-SLKRYGVKRGDT-GDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFL  365

Query  399  FCDFTEAFVGCALGNAGTITTCFLSFALLQALAGVTLSMLIRHIRRYLVVAVGFAFHACL  458
              DFT +FV C  G    I    + F +  A+A      L+  I R  + A+    + CL
Sbjct  366  AVDFTRSFVACGWG-ISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVNLCL  424

Query  459  LLTLITWKPAIDDPALFNVISAAWGVCNAIWEALILTLLLGLYPCTWQGPLSTSIFWKCL  518
            L  + TW+    D   +   +A WG+C+ +W  ++      L+P       S    W+  
Sbjct  425  LTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVVVNAFYGILFPNHLIAAYSNFRLWEST  484

Query  519  GIFLALGLHGLVCTRFRVFGLAGMLVLSAIPYAWLEIRLSKRVKCL  564
            G  +   +   +CT  ++  L   +++  + Y  +E R  ++ K L
Sbjct  485  GSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQKQKNL  530


>Q7K3V9_DROME unnamed protein product
Length=522

 Score = 123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 109/469 (23%), Positives = 205/469 (44%), Gaps = 30/469 (6%)

Query  115  PKKVIAKHCAVLFFGHMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSP  174
             + +I K+  V+    MI          LQ+   A + +LG   L ++Y    L++ F P
Sbjct  59   ERFIITKNVVVIGLAFMIHFTAFHGTSNLQSSVNA-DKALGTTTLAVIYGSLILSNIFLP  117

Query  175  M-IIQKFGINLVISLSHLITTIFISTHLFPKWYILLPSYALLGITISPSFVARILHIDIC  233
            M +I+ FG  L ++L+      +I+   +P++  L+P+  ++G    P + ++  ++   
Sbjct  118  MTVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTV  177

Query  234  AANLSIISPDSEDSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSP-  292
            +  L+ +       ++SR++    +      +   +    G LI++ ++T+  P   S  
Sbjct  178  SEALTQVR-----GNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAA  232

Query  293  ---IESDVQYT---------CGAKYCPQETFLYNETLFMPSITSETTKLLLSVLL-----  335
                E +VQ           CGA++CP      N  L  P+   E  +LL S+ L     
Sbjct  233  NDSFELEVQRELERNRVAELCGARFCPGVGAEANPNLVPPA--PEQIQLLNSIFLTCMAA  290

Query  336  GLCLLAFGISCTFLDSRIKKSQTLGDGSRKIAHLKSIKASFQDPKLQLAAPLTLFIGLEQ  395
             + ++ FG+S +     +K+  T GDG   +  L       +  +  L  P+T+FIGLE+
Sbjct  291  AVVMMIFGVS-SLKRYGVKRGDT-GDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEE  348

Query  396  GFIFCDFTEAFVGCALGNAGTITTCFLSFALLQALAGVTLSMLIRHIRRYLVVAVGFAFH  455
             F+  DFT +FV C  G    I    + F +  A+A      L+  I R  + A+    +
Sbjct  349  AFLAVDFTRSFVACGWG-ISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVN  407

Query  456  ACLLLTLITWKPAIDDPALFNVISAAWGVCNAIWEALILTLLLGLYPCTWQGPLSTSIFW  515
             CLL  + TW+    D   +   +A WG+C+ +W  ++      L+P       S    W
Sbjct  408  LCLLTYMYTWEAREGDYMSYCTFAAVWGICDGVWLVVVNAFYGILFPNHLIAAYSNFRLW  467

Query  516  KCLGIFLALGLHGLVCTRFRVFGLAGMLVLSAIPYAWLEIRLSKRVKCL  564
            +  G  +   +   +CT  ++  L   +++  + Y  +E R  ++ K L
Sbjct  468  ESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQKQKNL  516


>UNC93_CAEEL unnamed protein product
Length=705

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 122/533 (23%), Positives = 223/533 (42%), Gaps = 67/533 (13%)

Query  16   DSSLYRPTPTSNITQTKLPPHPTPLAQTNRR------VRSTTHHHALWDDTMLEHMMTYS  69
            D     PT T  + +     H  P+  + RR      V   T  H++ DD   E +   +
Sbjct  159  DDHFELPTETGRVPEYD---HFCPIHGSRRRLPRNKLVTMQTLMHSV-DDEDNEDL---A  211

Query  70   PISCQSARASTLSCRRRESMTSSAGTSSVRKLIAAVRATPSGPRLPKKVIAKHCAVLFFG  129
             I      A  +  ++RE M+   GT   R             ++ +K+++ +  +L   
Sbjct  212  YIYGHDFLAKLVRKKKREMMS---GTEKER-----------ANKIKRKIMS-NLWILSVA  256

Query  130  HMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSP-MIIQKFGINLVISL  188
             + +      +  LQ    + N  LG   L  LY    ++S F P  +I + G  L   +
Sbjct  257  FLFLFTAFNGLQNLQT---SVNGDLGSDSLVALYLSLAISSLFVPSFMINRLGCKLTFLI  313

Query  189  SHLITTIFISTHLFPKWYILLPSYALLGITISPSFVAR---ILHIDICAANLSIISPDSE  245
            +  +  ++I  +L P +  ++P+    GI  S  + A+   I  + I  A+L+       
Sbjct  314  AIFVYFLYIVINLRPTYSSMIPASIFCGIAASCIWGAKCAYITEMGIRYASLNF------  367

Query  246  DSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSPIESDVQYTCGAKY  305
               ES+   ++R       +    G  +G ++++ I T+     L   E  +  +CG ++
Sbjct  368  ---ESQTTVIVRFFGYFFMIVH-CGQVVGNMVSSYIFTLSYSQALRGPEDSIYDSCGYQF  423

Query  306  CPQETFLYNETLFMPSITSETTKLLLSVLLGL--CLLAFG-ISCTFLDSRIKKSQTLGDG  362
             P+      E L   ++     K+ ++V L    C++  G I   FL++  K ++     
Sbjct  424  -PKNLSDLTE-LAESNLARPPQKVYVAVCLAYLACVIISGMIMSMFLNALAKDAR-----  476

Query  363  SRKIAHLKSIKASFQ------DPKLQLAAPLTLFIGLEQGFIFCDFTEAFVGCALG--NA  414
            +RK+A   + +  +       + K  L  PLT+F GLEQ F+   +T+AFVGC LG    
Sbjct  477  NRKMAQKFNSEIFYLMLKHLINIKFMLLVPLTIFNGLEQAFLVGVYTKAFVGCGLGIWQI  536

Query  415  GTITTCFLSFALLQALAGVTLSMLIRHIRRYLVVAVGFAFHACLLLTLITWKPAIDDPAL  474
            G +  C   F +  A+  +    LI+   R  +   G   +  +++TL+ W     D  +
Sbjct  537  GFVMAC---FGISDAVCSLVFGPLIKLFGRMPLFVFGAVVNLLMIVTLMVWPLNAADTQI  593

Query  475  FNVISAAWGVCNAIWEALILTLLLGLY-PCTWQGPLSTSIFWKCLGIFLALGL  526
            F V++A WG+ + +W   I    + L    + Q   +   FW+ LGI +   L
Sbjct  594  FYVVAAMWGMADGVWNTQINGFWVALVGRQSLQFAFTKYRFWESLGIAIGFAL  646



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933654.1 protein unc-93 homolog A isoform X2 [Chelonus
insularis]

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7YZU1_DROME  unnamed protein product                                 89.4    1e-18
Q7K3V9_DROME  unnamed protein product                                 89.0    1e-18
UNC93_CAEEL  unnamed protein product                                  60.8    1e-09


>B7YZU1_DROME unnamed protein product
Length=536

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 91/368 (25%), Positives = 161/368 (44%), Gaps = 36/368 (10%)

Query  118  VIAKHCAVLFFGHMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSPM-I  176
            +I K+  V+    MI          LQ+   A + +LG   L ++Y    L++ F PM +
Sbjct  76   IITKNVVVIGLAFMIHFTAFHGTSNLQSSVNA-DKALGTTTLAVIYGSLILSNIFLPMTV  134

Query  177  IQKFGINLVISLSHLITTIFISTHLFPKWYILLPSYALLGITISPSFVARILHIDICAAN  236
            I+ FG  L ++L+      +I+   +P++  L+P+  ++G    P + ++  ++   +  
Sbjct  135  IRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEA  194

Query  237  LSIISPDSEDSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSP----  292
            L+ +       ++SR++    +      +   +    G LI++ ++T+  P   S     
Sbjct  195  LTQVR-----GNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDS  249

Query  293  IESDVQYT---------CGAKYCPQETFLYNETLFMPSITSETTKLLLSVLL-----GLC  338
             E +VQ           CGA++CP      N  L  P+   E  +LL S+ L      + 
Sbjct  250  FELEVQRELERNRVAELCGARFCPGVGAEANPNLVPPA--PEQIQLLNSIFLTCMAAAVV  307

Query  339  LLAFGISCTFLDSRIKKSQTLGDGSRKIAHLKSIKASFQDPKLQLAAPLTLFIGLEQGFI  398
            ++ FG+S +     +K+  T GDG   +  L       +  +  L  P+T+FIGLE+ F+
Sbjct  308  MMIFGVS-SLKRYGVKRGDT-GDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFL  365

Query  399  FCDFTEAFVGCALGNAGTITTCFLSFALLQALAGVTLSMLIRHIRRY------LVVALLL  452
              DFT +FV C  G    I    + F +  A+A      L+  I R        VV L L
Sbjct  366  AVDFTRSFVACGWG-ISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVNLCL  424

Query  453  GLYPCTWQ  460
              Y  TW+
Sbjct  425  LTYMYTWE  432


>Q7K3V9_DROME unnamed protein product
Length=522

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 91/368 (25%), Positives = 161/368 (44%), Gaps = 36/368 (10%)

Query  118  VIAKHCAVLFFGHMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSPM-I  176
            +I K+  V+    MI          LQ+   A + +LG   L ++Y    L++ F PM +
Sbjct  62   IITKNVVVIGLAFMIHFTAFHGTSNLQSSVNA-DKALGTTTLAVIYGSLILSNIFLPMTV  120

Query  177  IQKFGINLVISLSHLITTIFISTHLFPKWYILLPSYALLGITISPSFVARILHIDICAAN  236
            I+ FG  L ++L+      +I+   +P++  L+P+  ++G    P + ++  ++   +  
Sbjct  121  IRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVSEA  180

Query  237  LSIISPDSEDSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSP----  292
            L+ +       ++SR++    +      +   +    G LI++ ++T+  P   S     
Sbjct  181  LTQVR-----GNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDS  235

Query  293  IESDVQYT---------CGAKYCPQETFLYNETLFMPSITSETTKLLLSVLL-----GLC  338
             E +VQ           CGA++CP      N  L  P+   E  +LL S+ L      + 
Sbjct  236  FELEVQRELERNRVAELCGARFCPGVGAEANPNLVPPA--PEQIQLLNSIFLTCMAAAVV  293

Query  339  LLAFGISCTFLDSRIKKSQTLGDGSRKIAHLKSIKASFQDPKLQLAAPLTLFIGLEQGFI  398
            ++ FG+S +     +K+  T GDG   +  L       +  +  L  P+T+FIGLE+ F+
Sbjct  294  MMIFGVS-SLKRYGVKRGDT-GDGMSGLKLLTVTINLLRKRRQILMLPITMFIGLEEAFL  351

Query  399  FCDFTEAFVGCALGNAGTITTCFLSFALLQALAGVTLSMLIRHIRRY------LVVALLL  452
              DFT +FV C  G    I    + F +  A+A      L+  I R        VV L L
Sbjct  352  AVDFTRSFVACGWG-ISRIGFAMICFGVANAVAAGIAGALVERIGRVTLAALCAVVNLCL  410

Query  453  GLYPCTWQ  460
              Y  TW+
Sbjct  411  LTYMYTWE  418


>UNC93_CAEEL unnamed protein product
Length=705

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 98/427 (23%), Positives = 178/427 (42%), Gaps = 63/427 (15%)

Query  16   DSSLYRPTPTSNITQTKLPPHPTPLAQTNRR------VRSTTHHHALWDDTMLEHMMTYS  69
            D     PT T  + +     H  P+  + RR      V   T  H++ DD   E +   +
Sbjct  159  DDHFELPTETGRVPEYD---HFCPIHGSRRRLPRNKLVTMQTLMHSV-DDEDNEDL---A  211

Query  70   PISCQSARASTLSCRRRESMTSSAGTSSVRKLIAAVRATPSGPRLPKKVIAKHCAVLFFG  129
             I      A  +  ++RE M+   GT   R             ++ +K+++ +  +L   
Sbjct  212  YIYGHDFLAKLVRKKKREMMS---GTEKER-----------ANKIKRKIMS-NLWILSVA  256

Query  130  HMIISAVILPIMPLQAGFGAFNPSLGPLLLTLLYAVATLTSCFSP-MIIQKFGINLVISL  188
             + +      +  LQ    + N  LG   L  LY    ++S F P  +I + G  L   +
Sbjct  257  FLFLFTAFNGLQNLQT---SVNGDLGSDSLVALYLSLAISSLFVPSFMINRLGCKLTFLI  313

Query  189  SHLITTIFISTHLFPKWYILLPSYALLGITISPSFVAR---ILHIDICAANLSIISPDSE  245
            +  +  ++I  +L P +  ++P+    GI  S  + A+   I  + I  A+L+       
Sbjct  314  AIFVYFLYIVINLRPTYSSMIPASIFCGIAASCIWGAKCAYITEMGIRYASLNF------  367

Query  246  DSDESRRECLLRRLNRAMKLAEDLGLAIGCLIATLIITIINPVPLSPIESDVQYTCGAKY  305
               ES+   ++R       +    G  +G ++++ I T+     L   E  +  +CG ++
Sbjct  368  ---ESQTTVIVRFFGYFFMIVH-CGQVVGNMVSSYIFTLSYSQALRGPEDSIYDSCGYQF  423

Query  306  CPQETFLYNETLFMPSITSETTKLLLSVLLGL--CLLAFG-ISCTFLDSRIKKSQTLGDG  362
             P+      E L   ++     K+ ++V L    C++  G I   FL++  K ++     
Sbjct  424  -PKNLSDLTE-LAESNLARPPQKVYVAVCLAYLACVIISGMIMSMFLNALAKDAR-----  476

Query  363  SRKIAHLKSIKASFQ------DPKLQLAAPLTLFIGLEQGFIFCDFTEAFVGCALG--NA  414
            +RK+A   + +  +       + K  L  PLT+F GLEQ F+   +T+AFVGC LG    
Sbjct  477  NRKMAQKFNSEIFYLMLKHLINIKFMLLVPLTIFNGLEQAFLVGVYTKAFVGCGLGIWQI  536

Query  415  GTITTCF  421
            G +  CF
Sbjct  537  GFVMACF  543



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933655.1 doublesex- and mab-3-related transcription factor
1-like [Chelonus insularis]

Length=239
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYE0_DROME  unnamed protein product                                 99.4    3e-24
Q9XWN9_CAEEL  unnamed protein product                                 73.6    2e-15
DSX_DROME  unnamed protein product                                    73.6    7e-15


>Q9VYE0_DROME unnamed protein product
Length=377

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 55/70 (79%), Gaps = 2/70 (3%)

Query  3    DKSDNLCPFEIKEPRLRSPKCARCRNHGIISSLKGHKRSCTWKDCRCPCCLLVVERQRVM  62
            D S  +C  E +   LR+PKCARCRNHG+IS +KGHKR C W++C CP C LVV+RQRVM
Sbjct  104  DASVRICQRERRL--LRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVM  161

Query  63   AAQVALRRQQ  72
            AAQVALRRQQ
Sbjct  162  AAQVALRRQQ  171


>Q9XWN9_CAEEL unnamed protein product
Length=250

 Score = 73.6 bits (179),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 7/78 (9%)

Query  2    DDKSDNLCPFEIKEPRLRSPKCARCRNHGIISSLKGHKRSCTWKDCRCPCCLLVVERQRV  61
            +DK D        +P+ R P C RC  H +++ LKGHKR+C ++DC C  C +VVERQ++
Sbjct  103  EDKDDG-------KPKERRPNCQRCAQHSVVNRLKGHKRACPFRDCFCAKCQVVVERQKL  155

Query  62   MAAQVALRRQQQTQISSL  79
            MA Q+ LRR+Q+ + ++L
Sbjct  156  MADQIKLRRRQKREKNNL  173


 Score = 40.4 bits (93),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 17/39 (44%), Positives = 26/39 (67%), Gaps = 0/39 (0%)

Query  23  CARCRNHGIISSLKGHKRSCTWKDCRCPCCLLVVERQRV  61
           C RC NHG+    K HK SCT++ C+C  C++V  R+++
Sbjct  19  CQRCLNHGLREKRKNHKLSCTFRFCQCSNCIMVERRRQL  57


>DSX_DROME unnamed protein product
Length=549

 Score = 73.6 bits (179),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)

Query  21  PKCARCRNHGIISSLKGHKRSCTWKDCRCPCCLLVVERQRVMAAQVALRRQQ  72
           P CARCRNHG+  +LKGHKR C ++ C C  C L  +RQRVMA Q ALRR Q
Sbjct  42  PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQ  93



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933656.1 uncharacterized protein LOC118063666 [Chelonus
insularis]

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DW0_TRYB2  unnamed protein product                                 27.7    1.5  
Q9XV36_CAEEL  unnamed protein product                                 26.9    3.4  
Q9U4G5_DROME  unnamed protein product                                 26.9    3.8  


>Q38DW0_TRYB2 unnamed protein product
Length=168

 Score = 27.7 bits (60),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (49%), Gaps = 4/39 (10%)

Query  18   FFLVLFLYEGFLKEKPIDCVC----GAGARDLARQRSGK  52
            F+L + L EG   E PID V     GA AR    +R  K
Sbjct  87   FYLAMVLSEGTFYETPIDYVADRVSGAPARKAFNERIQK  125


>Q9XV36_CAEEL unnamed protein product
Length=292

 Score = 26.9 bits (58),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 17/35 (49%), Gaps = 2/35 (6%)

Query  31  EKPIDCVCGAGARDLARQRSGKEPPRSRCICKHWR  65
           E+P+ C    G  +  RQ+   EPPRSR      R
Sbjct  7   EQPVSCATSTGKSEKERQKD--EPPRSRAEAGMMR  39


>Q9U4G5_DROME unnamed protein product
Length=852

 Score = 26.9 bits (58),  Expect = 3.8, Method: Composition-based stats.
 Identities = 18/61 (30%), Positives = 24/61 (39%), Gaps = 14/61 (23%)

Query  37   VCGAGARDLARQRSGKEPPRSRC----ICKHWRKAIYPCGCKRKAIIDQCAGRRPSVSHN  92
            VCG   R+        +P    C    I     +A++PCGC R+A    C      V  N
Sbjct  434  VCGCSCREFC------DPETCACSQAGIKCQVDRAMFPCGCTREA----CGNTVGRVEFN  483

Query  93   P  93
            P
Sbjct  484  P  484



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933657.1 peptidyl-prolyl cis-trans isomerase FKBP4-like
[Chelonus insularis]

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FKB59_DROME  unnamed protein product                                  80.5    6e-17
O45418_CAEEL  unnamed protein product                                 72.8    2e-14
Q8I4V8_PLAF7  unnamed protein product                                 69.7    2e-13


>FKB59_DROME unnamed protein product
Length=439

 Score = 80.5 bits (197),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 128/283 (45%), Gaps = 40/283 (14%)

Query  13   KKRVITHGSVSNKPVEGSRVHLFIEDLDISNKIDLNEFHSEILNGKSNVIITVDEILSEI  72
            KKR  + G+     + GS      ED D+           E   G+   I  +D      
Sbjct  142  KKRTPSDGAFVKAHISGSFEGRVFEDRDV-----------EFDYGEGKAIGIID------  184

Query  73   DRQIERAIKWMGENETAIINITLP-SLLPKIEE-----CNESIQFKATVIKHEPFKPIWE  126
               +E A++ M   ET+ I I    +   K  E      N ++++   ++        W+
Sbjct  185  --GVEIALEKMNVGETSRIKIQAKYAFGAKGNEEFKIPPNATVEYTVKLVDCGKGLEEWK  242

Query  127  WTPEEKYERAAKYKEMAVELVRQNRIKDAFNRFSKAVKIIISLEPIDDLELNSTLYTN--  184
             + EE+   A  YKE      ++     A   ++K   I           L +T++TN  
Sbjct  243  LSDEERLAEAKVYKEKGTNYFKKENWALAIKMYTKCKNI-----------LPTTVHTNEE  291

Query  185  LYKLRTSIYNNMAICQLKFNNYDHTINLCTKVLNRDKNNVKAMYRRG-CAFGGNKNVEQA  243
            + K++ + ++N+A+C  K N++      C +VL  DKNNVKA+YRRG C    N+ +E A
Sbjct  292  VKKIKVATHSNIALCHQKSNDHFEAKQECNEVLALDKNNVKALYRRGQCNLTINE-LEDA  350

Query  244  MKDFERIVHIEPTNFAAREKLKIYSELWSEAKKRSDELLKKMF  286
            ++DF++++ +EP N AA  ++ I  +   E+K +  +L   MF
Sbjct  351  LEDFQKVIQLEPGNKAAANQVIICKQKLKESKNKEKKLYANMF  393


>O45418_CAEEL unnamed protein product
Length=431

 Score = 72.8 bits (177),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 87/181 (48%), Gaps = 5/181 (3%)

Query  106  NESIQFKATVIKHEPFKPIWEWTPEEKYERAAKYKEMAVELVRQNRIKDAFNRFSKAVKI  165
            N +++F   + + E     WE T EEK + A + K+     +++  +K A+N++ +A ++
Sbjct  224  NATLEFTIFLKEFEKVPATWEMTAEEKLDAAKQAKDRGTMYLQKGNLKLAYNKYKRAEEV  283

Query  166  IISLEPIDDLELNSTLYTNLYKLRTSIYNNMAICQLKFNNYDHTINLCTKVLNRDKNNVK  225
            +   E   D E  +   T L       Y N+++   K N     I  C KVL     NVK
Sbjct  284  L-EYEKSTDPEKMAERETIL----NGAYLNLSLVCSKQNEQLECIKWCDKVLETKPGNVK  338

Query  226  AMYRRGCAFGGNKNVEQAMKDFERIVHIEPTNFAAREKLKIYSELWSEAKKRSDELLKKM  285
            A+YR+  A      V  AMK FE+IV +EP N AA +++ +      E  +R  +  K +
Sbjct  339  ALYRKATALLTMNEVRDAMKLFEKIVEVEPENKAAAQQIIVCRNTIREQNERDKKRFKNL  398

Query  286  F  286
            F
Sbjct  399  F  399


>Q8I4V8_PLAF7 unnamed protein product
Length=304

 Score = 69.7 bits (169),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 88/194 (45%), Gaps = 17/194 (9%)

Query  103  EECNESIQFKATVIKH-------EPFKPIWEWTPEEKYERAAKYKEMAVELVRQNRIKDA  155
            E C ESI   + ++         E  K I+++T EEK + A   KE   E  ++N I +A
Sbjct  104  EGCGESIPGNSVLLFEIELLSFREAKKSIYDYTDEEKVQSAFDIKEEGNEFFKKNEINEA  163

Query  156  FNRFSKAVKIIISLEPIDDLELNSTLYTNLYKLRTSIYNNMAICQLKFNNYDHTINLCTK  215
              ++ +A+   I  E  DD      L      +  S   N+A C  K  +Y   I+  +K
Sbjct  164  IVKYKEALDFFIHTEEWDD----QILLDKKKNIEISCNLNLATCYNKNKDYPKAIDHASK  219

Query  216  VLNRDKNNVKAMYRRGCA---FGGNKNVEQAMKDFERIVHIEPTNFAAREKLKIYSELWS  272
            VL  DKNNVKA+Y+ G A   FG    +E+A ++  +   + P N   R   ++      
Sbjct  220  VLKIDKNNVKALYKLGVANMYFG---FLEEAKENLYKAASLNPNNLDIRNSYELCVNKLK  276

Query  273  EAKKRSDELLKKMF  286
            EA+K+       MF
Sbjct  277  EARKKDKLTFGGMF  290



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933658.1 ubiquitin-conjugating enzyme E2 L3 [Chelonus
insularis]

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K738_DROME  unnamed protein product                                 257     3e-89
Q21633_CAEEL  unnamed protein product                                 225     1e-76
UBC2_CAEEL  unnamed protein product                                   117     3e-34


>Q7K738_DROME unnamed protein product
Length=154

 Score = 257 bits (656),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 140/151 (93%), Gaps = 0/151 (0%)

Query  1    MAATRRLQKELNELKASAMKNFTNIQVDESNILNWQGLILPDNPPYNKGAFRIEINFPAE  60
            M A RRL+KEL++L+ +A+K+F +I+ D+ N+L W GLI+PDNPPYNKGAFRIEINFPAE
Sbjct  1    MTAPRRLRKELSDLQGNALKSFRDIKADDDNLLRWTGLIVPDNPPYNKGAFRIEINFPAE  60

Query  61   YPFKPPRITFKTKIYHPNVDEKGQVCLPIITAENWKPATKTDQVIQALIALVNDPEPEHP  120
            YPFKPP+I FKT+IYHPN+DEKGQVCLPII+ ENWKPAT+TDQV+QAL+ L+NDPEPEHP
Sbjct  61   YPFKPPKINFKTRIYHPNIDEKGQVCLPIISTENWKPATRTDQVVQALVDLINDPEPEHP  120

Query  121  LRADLAEEFLKDRKKYLKNAEEFTKKHAEKR  151
            LRA+LAEEFLKDRKK++KNAE++TKKH+EKR
Sbjct  121  LRAELAEEFLKDRKKFVKNAEDYTKKHSEKR  151


>Q21633_CAEEL unnamed protein product
Length=153

 Score = 225 bits (573),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 129/153 (84%), Gaps = 0/153 (0%)

Query  1    MAATRRLQKELNELKASAMKNFTNIQVDESNILNWQGLILPDNPPYNKGAFRIEINFPAE  60
            M+ATRRLQKEL +LK   +K + N++ +E+N+L W  L++PD  PYNKGAF++ I FP +
Sbjct  1    MSATRRLQKELGDLKNCGVKAYENVECEETNLLKWTVLLIPDKEPYNKGAFKVGITFPVD  60

Query  61   YPFKPPRITFKTKIYHPNVDEKGQVCLPIITAENWKPATKTDQVIQALIALVNDPEPEHP  120
            YPFKPP++ F+TKIYHPNVDE+G+ CLPI+TAENWKPATKT+QV+ AL++L+N+PEP HP
Sbjct  61   YPFKPPKVAFETKIYHPNVDEEGKFCLPIVTAENWKPATKTEQVMMALLSLINEPEPSHP  120

Query  121  LRADLAEEFLKDRKKYLKNAEEFTKKHAEKRRE  153
            +RAD+AEEF KD KK++K AEE T+KHAEKR E
Sbjct  121  IRADVAEEFQKDHKKFMKTAEEHTRKHAEKRPE  153


>UBC2_CAEEL unnamed protein product
Length=147

 Score = 117 bits (293),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 92/147 (63%), Gaps = 3/147 (2%)

Query  3    ATRRLQKELNELKASAMKNFTNIQVDESNILNWQGLIL-PDNPPYNKGAFRIEINFPAEY  61
            A +R+QKEL +L        +   V + ++ +WQ  I+ P   PY  G F + I+FP +Y
Sbjct  2    ALKRIQKELQDLGRDPPAQCSAGPVGD-DLFHWQATIMGPPESPYQGGVFFLTIHFPTDY  60

Query  62   PFKPPRITFKTKIYHPNVDEKGQVCLPIITAENWKPATKTDQVIQALIALVNDPEPEHPL  121
            PFKPP++ F T+IYHPN++  G +CL I+ ++ W PA    +V+ ++ +L+ DP P+ PL
Sbjct  61   PFKPPKVAFTTRIYHPNINSNGSICLDILRSQ-WSPALTISKVLLSICSLLCDPNPDDPL  119

Query  122  RADLAEEFLKDRKKYLKNAEEFTKKHA  148
              ++A  +  DR++Y + A E+T+K+A
Sbjct  120  VPEIARIYKTDRERYNQLAREWTQKYA  146



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933659.1 facilitated trehalose transporter Tret1-2 homolog
isoform X1 [Chelonus insularis]

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRET1_POLVA  unnamed protein product                                  282     3e-89
TRE12_DROME  unnamed protein product                                  280     1e-88
TRET1_APILI  unnamed protein product                                  270     1e-84


>TRET1_POLVA unnamed protein product
Length=504

 Score = 282 bits (721),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 168/496 (34%), Positives = 263/496 (53%), Gaps = 29/496 (6%)

Query  4    HHKYYVTTIPEENGYKMPRASVVHMTSTATRPQHL-SQVLATLALSMGTLSCGLAKGYTS  62
            H   +V  I E+   K+       +    T P ++ +Q+LA +A+SMG++  G A  YTS
Sbjct  12   HTVPFVRQITEDGKAKL------EIYRPTTNPIYIYTQILAAIAVSMGSMVVGFASAYTS  65

Query  63   PAVDSILDNQPHLYQSTGNDTWWAFSATKQEASWVAS-LAMLGAGFGAMIGDWIMRRGRR  121
            PA+ S+            N T  +F  T+QEASWV   + + G   G   G +I   GR+
Sbjct  66   PALVSM-----------QNTTITSFKVTEQEASWVGGIMPLAGLAGGIAGGPFIEYLGRK  114

Query  122  LALRLTSLPLAAVWILTGIAPCVELVFTTSFIGGLCCAVITMVAQVYISEISMPGIRGCL  181
              +  T++P    W+L   A  + +V     + G C  + ++   VY+ E   P +RG L
Sbjct  115  NTILATAVPFIVAWLLIAFANSIWMVLAGRALSGFCVGIASLSLPVYLGETVQPEVRGTL  174

Query  182  SAILKAVGHLGVLLSYITGSYLNWRESAMVVAIAPTMLFMGTLFIPETPSYLVLNGKDEE  241
              +  A G++G+L+ ++ G Y+NW   A + +I P    + TL IPETP + V  G++E 
Sbjct  175  GLLPTAFGNIGILICFVAGKYVNWSGLAFIGSILPIPFMVLTLLIPETPRWFVTRGREER  234

Query  242  ASGSLKWLRGSHVDVRQELQ-VIKTNILASRAKQYELSFRNSMLTPRLYKPIAITCGLMF  300
            A  +L+WLRG   DV  EL+ ++K++  A R       F   ++     KP+ I  GLMF
Sbjct  235  ARKALQWLRGKKADVEPELKGIVKSHCEAERHASQNAIF--DLMKRSNLKPLLIALGLMF  292

Query  301  FQRFSGANAFTYYAVIVFRQTLGGISPHGATIAIGFVQLLASLLSGFLIDIVGRLPLLIA  360
            FQ+ SG NA  +Y V +F+     I  +  TI +G V   A+  +  LID +GR  LL  
Sbjct  293  FQQLSGINAVIFYTVSIFKDAGSTIDENLCTIIVGVVNFGATFFATVLIDRLGRKILLYI  352

Query  361  STVFMSLALAGFGSYAYYNSMSQNIFEDPTSMGQHDWIPLLCVLVFTTALALGISPISWL  420
            S V M + L   G++ YY    +N   D +++G   W+PL   +++    + G+ PI WL
Sbjct  353  SEVAMVITLLTLGTFFYY----KNSGNDVSNIG---WLPLASFVIYVIGFSSGVGPIPWL  405

Query  421  LIGELFPLEYRGLGSSISTSFSYFCAFLGIKLFMDFQQLLGLHGAFWFYAAIAICGLCFV  480
            ++GE+ P + RG  +S++T F++ C F+  K F D    +G HGAFWF+  I + GL FV
Sbjct  406  MLGEILPGKIRGSAASVATGFNWTCTFIVTKTFADIVAAIGNHGAFWFFGVICLIGLFFV  465

Query  481  VCCVPETKGKQLDEMN  496
            +  VPET+GK L+E+ 
Sbjct  466  IFFVPETQGKSLEEIE  481


>TRE12_DROME unnamed protein product
Length=488

 Score = 280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 164/465 (35%), Positives = 251/465 (54%), Gaps = 30/465 (6%)

Query  38   LSQVLATLALSMGTLSCGLAKGYTSPAVDSILDNQPHLYQSTGNDTWWAFSATKQEASWV  97
             SQVLA L++S+ +L  G    YTSPA+ S+ D            T  +F  TK   SWV
Sbjct  26   FSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDR-----------TITSFEVTKDAGSWV  74

Query  98   ASLAMLGAGFGAMIGDWIMRR-GRRLALRLTSLPLAAVWILTGIAPCVELVFTTSFIGGL  156
              +  L A  G + G  ++   GRR  +  T++P     +L   A  V ++    F+ G 
Sbjct  75   GGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGF  134

Query  157  CCAVITMVAQVYISEISMPGIRGCLSAILKAVGHLGVLLSYITGSYLNWRESAMVVAIAP  216
            C  + ++   VY+ E   P +RG L  +  A+G++G+L+ Y+ GS++NW   A + A  P
Sbjct  135  CVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALP  194

Query  217  TMLFMGTLFIPETPSYLVLNGKDEEASGSLKWLRGSHVDVRQEL-QVIKTNILASR-AKQ  274
                +  + IPETP + V  G++E A  +LKWLRG   DV  EL +++++   A R A Q
Sbjct  195  VPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQ  254

Query  275  ---YELSFRNSMLTPRLYKPIAITCGLMFFQRFSGANAFTYYAVIVFRQTLGGISPHGAT  331
                EL  RN++      KP++I+ GLMFFQ+FSG NA  +Y V +F+     I  + +T
Sbjct  255  NTCLELFKRNNL------KPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLST  308

Query  332  IAIGFVQLLASLLSGFLIDIVGRLPLLIASTVFMSLALAGFGSYAYYNSMSQNIFEDPTS  391
            I +G V   A+ +   LID +GR  LL  S + M + L+  G + Y  +   ++      
Sbjct  309  IIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDV------  362

Query  392  MGQHDWIPLLCVLVFTTALALGISPISWLLIGELFPLEYRGLGSSISTSFSYFCAFLGIK  451
                 W+PL C +++    +LG  PI WL++GE+ P + RG  +S+ T+F++FC F+  K
Sbjct  363  -SHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTK  421

Query  452  LFMDFQQLLGLHGAFWFYAAIAICGLCFVVCCVPETKGKQLDEMN  496
             F D    +G HGAFW + AI I GL FV+  VPET+GK L+E+ 
Sbjct  422  TFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIE  466


>TRET1_APILI unnamed protein product
Length=502

 Score = 270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/471 (33%), Positives = 251/471 (53%), Gaps = 31/471 (7%)

Query  36   QHLSQVLATLALSMGTLSCGLAKGYTSPAVDSILDNQPHLYQSTGNDTWWAFSATKQEAS  95
            ++  Q+LA LA+SM +L  G +  YTSPA+ S+ DN           T   F  T   A 
Sbjct  38   RYTMQLLAALAVSMASLMIGYSSSYTSPALVSMRDN-----------TTATFEVTMDMAM  86

Query  96   WVASLAMLGA-GFGAMIGDWIMRRGRRLALRLTSLPLAAVWILTGIAPCVELVFTTSFIG  154
            W+ S+  L A   G + G  I   GRR  +  T+LP  A W+   +A  V ++     I 
Sbjct  87   WIGSIMPLSALIGGIIGGPCIEYIGRRNTILSTALPFLAGWLFIALATNVAMILVGRSIC  146

Query  155  GLCCAVITMVAQVYISEISMPGIRGCLSAILKAVGHLGVLLSYITGSYLNWRESAMVVAI  214
            G C  V ++   VY+ E   P +RG L  +    G+ G+L+ +  G YL WR  A++ A 
Sbjct  147  GFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVFGNSGILMCFTAGMYLAWRNLALLGAC  206

Query  215  APTMLFMGTLFIPETPSYLVLNGKDEEASGSLKWLRGSHVDVRQELQVIK-----TNILA  269
             P +  +    IPETP + +  GK +EA  SL+WLRG   D+ +EL  I+     +  +A
Sbjct  207  IPIIFLILMFLIPETPRWYISKGKIKEARKSLQWLRGKTADISEELDSIQKMHIESERIA  266

Query  270  SRAKQYELSFRNSMLTPRLYKPIAITCGLMFFQRFSGANAFTYYAVIVFRQTLGGISPHG  329
            +     EL  +N +      KP+ I+ GLMFFQ+FSG NA  +Y V +F+ +   +  + 
Sbjct  267  TEGALIELFRKNHI------KPVFISLGLMFFQQFSGINAVIFYTVQIFKDSGSTVDENL  320

Query  330  ATIAIGFVQLLASLLSGFLIDIVGRLPLLIASTVFMSLALAGFGSYAYYNSMSQNIFEDP  389
            +TI +G V  +++ ++  +ID +GR  LL  S++ M + L  FG++ Y   +      D 
Sbjct  321  STIIVGLVNFISTFVAAMIIDRLGRKMLLYISSILMCITLFTFGTFFYVKELM-----DV  375

Query  390  TSMGQHDWIPLLCVLVFTTALALGISPISWLLIGELFPLEYRGLGSSISTSFSYFCAFLG  449
            T+ G   WIPL+ ++V+    + G  PI WL++GE+ P++ RG  +S++T+F++ C F+ 
Sbjct  376  TAFG---WIPLMSLIVYVIGFSFGFGPIPWLMMGEILPVKIRGTAASVATAFNWSCTFVV  432

Query  450  IKLFMDFQQLLGLHGAFWFYAAIAICGLCFVVCCVPETKGKQLDEMNPEYA  500
             K + D    +G +G FW +  +      FV+ CVPET+G+ L+E+   +A
Sbjct  433  TKTYEDLVLHIGPYGTFWLFGTLVAVAFIFVIICVPETRGRSLEEIERRFA  483



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933660.1 facilitated trehalose transporter Tret1-like isoform
X2 [Chelonus insularis]

Length=484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRE12_DROME  unnamed protein product                                  280     6e-89
TRET1_POLVA  unnamed protein product                                  280     8e-89
TRET1_APILI  unnamed protein product                                  270     1e-84


>TRE12_DROME unnamed protein product
Length=488

 Score = 280 bits (717),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 164/465 (35%), Positives = 251/465 (54%), Gaps = 30/465 (6%)

Query  19   LSQVLATLALSMGTLSCGLAKGYTSPAVDSILDNQPHLYQSTGNDTWWAFSATKQEASWV  78
             SQVLA L++S+ +L  G    YTSPA+ S+ D            T  +F  TK   SWV
Sbjct  26   FSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDR-----------TITSFEVTKDAGSWV  74

Query  79   ASLAMLGAGFGAMIGDWIMRR-GRRLALRLTSLPLAAVWILTGIAPCVELVFTTSFIGGL  137
              +  L A  G + G  ++   GRR  +  T++P     +L   A  V ++    F+ G 
Sbjct  75   GGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGF  134

Query  138  CCAVITMVAQVYISEISMPGIRGCLSAILKAVGHLGVLLSYITGSYLNWRESAMVVAIAP  197
            C  + ++   VY+ E   P +RG L  +  A+G++G+L+ Y+ GS++NW   A + A  P
Sbjct  135  CVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALP  194

Query  198  TMLFMGTLFIPETPSYLVLNGKDEEASGSLKWLRGSHVDVRQEL-QVIKTNILASR-AKQ  255
                +  + IPETP + V  G++E A  +LKWLRG   DV  EL +++++   A R A Q
Sbjct  195  VPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQ  254

Query  256  ---YELSFRNSMLTPRLYKPIAITCGLMFFQRFSGANAFTYYAVIVFRQTLGGISPHGAT  312
                EL  RN++      KP++I+ GLMFFQ+FSG NA  +Y V +F+     I  + +T
Sbjct  255  NTCLELFKRNNL------KPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLST  308

Query  313  IAIGFVQLLASLLSGFLIDIVGRLPLLIASTVFMSLALAGFGSYAYYNSMSQNIFEDPTS  372
            I +G V   A+ +   LID +GR  LL  S + M + L+  G + Y  +   ++      
Sbjct  309  IIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGPDV------  362

Query  373  MGQHDWIPLLCVLVFTTALALGISPISWLLIGELFPLEYRGLGSSISTSFSYFCAFLGIK  432
                 W+PL C +++    +LG  PI WL++GE+ P + RG  +S+ T+F++FC F+  K
Sbjct  363  -SHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTK  421

Query  433  LFMDFQQLLGLHGAFWFYAAIAICGLCFVVCCVPETKGKQLDEMN  477
             F D    +G HGAFW + AI I GL FV+  VPET+GK L+E+ 
Sbjct  422  TFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIE  466


>TRET1_POLVA unnamed protein product
Length=504

 Score = 280 bits (717),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 163/467 (35%), Positives = 254/467 (54%), Gaps = 23/467 (5%)

Query  14   TRPQHL-SQVLATLALSMGTLSCGLAKGYTSPAVDSILDNQPHLYQSTGNDTWWAFSATK  72
            T P ++ +Q+LA +A+SMG++  G A  YTSPA+ S+            N T  +F  T+
Sbjct  35   TNPIYIYTQILAAIAVSMGSMVVGFASAYTSPALVSM-----------QNTTITSFKVTE  83

Query  73   QEASWVAS-LAMLGAGFGAMIGDWIMRRGRRLALRLTSLPLAAVWILTGIAPCVELVFTT  131
            QEASWV   + + G   G   G +I   GR+  +  T++P    W+L   A  + +V   
Sbjct  84   QEASWVGGIMPLAGLAGGIAGGPFIEYLGRKNTILATAVPFIVAWLLIAFANSIWMVLAG  143

Query  132  SFIGGLCCAVITMVAQVYISEISMPGIRGCLSAILKAVGHLGVLLSYITGSYLNWRESAM  191
              + G C  + ++   VY+ E   P +RG L  +  A G++G+L+ ++ G Y+NW   A 
Sbjct  144  RALSGFCVGIASLSLPVYLGETVQPEVRGTLGLLPTAFGNIGILICFVAGKYVNWSGLAF  203

Query  192  VVAIAPTMLFMGTLFIPETPSYLVLNGKDEEASGSLKWLRGSHVDVRQELQ-VIKTNILA  250
            + +I P    + TL IPETP + V  G++E A  +L+WLRG   DV  EL+ ++K++  A
Sbjct  204  IGSILPIPFMVLTLLIPETPRWFVTRGREERARKALQWLRGKKADVEPELKGIVKSHCEA  263

Query  251  SRAKQYELSFRNSMLTPRLYKPIAITCGLMFFQRFSGANAFTYYAVIVFRQTLGGISPHG  310
             R       F   ++     KP+ I  GLMFFQ+ SG NA  +Y V +F+     I  + 
Sbjct  264  ERHASQNAIF--DLMKRSNLKPLLIALGLMFFQQLSGINAVIFYTVSIFKDAGSTIDENL  321

Query  311  ATIAIGFVQLLASLLSGFLIDIVGRLPLLIASTVFMSLALAGFGSYAYYNSMSQNIFEDP  370
             TI +G V   A+  +  LID +GR  LL  S V M + L   G++ YY    +N   D 
Sbjct  322  CTIIVGVVNFGATFFATVLIDRLGRKILLYISEVAMVITLLTLGTFFYY----KNSGNDV  377

Query  371  TSMGQHDWIPLLCVLVFTTALALGISPISWLLIGELFPLEYRGLGSSISTSFSYFCAFLG  430
            +++G   W+PL   +++    + G+ PI WL++GE+ P + RG  +S++T F++ C F+ 
Sbjct  378  SNIG---WLPLASFVIYVIGFSSGVGPIPWLMLGEILPGKIRGSAASVATGFNWTCTFIV  434

Query  431  IKLFMDFQQLLGLHGAFWFYAAIAICGLCFVVCCVPETKGKQLDEMN  477
             K F D    +G HGAFWF+  I + GL FV+  VPET+GK L+E+ 
Sbjct  435  TKTFADIVAAIGNHGAFWFFGVICLIGLFFVIFFVPETQGKSLEEIE  481


>TRET1_APILI unnamed protein product
Length=502

 Score = 270 bits (689),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 156/471 (33%), Positives = 251/471 (53%), Gaps = 31/471 (7%)

Query  17   QHLSQVLATLALSMGTLSCGLAKGYTSPAVDSILDNQPHLYQSTGNDTWWAFSATKQEAS  76
            ++  Q+LA LA+SM +L  G +  YTSPA+ S+ DN           T   F  T   A 
Sbjct  38   RYTMQLLAALAVSMASLMIGYSSSYTSPALVSMRDN-----------TTATFEVTMDMAM  86

Query  77   WVASLAMLGA-GFGAMIGDWIMRRGRRLALRLTSLPLAAVWILTGIAPCVELVFTTSFIG  135
            W+ S+  L A   G + G  I   GRR  +  T+LP  A W+   +A  V ++     I 
Sbjct  87   WIGSIMPLSALIGGIIGGPCIEYIGRRNTILSTALPFLAGWLFIALATNVAMILVGRSIC  146

Query  136  GLCCAVITMVAQVYISEISMPGIRGCLSAILKAVGHLGVLLSYITGSYLNWRESAMVVAI  195
            G C  V ++   VY+ E   P +RG L  +    G+ G+L+ +  G YL WR  A++ A 
Sbjct  147  GFCVGVASLSLPVYLGESIQPEVRGSLGLLPTVFGNSGILMCFTAGMYLAWRNLALLGAC  206

Query  196  APTMLFMGTLFIPETPSYLVLNGKDEEASGSLKWLRGSHVDVRQELQVIK-----TNILA  250
             P +  +    IPETP + +  GK +EA  SL+WLRG   D+ +EL  I+     +  +A
Sbjct  207  IPIIFLILMFLIPETPRWYISKGKIKEARKSLQWLRGKTADISEELDSIQKMHIESERIA  266

Query  251  SRAKQYELSFRNSMLTPRLYKPIAITCGLMFFQRFSGANAFTYYAVIVFRQTLGGISPHG  310
            +     EL  +N +      KP+ I+ GLMFFQ+FSG NA  +Y V +F+ +   +  + 
Sbjct  267  TEGALIELFRKNHI------KPVFISLGLMFFQQFSGINAVIFYTVQIFKDSGSTVDENL  320

Query  311  ATIAIGFVQLLASLLSGFLIDIVGRLPLLIASTVFMSLALAGFGSYAYYNSMSQNIFEDP  370
            +TI +G V  +++ ++  +ID +GR  LL  S++ M + L  FG++ Y   +      D 
Sbjct  321  STIIVGLVNFISTFVAAMIIDRLGRKMLLYISSILMCITLFTFGTFFYVKELM-----DV  375

Query  371  TSMGQHDWIPLLCVLVFTTALALGISPISWLLIGELFPLEYRGLGSSISTSFSYFCAFLG  430
            T+ G   WIPL+ ++V+    + G  PI WL++GE+ P++ RG  +S++T+F++ C F+ 
Sbjct  376  TAFG---WIPLMSLIVYVIGFSFGFGPIPWLMMGEILPVKIRGTAASVATAFNWSCTFVV  432

Query  431  IKLFMDFQQLLGLHGAFWFYAAIAICGLCFVVCCVPETKGKQLDEMNPEYA  481
             K + D    +G +G FW +  +      FV+ CVPET+G+ L+E+   +A
Sbjct  433  TKTYEDLVLHIGPYGTFWLFGTLVAVAFIFVIICVPETRGRSLEEIERRFA  483



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933661.1 mediator of RNA polymerase II transcription subunit
20 [Chelonus insularis]

Length=206
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED20_DROME  unnamed protein product                                  248     9e-84
Q9W0D9_DROME  unnamed protein product                                 29.6    1.6  
Q7JYZ0_DROME  unnamed protein product                                 29.3    1.7  


>MED20_DROME unnamed protein product
Length=252

 Score = 248 bits (634),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 156/219 (71%), Gaps = 18/219 (8%)

Query  1    MGVTVLQQFPMMEKRTGPQTIDFLTKRVLALGAVQVGQFLVDCETFTSVPQL---GVQRT  57
            MGVT+LQ +P+ E ++G   ID L+KR+LALGA   GQFLVDCETF S PQ       R 
Sbjct  1    MGVTILQPYPLPEGKSGAHIIDQLSKRLLALGATHAGQFLVDCETFISTPQPHNGAPGRA  60

Query  58   VHVLHNSEQPASVFAILESGT-KVVPLIADGLFDLLMLKIASIYTSKKQTKIESKGPRFE  116
            VHVLHNSE PAS F+I+++GT K V ++AD +FDLLMLK+ + +TSKKQTKIES+G RFE
Sbjct  61   VHVLHNSEYPASTFSIIDNGTGKQVAIVADNIFDLLMLKMTNTFTSKKQTKIESRGARFE  120

Query  117  IGDFCVKLGSVTMSQNFKGVLVEVEYRPCVVPGSAWELMREFLQGFLGSAVSNQPPQY--  174
             GDF +KLGSVTM ++FKG+L+E+EY+ CV+    WE++RE LQGFLG AV+   P Y  
Sbjct  121  YGDFVIKLGSVTMMEHFKGILIEIEYKSCVILAYCWEMIREMLQGFLGIAVNKDFPSYFA  180

Query  175  ------------LQNRMNDIYQPLDTIQQYLEHFGQYRK  201
                        L  + NDI++P+DT++QYLE F  YRK
Sbjct  181  PQTIMTAMGQQQLHAKHNDIFEPMDTVKQYLEQFTNYRK  219


>Q9W0D9_DROME unnamed protein product
Length=381

 Score = 29.6 bits (65),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 0/41 (0%)

Query  146  VVPGSAWELMREFLQGFLGSAVSNQPPQYLQNRMNDIYQPL  186
            +VP + W L  EF++      V++    Y    +NDIY PL
Sbjct  147  IVPNAPWTLNEEFIEEHKIDFVAHDDIPYGAGGVNDIYAPL  187


>Q7JYZ0_DROME unnamed protein product
Length=161

 Score = 29.3 bits (64),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 3/35 (9%)

Query  167  VSNQPPQ---YLQNRMNDIYQPLDTIQQYLEHFGQ  198
            + N+ PQ      N +ND Y   +TIQ Y+  FGQ
Sbjct  75   LGNESPQSEDAYANCVNDPYCAANTIQNYMTKFGQ  109



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933662.1 multifunctional methyltransferase subunit TRM112-like
protein [Chelonus insularis]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57X98_TRYB2  unnamed protein product                                 71.2    8e-17
O44782_CAEEL  unnamed protein product                                 30.4    0.26 
Q38BC3_TRYB2  unnamed protein product                                 28.5    1.4  


>Q57X98_TRYB2 unnamed protein product
Length=127

 Score = 71.2 bits (173),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 72/130 (55%), Gaps = 13/130 (10%)

Query  1    MKLLTHNMLTSKCLKGVNVGYPLGIVAKDVKVSQVDFSSEFIARIIPKLDWNTLWKA---  57
            M+LLTHN L   C++  +  +PL + A +++V   +++ EFI  ++ ++D+  L +A   
Sbjct  1    MRLLTHNFLC--CIQCQS--FPLQLQATELEVLASEYNPEFIRTMLARMDYTYLVEAFNS  56

Query  58   -----ADSIGHVNDLPESLIQ-DFENNEEFLKKVHHVLLEVEVMSGDLLCPESGRKFPIN  111
                  D +   N LPE L   D  ++   LK VH+ + +V +  G L CP+  R++PI 
Sbjct  57   LRSQKQDQVDAGNVLPEKLEDVDLSDDSRDLKAVHYAIQDVAIREGALRCPQCKREYPIR  116

Query  112  DGIPNMLCNE  121
            + IP+M+  E
Sbjct  117  EFIPDMIAAE  126


>O44782_CAEEL unnamed protein product
Length=245

 Score = 30.4 bits (67),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  62   GHVNDLPESLIQDFENNEEFLKKVHHVLLEVEVM  95
            G VN L +SL    +  EE  KKVH +  E+EVM
Sbjct  168  GTVNSLRKSLKSTVDEKEELQKKVHGLEQEIEVM  201


>Q38BC3_TRYB2 unnamed protein product
Length=558

 Score = 28.5 bits (62),  Expect = 1.4, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 20/38 (53%), Gaps = 6/38 (16%)

Query  18   NVGYPLGIVAKDVKVSQVDFSSEFIARIIPKLDWNTLW  55
            + G PLG V      S +D SSE +A IIP LD    W
Sbjct  252  DFGIPLGYV------SILDLSSEAVANIIPVLDNEIDW  283



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933663.1 multifunctional methyltransferase subunit TRM112-like
protein [Chelonus insularis]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57X98_TRYB2  unnamed protein product                                 71.2    8e-17
O44782_CAEEL  unnamed protein product                                 30.4    0.26 
Q38BC3_TRYB2  unnamed protein product                                 28.5    1.4  


>Q57X98_TRYB2 unnamed protein product
Length=127

 Score = 71.2 bits (173),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 72/130 (55%), Gaps = 13/130 (10%)

Query  1    MKLLTHNMLTSKCLKGVNVGYPLGIVAKDVKVSQVDFSSEFIARIIPKLDWNTLWKA---  57
            M+LLTHN L   C++  +  +PL + A +++V   +++ EFI  ++ ++D+  L +A   
Sbjct  1    MRLLTHNFLC--CIQCQS--FPLQLQATELEVLASEYNPEFIRTMLARMDYTYLVEAFNS  56

Query  58   -----ADSIGHVNDLPESLIQ-DFENNEEFLKKVHHVLLEVEVMSGDLLCPESGRKFPIN  111
                  D +   N LPE L   D  ++   LK VH+ + +V +  G L CP+  R++PI 
Sbjct  57   LRSQKQDQVDAGNVLPEKLEDVDLSDDSRDLKAVHYAIQDVAIREGALRCPQCKREYPIR  116

Query  112  DGIPNMLCNE  121
            + IP+M+  E
Sbjct  117  EFIPDMIAAE  126


>O44782_CAEEL unnamed protein product
Length=245

 Score = 30.4 bits (67),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  62   GHVNDLPESLIQDFENNEEFLKKVHHVLLEVEVM  95
            G VN L +SL    +  EE  KKVH +  E+EVM
Sbjct  168  GTVNSLRKSLKSTVDEKEELQKKVHGLEQEIEVM  201


>Q38BC3_TRYB2 unnamed protein product
Length=558

 Score = 28.5 bits (62),  Expect = 1.4, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 20/38 (53%), Gaps = 6/38 (16%)

Query  18   NVGYPLGIVAKDVKVSQVDFSSEFIARIIPKLDWNTLW  55
            + G PLG V      S +D SSE +A IIP LD    W
Sbjct  252  DFGIPLGYV------SILDLSSEAVANIIPVLDNEIDW  283



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


Query= XP_034933664.1 uncharacterized protein LOC118063671 [Chelonus
insularis]

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EFK2_CAEEL  unnamed protein product                                 34.7    0.35 
Q8MMR8_DICDI  unnamed protein product                                 31.6    2.8  
Q55BQ2_DICDI  unnamed protein product                                 30.0    6.5  


>G5EFK2_CAEEL unnamed protein product
Length=1578

 Score = 34.7 bits (78),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 29/66 (44%), Gaps = 5/66 (8%)

Query  81    NQFTGIPKNDGICEVNQEAANYRVGD-GGKVGEQRAGIHYDVHCQPACYHLKERTGPNDK  139
             N F   PK+D I   ++   +  V D G + G  R+GIH   H    C+H       N+ 
Sbjct  1442  NIFPAKPKSDPIFSFHENDDSAGVEDRGARTGHARSGIHIQPHSAYRCFH----CSSNED  1497

Query  140   DVHSFP  145
              V  +P
Sbjct  1498  SVRIYP  1503


>Q8MMR8_DICDI unnamed protein product
Length=637

 Score = 31.6 bits (70),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 31/69 (45%), Gaps = 8/69 (12%)

Query  231  IGNAIVGEYIIKLCKAA-----HRAQINGNWNDLPPTADLPTVPTLDPKKKMKLR---DW  282
            IG++++   I   C A      H++ +   +   P       +P + P K +K+    DW
Sbjct  367  IGSSVIDTAIGYACIAGSDSADHQSVLAEQYGGKPTVPMFTEIPLIQPLKGLKIGVFYDW  426

Query  283  YNDINLSFK  291
             ND N+ FK
Sbjct  427  INDCNIEFK  435


>Q55BQ2_DICDI unnamed protein product
Length=310

 Score = 30.0 bits (66),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 47/121 (39%), Gaps = 23/121 (19%)

Query  262  TADLPTVPTLDPKKKMKLRDWYN---------------DINLSFKCPDPEMNLAEDTPKH  306
            T ++     LD  KK  L  W N               D +  FKC D E ++ +  PK 
Sbjct  5    TIEINQEGILDFVKKSSLSKWKNRYVRLVDGGIYIYKTDKDEDFKCIDLEFSVLDSNPKE  64

Query  307  PLNREKKLEELKTIEDSLKKP-LVSVGEWHEIKTEKLTKNIKSHRTRRQAKIPT-DSSIA  364
              NR         I DS  K  L S     E    K  +N+K    ++ +  PT DS++A
Sbjct  65   AGNRPNSF----LIRDSHNKAFLFSANTSQEY--NKWLENVKRSTGKKNSGCPTFDSAVA  118

Query  365  K  365
            K
Sbjct  119  K  119



Lambda      K        H
   0.319    0.136    0.393 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11746866096


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933665.1 5'-deoxynucleotidase HDDC2 [Chelonus insularis]

Length=195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38DT8_TRYB2  unnamed protein product                                 137     6e-41
Q21829_CAEEL  unnamed protein product                                 28.5    3.7  
Q8MYR7_DROME  unnamed protein product                                 28.5    4.5  


>Q38DT8_TRYB2 unnamed protein product
Length=182

 Score = 137 bits (344),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 114/179 (64%), Gaps = 8/179 (4%)

Query  8    EFVELVGRLKHLKRTGWVLKGISEPETVASHMFRMAMFSFLVDSTENLNRTKIMQMALIH  67
            EF+  VG+LK   RTGWV  G+ +PE+V+ HM+R A+   +   + +LNR ++++MAL H
Sbjct  5    EFLHTVGKLKETMRTGWVETGVHQPESVSDHMYRAALLCMMCPDS-SLNRDRLVRMALCH  63

Query  68   DLAECIVGDITPHCGVSVEEKHKLEDNAMVNICQLLGNKGP---ELLDLFREYELQESPE  124
            D+ E I+GDI+P  GV   EKHK E  A++++  LL +  P   EL +L+ EYE Q +PE
Sbjct  64   DVGESIIGDISPKMGVPAAEKHKREKEAILHLRGLLPHDSPLEKELQELWEEYETQGTPE  123

Query  125  AKYVKDLDRFDLIAQAYEYERRDKIPGELE-EFFSNTTDKINHPFIQQMAAEVLQRRQN  182
            A++++D+D  +++ QA+ YE   K   EL  + F  + +KI HP+++ +   ++  R +
Sbjct  124  ARFLRDIDLLEMVTQAHAYE---KTHPELNFDSFYVSGEKIKHPWVRSIYDNLVSTRPS  179


>Q21829_CAEEL unnamed protein product
Length=713

 Score = 28.5 bits (62),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 35/66 (53%), Gaps = 3/66 (5%)

Query  10   VELVGRLKHL-KRTG-WVLKGISEPETVASHMFRMAMFSFLVDSTENLNRTKIMQMALIH  67
            V+L+  L H  + TG + L+ +  P +      +   FSF  +  E+LN+  + Q++ + 
Sbjct  401  VQLIALLPHQDEETGVFYLRSVKLPFSDDMRTLKFPKFSF-DEEDEDLNKPTVAQLSAVD  459

Query  68   DLAECI  73
            DL +C+
Sbjct  460  DLIDCM  465


>Q8MYR7_DROME unnamed protein product
Length=1308

 Score = 28.5 bits (62),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 23/40 (58%), Gaps = 0/40 (0%)

Query  27   KGISEPETVASHMFRMAMFSFLVDSTENLNRTKIMQMALI  66
            K +S+P  +A H+  + + S +VD+ +  NR K+    L+
Sbjct  462  KLVSKPILIAPHLIWLQLLSEMVDTAKYCNRDKVEMFCLL  501



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933666.1 uncharacterized protein F58A4.6 [Chelonus insularis]

Length=254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDR1_CAEEL  unnamed protein product                                   35.0    0.059
Q38DN8_TRYB2  unnamed protein product                                 28.1    9.3  


>WDR1_CAEEL unnamed protein product
Length=611

 Score = 35.0 bits (79),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 10/118 (8%)

Query  113  INLIMPKKQFLDYKWNRIITVLALERRELNYAMSWLSTLGGAFSAMGEQFDSCAKVAGKI  172
            I+  +  + F D     I  +    + +L + +SW   L     A G   DS   VA K+
Sbjct  353  ISTGISNRVFPDVHATMITGIKTTSKGDL-FTVSWDDHLK-VVPAGGSGVDSSKAVANKL  410

Query  173  SMHQFKLALRLNDPLLIARCRLYACLSLIQQNKLKLPRTEIPRIYEFA--KLNEDKQL  228
            S     LA+  +  + +A C  Y  +++    KL    TE+P  Y  +   L+ DKQ 
Sbjct  411  SSQPLGLAVSADGDIAVAAC--YKHIAIYSHGKL----TEVPISYNSSCVALSNDKQF  462


>Q38DN8_TRYB2 unnamed protein product
Length=770

 Score = 28.1 bits (61),  Expect = 9.3, Method: Composition-based stats.
 Identities = 13/39 (33%), Positives = 19/39 (49%), Gaps = 0/39 (0%)

Query  78   TSDVYRQSAIKLLKYLILSRMENDVGRDSDAFVIFINLI  116
            T D  R   IK +K++++SR+     R  D   I I  I
Sbjct  299  TDDTLRNGLIKTVKWMLVSRLHRAGTRTEDILAILIGTI  337



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933667.1 zinc finger protein 430-like [Chelonus insularis]

Length=384
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLAS_DROME  unnamed protein product                                   136     4e-35
A0A0R4YI50_DROME  unnamed protein product                             131     4e-33
M9PB02_DROME  unnamed protein product                                 130     4e-33


>GLAS_DROME unnamed protein product
Length=604

 Score = 136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 90/133 (68%), Gaps = 0/133 (0%)

Query  238  CKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSSLNTHKRIHSGEKPHQCLVC  297
            C++CGK++ RPS LK H+RTH+GE+P+ C  CNK FS +++L  H R H+G+KP +C +C
Sbjct  439  CRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPIC  498

Query  298  GKKFTASSNLYYHRMTHIKEKPHKCSQCSKSFPTPGDLKSHMYVHNGLWPFRCHVCNRGF  357
             ++F+ SS++  H  TH  E+P++CS C KSF     L  H+ +H+G  P++C +C   F
Sbjct  499  DRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRF  558

Query  358  SKPTNLKNHMLLH  370
            S+  NL  HM +H
Sbjct  559  SQSGNLNRHMRVH  571


 Score = 97.8 bits (242),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 66/112 (59%), Gaps = 0/112 (0%)

Query  262  KPHVCMVCNKGFSTSSSLNTHKRIHSGEKPHQCLVCGKKFTASSNLYYHRMTHIKEKPHK  321
            KP++C +C K ++  S+L TH R HSGE+P++C  C K F+ ++NL  H  TH  +KP +
Sbjct  435  KPNLCRLCGKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFR  494

Query  322  CSQCSKSFPTPGDLKSHMYVHNGLWPFRCHVCNRGFSKPTNLKNHMLLHLGR  373
            C  C + F     + +HM  H+G  P+RC  C + FS  + L  H+ +H G 
Sbjct  495  CPICDRRFSQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGE  546


>A0A0R4YI50_DROME unnamed protein product
Length=698

 Score = 131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 87/149 (58%), Gaps = 1/149 (1%)

Query  219  HLDCSILTTIKRGERVLLPCKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSS  278
            H + +    +  G R  + CKVCGK F + S L RH   HT EKPH C  C K F+ SS+
Sbjct  330  HYNLTRHMPVHTGARPFV-CKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSST  388

Query  279  LNTHKRIHSGEKPHQCLVCGKKFTASSNLYYHRMTHIKEKPHKCSQCSKSFPTPGDLKSH  338
            LNTH RIH+G KP  C  CGK F    N   H++TH  EK +KC+ C+K+F    +L  H
Sbjct  389  LNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFH  448

Query  339  MYVHNGLWPFRCHVCNRGFSKPTNLKNHM  367
            M+ HN   P+ C VC +GF +  +LK HM
Sbjct  449  MHTHNDKKPYTCRVCAKGFCRNFDLKKHM  477


 Score = 121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 77/140 (55%), Gaps = 0/140 (0%)

Query  231  GERVLLPCKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSSLNTHKRIHSGEK  290
            G+     C  CGK F+    L RHM  HTG +P VC VC KGF  +S+L  HK IH+ EK
Sbjct  313  GKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEK  372

Query  291  PHQCLVCGKKFTASSNLYYHRMTHIKEKPHKCSQCSKSFPTPGDLKSHMYVHNGLWPFRC  350
            PH+C  CGK F  SS L  H   H   KP  C  C K F   G+ K+H   H+G   ++C
Sbjct  373  PHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKC  432

Query  351  HVCNRGFSKPTNLKNHMLLH  370
            ++CN+ F +  NL  HM  H
Sbjct  433  NICNKAFHQVYNLTFHMHTH  452


 Score = 99.4 bits (246),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 2/116 (2%)

Query  259  TGEKPHV--CMVCNKGFSTSSSLNTHKRIHSGEKPHQCLVCGKKFTASSNLYYHRMTHIK  316
            +G KP    C+ C K F+   +L  H  +H+G +P  C VCGK F  +S L  H++ H  
Sbjct  311  SGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTS  370

Query  317  EKPHKCSQCSKSFPTPGDLKSHMYVHNGLWPFRCHVCNRGFSKPTNLKNHMLLHLG  372
            EKPHKC  C K+F     L +H  +H G  PF C  C +GF +  N KNH L H G
Sbjct  371  EKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSG  426


 Score = 42.7 bits (99),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 29/54 (54%), Gaps = 1/54 (2%)

Query  231  GERVLLPCKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSSLNTHKR  284
            GE+    C +C K+F +   L  HM TH  +KP+ C VC KGF  +  L  H R
Sbjct  426  GEKAYK-CNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMR  478


>M9PB02_DROME unnamed protein product
Length=654

 Score = 130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 87/149 (58%), Gaps = 1/149 (1%)

Query  219  HLDCSILTTIKRGERVLLPCKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSS  278
            H + +    +  G R  + CKVCGK F + S L RH   HT EKPH C  C K F+ SS+
Sbjct  330  HYNLTRHMPVHTGARPFV-CKVCGKGFRQASTLCRHKIIHTSEKPHKCQTCGKAFNRSST  388

Query  279  LNTHKRIHSGEKPHQCLVCGKKFTASSNLYYHRMTHIKEKPHKCSQCSKSFPTPGDLKSH  338
            LNTH RIH+G KP  C  CGK F    N   H++TH  EK +KC+ C+K+F    +L  H
Sbjct  389  LNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLTFH  448

Query  339  MYVHNGLWPFRCHVCNRGFSKPTNLKNHM  367
            M+ HN   P+ C VC +GF +  +LK HM
Sbjct  449  MHTHNDKKPYTCRVCAKGFCRNFDLKKHM  477


 Score = 120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 77/140 (55%), Gaps = 0/140 (0%)

Query  231  GERVLLPCKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSSLNTHKRIHSGEK  290
            G+     C  CGK F+    L RHM  HTG +P VC VC KGF  +S+L  HK IH+ EK
Sbjct  313  GKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEK  372

Query  291  PHQCLVCGKKFTASSNLYYHRMTHIKEKPHKCSQCSKSFPTPGDLKSHMYVHNGLWPFRC  350
            PH+C  CGK F  SS L  H   H   KP  C  C K F   G+ K+H   H+G   ++C
Sbjct  373  PHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKC  432

Query  351  HVCNRGFSKPTNLKNHMLLH  370
            ++CN+ F +  NL  HM  H
Sbjct  433  NICNKAFHQVYNLTFHMHTH  452


 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 63/116 (54%), Gaps = 2/116 (2%)

Query  259  TGEKPHV--CMVCNKGFSTSSSLNTHKRIHSGEKPHQCLVCGKKFTASSNLYYHRMTHIK  316
            +G KP    C+ C K F+   +L  H  +H+G +P  C VCGK F  +S L  H++ H  
Sbjct  311  SGGKPKTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTS  370

Query  317  EKPHKCSQCSKSFPTPGDLKSHMYVHNGLWPFRCHVCNRGFSKPTNLKNHMLLHLG  372
            EKPHKC  C K+F     L +H  +H G  PF C  C +GF +  N KNH L H G
Sbjct  371  EKPHKCQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSG  426


 Score = 43.1 bits (100),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 29/54 (54%), Gaps = 1/54 (2%)

Query  231  GERVLLPCKVCGKSFDRPSLLKRHMRTHTGEKPHVCMVCNKGFSTSSSLNTHKR  284
            GE+    C +C K+F +   L  HM TH  +KP+ C VC KGF  +  L  H R
Sbjct  426  GEKAYK-CNICNKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMR  478



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933668.1 lachesin [Chelonus insularis]

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2JCW3_DROME  unnamed protein product                                 328     2e-107
B7Z153_DROME  unnamed protein product                                 320     6e-104
Q9W4R3_DROME  unnamed protein product                                 317     4e-103


>X2JCW3_DROME unnamed protein product
Length=534

 Score = 328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 224/348 (64%), Gaps = 11/348 (3%)

Query  27   PVFLAPLENHTVTQGRDVSFTCVVNHLHNFRVAWIKSDSRAILAIHTHMVTHNPRLSVTH  86
            P F+ PLEN T+ QGRD +FTCVVN+L   RVAWIK+D++AILAIH H++T+N RLSV H
Sbjct  88   PDFVIPLENVTIAQGRDATFTCVVNNLGGHRVAWIKADAKAILAIHEHVITNNDRLSVQH  147

Query  87   NGHDTWKLHISNVQKNDSGTYMCQVNTDPMRSQMGYMVVQIPPDIMDDESTDGYVTQERG  146
            N ++TW L+I  V+  D+G YMCQVNTDPM+ Q   + V IPPDI+++E++   +  E G
Sbjct  148  NDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEETSGDMMVPEGG  207

Query  147  NIKLRCVATGIPQPTVTWRREDGRNITLREEGREKISVKNFDGETLNLTGVLRQEMGNYL  206
            + KL C A G P+P +TWRREDGR I  R    +K   ++ +GE L L+ + R EMG Y+
Sbjct  208  SAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLSKITRSEMGAYM  267

Query  207  CIASNGVPPTISKRYSVQVHFLPVIKVTNQLVGAPVNRNVTLECIVEASPRAMNTWYNNK  266
            CIASNGVPPT+SKR  +QVHF P+++V NQLVGAPV  +VTL C VEASP+A+N W    
Sbjct  268  CIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEASPKAINYWQREN  327

Query  267  GEKLMHNGKYTMSESALPDGYSWQMNLTIHNLEKKDFGSYACAAVNALGRAEAAVRLQEL  326
            GE ++   +Y ++E    + Y+ +M L I  L+  DFG Y C + N++G  E  +RL E+
Sbjct  328  GEMIIAGDRYALTEKE-NNMYAIEMILHIKRLQSSDFGGYKCISKNSIGDTEGTIRLYEM  386

Query  327  ELVTETTPG-PISRNTDAKVRKKIYGKKKINTINRRPHDGYTEFNNNL  373
            E      PG  I R+ D         K ++   + R  DG    N  L
Sbjct  387  E-----RPGKKILRDDDLNE----VSKNEVVQKDTRSEDGSRNLNGRL  425


>B7Z153_DROME unnamed protein product
Length=555

 Score = 320 bits (819),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 165/359 (46%), Positives = 224/359 (62%), Gaps = 22/359 (6%)

Query  27   PVFLAPLENHTVTQGRDVSFTCVVNHLHNFRV-----------AWIKSDSRAILAIHTHM  75
            P F+ PLEN T+ QGRD +FTCVVN+L   RV           AWIK+D++AILAIH H+
Sbjct  98   PDFVIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHV  157

Query  76   VTHNPRLSVTHNGHDTWKLHISNVQKNDSGTYMCQVNTDPMRSQMGYMVVQIPPDIMDDE  135
            +T+N RLSV HN ++TW L+I  V+  D+G YMCQVNTDPM+ Q   + V IPPDI+++E
Sbjct  158  ITNNDRLSVQHNDYNTWTLNIRGVKMEDAGKYMCQVNTDPMKMQTATLEVVIPPDIINEE  217

Query  136  STDGYVTQERGNIKLRCVATGIPQPTVTWRREDGRNITLREEGREKISVKNFDGETLNLT  195
            ++   +  E G+ KL C A G P+P +TWRREDGR I  R    +K   ++ +GE L L+
Sbjct  218  TSGDMMVPEGGSAKLVCRARGHPKPKITWRREDGREIIARNGSHQKTKAQSVEGEMLTLS  277

Query  196  GVLRQEMGNYLCIASNGVPPTISKRYSVQVHFLPVIKVTNQLVGAPVNRNVTLECIVEAS  255
             + R EMG Y+CIASNGVPPT+SKR  +QVHF P+++V NQLVGAPV  +VTL C VEAS
Sbjct  278  KITRSEMGAYMCIASNGVPPTVSKRMKLQVHFHPLVQVPNQLVGAPVLTDVTLICNVEAS  337

Query  256  PRAMNTWYNNKGEKLMHNGKYTMSESALPDGYSWQMNLTIHNLEKKDFGSYACAAVNALG  315
            P+A+N W    GE ++   +Y ++E    + Y+ +M L I  L+  DFG Y C + N++G
Sbjct  338  PKAINYWQRENGEMIIAGDRYALTEKE-NNMYAIEMILHIKRLQSSDFGGYKCISKNSIG  396

Query  316  RAEAAVRLQELELVTETTPG-PISRNTDAKVRKKIYGKKKINTINRRPHDGYTEFNNNL  373
              E  +RL E+E      PG  I R+ D         K ++   + R  DG    N  L
Sbjct  397  DTEGTIRLYEME-----RPGKKILRDDDLNE----VSKNEVVQKDTRSEDGSRNLNGRL  446


>Q9W4R3_DROME unnamed protein product
Length=554

 Score = 317 bits (813),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/310 (47%), Positives = 211/310 (68%), Gaps = 8/310 (3%)

Query  27   PVFLAPLENHTVTQGRDVSFTCVVNHLHNFRVAWIKSDSRAILAIHTHMVTHNPRLSVTH  86
            P F+  + N +V  GRD +FTC V HL  +RV W+K+D++AI AIH +++THNPR++V+H
Sbjct  42   PEFVESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSH  101

Query  87   NGHDTWKLHISNVQKNDSGTYMCQVNTDPMRSQMGYMVVQIPPDIMDDESTDGYVTQERG  146
               +TW LHI  V + D G YMCQ+NTDPM+SQ+G++ V IPPD + ++++   +  E  
Sbjct  102  LDQNTWNLHIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDVIVPEGS  161

Query  147  NIKLRCVATGIPQPTVTWRREDGRNITLREEGREKISVKNFDGETLNLTGVLRQEMGNYL  206
            +++L C A G P+P VTWRREDG  I L++    K    +F GE L L+ + R EMG+YL
Sbjct  162  SVRLTCRARGYPEPIVTWRREDGNEIVLKDNVGTKTLAPSFRGEVLKLSKISRNEMGSYL  221

Query  207  CIASNGVPPTISKRYSVQVHFLPVIKVTNQLVGAPVNRNVTLECIVEASPRAMNTWYNNK  266
            CIASNGVPP++SKR S+ +HF PVI+V NQLVGAP+  +V +EC VEASP+++N W  + 
Sbjct  222  CIASNGVPPSVSKRISLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDT  281

Query  267  GEKLMHNGKYTMSESALPDGYSWQMNLTIHNLEKKDFGSYACAAVNALGRAEAAVRLQEL  326
            GE ++ +GKY + ES+    Y  +M++ +   +K D GSY C A N+LG  ++++RL E+
Sbjct  282  GEMIVTSGKYHVQESSQ-SMYETKMSMIVRKFQKDDVGSYRCIAKNSLGEVDSSIRLYEI  340

Query  327  ELVTETTPGP  336
                   PGP
Sbjct  341  -------PGP  343



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933669.1 uncharacterized protein LOC118063677 [Chelonus
insularis]

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMP3_DROME  unnamed protein product                                 33.9    0.33 
O45028_DROME  unnamed protein product                                 33.9    0.42 
RS15A_DROME  unnamed protein product                                  30.0    1.8  


>Q9VMP3_DROME unnamed protein product
Length=913

 Score = 33.9 bits (76),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 81/183 (44%), Gaps = 21/183 (11%)

Query  243  SFALFEIIRLLISQNLHTRMKTLPLRLFFITVLIYFLIIQATFHGHLAKFLTHPDLRKHV  302
            S AL+ ++  +++Q      + LP+RL      I+ L+I  T+   LA F+T   +   +
Sbjct  602  SNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDI  661

Query  303  ETLTDL---NKFGY-----------------TSDRIDFPINISIRRIDSPRRAQICLRKI  342
             +L DL   NK  +                 T +R+ +   +S +     +  +  + ++
Sbjct  662  GSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEGVDRV  721

Query  343  LLN-NSLACVLDHATLLYYSRKNEKLYVSEKPSEDEYYGYIVRRHAPLLKRINLFFMSLE  401
             L+  + A +++   L YY ++N +L    +   +++YG  V  +A     +++  + L 
Sbjct  722  KLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLS  781

Query  402  DFG  404
            + G
Sbjct  782  ERG  784


>O45028_DROME unnamed protein product
Length=913

 Score = 33.9 bits (76),  Expect = 0.42, Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 80/183 (44%), Gaps = 21/183 (11%)

Query  243  SFALFEIIRLLISQNLHTRMKTLPLRLFFITVLIYFLIIQATFHGHLAKFLTHPDLRKHV  302
            S AL+ ++  +++Q      + LP+RL      I+ L+I  T+   LA F+T   +   +
Sbjct  602  SNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFALLISQTYIAKLAAFITSSKIAGDI  661

Query  303  ETLTDL---NKFGY-----------------TSDRIDFPINISIRRIDSPRRAQICLRKI  342
             +L DL   NK  +                 T +R+ +   +S +     +  +  +  +
Sbjct  662  GSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKMLSFKPDAFTKNNEEAVDPV  721

Query  343  LLN-NSLACVLDHATLLYYSRKNEKLYVSEKPSEDEYYGYIVRRHAPLLKRINLFFMSLE  401
             L+  + A +++   L YY ++N +L    +   +++YG  V  +A     +++  + L 
Sbjct  722  KLSKGTYAFLMETTNLQYYVQRNCELTQIGESFGEKHYGIAVPLNADFRSNLSVGILRLS  781

Query  402  DFG  404
            + G
Sbjct  782  ERG  784


>RS15A_DROME unnamed protein product
Length=130

 Score = 30.0 bits (66),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 28/53 (53%), Gaps = 4/53 (8%)

Query  274  VLIYFLIIQATFHGHLAKFLTHPDLR--KHVETLTD-LNKFGYTSDRIDFPIN  323
            V+I FL +    HG++ +F    D R  K V  LT  LNK G  S R D PIN
Sbjct  33   VIIKFLTVMMK-HGYIGEFEIVDDHRSGKIVVNLTGRLNKCGVISPRFDVPIN  84



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933670.1 E3 ubiquitin-protein ligase UBR2 [Chelonus insularis]

Length=1793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBR1_CAEEL  unnamed protein product                                   405     5e-115
M9PDZ8_DROME  unnamed protein product                                 110     9e-24 
UBR3_DROME  unnamed protein product                                   110     1e-23 


>UBR1_CAEEL unnamed protein product
Length=2058

 Score = 405 bits (1042),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 290/979 (30%), Positives = 476/979 (49%), Gaps = 104/979 (11%)

Query  373   IVEGILRRDSQLWKAARTAWHKLLISGMLMEYESKKALATVFTNNYGTVMKDFIRDDHDH  432
             ++E IL +D+Q+WKA R+  H++L+  + M Y+ K   A  F  +Y  + +DFI+DDH+ 
Sbjct  444   MLENILLQDTQMWKAGRSILHQMLMRTVFMIYDQKVRFAKAFMLHYNEIYEDFIKDDHEM  503

Query  433   SFSISSLSVQLFTVPTLAHYLIANHDVLFILLNTFISESSRRC------NAAGKLEFERN  486
               S+  LSVQ  TVP+LA  L+A  D  F +++  I + + +           + +F   
Sbjct  504   DVSVVGLSVQFMTVPSLARKLVA-EDQAFSVISKAIRDQTDKFVKYYNDGKIARFDFTSR  562

Query  487   VPNTPFKRAQYILCDLAYLLSSKPDT--WTDELRKGFLQGLSLLLNLLASMQSMDAVLRQ  544
                   +R+ +I  D+AY+L++ P    W  EL  GF+QG +  L  L  +Q MD V RQ
Sbjct  563   SFPPELRRSLHITRDMAYILNAVPSESDWNRELIDGFVQGFADFLLFLQHLQGMDEVKRQ  622

Query  545   VGQHMEYEPEWESAFNLHIKLSPVISLALEWCGSDKIVLVKAFRAVLKKLGEQ-----SG  599
               +H  +E EWE+AFN+ ++L   IS+ + W  +++ V  +     L+ +          
Sbjct  623   AVEHQVWESEWETAFNILLRLKDAISMIIGWAETNEEVHNRLMIMCLELMNRMPPVYTKS  682

Query  600   NDSTPRVLREIEHHSASCIQYDVSSEPVSIHLPLSRFLAGLF-------LYLEKYN----  648
              + T  +   I   S     +DV     S+H P+ R +AGLF         L + N    
Sbjct  683   EEDTYELTVTINGESCRISHFDVLKSSTSVHQPVVRIIAGLFSASNYTGFLLNRSNNSHT  742

Query  649   -LNFES-EEFVISDNLTLEQLIEPVLRAQAMISQVHAGMWRRNGYSLLNQLYFYHNVRCR  706
              LN E  +E +   + T   L E  LR   + +Q +A +WRRNG+SL+NQ++ Y +  CR
Sbjct  743   SLNQERIKELINCKDET--NLYELSLRVLVLCAQSNATLWRRNGFSLINQIHNYFSPLCR  800

Query  707   TEMLDRDINLLQVGASLIESNEFLIHILNKFNLINWADPNFETNVIK----NPEEDSIRQ  762
              EM DRD+ ++QVGA+L  S +F+ H+L++F L  WA   FE +        PE + + +
Sbjct  801   NEMFDRDVLMMQVGAALTPSTKFIFHLLHRFRLFKWATSEFEQDKANEKPAKPESEDLSK  860

Query  763   TINLV-EEFLGLLITIIGERHIPGVGQVTSDDRLKKEIIQQLCIKPMSHSELNKTLPDGV  821
             T+ ++ EEF+  LI I+ ER+  GVG+    D++K+E+I  LC    + S + + +   +
Sbjct  861   TLVMIAEEFIQCLILILCERYTYGVGKTRPMDQMKREVIHILCTGSHTFSHIQQKMSHDI  920

Query  822   HHE-IGLERVINDIADFKKSAQNSVGKRLYELNSHLYDEYNVFFYHYTKEELSKSEEAQ-  879
             + + + L   +N +ADF+K    + G+  +         Y+ FF HY+K + S +E++Q 
Sbjct  921   NSKRLSLHEAVNLVADFRKPLATTAGQ--FHCKESSLPTYSPFFMHYSKSDQSAAEQSQA  978

Query  880   RKRKKAMGELECCPPPQLPRLTETFSLVANLLRCDVMLHIMQTVLERARNLRARSFSESQ  939
             R R K    +  C PP LP     F  +  +L  +V++H+++ +++R    R+R  S+  
Sbjct  979   RVRAKMEKSVRACAPPILPDFQTFFERIPEILTTNVLIHVVRLIIDRTAR-RSRFSSDRL  1037

Query  940   IHKILHLIGYALQEQMTGYYSFLNFTERAAQK-NILNLLEDLLNNPRIDAHKDLLTWVLK  998
              HK L+LIG AL E+         FT+RA +   +L+LLE L+  P       LL   ++
Sbjct  1038  FHKTLYLIGIALNEEEKN--PSFGFTQRAEESIGLLSLLEGLVGKPESSICPILLEVTVE  1095

Query  999   KYRE--AAGSTINEEKNKNIDAKSAETSASEKDIAKNSKEWRMQMAAQKRAKVMAQMQLM  1056
             KYR+   A + + E       A   + + SE++I         +M    R K MA+M  M
Sbjct  1096  KYRKLIKARAGVPEAA----PAPENKPAQSEEEIKAKRAARAAEM----RQKAMAKMSNM  1147

Query  1057  QKHFMKNNAKLFEETVLDVNKSNERGSSMDLSECIERS---------------------P  1095
             Q  FMK         + D  K +E  +  + SE + +                      P
Sbjct  1148  QSKFMKK--------IEDEEKKDESQTPSEKSETVVKKDDYDNKHFFDEDVVKQVGHDFP  1199

Query  1096  IAVGPNQ-TARLAEEKTYTCILCQADQSVT-VSGDAMVLAAFVQQSTVLCQTRSEPD---  1150
             + +G N+  A L + +T TCILCQ D+ +    G  MV AAF+QQS +        +   
Sbjct  1200  VCIGANKWHAELVKPRTLTCILCQEDEIIAPQQGKPMVCAAFIQQSQLFTHKNKNGELMT  1259

Query  1151  -------EPNPIYLSAKLGASPHTSTCGHVMHAYCWQTHFDNVLAKEHRRPYRLRQPAS-  1202
                      + +   A L      STC H MH  C+++  +   ++E  R  ++ Q +  
Sbjct  1260  ASSGTISTRDLLTAPATLQYGVDVSTCSHSMHYECYRSLAEANRSRESLRARQVGQHSHK  1319

Query  1203  -FDVEKQEYLCPLCECLSNTVLPLLPPLALLQ----PTESNKCNIDFETWLNALQLILDF  1257
               D E  EY CPLC+ LSN  +P+LP   L       T S     +F+TW+  ++     
Sbjct  1320  MVDTENGEYQCPLCKRLSNAAIPVLPAYQLTNQNGFSTVSGAGKENFDTWVARVK-----  1374

Query  1258  RDKENNIETDDASLDDHHK  1276
             R+ E  + ++  S   H +
Sbjct  1375  RNLEMPLSSESVSKKGHSR  1393


 Score = 210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 153/505 (30%), Positives = 236/505 (47%), Gaps = 72/505 (14%)

Query  1355  VDPHEEDSRVPLLAFKSTSYTIHAIEFMLRDSEKPLLGALSSRQKDSLECL----ARISA  1410
             ++ H +   +  + ++ST++   AI   L   +KPL GAL++RQ+D L  +    A +S 
Sbjct  1560  IEKHLKGYVISTVTWQSTAHVARAISSYLHYDKKPLFGALNTRQRDCLSAMARLCASLSH  1619

Query  1411  ILGYTWPPYGDTGRL-----------RTLGNHALHILTMI------LDNPHDG-------  1446
              + +      D  R+           +T G+  L   +           PH G       
Sbjct  1620  NMQFLLHAVSDMLRVFLCEPPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLV  1679

Query  1447  ----PC---------IMDWDSFGILVPLLITF--------PSLFAINSESPPSIIT--GG  1483
                 P          I+  D   + + L++T          S+ + ++     ++T  G 
Sbjct  1680  QLFNPAGPRKNVNLNILQIDILSLAISLMMTIGWTWNNGTQSMNSSSTHQKARLLTPDGS  1739

Query  1484  THELYLLKLVFITLIVKILVT-NEFDSNEA---------MDIDDPDNEEEEKYDALLVLM  1533
               E Y+L+L  +    +I+ T +E D N+          M++D    +   K  AL    
Sbjct  1740  VDEAYVLRLSLLAHYFQIIATHSEADGNDVNMEEEQESQMEVDPVAAQTIRKLYALCHPF  1799

Query  1534  DIINVKTGGLTVREI-WKYIKEASLSFLRCCTLYFHFVTDVPAPIELTTKGGDTYENICM  1592
             D      G L   +I W+ ++E + S LR   L +HF+T V  P  L     ++ E +  
Sbjct  1800  D------GPLRRVDILWRKMEEGAQSLLRPIALLYHFITLVDPPEALKDPSINSSEPLFR  1853

Query  1593  YLGLPTTCDGLLNSENVQKLAKKWMEH--PRTLLKSTHVKEPPKLNSLVSLPDDYSELIN  1650
             YLGLP   +  ++   ++KL   W         L+   V +P + N LV LP+ YS+LIN
Sbjct  1854  YLGLPHKIEEQISGSMLEKLFTMWSSSIPSDQALRQDLVVQPVRPNLLVELPEKYSQLIN  1913

Query  1651  TVSLFTCPTSDREDSRN--PTMCLVCGEMLCSQSYCCQTELNKIMVGACTYHASKCGAGV  1708
              V+ F CPT   E+S +  PT+CLVCG +LCSQ+YCCQ  +NK   GAC YH S+C   V
Sbjct  1914  QVATFKCPTIPIEESTSNVPTLCLVCGTILCSQAYCCQKIINKQSYGACRYHMSQCSGSV  1973

Query  1709  GIFFRVRECEILFLRSPNRGAFACPPYLDEYGETDQGLRRGNPLKLCKNKYKQLNQMWLG  1768
             G+F RVR+C ++ + +  RG F   PY+DE+GE DQG RRGNPL L    Y++L  +WL 
Sbjct  1974  GMFLRVRDCSLVLMTTRKRGCFRPAPYVDEFGEVDQGFRRGNPLHLNPELYQKLKSLWLQ  2033

Query  1769  HGLHEAVARAIESSSNLMSTQWQHL  1793
              G+ E V    E     +   W H 
Sbjct  2034  QGITEEVVNYNEIDFRNVQYDWGHF  2058


 Score = 159 bits (403),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 142/287 (49%), Gaps = 29/287 (10%)

Query  114  VCGKFFRVGEPTYICRECGMDPTCVLCVPCFKESAHQNHKYKIATSGGGGCCDCGDPEAW  173
            +CG  F+ GE TY C +C  D TCV+C+ CF+ S H++HKYK+ +S G G CDCGD +AW
Sbjct  94   ICGHVFKNGELTYTCLDCATDGTCVMCLQCFEVSIHKSHKYKMHSSSGSGYCDCGDADAW  153

Query  174  KRDPFCNIHLAGIQSKESSSNKLPEDIAERATATFEAVLKYCYELLSLEHSPGLPADLRV  233
                 C  H    +  +  +  L  ++ +R     E +L++   +++ +    LP     
Sbjct  154  TEGYACANHE---KKDDEEAAVLAPELKKRCEQLVEIILQFSLSMITHKDDLKLPEIFEK  210

Query  234  KETDEDPLSLLSTTDSYCTVLFNDETHTFEQVISILSRVIKCTQKEAIEFVTNIDRNGRA  293
             + +     + +    Y TVL+NDETHT+E VI +L   I CT+ +A+   T +DR GR+
Sbjct  211  MKPE-----VTNEAQQYLTVLYNDETHTYESVIKVLELYIHCTKDQAMLVATIVDREGRS  265

Query  294  VVKCSDFQHCNELKSDVERFTWRQNSQ---------PLKVLVVHAHVIAHQIFAMKLLGW  344
             VK      C + K DV+R T R  +          PL V V+   + A Q F++ LL W
Sbjct  266  AVKLGSKADCTKAKDDVQRKTARDPTSIRRSSNHNLPLSVKVMDTTLFALQNFSISLLTW  325

Query  345  LQHFISQCEGFRIIFSDVALNTKLP------------DVPIVEGILR  379
            L   +      R I  ++ L++K              D  +V GI+R
Sbjct  326  LNTQMDVFPPLREIVGEILLSSKFALKKNYTRKMKSEDQRLVAGIIR  372


>M9PDZ8_DROME unnamed protein product
Length=2236

 Score = 110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 195/896 (22%), Positives = 350/896 (39%), Gaps = 137/896 (15%)

Query  98    PQQVLQQLRQMEKPPSVCGKFFRVGEPTYICRECGMDPTCVLCVPCFKESAHQNHKYKIA  157
             PQ+ ++ +R  +   + CG  +      Y CR CG+ P   +C  CFK+  H NH + + 
Sbjct  208   PQEFVKIVRSYDNH-AKCGLVWVPHVVAYRCRTCGISPCMSICRDCFKKGNHTNHDFNMF  266

Query  158   TSGGGGCCDCGDPEAWKRDPFCNIHLAGIQSKESSSNKLPEDIAERATATFEAVL-KYCY  216
              S  GG CDCGD    K + FC+ H  GI ++    N+ P  +     A  EA++ K  +
Sbjct  267   LSQAGGACDCGDTSVMKAEGFCSDH--GINNR---VNRDP--VPNNLLAVAEAIMPKLLF  319

Query  217   ELLSLEHSPGLPADLRVKETDEDPLSLLSTTDSYCTVLFN---DETHTFEQVISILSRVI  273
              LL              +E  + PL + + T   C    N   D  +  E +  +++R +
Sbjct  320   RLLQ-----------HFREHSDTPLEVQAITSYSCEEFANMLIDLNNMGEIMRKVMTRTL  368

Query  274   KCTQKEA--IEFVTNIDRNGRAVVKCSDFQHCNELKSD--VERFTWRQNSQPLKVLVVHA  329
                +  A  +E      RNGR       F   N  K +  V RF   +     + L    
Sbjct  369   INPEVYAFFMEAPCQDTRNGR-------FLKANREKYEDAVNRFPNPEPPDEYRDLPALG  421

Query  330   HVIAHQIFAMKLLGWLQHFISQCEGFRIIFSDVALNTKLPDVPIVEGILRRDSQLWKAAR  389
               + H     + + W   F                  + P   +                
Sbjct  422   DKLVHTTLLEEFIFWTFKF------------------EFPQTLVC---------------  448

Query  390   TAWHKLLISGMLMEYESKKALATVFTNNYGTV--MKDFIRDDHDHSFSISSLSVQLFTVP  447
                    +  ML + + K+ L   F  +Y  +  + +  RD    S  +  +SVQLF+  
Sbjct  449   ------FLLNMLPDQDYKEHLTRTFVMHYSRIPSVLEMSRDPDTLSNRVVHMSVQLFSNE  502

Query  448   TLAHYLIANHDVLFILLNTFISESSRRCNAAGKLEFERNVPNTPFKRA----QYILCDLA  503
             +LA  ++    +L +++ +     S+       ++   + PN  F       + ++ D  
Sbjct  503   SLALKMVNELSLLHVMIISLKLMMSKIL-----IQNTLHDPNKNFHFVIDCTRQVMKDHC  557

Query  504   Y--LLSSKPDTWTDE-LRKGFLQGLSLL---LNLLASMQSMDAVLRQVGQHMEYEP-EWE  556
             Y  L+S   +  + E +   FL+  +L+      L  +Q M+  +R+   H+E+EP  + 
Sbjct  558   YWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNVNVRETASHVEFEPNSYY  617

Query  557   SAFNLHIKLS--PVISLALEWC-GSDKIVLVKAFRAVLKKLGEQSGNDSTPRVLREIEHH  613
             +AF+  ++ S  P+ S+      G+   +  K     +  L E          L  I   
Sbjct  618   AAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHEW---------LDSIYFM  668

Query  614   SASCIQYDVSSEPVSIHLPLSRFLAGLFLYLEKYNLNFESEEFVISDNLTLEQLIEPVLR  673
              A     ++     S H PL R+LA  F+      +     + + S    L  L+   LR
Sbjct  669   EARLSMEEMMQ--ASFHFPLHRYLAA-FVCQAVTKMGISLNDVLPSRPYLLPLLMIHPLR  725

Query  674   AQAMISQVHAGMWRRNGYSLLNQLYFYHNVRCRTEMLDRDINLLQVGASLIESNEFLIHI  733
              Q+   ++ AG W RNG  +  Q   Y        M D D+  LQ+ A+ +    FL + 
Sbjct  726   VQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYFFLQNT  785

Query  734   LNKFNLINWADPNFETNVIKNPEEDSIRQTINLVEEFLGLLITIIGERHIPGVGQVTSDD  793
             +  F++  W     ET  +K P++    +  +++E FL  L T++  R   G  + T   
Sbjct  786   IELFDVGQW----LETAPLKQPQK---AEQSSMLEGFLTFLATLVTSRTNLGNDEAT---  835

Query  794   RLKKEIIQQLCIKPMSHSELNKTLPD--GVHHEIGLERVINDIADFK--KSAQNSVGKRL  849
             +   EI   L  +  +HS+L + +P+  G  H    E  +  ++ +K   S   ++ + L
Sbjct  836   QCIIEISALLATENKTHSQLLELMPERSGNVHTKNFETFLKKLSVYKAPSSGSENLEQGL  895

Query  850   Y----ELNSHLYDEYNVFFYHYTKEELSKSEE------AQRKRKKAMGELECCPPPQLPR  899
             +    E+    YD  +V      + +   S +        + +  A G L   PP +LP 
Sbjct  896   FTPIDEVWEKHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNL--WPPFRLPH  953

Query  900   ---LTETFSLVANLLRCDVMLHIMQTVLERARNLRARSFSESQIHKILHLIGYALQ  952
                 T +FS    +L   +    + ++  RA  +  R  SE  +   + L+  A++
Sbjct  954   ALPATSSFSDPCKILNSRIFHSTILSIFFRA--VHTRDVSEHLLALAVFLLEIAVE  1007


 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 16/137 (12%)

Query  1638  LVSLPDDYSELINTV---SLFTCPTSDREDSRNPTMCLVCGEMLCSQSYCCQTELNKIMV  1694
             L+ LP +Y  L           C    +E S    +CL+CG ++C +  CC         
Sbjct  2078  LLELPREYERLFTYYHERPCLNCYKVPKESS----ICLLCGTIVCLKQNCCAEN------  2127

Query  1695  GAC--TYHASKCGAGVGIFFRVRECEILFLRSPNRGAFACPPYLDEYGETDQGLRRGNPL  1752
               C    H   CG G+GIF  V    I+ +R   R       YLD++ E D+ L+RG PL
Sbjct  2128  DCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRG-RRACLWGSLYLDDFDEEDRDLKRGKPL  2186

Query  1753  KLCKNKYKQLNQMWLGH  1769
              L K+++  L   WL H
Sbjct  2187  YLSKDRFNLLESQWLSH  2203


 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 93/264 (35%), Gaps = 72/264 (27%)

Query  1009  NEEKNKNIDAKSAETSASEKDIAKNSKEWRMQMAAQKRAKVMAQMQLMQKHFMKNNAKLF  1068
             +E+  ++ID   A    ++++    +K    +   ++R K   + Q M + F  N  KLF
Sbjct  1422  DEQCAQSIDDIRARLWPNQREKQAEAKAREAKEKEERRKKARERQQKMMQDF-ANKQKLF  1480

Query  1069  EETVLDVNKSNERGSSMDLSECIERSPIAVGPNQTARLA------EEKTYTCILCQADQS  1122
              +                 S     S +  GP              EK Y CI+C     
Sbjct  1481  MQ-----------------SAAASSSGMGYGPEDEDDEELYEEQPREKEYDCIICNCTTP  1523

Query  1123  VTVSGDAMVLAAFVQQSTVLCQTRSEPDE-PNPI-----------------------YLS  1158
              T S + + L   V+ S ++   R   +  P PI                        LS
Sbjct  1524  STES-NPIGLVVLVESSGIVGHRRRIAERLPLPINAEDESRLAHTTRLAAEFNRRTELLS  1582

Query  1159  AKLGASP-------------HTSTCGHVMHAYCWQTHFDNVLAKEHRRPYRLRQPASFDV  1205
              K G                H  +CGH +H  C + +   +   +       RQP     
Sbjct  1583  LKFGDESWYLSNNMAYDNGVHVQSCGHHVHLSCLEAYLKTLYTTQ-------RQPVQ---  1632

Query  1206  EKQEYLCPLCECLSNTVLPLLPPL  1229
             ++ E+ CP+C  LSN+VLPL P L
Sbjct  1633  DRGEFYCPVCRQLSNSVLPLSPQL  1656


>UBR3_DROME unnamed protein product
Length=2219

 Score = 110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 195/896 (22%), Positives = 350/896 (39%), Gaps = 137/896 (15%)

Query  98    PQQVLQQLRQMEKPPSVCGKFFRVGEPTYICRECGMDPTCVLCVPCFKESAHQNHKYKIA  157
             PQ+ ++ +R  +   + CG  +      Y CR CG+ P   +C  CFK+  H NH + + 
Sbjct  208   PQEFVKIVRSYDNH-AKCGLVWVPHVVAYRCRTCGISPCMSICRDCFKKGNHTNHDFNMF  266

Query  158   TSGGGGCCDCGDPEAWKRDPFCNIHLAGIQSKESSSNKLPEDIAERATATFEAVL-KYCY  216
              S  GG CDCGD    K + FC+ H  GI ++    N+ P  +     A  EA++ K  +
Sbjct  267   LSQAGGACDCGDTSVMKAEGFCSDH--GINNR---VNRDP--VPNNLLAVAEAIMPKLLF  319

Query  217   ELLSLEHSPGLPADLRVKETDEDPLSLLSTTDSYCTVLFN---DETHTFEQVISILSRVI  273
              LL              +E  + PL + + T   C    N   D  +  E +  +++R +
Sbjct  320   RLLQ-----------HFREHSDTPLEVQAITSYSCEEFANMLIDLNNMGEIMRKVMTRTL  368

Query  274   KCTQKEA--IEFVTNIDRNGRAVVKCSDFQHCNELKSD--VERFTWRQNSQPLKVLVVHA  329
                +  A  +E      RNGR       F   N  K +  V RF   +     + L    
Sbjct  369   INPEVYAFFMEAPCQDTRNGR-------FLKANREKYEDAVNRFPNPEPPDEYRDLPALG  421

Query  330   HVIAHQIFAMKLLGWLQHFISQCEGFRIIFSDVALNTKLPDVPIVEGILRRDSQLWKAAR  389
               + H     + + W   F                  + P   +                
Sbjct  422   DKLVHTTLLEEFIFWTFKF------------------EFPQTLVC---------------  448

Query  390   TAWHKLLISGMLMEYESKKALATVFTNNYGTV--MKDFIRDDHDHSFSISSLSVQLFTVP  447
                    +  ML + + K+ L   F  +Y  +  + +  RD    S  +  +SVQLF+  
Sbjct  449   ------FLLNMLPDQDYKEHLTRTFVMHYSRIPSVLEMSRDPDTLSNRVVHMSVQLFSNE  502

Query  448   TLAHYLIANHDVLFILLNTFISESSRRCNAAGKLEFERNVPNTPFKRA----QYILCDLA  503
             +LA  ++    +L +++ +     S+       ++   + PN  F       + ++ D  
Sbjct  503   SLALKMVNELSLLHVMIISLKLMMSKIL-----IQNTLHDPNKNFHFVIDCTRQVMKDHC  557

Query  504   Y--LLSSKPDTWTDE-LRKGFLQGLSLL---LNLLASMQSMDAVLRQVGQHMEYEP-EWE  556
             Y  L+S   +  + E +   FL+  +L+      L  +Q M+  +R+   H+E+EP  + 
Sbjct  558   YWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNVNVRETASHVEFEPNSYY  617

Query  557   SAFNLHIKLS--PVISLALEWC-GSDKIVLVKAFRAVLKKLGEQSGNDSTPRVLREIEHH  613
             +AF+  ++ S  P+ S+      G+   +  K     +  L E          L  I   
Sbjct  618   AAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHEW---------LDSIYFM  668

Query  614   SASCIQYDVSSEPVSIHLPLSRFLAGLFLYLEKYNLNFESEEFVISDNLTLEQLIEPVLR  673
              A     ++     S H PL R+LA  F+      +     + + S    L  L+   LR
Sbjct  669   EARLSMEEMMQ--ASFHFPLHRYLAA-FVCQAVTKMGISLNDVLPSRPYLLPLLMIHPLR  725

Query  674   AQAMISQVHAGMWRRNGYSLLNQLYFYHNVRCRTEMLDRDINLLQVGASLIESNEFLIHI  733
              Q+   ++ AG W RNG  +  Q   Y        M D D+  LQ+ A+ +    FL + 
Sbjct  726   VQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYFFLQNT  785

Query  734   LNKFNLINWADPNFETNVIKNPEEDSIRQTINLVEEFLGLLITIIGERHIPGVGQVTSDD  793
             +  F++  W     ET  +K P++    +  +++E FL  L T++  R   G  + T   
Sbjct  786   IELFDVGQW----LETAPLKQPQK---AEQSSMLEGFLTFLATLVTSRTNLGNDEAT---  835

Query  794   RLKKEIIQQLCIKPMSHSELNKTLPD--GVHHEIGLERVINDIADFK--KSAQNSVGKRL  849
             +   EI   L  +  +HS+L + +P+  G  H    E  +  ++ +K   S   ++ + L
Sbjct  836   QCIIEISALLATENKTHSQLLELMPERSGNVHTKNFETFLKKLSVYKAPSSGSENLEQGL  895

Query  850   Y----ELNSHLYDEYNVFFYHYTKEELSKSEE------AQRKRKKAMGELECCPPPQLPR  899
             +    E+    YD  +V      + +   S +        + +  A G L   PP +LP 
Sbjct  896   FTPIDEVWEKHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNL--WPPFRLPH  953

Query  900   ---LTETFSLVANLLRCDVMLHIMQTVLERARNLRARSFSESQIHKILHLIGYALQ  952
                 T +FS    +L   +    + ++  RA  +  R  SE  +   + L+  A++
Sbjct  954   ALPATSSFSDPCKILNSRIFHSTILSIFFRA--VHTRDVSEHLLALAVFLLEIAVE  1007


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 16/137 (12%)

Query  1638  LVSLPDDYSELINTV---SLFTCPTSDREDSRNPTMCLVCGEMLCSQSYCCQTELNKIMV  1694
             L+ LP +Y  L           C    +E S    +CL+CG ++C +  CC         
Sbjct  2078  LLELPREYERLFTYYHERPCLNCYKVPKESS----ICLLCGTIVCLKQNCCAEN------  2127

Query  1695  GAC--TYHASKCGAGVGIFFRVRECEILFLRSPNRGAFACPPYLDEYGETDQGLRRGNPL  1752
               C    H   CG G+GIF  V    I+ +R   R       YLD++ E D+ L+RG PL
Sbjct  2128  DCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRG-RRACLWGSLYLDDFDEEDRDLKRGKPL  2186

Query  1753  KLCKNKYKQLNQMWLGH  1769
              L K+++  L   WL H
Sbjct  2187  YLSKDRFNLLESQWLSH  2203


 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 93/264 (35%), Gaps = 72/264 (27%)

Query  1009  NEEKNKNIDAKSAETSASEKDIAKNSKEWRMQMAAQKRAKVMAQMQLMQKHFMKNNAKLF  1068
             +E+  ++ID   A    ++++    +K    +   ++R K   + Q M + F  N  KLF
Sbjct  1422  DEQCAQSIDDIRARLWPNQREKQAEAKAREAKEKEERRKKARERQQKMMQDF-ANKQKLF  1480

Query  1069  EETVLDVNKSNERGSSMDLSECIERSPIAVGPNQTARLA------EEKTYTCILCQADQS  1122
              +                 S     S +  GP              EK Y CI+C     
Sbjct  1481  MQ-----------------SAAASSSGMGYGPEDEDDEELYEEQPREKEYDCIICNCTTP  1523

Query  1123  VTVSGDAMVLAAFVQQSTVLCQTRSEPDE-PNPI-----------------------YLS  1158
              T S + + L   V+ S ++   R   +  P PI                        LS
Sbjct  1524  STES-NPIGLVVLVESSGIVGHRRRIAERLPLPINAEDESRLAHTTRLAAEFNRRTELLS  1582

Query  1159  AKLGASP-------------HTSTCGHVMHAYCWQTHFDNVLAKEHRRPYRLRQPASFDV  1205
              K G                H  +CGH +H  C + +   +   +       RQP     
Sbjct  1583  LKFGDESWYLSNNMAYDNGVHVQSCGHHVHLSCLEAYLKTLYTTQ-------RQPVQ---  1632

Query  1206  EKQEYLCPLCECLSNTVLPLLPPL  1229
             ++ E+ CP+C  LSN+VLPL P L
Sbjct  1633  DRGEFYCPVCRQLSNSVLPLSPQL  1656



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933671.1 caspase-8 isoform X1 [Chelonus insularis]

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CASP8_DROME  unnamed protein product                                  127     1e-31
DRICE_DROME  unnamed protein product                                  84.3    1e-17
D3YT61_CAEEL  unnamed protein product                                 80.5    1e-16


>CASP8_DROME unnamed protein product
Length=494

 Score = 127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 122/483 (25%), Positives = 212/483 (44%), Gaps = 50/483 (10%)

Query  34   IEHELDIEEKFSILFLMLDD-----FYCFNDLMAIYLQN-GHSDIIIQHLK-KISNWKDK  86
            +E +++  +K  + FL+  D      Y    L+A+   +   SD++I+  K +   W+  
Sbjct  21   VERDMNFAQKVGLCFLLYGDDHSDATYILQKLLAMTRSDFPQSDLLIKFAKSRPETWRRH  80

Query  87   FIEALCIINNQKIITSLGLLMKDLELIHYPFSSRIVSKINVGAKILYKCFESLGVKDQAL  146
             +EALCII  +K++  LG   ++L + + P  + I   ++   K LY+  E L +     
Sbjct  81   LVEALCIIGARKVLRRLGFCWQELRMHYLPHIAGITLHVHPLLKSLYRMCEELSLVQSGR  140

Query  147  LLNAIYKNIEKDE-----RLKNVEILELHALYWI---SVGYITIKPNEGDMRQLLKCLKS  198
            LL  + + +E  +     R  +   LE+  L W+   S+    I     D++ L+  LKS
Sbjct  141  LLLDVREKVESQQAGDPLRFYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKS  200

Query  199  LGHYEKIYYC-----------DIDWYCSKLFKQIKIESTDSKNNLEQHVIIKK------G  241
             G   +               D     +   KQ +IES + ++     +   K      G
Sbjct  201  NGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQ-EIESDNQQSYCSTQIDALKLTRENAG  259

Query  242  LCLIINEMDFRL---FDTEKSLICFQYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAE  298
            + LIIN+  F      D  K L       R G++ D+E L+  F  + + V  + +++  
Sbjct  260  IALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHM  319

Query  299  QIITKIKDFASKNDVYDCFAVCILSHGLLGKIVTIDNATILIDDIDKIMCTKE-MKNTLK  357
             II +I+    ++ V D   V ILSHG    +   ++  + I DI+ ++C+ + +    K
Sbjct  320  GIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPK  379

Query  358  LLIIQACQGDTYGVHTDTDNHL---TTDGVSYNYNLAFYKEYYCFSSTIKDHVSYRHKEE  414
            LLIIQACQ     VH    N L       VS + ++   +      ST+  + + RH + 
Sbjct  380  LLIIQACQEKL--VHKKKPNELFRIDVTTVSPDQHIDMLRAM----STVNGYAALRHTQT  433

Query  415  GSWFITDLCNVLKENKKSIISIEDWKREVIKRVQKRRGKLSDNNCAQLPEATDRLTKKFC  474
            GSWFI  LC+ + + + +   I D    V   V K+RG    N+ + +P       +   
Sbjct  434  GSWFIGSLCDAI-DRRSASEHIADILTIVTNEVSKKRGS---NDESMVPNVKSTFRQHVY  489

Query  475  FPP  477
            FPP
Sbjct  490  FPP  492


>DRICE_DROME unnamed protein product
Length=339

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 92/200 (46%), Gaps = 16/200 (8%)

Query  240  KGLCLIINEMDFRLFDTEKSLICFQYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAEQ  299
            +G+ LI N   F +  T KS        R G+  D ENL      L+FEV  +KD   + 
Sbjct  93   RGMALIFNHEHFEV-PTLKS--------RAGTNVDCENLTRVLKQLDFEVTVYKDCRYKD  143

Query  300  IITKIKDFASKNDV-YDCFAVCILSHGLLGKIVTIDNATILIDDIDKIMCT---KEMKNT  355
            I+  I+  AS+N    DC  V ILSHG +G I   D    L D+I           +   
Sbjct  144  ILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKL-DNIWSFFTANHCPSLAGK  202

Query  356  LKLLIIQACQGDTY-GVHTDTDNHLTTDG-VSYNYNLAFYKEYYCFSSTIKDHVSYRHKE  413
             KL  IQACQGD   G  T   +   TDG  S +Y +  + ++    ST+    S+R+  
Sbjct  203  PKLFFIQACQGDRLDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTT  262

Query  414  EGSWFITDLCNVLKENKKSI  433
             GSWF+  LC  L  N K +
Sbjct  263  RGSWFMQSLCAELAANGKRL  282


>D3YT61_CAEEL unnamed protein product
Length=287

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 112/276 (41%), Gaps = 57/276 (21%)

Query  239  KKGLCLIINEMDFRLFDTEKSLICFQYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAE  298
             +G+CLIIN   F            Q   R G++ D++NL + F  + + V    +L   
Sbjct  25   PRGMCLIINNEHFE-----------QMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGR  73

Query  299  QIITKIKDFASKNDVYDCFAVCILSHGLLGKIVTIDNATIL---IDDIDKIMCTKEMKNT  355
             ++  I+DFA      D   + ILSHG    I+ +D+  I    I D+        + N 
Sbjct  74   GMLLTIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANK  133

Query  356  LKLLIIQACQGDTYGVHTDTDNHL----TTDGVSY-------NYNLAFYKEYYCFS----  400
             K++ +QAC+G+        DN      + DGV         N +   +    C      
Sbjct  134  PKIVFVQACRGER------RDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQ  187

Query  401  ----------------STIKDHVSYRHKEEGSWFITDLCNVLKENKKSIISIE---DWKR  441
                            +T   +VS+R+   GSWFI  +C V   + K +  +E   +  +
Sbjct  188  QVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNK  247

Query  442  EVIKRVQKRRGKLSDNNCAQLPEATDRLTKKFCFPP  477
            +V    Q  +G    N   Q+PE T RL KKF F P
Sbjct  248  KVACGFQTSQGS---NILKQMPEMTSRLLKKFYFWP  280



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933672.1 caspase-8 isoform X1 [Chelonus insularis]

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CASP8_DROME  unnamed protein product                                  127     1e-31
DRICE_DROME  unnamed protein product                                  84.3    1e-17
D3YT61_CAEEL  unnamed protein product                                 80.5    1e-16


>CASP8_DROME unnamed protein product
Length=494

 Score = 127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 122/483 (25%), Positives = 212/483 (44%), Gaps = 50/483 (10%)

Query  34   IEHELDIEEKFSILFLMLDD-----FYCFNDLMAIYLQN-GHSDIIIQHLK-KISNWKDK  86
            +E +++  +K  + FL+  D      Y    L+A+   +   SD++I+  K +   W+  
Sbjct  21   VERDMNFAQKVGLCFLLYGDDHSDATYILQKLLAMTRSDFPQSDLLIKFAKSRPETWRRH  80

Query  87   FIEALCIINNQKIITSLGLLMKDLELIHYPFSSRIVSKINVGAKILYKCFESLGVKDQAL  146
             +EALCII  +K++  LG   ++L + + P  + I   ++   K LY+  E L +     
Sbjct  81   LVEALCIIGARKVLRRLGFCWQELRMHYLPHIAGITLHVHPLLKSLYRMCEELSLVQSGR  140

Query  147  LLNAIYKNIEKDE-----RLKNVEILELHALYWI---SVGYITIKPNEGDMRQLLKCLKS  198
            LL  + + +E  +     R  +   LE+  L W+   S+    I     D++ L+  LKS
Sbjct  141  LLLDVREKVESQQAGDPLRFYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKS  200

Query  199  LGHYEKIYYC-----------DIDWYCSKLFKQIKIESTDSKNNLEQHVIIKK------G  241
             G   +               D     +   KQ +IES + ++     +   K      G
Sbjct  201  NGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQ-EIESDNQQSYCSTQIDALKLTRENAG  259

Query  242  LCLIINEMDFRL---FDTEKSLICFQYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAE  298
            + LIIN+  F      D  K L       R G++ D+E L+  F  + + V  + +++  
Sbjct  260  IALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHM  319

Query  299  QIITKIKDFASKNDVYDCFAVCILSHGLLGKIVTIDNATILIDDIDKIMCTKE-MKNTLK  357
             II +I+    ++ V D   V ILSHG    +   ++  + I DI+ ++C+ + +    K
Sbjct  320  GIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPK  379

Query  358  LLIIQACQGDTYGVHTDTDNHL---TTDGVSYNYNLAFYKEYYCFSSTIKDHVSYRHKEE  414
            LLIIQACQ     VH    N L       VS + ++   +      ST+  + + RH + 
Sbjct  380  LLIIQACQEKL--VHKKKPNELFRIDVTTVSPDQHIDMLRAM----STVNGYAALRHTQT  433

Query  415  GSWFITDLCNVLKENKKSIISIEDWKREVIKRVQKRRGKLSDNNCAQLPEATDRLTKKFC  474
            GSWFI  LC+ + + + +   I D    V   V K+RG    N+ + +P       +   
Sbjct  434  GSWFIGSLCDAI-DRRSASEHIADILTIVTNEVSKKRGS---NDESMVPNVKSTFRQHVY  489

Query  475  FPP  477
            FPP
Sbjct  490  FPP  492


>DRICE_DROME unnamed protein product
Length=339

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 92/200 (46%), Gaps = 16/200 (8%)

Query  240  KGLCLIINEMDFRLFDTEKSLICFQYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAEQ  299
            +G+ LI N   F +  T KS        R G+  D ENL      L+FEV  +KD   + 
Sbjct  93   RGMALIFNHEHFEV-PTLKS--------RAGTNVDCENLTRVLKQLDFEVTVYKDCRYKD  143

Query  300  IITKIKDFASKNDV-YDCFAVCILSHGLLGKIVTIDNATILIDDIDKIMCT---KEMKNT  355
            I+  I+  AS+N    DC  V ILSHG +G I   D    L D+I           +   
Sbjct  144  ILRTIEYAASQNHSDSDCILVAILSHGEMGYIYAKDTQYKL-DNIWSFFTANHCPSLAGK  202

Query  356  LKLLIIQACQGDTY-GVHTDTDNHLTTDG-VSYNYNLAFYKEYYCFSSTIKDHVSYRHKE  413
             KL  IQACQGD   G  T   +   TDG  S +Y +  + ++    ST+    S+R+  
Sbjct  203  PKLFFIQACQGDRLDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTT  262

Query  414  EGSWFITDLCNVLKENKKSI  433
             GSWF+  LC  L  N K +
Sbjct  263  RGSWFMQSLCAELAANGKRL  282


>D3YT61_CAEEL unnamed protein product
Length=287

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 72/276 (26%), Positives = 112/276 (41%), Gaps = 57/276 (21%)

Query  239  KKGLCLIINEMDFRLFDTEKSLICFQYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAE  298
             +G+CLIIN   F            Q   R G++ D++NL + F  + + V    +L   
Sbjct  25   PRGMCLIINNEHFE-----------QMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGR  73

Query  299  QIITKIKDFASKNDVYDCFAVCILSHGLLGKIVTIDNATIL---IDDIDKIMCTKEMKNT  355
             ++  I+DFA      D   + ILSHG    I+ +D+  I    I D+        + N 
Sbjct  74   GMLLTIRDFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANK  133

Query  356  LKLLIIQACQGDTYGVHTDTDNHL----TTDGVSY-------NYNLAFYKEYYCFS----  400
             K++ +QAC+G+        DN      + DGV         N +   +    C      
Sbjct  134  PKIVFVQACRGER------RDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQ  187

Query  401  ----------------STIKDHVSYRHKEEGSWFITDLCNVLKENKKSIISIE---DWKR  441
                            +T   +VS+R+   GSWFI  +C V   + K +  +E   +  +
Sbjct  188  QVWRKKPSQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNK  247

Query  442  EVIKRVQKRRGKLSDNNCAQLPEATDRLTKKFCFPP  477
            +V    Q  +G    N   Q+PE T RL KKF F P
Sbjct  248  KVACGFQTSQGS---NILKQMPEMTSRLLKKFYFWP  280



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933673.1 caspase-8 isoform X2 [Chelonus insularis]

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CASP8_DROME  unnamed protein product                                  125     4e-31
DRICE_DROME  unnamed protein product                                  87.0    1e-18
D3YT61_CAEEL  unnamed protein product                                 82.4    2e-17


>CASP8_DROME unnamed protein product
Length=494

 Score = 125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 120/483 (25%), Positives = 210/483 (43%), Gaps = 57/483 (12%)

Query  34   IEHELDIEEKFSILFLMLDD-----FYCFNDLMAIYLQN-GHSDIIIQHLK-KISNWKDK  86
            +E +++  +K  + FL+  D      Y    L+A+   +   SD++I+  K +   W+  
Sbjct  21   VERDMNFAQKVGLCFLLYGDDHSDATYILQKLLAMTRSDFPQSDLLIKFAKSRPETWRRH  80

Query  87   FIEALCIINNQKIITSLGLLMKDLELIHYPFSSRIVSKINVGAKILYKCFESLGVKDQAL  146
             +EALCII  +K++  LG   ++L + + P  + I   ++   K LY+  E L +     
Sbjct  81   LVEALCIIGARKVLRRLGFCWQELRMHYLPHIAGITLHVHPLLKSLYRMCEELSLVQSGR  140

Query  147  LLNAIYKNIEKDE-----RLKNVEILELHALYWI---SVGYITIKPNEGDMRQLLKCLKS  198
            LL  + + +E  +     R  +   LE+  L W+   S+    I     D++ L+  LKS
Sbjct  141  LLLDVREKVESQQAGDPLRFYDPAYLEIFLLDWLTRRSIKLGDINAAGSDVQLLVGHLKS  200

Query  199  LGHYEKIYYC-----------DIDWYCSKLFKQIKIESTDSKNNLEQHVIIKK------G  241
             G   +               D     +   KQ +IES + ++     +   K      G
Sbjct  201  NGLQAQANLLKDTIISNAPEPDAAGTAAMAVKQ-EIESDNQQSYCSTQIDALKLTRENAG  259

Query  242  LCLIINEMDFR----------LFDTEYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAE  291
            + LIIN+  F           L       R G++ D+E L+  F  + + V  + +++  
Sbjct  260  IALIINQQKFHRNVSRDNMKFLSPDPLRRRDGTDVDKERLIEVFSSMGYNVEAYDNVDHM  319

Query  292  QIITKIKDFASKNDVYDCFAVCILSHGLLGKIVTIDNATILIDDIDKIMCTKE-MKNTLK  350
             II +I+    ++ V D   V ILSHG    +   ++  + I DI+ ++C+ + +    K
Sbjct  320  GIIERIRSACDRSLVRDSLVVFILSHGFEEAVYASNSIAMKITDIEDLLCSYDTLYYKPK  379

Query  351  LLIIQACQGDTYGVHTDTDNHL---TTDGVSYNYNLAFYKEYYCFSSTIKDHVSYRHKEE  407
            LLIIQACQ     VH    N L       VS + ++   +      ST+  + + RH + 
Sbjct  380  LLIIQACQEKL--VHKKKPNELFRIDVTTVSPDQHIDMLRAM----STVNGYAALRHTQT  433

Query  408  GSWFITDLCNVLKENKKSIISIEDWKREVIKRVQKRRGKLSDNNCAQLPEATDRLTKKFC  467
            GSWFI  LC+ + + + +   I D    V   V K+RG    N+ + +P       +   
Sbjct  434  GSWFIGSLCDAI-DRRSASEHIADILTIVTNEVSKKRGS---NDESMVPNVKSTFRQHVY  489

Query  468  FPP  470
            FPP
Sbjct  490  FPP  492


>DRICE_DROME unnamed protein product
Length=339

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 91/193 (47%), Gaps = 9/193 (5%)

Query  240  KGLCLIINEMDFRLFDTEYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAEQIITKIKD  299
            +G+ LI N   F +     ++R G+  D ENL      L+FEV  +KD   + I+  I+ 
Sbjct  93   RGMALIFNHEHFEV--PTLKSRAGTNVDCENLTRVLKQLDFEVTVYKDCRYKDILRTIEY  150

Query  300  FASKNDV-YDCFAVCILSHGLLGKIVTIDNATILIDDIDKIMCT---KEMKNTLKLLIIQ  355
             AS+N    DC  V ILSHG +G I   D    L D+I           +    KL  IQ
Sbjct  151  AASQNHSDSDCILVAILSHGEMGYIYAKDTQYKL-DNIWSFFTANHCPSLAGKPKLFFIQ  209

Query  356  ACQGDTY-GVHTDTDNHLTTDG-VSYNYNLAFYKEYYCFSSTIKDHVSYRHKEEGSWFIT  413
            ACQGD   G  T   +   TDG  S +Y +  + ++    ST+    S+R+   GSWF+ 
Sbjct  210  ACQGDRLDGGVTMQRSQTETDGDSSMSYKIPVHADFLIAYSTVPGFYSWRNTTRGSWFMQ  269

Query  414  DLCNVLKENKKSI  426
             LC  L  N K +
Sbjct  270  SLCAELAANGKRL  282


>D3YT61_CAEEL unnamed protein product
Length=287

 Score = 82.4 bits (202),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 72/269 (27%), Positives = 112/269 (42%), Gaps = 50/269 (19%)

Query  239  KKGLCLIINEMDFRLFDTEYENRKGSEKDEENLVHTFHGLNFEVHRFKDLEAEQIITKIK  298
             +G+CLIIN   F    T    R G++ D++NL + F  + + V    +L    ++  I+
Sbjct  25   PRGMCLIINNEHFEQMPT----RNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIR  80

Query  299  DFASKNDVYDCFAVCILSHGLLGKIVTIDNATIL---IDDIDKIMCTKEMKNTLKLLIIQ  355
            DFA      D   + ILSHG    I+ +D+  I    I D+        + N  K++ +Q
Sbjct  81   DFAKHESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQ  140

Query  356  ACQGDTYGVHTDTDNHL----TTDGVSY-------NYNLAFYKEYYCFS-----------  393
            AC+G+        DN      + DGV         N +   +    C             
Sbjct  141  ACRGER------RDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKP  194

Query  394  ---------STIKDHVSYRHKEEGSWFITDLCNVLKENKKSIISIE---DWKREVIKRVQ  441
                     +T   +VS+R+   GSWFI  +C V   + K +  +E   +  ++V    Q
Sbjct  195  SQADILIAYATTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQ  254

Query  442  KRRGKLSDNNCAQLPEATDRLTKKFCFPP  470
              +G    N   Q+PE T RL KKF F P
Sbjct  255  TSQGS---NILKQMPEMTSRLLKKFYFWP  280



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933674.1 bleomycin hydrolase [Chelonus insularis]

Length=454
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2JEJ0_DROME  unnamed protein product                                 635     0.0  
A8JV22_DROME  unnamed protein product                                 634     0.0  
Q9W3F6_DROME  unnamed protein product                                 634     0.0  


>X2JEJ0_DROME unnamed protein product
Length=551

 Score = 635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/454 (64%), Positives = 363/454 (80%), Gaps = 1/454 (0%)

Query  2    AAPGELTPEILSDFRKKFHQEEKNLLAQNVCTKNDPLECCMSRSNFEETNHVFQYKV-ME  60
            A    +T ++L  +RK F+ E KNLLAQNVC++ DP + C+SR   E TNHVF YKV  E
Sbjct  98   AETSVITNQLLEKWRKNFYSEPKNLLAQNVCSRVDPFDVCLSRKALETTNHVFNYKVETE  157

Query  61   AKPMTNQKNSGRCWIFATLNVIRIPFIKHFNLEEFEFSQPYLFFWDKIERCNYFLHNIVK  120
             KP+TNQ++SGRCW+FA LN IR+PF+K++NL+EFEFSQ +LF+WDKIERCNYFL+N+VK
Sbjct  158  GKPVTNQRSSGRCWLFAALNCIRLPFMKNYNLDEFEFSQAFLFYWDKIERCNYFLNNVVK  217

Query  121  TAKQGEKVEDRLVSFLLHDPTCDGGQWDMICNLINRYGLVPKACFPESWTTESTSRMNSL  180
            TA++GEKV+ RLVSFLL DPT DGGQWDM+ NLI ++GL+PK CFPES++ ES+ RMN++
Sbjct  218  TAQRGEKVDGRLVSFLLLDPTSDGGQWDMLVNLITKHGLMPKKCFPESFSCESSLRMNAI  277

Query  181  LTSKLREFSRELRSLVDDGASNEAIEKRIIEQMTVVYRIVGICVGIPSETITWEYYDKAK  240
            L SKLRE++R LR L++   ++E I  +I EQM  +Y++VGIC+GIPSET TWEYYDK+K
Sbjct  278  LKSKLREYARNLRVLMEKNPTDEEIACKIQEQMAEIYKVVGICLGIPSETFTWEYYDKSK  337

Query  241  NHKSIGPITGLDFYKNHVKPYFNVDDKVCLVTDPRPTHPFGHLYTVDCLGNVVGGRQTLY  300
            N++SIGP++ L+FY+ +VKP+FNV+DKVCLVTDPRPT  +   YTVDCLGNVVGGR  LY
Sbjct  338  NYQSIGPVSSLEFYERYVKPHFNVEDKVCLVTDPRPTSSYDQAYTVDCLGNVVGGRPVLY  397

Query  301  NNQPAEVLLELTAKSIHQQEAVWFGCEVVKRFASKPGFFSLKAHDIMSMFGVDAQLGLSK  360
            NNQ  E+LL +  KS+   EAVWFGCEV KRFASK G   +  HD   +F +D Q   SK
Sbjct  398  NNQSVELLLAVVTKSLKAGEAVWFGCEVSKRFASKQGIEDVDVHDFKLVFDIDIQTTFSK  457

Query  361  ADRLIYGESSMTHAMVFTGVSLDNKGKVTKLRVENSWGEERGDKGYNVMTAEWFNEFVFE  420
            ADRLIYGES+MTHAMVFT VS+D  G   KLRVENSWGE+RG+KGY VM A+WF EF FE
Sbjct  458  ADRLIYGESAMTHAMVFTAVSVDKSGVAQKLRVENSWGEDRGEKGYLVMNADWFREFGFE  517

Query  421  IVVDKKFVPPEVLAVFEQEPRVLPAWDPMGTLAQ  454
            +VVDKK+VP +VL VF+ +P VLPAWDPMGTLAQ
Sbjct  518  VVVDKKYVPEDVLRVFDMDPIVLPAWDPMGTLAQ  551


>A8JV22_DROME unnamed protein product
Length=511

 Score = 634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/454 (64%), Positives = 363/454 (80%), Gaps = 1/454 (0%)

Query  2    AAPGELTPEILSDFRKKFHQEEKNLLAQNVCTKNDPLECCMSRSNFEETNHVFQYKV-ME  60
            A    +T ++L  +RK F+ E KNLLAQNVC++ DP + C+SR   E TNHVF YKV  E
Sbjct  58   AETSVITNQLLEKWRKNFYSEPKNLLAQNVCSRVDPFDVCLSRKALETTNHVFNYKVETE  117

Query  61   AKPMTNQKNSGRCWIFATLNVIRIPFIKHFNLEEFEFSQPYLFFWDKIERCNYFLHNIVK  120
             KP+TNQ++SGRCW+FA LN IR+PF+K++NL+EFEFSQ +LF+WDKIERCNYFL+N+VK
Sbjct  118  GKPVTNQRSSGRCWLFAALNCIRLPFMKNYNLDEFEFSQAFLFYWDKIERCNYFLNNVVK  177

Query  121  TAKQGEKVEDRLVSFLLHDPTCDGGQWDMICNLINRYGLVPKACFPESWTTESTSRMNSL  180
            TA++GEKV+ RLVSFLL DPT DGGQWDM+ NLI ++GL+PK CFPES++ ES+ RMN++
Sbjct  178  TAQRGEKVDGRLVSFLLLDPTSDGGQWDMLVNLITKHGLMPKKCFPESFSCESSLRMNAI  237

Query  181  LTSKLREFSRELRSLVDDGASNEAIEKRIIEQMTVVYRIVGICVGIPSETITWEYYDKAK  240
            L SKLRE++R LR L++   ++E I  +I EQM  +Y++VGIC+GIPSET TWEYYDK+K
Sbjct  238  LKSKLREYARNLRVLMEKNPTDEEIACKIQEQMAEIYKVVGICLGIPSETFTWEYYDKSK  297

Query  241  NHKSIGPITGLDFYKNHVKPYFNVDDKVCLVTDPRPTHPFGHLYTVDCLGNVVGGRQTLY  300
            N++SIGP++ L+FY+ +VKP+FNV+DKVCLVTDPRPT  +   YTVDCLGNVVGGR  LY
Sbjct  298  NYQSIGPVSSLEFYERYVKPHFNVEDKVCLVTDPRPTSSYDQAYTVDCLGNVVGGRPVLY  357

Query  301  NNQPAEVLLELTAKSIHQQEAVWFGCEVVKRFASKPGFFSLKAHDIMSMFGVDAQLGLSK  360
            NNQ  E+LL +  KS+   EAVWFGCEV KRFASK G   +  HD   +F +D Q   SK
Sbjct  358  NNQSVELLLAVVTKSLKAGEAVWFGCEVSKRFASKQGIEDVDVHDFKLVFDIDIQTTFSK  417

Query  361  ADRLIYGESSMTHAMVFTGVSLDNKGKVTKLRVENSWGEERGDKGYNVMTAEWFNEFVFE  420
            ADRLIYGES+MTHAMVFT VS+D  G   KLRVENSWGE+RG+KGY VM A+WF EF FE
Sbjct  418  ADRLIYGESAMTHAMVFTAVSVDKSGVAQKLRVENSWGEDRGEKGYLVMNADWFREFGFE  477

Query  421  IVVDKKFVPPEVLAVFEQEPRVLPAWDPMGTLAQ  454
            +VVDKK+VP +VL VF+ +P VLPAWDPMGTLAQ
Sbjct  478  VVVDKKYVPEDVLRVFDMDPIVLPAWDPMGTLAQ  511


>Q9W3F6_DROME unnamed protein product
Length=488

 Score = 634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/454 (64%), Positives = 363/454 (80%), Gaps = 1/454 (0%)

Query  2    AAPGELTPEILSDFRKKFHQEEKNLLAQNVCTKNDPLECCMSRSNFEETNHVFQYKV-ME  60
            A    +T ++L  +RK F+ E KNLLAQNVC++ DP + C+SR   E TNHVF YKV  E
Sbjct  35   AETSVITNQLLEKWRKNFYSEPKNLLAQNVCSRVDPFDVCLSRKALETTNHVFNYKVETE  94

Query  61   AKPMTNQKNSGRCWIFATLNVIRIPFIKHFNLEEFEFSQPYLFFWDKIERCNYFLHNIVK  120
             KP+TNQ++SGRCW+FA LN IR+PF+K++NL+EFEFSQ +LF+WDKIERCNYFL+N+VK
Sbjct  95   GKPVTNQRSSGRCWLFAALNCIRLPFMKNYNLDEFEFSQAFLFYWDKIERCNYFLNNVVK  154

Query  121  TAKQGEKVEDRLVSFLLHDPTCDGGQWDMICNLINRYGLVPKACFPESWTTESTSRMNSL  180
            TA++GEKV+ RLVSFLL DPT DGGQWDM+ NLI ++GL+PK CFPES++ ES+ RMN++
Sbjct  155  TAQRGEKVDGRLVSFLLLDPTSDGGQWDMLVNLITKHGLMPKKCFPESFSCESSLRMNAI  214

Query  181  LTSKLREFSRELRSLVDDGASNEAIEKRIIEQMTVVYRIVGICVGIPSETITWEYYDKAK  240
            L SKLRE++R LR L++   ++E I  +I EQM  +Y++VGIC+GIPSET TWEYYDK+K
Sbjct  215  LKSKLREYARNLRVLMEKNPTDEEIACKIQEQMAEIYKVVGICLGIPSETFTWEYYDKSK  274

Query  241  NHKSIGPITGLDFYKNHVKPYFNVDDKVCLVTDPRPTHPFGHLYTVDCLGNVVGGRQTLY  300
            N++SIGP++ L+FY+ +VKP+FNV+DKVCLVTDPRPT  +   YTVDCLGNVVGGR  LY
Sbjct  275  NYQSIGPVSSLEFYERYVKPHFNVEDKVCLVTDPRPTSSYDQAYTVDCLGNVVGGRPVLY  334

Query  301  NNQPAEVLLELTAKSIHQQEAVWFGCEVVKRFASKPGFFSLKAHDIMSMFGVDAQLGLSK  360
            NNQ  E+LL +  KS+   EAVWFGCEV KRFASK G   +  HD   +F +D Q   SK
Sbjct  335  NNQSVELLLAVVTKSLKAGEAVWFGCEVSKRFASKQGIEDVDVHDFKLVFDIDIQTTFSK  394

Query  361  ADRLIYGESSMTHAMVFTGVSLDNKGKVTKLRVENSWGEERGDKGYNVMTAEWFNEFVFE  420
            ADRLIYGES+MTHAMVFT VS+D  G   KLRVENSWGE+RG+KGY VM A+WF EF FE
Sbjct  395  ADRLIYGESAMTHAMVFTAVSVDKSGVAQKLRVENSWGEDRGEKGYLVMNADWFREFGFE  454

Query  421  IVVDKKFVPPEVLAVFEQEPRVLPAWDPMGTLAQ  454
            +VVDKK+VP +VL VF+ +P VLPAWDPMGTLAQ
Sbjct  455  VVVDKKYVPEDVLRVFDMDPIVLPAWDPMGTLAQ  488



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933675.1 nuclear export mediator factor NEMF [Chelonus
insularis]

Length=1048
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEMF_DROME  unnamed protein product                                   488     7e-156


>NEMF_DROME unnamed protein product
Length=992

 Score = 488 bits (1255),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 278/564 (49%), Positives = 379/564 (67%), Gaps = 62/564 (11%)

Query  503   IVDIDLELTAFANATKYYNMKRSAAKKHQKTIESHEKALKNAEKKTKQTLKEVQAIHSIN  562
             +VD+DL L+A+ANA +YY+MKRSAA+K +KT+++ +KALK+AE+KT+QTLKEV+ I +I 
Sbjct  459   VVDVDLALSAWANARRYYDMKRSAAQKEKKTVDASQKALKSAERKTQQTLKEVRTISNIV  518

Query  563   KARKVYWFEKFYWFITSENYLVIGGRDQQQNELIVKRYLRPGDLYVHADLTGASSVVLKN  622
             KARKV+WFEKFYWFI+SENYLVIGGRD QQNELIVKRY+RP D+YVHA++ GASSV+++N
Sbjct  519   KARKVFWFEKFYWFISSENYLVIGGRDAQQNELIVKRYMRPKDIYVHAEIQGASSVIIQN  578

Query  623   PSGNPVPPKSLSEAGTMAVAYSIAWDAKVVARAYWVHHDQVSKTAPTGEYLTTGSFMIRG  682
             P+G  +PPK+L EAG+MA++YS+AWDAKVV  +YWV  DQVSKTAPTGEYL TGSFMIRG
Sbjct  579   PTGEEIPPKTLLEAGSMAISYSVAWDAKVVTNSYWVTSDQVSKTAPTGEYLATGSFMIRG  638

Query  683   RKNYLPPCQLVMGLGFLFRLEESSIERHQSERKIKTLEEDKFYVFKEESADEEELKVPED  742
             +KN+LP C L MGL  LF+LE+S IERH  ERK+++LE+D+                   
Sbjct  639   KKNFLPSCHLTMGLSLLFKLEDSFIERHLGERKVRSLEDDQI------------------  680

Query  743   DSDNSDNEGKLEAIEENEKVDDINDNKEDSKSSSDEEGDQVKFPDTQIKLDLSGAQMKF-  801
             D +  +NE + + + +NE   D + N   S+ SS+ E     FP+T++K++    ++   
Sbjct  681   DPNVKENEVEHDLLSDNE---DADSNINLSEPSSNTE--ITAFPNTEVKIEHDTGRIIVR  735

Query  802   --SVDPKSSLKIHQSDEEIIYL------GDDQP---VILKPSLKKKPNQGKVSVTIEEQL  850
               SV+P    +I ++ E  + L       DD+    ++  PS KK+ +  K   T E++ 
Sbjct  736   SDSVNP----EIEETKESEVVLDKILKKTDDEETTIILAGPSRKKQVSAKK---TKEDKA  788

Query  851   KTQESKG------------NSERTKRRQKTKQKKMMNKYKDQDEEDRQIIMEMMKPNPAR  898
             + ++               N  + KR QK K KKM  KYKDQD+E+R+I M ++K     
Sbjct  789   RAKQEAAKQEVPPVSSEPKNPSQVKRGQKGKLKKMKQKYKDQDDEEREIRMMILK-----  843

Query  899   EARKMKKNKKTDHTNQARKKNRNISNQYDTQRQSNNVENIDDDADPGP-APEVDMLNQLT  957
              + K K     D   +  +  +       +    N VE   DDAD  P   +VD+LN LT
Sbjct  844   SSGKEKPQASADKVVEKSESTKEYVKPEKSAAPKNPVEL--DDADEVPVGGDVDVLNSLT  901

Query  958   GKPVEEDELLFAVPVVAPYNAVLNYKFKVKLTPGTGRRGKAAKTALDAFLRDKIITQREK  1017
             G+P E DELLFA+PVVAPY A+ NYKFKVKLTPGTG+RGKAAK AL+ F ++K  + REK
Sbjct  902   GQPHEGDELLFAIPVVAPYQALQNYKFKVKLTPGTGKRGKAAKLALNIFAKEKSCSAREK  961

Query  1018  DLLKAVKEETVARNIPGKVKITTP  1041
             DLLK++KEE++ARNIPGKVK++ P
Sbjct  962   DLLKSIKEESLARNIPGKVKLSAP  985


 Score = 460 bits (1183),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 231/441 (52%), Positives = 303/441 (69%), Gaps = 34/441 (8%)

Query  1    MKTRFDTYDLVCSIAGLQRLIGMRVNQVYDIDHRTYLIRFQRSE--EKCILLLESGNRMH  58
            MKTRF+T+D++C +A LQ+L+G RVNQ+YD+D++TYL R Q +   EK  LL+ESG R H
Sbjct  1    MKTRFNTFDIICGVAELQKLVGWRVNQIYDVDNKTYLFRMQGTGAVEKVTLLIESGTRFH  60

Query  59   TTAFEWPKNTAPSGFSMKMRKHLKNKRLESLTQIGTDRVVDLKFGSDEAAYHVILEVYDR  118
            TT FEWPKN APSGFSMK+RKHLKNKRLE + Q+G+DR+VD +FG+ +AAYHVILE+YDR
Sbjct  61   TTRFEWPKNMAPSGFSMKLRKHLKNKRLEKVQQMGSDRIVDFQFGTGDAAYHVILELYDR  120

Query  119  GNIILTDYQLTILNILRPHTEGDKIRLAVREKYPVDRVHTTTMPPR-KVIESRLAEAKSG  177
            GN+ILTDY+LT L ILRPHTEG+ +R A+REKYPV+R    T     + +   L  A++G
Sbjct  121  GNVILTDYELTTLYILRPHTEGENLRFAMREKYPVERAKQPTKELELEALVKLLENARNG  180

Query  178  ESLKKFLNPLLEFGSALIDHVLLKSGFPS------------------------------N  207
            + L++ L P L+ G A+I+HVLL  G  +                              N
Sbjct  181  DYLRQILTPNLDCGPAVIEHVLLSHGLDNHVIKKETTEETPEAEDKPEKGGKKQRKKQQN  240

Query  208  CKIE-KTFNVKEDMDKLWSALQLADQILEDAKKGPSKGYIFQKKESKPSQDGKDEFMMVN  266
             K+E K F++  D+  L  A++ A +++ +   G SKGYI Q KE KP+++G  EF   N
Sbjct  241  TKLEQKPFDMVNDLPILQQAVKDAQELIAEGNSGKSKGYIIQVKEEKPTENGTVEFFFRN  300

Query  267  IGFHPELLEQCKNQHYKEFDNFDAAVDEYFSTMEGQKLDFKALAQEREALKKLENVRKDH  326
            I FHP L  Q KN     F++F  AVDE++ST E QK+D K L QEREALKKL NV+ DH
Sbjct  301  IEFHPYLFIQFKNFEKATFESFMEAVDEFYSTQESQKIDMKTLQQEREALKKLSNVKNDH  360

Query  327  DQRLAGLGKVQEEDKKKAELISRNQALVDNAILVVQSALAAQMPWPEIEELIKEAQMRND  386
             +RL  L KVQ+ D+KKAELI+ NQ+LVDNAI  VQSA+A+Q+ WP+I EL+KEAQ   D
Sbjct  361  AKRLEELTKVQDVDRKKAELITSNQSLVDNAIRAVQSAIASQLSWPDIHELVKEAQANGD  420

Query  387  PIALAIKKLKFETNHISLYLT  407
             +A +IK+LK ETNHISL L+
Sbjct  421  AVASSIKQLKLETNHISLMLS  441



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933676.1 serine protease inhibitor swm-1-like [Chelonus
insularis]

Length=98
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q21248_CAEEL  unnamed protein product                                 32.7    0.021
Q9U1T5_CAEEL  unnamed protein product                                 29.6    0.35 
IMPI_GALME  unnamed protein product                                   29.3    0.37 


>Q21248_CAEEL unnamed protein product
Length=171

 Score = 32.7 bits (73),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 17/44 (39%), Positives = 19/44 (43%), Gaps = 3/44 (7%)

Query  48   YCPPTCENPRPQICPQACILNVCQCTGGTVRGPNGRCIWPSQCP  91
            + PP C N    +    C    C C  G VR   G CI PS CP
Sbjct  76   FSPPHCLN---HLHHAKCYFPRCVCNDGYVRSEKGICIRPSHCP  116


>Q9U1T5_CAEEL unnamed protein product
Length=796

 Score = 29.6 bits (65),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (49%), Gaps = 2/47 (4%)

Query  45  CGSYCPPTCENPRPQICPQACILNVCQCTGGTV-RGPNGRCIWPSQC  90
           CG+ C PTC  P P  C   C++  CQC  G   R  + RC+    C
Sbjct  35  CGTACEPTCGLPTPTFCTLQCVMG-CQCNSGFFRRTSDNRCVEQKDC  80


 Score = 26.2 bits (56),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 9/57 (16%)

Query  41   RCFECGSYC---PPTCENPRPQICPQACILNVCQCTGGTVRGPNGRCIWPSQCPRRS  94
            RC +C   C    P C  P+ + C +ACI     C  G V+  NG+C+  + CP   
Sbjct  624  RCEKCAGTCKNPEPNCPGPKNKSCKRACI-----CAPGFVKK-NGKCVTLASCPDHD  674


 Score = 25.4 bits (54),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 7/54 (13%)

Query  39   YDRCFECGSYCPPTCENPRPQI-CPQACILNVCQCTGGTVRGPNGRCIWPSQCP  91
            ++ CFE    CP     P+P + C + C +  C C  G +R   G+C+ P++CP
Sbjct  173  HNACFE--KKCP---VKPQPLVNCMEKCDIG-CSCKKGFLRNRQGQCVNPTECP  220


>IMPI_GALME unnamed protein product
Length=170

 Score = 29.3 bits (64),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 28/66 (42%), Gaps = 7/66 (11%)

Query  32  VFCRGGLYDRCFECGSYCPPTCENPRPQICPQACILNV-----CQCTGGTVRGPNGRCIW  86
           + C GG     +ECG  C   C +   Q      I+N+     C C  G  R  NG+CI 
Sbjct  22  LICNGG--HEYYECGGACDNVCADLHIQNKTNCPIINIRCNDKCYCEDGYARDVNGKCIP  79

Query  87  PSQCPR  92
              CP+
Sbjct  80  IKDCPK  85



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933677.1 diuretic hormone class 2 [Chelonus insularis]

Length=105
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DIUX_DROME  unnamed protein product                                   72.8    7e-18
DIUX_RHOPR  unnamed protein product                                   59.7    2e-13
M9PCK8_DROME  unnamed protein product                                 29.3    0.55 


>DIUX_DROME unnamed protein product
Length=116

 Score = 72.8 bits (177),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/73 (51%), Positives = 53/73 (73%), Gaps = 8/73 (11%)

Query  37   QLENDPEAFY-ELISQYNKL-----RELENTKRAYGLDFGLSRGFSGSQTAKHLMGMAAA  90
            +LE  P+    EL++++ +       +LEN+KR   +DFGL+RG+SG+Q AKH MG+AAA
Sbjct  43   ELEEVPDDLLMELMTRFGRTIIRARNDLENSKRT--VDFGLARGYSGTQEAKHRMGLAAA  100

Query  91   NYANGPGRKRRSE  103
            N+A GPGR+RRSE
Sbjct  101  NFAGGPGRRRRSE  113


>DIUX_RHOPR unnamed protein product
Length=31

 Score = 59.7 bits (143),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 27/31 (87%), Positives = 28/31 (90%), Gaps = 0/31 (0%)

Query  66  GLDFGLSRGFSGSQTAKHLMGMAAANYANGP  96
           GLD GLSRGFSGSQ AKHLMG+AAANYA GP
Sbjct  1   GLDLGLSRGFSGSQAAKHLMGLAAANYAGGP  31


>M9PCK8_DROME unnamed protein product
Length=960

 Score = 29.3 bits (64),  Expect = 0.55, Method: Composition-based stats.
 Identities = 25/72 (35%), Positives = 37/72 (51%), Gaps = 9/72 (13%)

Query  21   ASQAAPYSQERQIYLD-QLENDPEAFYELISQYN--------KLRELENTKRAYGLDFGL  71
            A Q A  S+E +I L  QLE   EA  ++  Q N        +LR+L+   +  G D  L
Sbjct  293  AMQRALSSEEDKIKLQTQLEELKEAALQVEQQANAEIDAKESELRQLQLELKKKGKDHRL  352

Query  72   SRGFSGSQTAKH  83
            + GF+ +Q+ KH
Sbjct  353  TGGFASNQSDKH  364



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933678.1 E3 ubiquitin-protein ligase UBR2 [Chelonus insularis]

Length=1793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBR1_CAEEL  unnamed protein product                                   405     5e-115
M9PDZ8_DROME  unnamed protein product                                 110     9e-24 
UBR3_DROME  unnamed protein product                                   110     1e-23 


>UBR1_CAEEL unnamed protein product
Length=2058

 Score = 405 bits (1042),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 290/979 (30%), Positives = 476/979 (49%), Gaps = 104/979 (11%)

Query  373   IVEGILRRDSQLWKAARTAWHKLLISGMLMEYESKKALATVFTNNYGTVMKDFIRDDHDH  432
             ++E IL +D+Q+WKA R+  H++L+  + M Y+ K   A  F  +Y  + +DFI+DDH+ 
Sbjct  444   MLENILLQDTQMWKAGRSILHQMLMRTVFMIYDQKVRFAKAFMLHYNEIYEDFIKDDHEM  503

Query  433   SFSISSLSVQLFTVPTLAHYLIANHDVLFILLNTFISESSRRC------NAAGKLEFERN  486
               S+  LSVQ  TVP+LA  L+A  D  F +++  I + + +           + +F   
Sbjct  504   DVSVVGLSVQFMTVPSLARKLVA-EDQAFSVISKAIRDQTDKFVKYYNDGKIARFDFTSR  562

Query  487   VPNTPFKRAQYILCDLAYLLSSKPDT--WTDELRKGFLQGLSLLLNLLASMQSMDAVLRQ  544
                   +R+ +I  D+AY+L++ P    W  EL  GF+QG +  L  L  +Q MD V RQ
Sbjct  563   SFPPELRRSLHITRDMAYILNAVPSESDWNRELIDGFVQGFADFLLFLQHLQGMDEVKRQ  622

Query  545   VGQHMEYEPEWESAFNLHIKLSPVISLALEWCGSDKIVLVKAFRAVLKKLGEQ-----SG  599
               +H  +E EWE+AFN+ ++L   IS+ + W  +++ V  +     L+ +          
Sbjct  623   AVEHQVWESEWETAFNILLRLKDAISMIIGWAETNEEVHNRLMIMCLELMNRMPPVYTKS  682

Query  600   NDSTPRVLREIEHHSASCIQYDVSSEPVSIHLPLSRFLAGLF-------LYLEKYN----  648
              + T  +   I   S     +DV     S+H P+ R +AGLF         L + N    
Sbjct  683   EEDTYELTVTINGESCRISHFDVLKSSTSVHQPVVRIIAGLFSASNYTGFLLNRSNNSHT  742

Query  649   -LNFES-EEFVISDNLTLEQLIEPVLRAQAMISQVHAGMWRRNGYSLLNQLYFYHNVRCR  706
              LN E  +E +   + T   L E  LR   + +Q +A +WRRNG+SL+NQ++ Y +  CR
Sbjct  743   SLNQERIKELINCKDET--NLYELSLRVLVLCAQSNATLWRRNGFSLINQIHNYFSPLCR  800

Query  707   TEMLDRDINLLQVGASLIESNEFLIHILNKFNLINWADPNFETNVIK----NPEEDSIRQ  762
              EM DRD+ ++QVGA+L  S +F+ H+L++F L  WA   FE +        PE + + +
Sbjct  801   NEMFDRDVLMMQVGAALTPSTKFIFHLLHRFRLFKWATSEFEQDKANEKPAKPESEDLSK  860

Query  763   TINLV-EEFLGLLITIIGERHIPGVGQVTSDDRLKKEIIQQLCIKPMSHSELNKTLPDGV  821
             T+ ++ EEF+  LI I+ ER+  GVG+    D++K+E+I  LC    + S + + +   +
Sbjct  861   TLVMIAEEFIQCLILILCERYTYGVGKTRPMDQMKREVIHILCTGSHTFSHIQQKMSHDI  920

Query  822   HHE-IGLERVINDIADFKKSAQNSVGKRLYELNSHLYDEYNVFFYHYTKEELSKSEEAQ-  879
             + + + L   +N +ADF+K    + G+  +         Y+ FF HY+K + S +E++Q 
Sbjct  921   NSKRLSLHEAVNLVADFRKPLATTAGQ--FHCKESSLPTYSPFFMHYSKSDQSAAEQSQA  978

Query  880   RKRKKAMGELECCPPPQLPRLTETFSLVANLLRCDVMLHIMQTVLERARNLRARSFSESQ  939
             R R K    +  C PP LP     F  +  +L  +V++H+++ +++R    R+R  S+  
Sbjct  979   RVRAKMEKSVRACAPPILPDFQTFFERIPEILTTNVLIHVVRLIIDRTAR-RSRFSSDRL  1037

Query  940   IHKILHLIGYALQEQMTGYYSFLNFTERAAQK-NILNLLEDLLNNPRIDAHKDLLTWVLK  998
              HK L+LIG AL E+         FT+RA +   +L+LLE L+  P       LL   ++
Sbjct  1038  FHKTLYLIGIALNEEEKN--PSFGFTQRAEESIGLLSLLEGLVGKPESSICPILLEVTVE  1095

Query  999   KYRE--AAGSTINEEKNKNIDAKSAETSASEKDIAKNSKEWRMQMAAQKRAKVMAQMQLM  1056
             KYR+   A + + E       A   + + SE++I         +M    R K MA+M  M
Sbjct  1096  KYRKLIKARAGVPEAA----PAPENKPAQSEEEIKAKRAARAAEM----RQKAMAKMSNM  1147

Query  1057  QKHFMKNNAKLFEETVLDVNKSNERGSSMDLSECIERS---------------------P  1095
             Q  FMK         + D  K +E  +  + SE + +                      P
Sbjct  1148  QSKFMKK--------IEDEEKKDESQTPSEKSETVVKKDDYDNKHFFDEDVVKQVGHDFP  1199

Query  1096  IAVGPNQ-TARLAEEKTYTCILCQADQSVT-VSGDAMVLAAFVQQSTVLCQTRSEPD---  1150
             + +G N+  A L + +T TCILCQ D+ +    G  MV AAF+QQS +        +   
Sbjct  1200  VCIGANKWHAELVKPRTLTCILCQEDEIIAPQQGKPMVCAAFIQQSQLFTHKNKNGELMT  1259

Query  1151  -------EPNPIYLSAKLGASPHTSTCGHVMHAYCWQTHFDNVLAKEHRRPYRLRQPAS-  1202
                      + +   A L      STC H MH  C+++  +   ++E  R  ++ Q +  
Sbjct  1260  ASSGTISTRDLLTAPATLQYGVDVSTCSHSMHYECYRSLAEANRSRESLRARQVGQHSHK  1319

Query  1203  -FDVEKQEYLCPLCECLSNTVLPLLPPLALLQ----PTESNKCNIDFETWLNALQLILDF  1257
               D E  EY CPLC+ LSN  +P+LP   L       T S     +F+TW+  ++     
Sbjct  1320  MVDTENGEYQCPLCKRLSNAAIPVLPAYQLTNQNGFSTVSGAGKENFDTWVARVK-----  1374

Query  1258  RDKENNIETDDASLDDHHK  1276
             R+ E  + ++  S   H +
Sbjct  1375  RNLEMPLSSESVSKKGHSR  1393


 Score = 210 bits (535),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 153/505 (30%), Positives = 236/505 (47%), Gaps = 72/505 (14%)

Query  1355  VDPHEEDSRVPLLAFKSTSYTIHAIEFMLRDSEKPLLGALSSRQKDSLECL----ARISA  1410
             ++ H +   +  + ++ST++   AI   L   +KPL GAL++RQ+D L  +    A +S 
Sbjct  1560  IEKHLKGYVISTVTWQSTAHVARAISSYLHYDKKPLFGALNTRQRDCLSAMARLCASLSH  1619

Query  1411  ILGYTWPPYGDTGRL-----------RTLGNHALHILTMI------LDNPHDG-------  1446
              + +      D  R+           +T G+  L   +           PH G       
Sbjct  1620  NMQFLLHAVSDMLRVFLCEPPRPKLAQTPGSPLLSAPSTSSFTPAPAQIPHSGTNFAFLV  1679

Query  1447  ----PC---------IMDWDSFGILVPLLITF--------PSLFAINSESPPSIIT--GG  1483
                 P          I+  D   + + L++T          S+ + ++     ++T  G 
Sbjct  1680  QLFNPAGPRKNVNLNILQIDILSLAISLMMTIGWTWNNGTQSMNSSSTHQKARLLTPDGS  1739

Query  1484  THELYLLKLVFITLIVKILVT-NEFDSNEA---------MDIDDPDNEEEEKYDALLVLM  1533
               E Y+L+L  +    +I+ T +E D N+          M++D    +   K  AL    
Sbjct  1740  VDEAYVLRLSLLAHYFQIIATHSEADGNDVNMEEEQESQMEVDPVAAQTIRKLYALCHPF  1799

Query  1534  DIINVKTGGLTVREI-WKYIKEASLSFLRCCTLYFHFVTDVPAPIELTTKGGDTYENICM  1592
             D      G L   +I W+ ++E + S LR   L +HF+T V  P  L     ++ E +  
Sbjct  1800  D------GPLRRVDILWRKMEEGAQSLLRPIALLYHFITLVDPPEALKDPSINSSEPLFR  1853

Query  1593  YLGLPTTCDGLLNSENVQKLAKKWMEH--PRTLLKSTHVKEPPKLNSLVSLPDDYSELIN  1650
             YLGLP   +  ++   ++KL   W         L+   V +P + N LV LP+ YS+LIN
Sbjct  1854  YLGLPHKIEEQISGSMLEKLFTMWSSSIPSDQALRQDLVVQPVRPNLLVELPEKYSQLIN  1913

Query  1651  TVSLFTCPTSDREDSRN--PTMCLVCGEMLCSQSYCCQTELNKIMVGACTYHASKCGAGV  1708
              V+ F CPT   E+S +  PT+CLVCG +LCSQ+YCCQ  +NK   GAC YH S+C   V
Sbjct  1914  QVATFKCPTIPIEESTSNVPTLCLVCGTILCSQAYCCQKIINKQSYGACRYHMSQCSGSV  1973

Query  1709  GIFFRVRECEILFLRSPNRGAFACPPYLDEYGETDQGLRRGNPLKLCKNKYKQLNQMWLG  1768
             G+F RVR+C ++ + +  RG F   PY+DE+GE DQG RRGNPL L    Y++L  +WL 
Sbjct  1974  GMFLRVRDCSLVLMTTRKRGCFRPAPYVDEFGEVDQGFRRGNPLHLNPELYQKLKSLWLQ  2033

Query  1769  HGLHEAVARAIESSSNLMSTQWQHL  1793
              G+ E V    E     +   W H 
Sbjct  2034  QGITEEVVNYNEIDFRNVQYDWGHF  2058


 Score = 159 bits (403),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 142/287 (49%), Gaps = 29/287 (10%)

Query  114  VCGKFFRVGEPTYICRECGMDPTCVLCVPCFKESAHQNHKYKIATSGGGGCCDCGDPEAW  173
            +CG  F+ GE TY C +C  D TCV+C+ CF+ S H++HKYK+ +S G G CDCGD +AW
Sbjct  94   ICGHVFKNGELTYTCLDCATDGTCVMCLQCFEVSIHKSHKYKMHSSSGSGYCDCGDADAW  153

Query  174  KRDPFCNIHLAGIQSKESSSNKLPEDIAERATATFEAVLKYCYELLSLEHSPGLPADLRV  233
                 C  H    +  +  +  L  ++ +R     E +L++   +++ +    LP     
Sbjct  154  TEGYACANHE---KKDDEEAAVLAPELKKRCEQLVEIILQFSLSMITHKDDLKLPEIFEK  210

Query  234  KETDEDPLSLLSTTDSYCTVLFNDETHTFEQVISILSRVIKCTQKEAIEFVTNIDRNGRA  293
             + +     + +    Y TVL+NDETHT+E VI +L   I CT+ +A+   T +DR GR+
Sbjct  211  MKPE-----VTNEAQQYLTVLYNDETHTYESVIKVLELYIHCTKDQAMLVATIVDREGRS  265

Query  294  VVKCSDFQHCNELKSDVERFTWRQNSQ---------PLKVLVVHAHVIAHQIFAMKLLGW  344
             VK      C + K DV+R T R  +          PL V V+   + A Q F++ LL W
Sbjct  266  AVKLGSKADCTKAKDDVQRKTARDPTSIRRSSNHNLPLSVKVMDTTLFALQNFSISLLTW  325

Query  345  LQHFISQCEGFRIIFSDVALNTKLP------------DVPIVEGILR  379
            L   +      R I  ++ L++K              D  +V GI+R
Sbjct  326  LNTQMDVFPPLREIVGEILLSSKFALKKNYTRKMKSEDQRLVAGIIR  372


>M9PDZ8_DROME unnamed protein product
Length=2236

 Score = 110 bits (275),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 195/896 (22%), Positives = 350/896 (39%), Gaps = 137/896 (15%)

Query  98    PQQVLQQLRQMEKPPSVCGKFFRVGEPTYICRECGMDPTCVLCVPCFKESAHQNHKYKIA  157
             PQ+ ++ +R  +   + CG  +      Y CR CG+ P   +C  CFK+  H NH + + 
Sbjct  208   PQEFVKIVRSYDNH-AKCGLVWVPHVVAYRCRTCGISPCMSICRDCFKKGNHTNHDFNMF  266

Query  158   TSGGGGCCDCGDPEAWKRDPFCNIHLAGIQSKESSSNKLPEDIAERATATFEAVL-KYCY  216
              S  GG CDCGD    K + FC+ H  GI ++    N+ P  +     A  EA++ K  +
Sbjct  267   LSQAGGACDCGDTSVMKAEGFCSDH--GINNR---VNRDP--VPNNLLAVAEAIMPKLLF  319

Query  217   ELLSLEHSPGLPADLRVKETDEDPLSLLSTTDSYCTVLFN---DETHTFEQVISILSRVI  273
              LL              +E  + PL + + T   C    N   D  +  E +  +++R +
Sbjct  320   RLLQ-----------HFREHSDTPLEVQAITSYSCEEFANMLIDLNNMGEIMRKVMTRTL  368

Query  274   KCTQKEA--IEFVTNIDRNGRAVVKCSDFQHCNELKSD--VERFTWRQNSQPLKVLVVHA  329
                +  A  +E      RNGR       F   N  K +  V RF   +     + L    
Sbjct  369   INPEVYAFFMEAPCQDTRNGR-------FLKANREKYEDAVNRFPNPEPPDEYRDLPALG  421

Query  330   HVIAHQIFAMKLLGWLQHFISQCEGFRIIFSDVALNTKLPDVPIVEGILRRDSQLWKAAR  389
               + H     + + W   F                  + P   +                
Sbjct  422   DKLVHTTLLEEFIFWTFKF------------------EFPQTLVC---------------  448

Query  390   TAWHKLLISGMLMEYESKKALATVFTNNYGTV--MKDFIRDDHDHSFSISSLSVQLFTVP  447
                    +  ML + + K+ L   F  +Y  +  + +  RD    S  +  +SVQLF+  
Sbjct  449   ------FLLNMLPDQDYKEHLTRTFVMHYSRIPSVLEMSRDPDTLSNRVVHMSVQLFSNE  502

Query  448   TLAHYLIANHDVLFILLNTFISESSRRCNAAGKLEFERNVPNTPFKRA----QYILCDLA  503
             +LA  ++    +L +++ +     S+       ++   + PN  F       + ++ D  
Sbjct  503   SLALKMVNELSLLHVMIISLKLMMSKIL-----IQNTLHDPNKNFHFVIDCTRQVMKDHC  557

Query  504   Y--LLSSKPDTWTDE-LRKGFLQGLSLL---LNLLASMQSMDAVLRQVGQHMEYEP-EWE  556
             Y  L+S   +  + E +   FL+  +L+      L  +Q M+  +R+   H+E+EP  + 
Sbjct  558   YWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNVNVRETASHVEFEPNSYY  617

Query  557   SAFNLHIKLS--PVISLALEWC-GSDKIVLVKAFRAVLKKLGEQSGNDSTPRVLREIEHH  613
             +AF+  ++ S  P+ S+      G+   +  K     +  L E          L  I   
Sbjct  618   AAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHEW---------LDSIYFM  668

Query  614   SASCIQYDVSSEPVSIHLPLSRFLAGLFLYLEKYNLNFESEEFVISDNLTLEQLIEPVLR  673
              A     ++     S H PL R+LA  F+      +     + + S    L  L+   LR
Sbjct  669   EARLSMEEMMQ--ASFHFPLHRYLAA-FVCQAVTKMGISLNDVLPSRPYLLPLLMIHPLR  725

Query  674   AQAMISQVHAGMWRRNGYSLLNQLYFYHNVRCRTEMLDRDINLLQVGASLIESNEFLIHI  733
              Q+   ++ AG W RNG  +  Q   Y        M D D+  LQ+ A+ +    FL + 
Sbjct  726   VQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYFFLQNT  785

Query  734   LNKFNLINWADPNFETNVIKNPEEDSIRQTINLVEEFLGLLITIIGERHIPGVGQVTSDD  793
             +  F++  W     ET  +K P++    +  +++E FL  L T++  R   G  + T   
Sbjct  786   IELFDVGQW----LETAPLKQPQK---AEQSSMLEGFLTFLATLVTSRTNLGNDEAT---  835

Query  794   RLKKEIIQQLCIKPMSHSELNKTLPD--GVHHEIGLERVINDIADFK--KSAQNSVGKRL  849
             +   EI   L  +  +HS+L + +P+  G  H    E  +  ++ +K   S   ++ + L
Sbjct  836   QCIIEISALLATENKTHSQLLELMPERSGNVHTKNFETFLKKLSVYKAPSSGSENLEQGL  895

Query  850   Y----ELNSHLYDEYNVFFYHYTKEELSKSEE------AQRKRKKAMGELECCPPPQLPR  899
             +    E+    YD  +V      + +   S +        + +  A G L   PP +LP 
Sbjct  896   FTPIDEVWEKHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNL--WPPFRLPH  953

Query  900   ---LTETFSLVANLLRCDVMLHIMQTVLERARNLRARSFSESQIHKILHLIGYALQ  952
                 T +FS    +L   +    + ++  RA  +  R  SE  +   + L+  A++
Sbjct  954   ALPATSSFSDPCKILNSRIFHSTILSIFFRA--VHTRDVSEHLLALAVFLLEIAVE  1007


 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 16/137 (12%)

Query  1638  LVSLPDDYSELINTV---SLFTCPTSDREDSRNPTMCLVCGEMLCSQSYCCQTELNKIMV  1694
             L+ LP +Y  L           C    +E S    +CL+CG ++C +  CC         
Sbjct  2078  LLELPREYERLFTYYHERPCLNCYKVPKESS----ICLLCGTIVCLKQNCCAEN------  2127

Query  1695  GAC--TYHASKCGAGVGIFFRVRECEILFLRSPNRGAFACPPYLDEYGETDQGLRRGNPL  1752
               C    H   CG G+GIF  V    I+ +R   R       YLD++ E D+ L+RG PL
Sbjct  2128  DCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRG-RRACLWGSLYLDDFDEEDRDLKRGKPL  2186

Query  1753  KLCKNKYKQLNQMWLGH  1769
              L K+++  L   WL H
Sbjct  2187  YLSKDRFNLLESQWLSH  2203


 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 93/264 (35%), Gaps = 72/264 (27%)

Query  1009  NEEKNKNIDAKSAETSASEKDIAKNSKEWRMQMAAQKRAKVMAQMQLMQKHFMKNNAKLF  1068
             +E+  ++ID   A    ++++    +K    +   ++R K   + Q M + F  N  KLF
Sbjct  1422  DEQCAQSIDDIRARLWPNQREKQAEAKAREAKEKEERRKKARERQQKMMQDF-ANKQKLF  1480

Query  1069  EETVLDVNKSNERGSSMDLSECIERSPIAVGPNQTARLA------EEKTYTCILCQADQS  1122
              +                 S     S +  GP              EK Y CI+C     
Sbjct  1481  MQ-----------------SAAASSSGMGYGPEDEDDEELYEEQPREKEYDCIICNCTTP  1523

Query  1123  VTVSGDAMVLAAFVQQSTVLCQTRSEPDE-PNPI-----------------------YLS  1158
              T S + + L   V+ S ++   R   +  P PI                        LS
Sbjct  1524  STES-NPIGLVVLVESSGIVGHRRRIAERLPLPINAEDESRLAHTTRLAAEFNRRTELLS  1582

Query  1159  AKLGASP-------------HTSTCGHVMHAYCWQTHFDNVLAKEHRRPYRLRQPASFDV  1205
              K G                H  +CGH +H  C + +   +   +       RQP     
Sbjct  1583  LKFGDESWYLSNNMAYDNGVHVQSCGHHVHLSCLEAYLKTLYTTQ-------RQPVQ---  1632

Query  1206  EKQEYLCPLCECLSNTVLPLLPPL  1229
             ++ E+ CP+C  LSN+VLPL P L
Sbjct  1633  DRGEFYCPVCRQLSNSVLPLSPQL  1656


>UBR3_DROME unnamed protein product
Length=2219

 Score = 110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 195/896 (22%), Positives = 350/896 (39%), Gaps = 137/896 (15%)

Query  98    PQQVLQQLRQMEKPPSVCGKFFRVGEPTYICRECGMDPTCVLCVPCFKESAHQNHKYKIA  157
             PQ+ ++ +R  +   + CG  +      Y CR CG+ P   +C  CFK+  H NH + + 
Sbjct  208   PQEFVKIVRSYDNH-AKCGLVWVPHVVAYRCRTCGISPCMSICRDCFKKGNHTNHDFNMF  266

Query  158   TSGGGGCCDCGDPEAWKRDPFCNIHLAGIQSKESSSNKLPEDIAERATATFEAVL-KYCY  216
              S  GG CDCGD    K + FC+ H  GI ++    N+ P  +     A  EA++ K  +
Sbjct  267   LSQAGGACDCGDTSVMKAEGFCSDH--GINNR---VNRDP--VPNNLLAVAEAIMPKLLF  319

Query  217   ELLSLEHSPGLPADLRVKETDEDPLSLLSTTDSYCTVLFN---DETHTFEQVISILSRVI  273
              LL              +E  + PL + + T   C    N   D  +  E +  +++R +
Sbjct  320   RLLQ-----------HFREHSDTPLEVQAITSYSCEEFANMLIDLNNMGEIMRKVMTRTL  368

Query  274   KCTQKEA--IEFVTNIDRNGRAVVKCSDFQHCNELKSD--VERFTWRQNSQPLKVLVVHA  329
                +  A  +E      RNGR       F   N  K +  V RF   +     + L    
Sbjct  369   INPEVYAFFMEAPCQDTRNGR-------FLKANREKYEDAVNRFPNPEPPDEYRDLPALG  421

Query  330   HVIAHQIFAMKLLGWLQHFISQCEGFRIIFSDVALNTKLPDVPIVEGILRRDSQLWKAAR  389
               + H     + + W   F                  + P   +                
Sbjct  422   DKLVHTTLLEEFIFWTFKF------------------EFPQTLVC---------------  448

Query  390   TAWHKLLISGMLMEYESKKALATVFTNNYGTV--MKDFIRDDHDHSFSISSLSVQLFTVP  447
                    +  ML + + K+ L   F  +Y  +  + +  RD    S  +  +SVQLF+  
Sbjct  449   ------FLLNMLPDQDYKEHLTRTFVMHYSRIPSVLEMSRDPDTLSNRVVHMSVQLFSNE  502

Query  448   TLAHYLIANHDVLFILLNTFISESSRRCNAAGKLEFERNVPNTPFKRA----QYILCDLA  503
             +LA  ++    +L +++ +     S+       ++   + PN  F       + ++ D  
Sbjct  503   SLALKMVNELSLLHVMIISLKLMMSKIL-----IQNTLHDPNKNFHFVIDCTRQVMKDHC  557

Query  504   Y--LLSSKPDTWTDE-LRKGFLQGLSLL---LNLLASMQSMDAVLRQVGQHMEYEP-EWE  556
             Y  L+S   +  + E +   FL+  +L+      L  +Q M+  +R+   H+E+EP  + 
Sbjct  558   YWPLVSDFNNVLSHESVALVFLRDDNLIDMWFQFLQMLQGMNVNVRETASHVEFEPNSYY  617

Query  557   SAFNLHIKLS--PVISLALEWC-GSDKIVLVKAFRAVLKKLGEQSGNDSTPRVLREIEHH  613
             +AF+  ++ S  P+ S+      G+   +  K     +  L E          L  I   
Sbjct  618   AAFSCELEASAYPMWSIISHLQDGTHAHLAKKIINYCVTTLHEW---------LDSIYFM  668

Query  614   SASCIQYDVSSEPVSIHLPLSRFLAGLFLYLEKYNLNFESEEFVISDNLTLEQLIEPVLR  673
              A     ++     S H PL R+LA  F+      +     + + S    L  L+   LR
Sbjct  669   EARLSMEEMMQ--ASFHFPLHRYLAA-FVCQAVTKMGISLNDVLPSRPYLLPLLMIHPLR  725

Query  674   AQAMISQVHAGMWRRNGYSLLNQLYFYHNVRCRTEMLDRDINLLQVGASLIESNEFLIHI  733
              Q+   ++ AG W RNG  +  Q   Y        M D D+  LQ+ A+ +    FL + 
Sbjct  726   VQSFFYEILAGKWVRNGLQIKGQAMTYIQANFCNSMADMDLFFLQICATNLPQYFFLQNT  785

Query  734   LNKFNLINWADPNFETNVIKNPEEDSIRQTINLVEEFLGLLITIIGERHIPGVGQVTSDD  793
             +  F++  W     ET  +K P++    +  +++E FL  L T++  R   G  + T   
Sbjct  786   IELFDVGQW----LETAPLKQPQK---AEQSSMLEGFLTFLATLVTSRTNLGNDEAT---  835

Query  794   RLKKEIIQQLCIKPMSHSELNKTLPD--GVHHEIGLERVINDIADFK--KSAQNSVGKRL  849
             +   EI   L  +  +HS+L + +P+  G  H    E  +  ++ +K   S   ++ + L
Sbjct  836   QCIIEISALLATENKTHSQLLELMPERSGNVHTKNFETFLKKLSVYKAPSSGSENLEQGL  895

Query  850   Y----ELNSHLYDEYNVFFYHYTKEELSKSEE------AQRKRKKAMGELECCPPPQLPR  899
             +    E+    YD  +V      + +   S +        + +  A G L   PP +LP 
Sbjct  896   FTPIDEVWEKHYDPLHVLLRAVHRRDFQSSLDRFTNYVKSKDKMPASGNL--WPPFRLPH  953

Query  900   ---LTETFSLVANLLRCDVMLHIMQTVLERARNLRARSFSESQIHKILHLIGYALQ  952
                 T +FS    +L   +    + ++  RA  +  R  SE  +   + L+  A++
Sbjct  954   ALPATSSFSDPCKILNSRIFHSTILSIFFRA--VHTRDVSEHLLALAVFLLEIAVE  1007


 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (45%), Gaps = 16/137 (12%)

Query  1638  LVSLPDDYSELINTV---SLFTCPTSDREDSRNPTMCLVCGEMLCSQSYCCQTELNKIMV  1694
             L+ LP +Y  L           C    +E S    +CL+CG ++C +  CC         
Sbjct  2078  LLELPREYERLFTYYHERPCLNCYKVPKESS----ICLLCGTIVCLKQNCCAEN------  2127

Query  1695  GAC--TYHASKCGAGVGIFFRVRECEILFLRSPNRGAFACPPYLDEYGETDQGLRRGNPL  1752
               C    H   CG G+GIF  V    I+ +R   R       YLD++ E D+ L+RG PL
Sbjct  2128  DCCEAVRHTLSCGGGIGIFLVVTSTYIIVIRG-RRACLWGSLYLDDFDEEDRDLKRGKPL  2186

Query  1753  KLCKNKYKQLNQMWLGH  1769
              L K+++  L   WL H
Sbjct  2187  YLSKDRFNLLESQWLSH  2203


 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 93/264 (35%), Gaps = 72/264 (27%)

Query  1009  NEEKNKNIDAKSAETSASEKDIAKNSKEWRMQMAAQKRAKVMAQMQLMQKHFMKNNAKLF  1068
             +E+  ++ID   A    ++++    +K    +   ++R K   + Q M + F  N  KLF
Sbjct  1422  DEQCAQSIDDIRARLWPNQREKQAEAKAREAKEKEERRKKARERQQKMMQDF-ANKQKLF  1480

Query  1069  EETVLDVNKSNERGSSMDLSECIERSPIAVGPNQTARLA------EEKTYTCILCQADQS  1122
              +                 S     S +  GP              EK Y CI+C     
Sbjct  1481  MQ-----------------SAAASSSGMGYGPEDEDDEELYEEQPREKEYDCIICNCTTP  1523

Query  1123  VTVSGDAMVLAAFVQQSTVLCQTRSEPDE-PNPI-----------------------YLS  1158
              T S + + L   V+ S ++   R   +  P PI                        LS
Sbjct  1524  STES-NPIGLVVLVESSGIVGHRRRIAERLPLPINAEDESRLAHTTRLAAEFNRRTELLS  1582

Query  1159  AKLGASP-------------HTSTCGHVMHAYCWQTHFDNVLAKEHRRPYRLRQPASFDV  1205
              K G                H  +CGH +H  C + +   +   +       RQP     
Sbjct  1583  LKFGDESWYLSNNMAYDNGVHVQSCGHHVHLSCLEAYLKTLYTTQ-------RQPVQ---  1632

Query  1206  EKQEYLCPLCECLSNTVLPLLPPL  1229
             ++ E+ CP+C  LSN+VLPL P L
Sbjct  1633  DRGEFYCPVCRQLSNSVLPLSPQL  1656



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933679.1 putative fatty acyl-CoA reductase CG5065 [Chelonus
insularis]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MMC6_DROME  unnamed protein product                                 529     0.0   
Q0E8W1_DROME  unnamed protein product                                 509     9e-178
Q9W0Y5_DROME  unnamed protein product                                 500     6e-174


>Q8MMC6_DROME unnamed protein product
Length=506

 Score = 529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/472 (53%), Positives = 334/472 (71%), Gaps = 0/472 (0%)

Query  1    MDKELSPIQSYYAGKTIFISGASGFMGKVLVEKLLYSCSNLKRIYILLRSKRGRTPEMRI  60
            M  +LSP+Q YY  KTIFI+GASGFMGKVL+EKLLYSC +LK + I+ R KRG+ PE R+
Sbjct  1    MTVDLSPVQEYYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRL  60

Query  61   DDMFKLPMFDRIRKEKAHVLKKLIALPGDISSKNFGLTEAHQNLLINEVEIIFHCAATLR  120
            ++MFKLP+F RI+ E+  +LK++    GD++    GL+      +     I+FH AATL+
Sbjct  61   EEMFKLPIFQRIKDERPEMLKRVTIYQGDVTFDQLGLSGESLKHVTENTNIVFHMAATLK  120

Query  121  LEAKLKDAIEMNAFGTASMLELARKMKKLQVFIHLSTAFCHVDQEELEERVYDSPEDPHE  180
            LE  L+DAI+MN  GT   L +A++MK+L+ FIHLSTAFC+ DQ+ + E+VY+ P  P +
Sbjct  121  LEGNLRDAIDMNLLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQDVMYEKVYEFPHKPED  180

Query  181  VMRLTQWMKPDALELITPKLLDPHPNTYTYSKRLAETLVANEYPNLPCVIVRPSIVTPAW  240
            +MRL +WM    L+ ITP LL PHPNTYTYSKRLAE LV + Y ++P +I RPSIVTPA 
Sbjct  181  LMRLAEWMDVKTLDAITPDLLKPHPNTYTYSKRLAELLVRDHYESMPVIIARPSIVTPAV  240

Query  241  AEPLPGWVDSLNGPVGLIVGAGKGVIRSMHCNANYHAEVIPVDLAINALIAIGWKMGMAT  300
            AEPLPGWVD++NGP G+++GAGKGVIRSM CN    +EVIPVD+AIN LI + +   +A 
Sbjct  241  AEPLPGWVDNMNGPTGVLIGAGKGVIRSMICNGELKSEVIPVDIAINGLILLPYHNSLAE  300

Query  301  CREKNVPVYNVTQSGVVPVTWGEIVERGKKVAFNYPFETCIWYPGGDIHSSKFVHNLIVF  360
             R   +PVYN+T       TW  I++ G+ +   YPFE  +WYP G++ SSKF H +   
Sbjct  301  KRPLQIPVYNLTVDDAKKRTWKWIMDVGRDLGIKYPFEVGLWYPDGNMTSSKFYHTICTI  360

Query  361  FFHIIPAYIIDFLLLIFRQKRFMVHVQKRITDGLEVLQYFTTRDWIFHNTNLLNLWEEMN  420
             F  +PAY+IDFLLLIF Q+RFM+ VQ +I  GLEVLQ+FTTR W F +T+   +++E+ 
Sbjct  361  LFMWLPAYLIDFLLLIFGQRRFMIRVQTKIAVGLEVLQFFTTRSWDFKSTHFEQIYKELG  420

Query  421  LQDKKIFPIDFLAVDESEYIKYIILGARQYCMKEKLESLPRARVLQRILWVI  472
              D++IF I+   VD+ EY+K  ILG RQY MKE L SLP++R+  R ++V+
Sbjct  421  STDRRIFKINTDDVDDYEYMKVSILGGRQYVMKEPLTSLPKSRIQLRFMYVL  472


>Q0E8W1_DROME unnamed protein product
Length=499

 Score = 509 bits (1312),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 243/476 (51%), Positives = 332/476 (70%), Gaps = 7/476 (1%)

Query  1    MDKELSPIQSYYAGKTIFISGASGFMGKVLVEKLLYSCSNLKRIYILLRSKRGRTPEMRI  60
            M  +LSP+Q YY  KTIFI+GASGFMGKVL+EKLLYSC +LK + I+ R KRG+ PE R+
Sbjct  1    MTVDLSPVQEYYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRL  60

Query  61   DDMFKLPMFDRIRKEKAHVLKKLIALPGDISSKNFGLTEAHQNLLINEVEIIFHCAATLR  120
            ++MFKLP+F RI+ E+  +LK++    GD++    GL+      +     I+FH AATL+
Sbjct  61   EEMFKLPIFQRIKDERPEMLKRVTIYQGDVTFDQLGLSGESLKHVTENTNIVFHMAATLK  120

Query  121  LEAKLKDAIEMNAFGTASMLELARKMKKLQVFIHLSTAFCHVDQEELEERVYDSPEDPHE  180
            LE  L+DAI+MN  GT   L +A++MK+L+ FIHLSTAFC+ DQ+ + E+VY+ P  P +
Sbjct  121  LEGNLRDAIDMNLLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQDVMYEKVYEFPHKPED  180

Query  181  VMRLTQWMKPDALELITPKLLDPHPNTYTYSKRLAETLVANEYPNLPCVIVRPSIVTPAW  240
            +MRL +WM    L+ ITP LL PHPNTYTYSKRLAE LV + Y ++P +I RPSIV+P+ 
Sbjct  181  LMRLAEWMDVKTLDAITPDLLKPHPNTYTYSKRLAELLVRDHYESMPVIIARPSIVSPSA  240

Query  241  AEPLPGWVDSLNGPVGLIVGAGKGVIRSMHCNANYHAEVIPVDLAINALIAIGWKMGMAT  300
             EP+PGWVD+LNGP GL+VGAGKGVIRSM  +  + +EVIPVD AIN L  I ++    T
Sbjct  241  YEPVPGWVDNLNGPTGLMVGAGKGVIRSMLIDTRHLSEVIPVDYAINGLCVIPYQFAKMT  300

Query  301  CREKNVPVYNVTQSGVVPVTWGEIVERGKKVAFNYPFETCIWYPGGDIHSSKFVHNLIVF  360
             R K+VPVYN+T +    + WGE++E  K++ + YP E  +WYP G I ++K  HN+ V 
Sbjct  301  ERPKDVPVYNITCADHRKMQWGEVIEMSKEIGYRYPMEAGLWYPDGCITTNKLHHNINVL  360

Query  361  FFHIIPAYIIDFLLLIFRQKRFMVHVQKRITDGLEVLQYFTTRDWIFHNTNLLNLWEEMN  420
             FH +PAY+IDF+LL+  QKRFM+ VQ RI+ GLEVLQ+FT R W F +    +LW  +N
Sbjct  361  LFHWLPAYLIDFILLLLGQKRFMIRVQNRISVGLEVLQFFTMRAWFFKSDAYSSLWAMLN  420

Query  421  LQDKKIFPIDFLAVDESE----YIKYIILGARQYCMKEKLESLPRARVLQRILWVI  472
              D+K F +D   +D  E    YI+  + G RQY MKE  +SLPRAR+  ++++++
Sbjct  421  ESDRKNFNMD---MDPEETVPMYIESCVQGGRQYLMKESPDSLPRARLQLKLMYIL  473


>Q9W0Y5_DROME unnamed protein product
Length=499

 Score = 500 bits (1287),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 244/492 (50%), Positives = 332/492 (67%), Gaps = 6/492 (1%)

Query  1    MDKELSPIQSYYAGKTIFISGASGFMGKVLVEKLLYSCSNLKRIYILLRSKRGRTPEMRI  60
            M  +LSP+Q YY  KTIFI+GASGFMGKVL+EKLLYSC +LK + I+ R KRG+ PE R+
Sbjct  1    MTVDLSPVQEYYKDKTIFITGASGFMGKVLLEKLLYSCHSLKEVIIICRPKRGKAPETRL  60

Query  61   DDMFKLPMFDRIRKEKAHVLKKLIALPGDISSKNFGLTEAHQNLLINEVEIIFHCAATLR  120
            ++MFKLP+F RI+ E+  +LK++    GD++    GL+      +     I+FH AATL+
Sbjct  61   EEMFKLPIFQRIKDERPEMLKRVTIYQGDVTFDQLGLSGESLKHVTENTNIVFHMAATLK  120

Query  121  LEAKLKDAIEMNAFGTASMLELARKMKKLQVFIHLSTAFCHVDQEELEERVYDSPEDPHE  180
            LE  L+DAI+MN  GT   L +A++MK+L+ FIHLSTAFC+ DQ+ + E+VY+ P  P +
Sbjct  121  LEGNLRDAIDMNLLGTRRALNVAKEMKQLEAFIHLSTAFCNCDQDVMYEKVYEFPHKPED  180

Query  181  VMRLTQWMKPDALELITPKLLDPHPNTYTYSKRLAETLVANEYPNLPCVIVRPSIVTPAW  240
            +MRL +WM    L+ ITP LL PHPNTYTYSKRLAE LV + Y ++P +I RPSIV+PA 
Sbjct  181  LMRLAEWMDVKTLDAITPDLLKPHPNTYTYSKRLAELLVRDHYESMPVIIARPSIVSPAA  240

Query  241  AEPLPGWVDSLNGPVGLIVGAGKGVIRSMHCNANYHAEVIPVDLAINALIAIGWKMGMAT  300
             EPLPGWVD+LNGP GL++G GKGVIRS+  N    AEVIPVD AIN LI I ++     
Sbjct  241  YEPLPGWVDNLNGPTGLMIGCGKGVIRSVLVNQQNKAEVIPVDYAINGLIVIPYEFNKQA  300

Query  301  CREKNVPVYNVTQSGVVPVTWGEIVERGKKVAFNYPFETCIWYPGGDIHSSKFVHNLIVF  360
             R  NVPVYN+T +    +T G +VE  K++   +PF   +WYP   + +++  HN  V 
Sbjct  301  KRPTNVPVYNITNADHRKMTMGTVVEMSKRINKQFPFNAGLWYPDPCVTTNQLYHNFNVA  360

Query  361  FFHIIPAYIIDFLLLIFRQKRFMVHVQKRITDGLEVLQYFTTRDWIFHNTNLLNLWEEMN  420
             FH +PAY +DFL+LI  QKRFM+ VQ++I+ GL VLQ+FT   W F + N  +LW ++N
Sbjct  361  LFHWLPAYFLDFLMLILGQKRFMLRVQEKISTGLGVLQFFTLNAWCFRSDNYASLWNKLN  420

Query  421  LQDKKIFPIDFLAVD-ESEYIKYIILGARQYCMKEKLESLPRARV---LQRILWVIHVTT  476
             +DK IF ++    + E EY+     GAR++ +KEK E LP ARV   +QR++ V+  T 
Sbjct  421  EEDKAIFNMNMNTENTEEEYMIECAKGARKFILKEKEEDLPTARVHMKIQRVVDVVCKTV  480

Query  477  VYG--FYLGIAW  486
            + G  FY  + W
Sbjct  481  IVGLFFYYLLKW  492



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933680.1 transcription initiation factor TFIID subunit 11
[Chelonus insularis]

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAF11_DROME  unnamed protein product                                  184     2e-58


>TAF11_DROME unnamed protein product
Length=196

 Score = 184 bits (466),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)

Query  136  MRVLVSNFTEDQLHRYEMYRRAAFPKAAIKRIMQTITGCSVSQNVVIAMAGIAKVYVGEI  195
            M+VLVSNFTE+QL RYEMYRR+AFPKAA+KR+MQTITGCSVSQNVVIAM+GIAKV+VGE+
Sbjct  89   MQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITGCSVSQNVVIAMSGIAKVFVGEV  148

Query  196  VEEALDVMEEWEDSGPLQPKHLREAVRRLRLRGKIPIGRARKPFFRL  242
            VEEALDVME   +SG LQPK +REAVRRLR + ++PIGR ++P+FRL
Sbjct  149  VEEALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYFRL  195



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933681.1 biogenesis of lysosome-related organelles complex 1
subunit 4-like [Chelonus insularis]

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BL1S4_DROME  unnamed protein product                                  45.8    2e-06
BL1S6_CAEEL  unnamed protein product                                  28.5    1.3  
Q57YZ5_TRYB2  unnamed protein product                                 27.7    6.9  


>BL1S4_DROME unnamed protein product
Length=169

 Score = 45.8 bits (107),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 52/102 (51%), Gaps = 1/102 (1%)

Query  15   IETLANDYSSFMK-VDLPSQTKKVHETVDEMMVRLEEFESIVGMVQNLRAECTYEHLIRF  73
            IE ++ DY+  ++  DL  +   +   +++M+ RL+EFE+++  V+         ++   
Sbjct  5    IENVSRDYAKILQSADLEKEINPLCTNIEDMLARLDEFETLLASVRAESNGMMANNVCSI  64

Query  74   RSVNPQLMELCRRIDALEHVVARASIDLTNLEAAVDNAEAEL  115
                    +L  RID LE  V   S +L+ +E +VD AE EL
Sbjct  65   LGFTDSFEQLKARIDGLEQCVGVVSANLSEVERSVDIAEEEL  106


>BL1S6_CAEEL unnamed protein product
Length=106

 Score = 28.5 bits (62),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 20/84 (24%), Positives = 42/84 (50%), Gaps = 12/84 (14%)

Query  33   QTKKVHETVDEMMVRLEEFESIVGMVQNLRAECTYEHLIRFRS-----------VNPQLM  81
            ++K V +T+DE++   E+ ++ +G   N   E  +E +  F S           ++  ++
Sbjct  9    ESKNVTDTLDEILRLQEDIQARIGS-SNHNLETNFESIKDFVSRAHAYIPILNQISKDMI  67

Query  82   ELCRRIDALEHVVARASIDLTNLE  105
            E+C R  AL+   ++  +  TN+E
Sbjct  68   EICERTQALKKKTSQLELSDTNIE  91


>Q57YZ5_TRYB2 unnamed protein product
Length=1156

 Score = 27.7 bits (60),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 31/56 (55%), Gaps = 8/56 (14%)

Query  70   LIRFRSVNPQLMELCRRIDALEHVVARASIDLTNLEAA-VDNAEAELGANTTVSDR  124
            L  FRS+N QL+E  +R+ A+        + L N+ A  + +AEA L A   V+DR
Sbjct  311  LAEFRSLNSQLVEERKRLLAMTQ-----EVHLANMRAGDIRDAEARLAA--VVNDR  359



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933682.1 protein Wnt-10a-like [Chelonus insularis]

Length=395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WNT2_CAEEL  unnamed protein product                                   240     3e-76
WNT2_DROME  unnamed protein product                                   234     4e-74
A8WV58_CAEBR  unnamed protein product                                 225     6e-70


>WNT2_CAEEL unnamed protein product
Length=360

 Score = 240 bits (613),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/345 (39%), Positives = 176/345 (51%), Gaps = 39/345 (11%)

Query  58   IPGLTKEQRDLCYANPDVTAAAIKGLQMAITECQHQFAWHRWNCSSLSTSTRTQKNSVLL  117
            +PGL+  Q  +C    D   A   G Q AI ECQ QF  HRWNCS   T   T     + 
Sbjct  48   LPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCS---THYSTGMLGPIH  104

Query  118  QRGYRETAFAYAISAAGVAHSIAKSCSMGRLISCGCDPSSYKGKPPAKARGAHWKWGGCS  177
            +   RE AF YAI +AGV H I + C  G L SCGC   +     P       W WGGC 
Sbjct  105  KMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTD-----WSWGGCG  159

Query  178  HNLEYGMEFSRQFLDSREKAGDIQ-------STVNLHNNQAGRLAVENNIQVRCKCHGMS  230
             N+EYG +FSR F+D REK  D +       S +N  NN+AGR  ++ + + +CKCHG+S
Sbjct  160  DNVEYGYKFSRDFIDIREKEHDPKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVS  219

Query  231  GSCELKTCWKVVPEFRIVGKTLKDRFRNAVLVAQSNLGNVTPLSRLRGSRRRRIDKEKQR  290
            G+C +KTCW  +P    VGK L++++  A+ V  ++ GN+  L+                
Sbjct  220  GACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRGNLQLLA----------------  263

Query  291  KNRPGRDGNNIGRKRKPRDLAKQLFYYQKSPNFCERDPYQDIPGTTGRRCNRTSPGGDGC  350
                    +   ++RK R L   L +   SP++C  D +    GT GR C R S G +GC
Sbjct  264  --------DEATKERKTRALPTDLVFMDDSPDYCRFDRHSGTLGTEGRVCKRGSGGAEGC  315

Query  351  ASLCCGRGYNIIKQRRTERCRCKFHWCCFVQCQNCTIEEWITVCK  395
             SLCCGRGYN   Q    +C CKF WCC V CQ C     + +CK
Sbjct  316  DSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDICK  360


>WNT2_DROME unnamed protein product
Length=352

 Score = 234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 142/367 (39%), Positives = 202/367 (55%), Gaps = 38/367 (10%)

Query  24   LFFMLLFVEQRRAMGLMSNSVDDWSSGNIIVCNGIPGLTKEQRDLCYANPDVTAAAIKGL  83
            L ++L  +E R      S          +++C  IPGLT  QR++C   PD   A  +G 
Sbjct  9    LIYILWIMEIRLVSSFTS----------VMLCGRIPGLTPGQRNMCREMPDALIALGEGH  58

Query  84   QMAITECQHQFAWHRWNCSSLSTSTRTQKN--SVLLQRGYRETAFAYAISAAGVAHSIAK  141
            Q+   ECQHQF  HRWNCS +      Q+N  + ++    RE A+ YAI++AG A+++  
Sbjct  59   QLGAQECQHQFRGHRWNCSEV-----WQRNVFAHVIPTASREAAYTYAIASAGAAYAVTA  113

Query  142  SCSMGRLISCGCDPSSYKGKPPAKARGAHWKWGGCSHNLEYGMEFSRQFLDSREKAGDIQ  201
            +C+ G + +CGCD                WKWGGCS ++++GM ++R+F+D+RE   D +
Sbjct  114  ACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERDSR  173

Query  202  STVNLHNNQAGRLAVENNIQVRCKCHGMSGSCELKTCWKVVPEFRIVGKTLKDRFRNAVL  261
            + +NLHNN+AGR  V+  ++  CKCHG+SGSC +KTCWK +P FR+VG  L  +++ A  
Sbjct  174  TLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKT  233

Query  262  VAQSNLGNVTPLSRLRGSRRRRIDKEKQRKNRPGRDGNNIGRKRKP-RDLAK--QLFYYQ  318
            V             ++G R  R+     RK   G       R +KP  D  K  +L Y +
Sbjct  234  VQA-----------VKGKRGLRL--VLSRKKHAG-----TARAQKPVLDWPKRMELIYLE  275

Query  319  KSPNFCERDPYQDIPGTTGRRCNRTSPGGDGCASLCCGRGYNIIKQRRTERCRCKFHWCC  378
             SPN+CER       GT+GR C RT  G   C  LCCGRG+N    RRT +CRC+F WCC
Sbjct  276  ASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCC  335

Query  379  FVQCQNC  385
             V+C  C
Sbjct  336  EVKCDEC  342


>A8WV58_CAEBR unnamed protein product
Length=398

 Score = 225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/357 (36%), Positives = 183/357 (51%), Gaps = 36/357 (10%)

Query  54   VCNGIPGLTKEQRDLCYANPDVTAAAIKGLQMAITECQHQFAWHRWNCSSLSTSTRTQKN  113
            +C  + GL   Q+ +C  NP       +G++ AI EC+++F + RWNCSS    T T+  
Sbjct  63   LCRRLDGLNPNQQAMCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHG  122

Query  114  SV------LLQRGYRETAFAYAISAAGVAHSIAKSCSMGRLISCGCDPSS----YKGKPP  163
                     L+   +E AF  AI AA + HSI K C+ G L  CGCD       Y+    
Sbjct  123  KFQDILGKTLRSSNKEAAFLSAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQADSD  182

Query  164  AKARGAHWKWGGCSHNLEYGMEFSRQFLDS-----REKAGDIQSTVNLHNNQAGRLAVEN  218
            +      + WGGCS N+ YG+ ++R+FLD       E+  ++   V  HNN  GR A+  
Sbjct  183  SAMSRDQFSWGGCSDNVPYGIRYARRFLDEWEVQQFEETKNVAHLVRRHNNFVGREAIAQ  242

Query  219  NIQVRCKCHGMSGSCELKTCWKVVPEFRIVGKTLKDRFRNAVLVAQSNLGNVTPLSRLRG  278
            NI+ +C+CHG+SGSCE KTCW  + +F  V   LK R+ +     Q  L +VT     R 
Sbjct  243  NIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDH--FAVQVELEDVT-----RK  295

Query  279  SRRRRIDKEKQRKNRPGRDGNNIGRKRKPRDLAKQLFYYQKSPNFCERDPYQDIPGTTGR  338
            + +R   KE+  +  P R GN +              Y  +SP++CER+    I GT+GR
Sbjct  296  ATKRLRRKERTERKIPLR-GNEMA-------------YVHRSPSYCERNLTAGILGTSGR  341

Query  339  RCNRTSPGGDGCASLCCGRGYNIIKQRRTERCRCKFHWCCFVQCQNCTIEEWITVCK  395
             C   S   + C  LCCGRGYN   + R  +C CKF WCC V+C+ CT E  +  CK
Sbjct  342  ECIHNSYSSESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTCK  398



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


Query= XP_034933683.1 DNA ligase 4-like isoform X1 [Chelonus insularis]

Length=943
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYA5_DROME  unnamed protein product                                 345     6e-104
Q8MS06_DROME  unnamed protein product                                 342     5e-103
Q95YE6_CAEEL  unnamed protein product                                 127     1e-29 


>Q9VYA5_DROME unnamed protein product
Length=918

 Score = 345 bits (884),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 278/975 (29%), Positives = 476/975 (49%), Gaps = 103/975 (11%)

Query  1    MSLASKITFQNFCEVLENI-WTARGNKKVEILKKFLDNY--------RQLGREMKEKDPN  51
            + +AS I F++ C + E I  T +   K E+LK + +++        RQ G    + +  
Sbjct  3    VDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPEDG  62

Query  52   VDVSLYPVMRLLLVKSDKHRGPFGLKQINLGKLYVRVFCLGKTSTEAQSIINYRQPSSDR  111
               S Y V+RLLL  +D  R  +GL+   LG+LY+RV  L   S++A  +  +R  +  R
Sbjct  63   AS-SFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRL-QHRNGNMYR  120

Query  112  MQMNDFAERVYWILTSR-LRQSGNLSIEQINNILDKIAEKNAQNGSKDSEFIHL-QKCNA  169
                D+ + VY +L  R      NL +++I+ +LD IA ++ +   K  + I   ++ + 
Sbjct  121  ----DYGDVVYSVLKPRCFNPPSNLRLKEIHQMLDTIANEDTE--VKQQQLIRFTEQASP  174

Query  170  MEIKWFTRIILKDIKIGMGEKSIFEAYHPDADWYYGEKCDLKQVCDTLLNLQTQLERNIS  229
             E KW  R++LK + +G+GE+ IF   HP A   Y    DL  VC+ L +  T L+ + S
Sbjct  175  EEQKWLIRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSS  234

Query  230  NVA-----------LLSPF---KPMLLERLKVEEIGKLFTSDDTYVIQTKFDGERSQLHM  275
              +           ++ PF   +PML ER    +I +L  SD  Y ++TK DGER QLH+
Sbjct  235  KDSKAAVKFVNLNSVIRPFHQIRPMLCERFP-GDIQELMQSDVLY-LETKMDGERFQLHI  292

Query  276  KNGEYKYFTRHGLDITDNSGFGASKSSMNSFLTKAIADLINPQCQSIILDGELVGWHKEK  335
              G + Y +R+G+D T N G      +    LT  +  L+    +SIILDGE++ W   K
Sbjct  293  DRGRFMYISRNGVDYTRNFGHSYDHGT----LTPKLRGLLPLGLESIILDGEMMVWDTNK  348

Query  336  KIFGSKGMSYDVKKLTSRSNYQSCFIAFDVILYNDRLLINLPLHERLKILEAAFKEQEGV  395
              F  KG + DVK L    ++Q CF+ +D++ +N + L++    +R   L+    EQ GV
Sbjct  349  LRFREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGV  408

Query  396  LVRCKNTLVKTKDEVLDIFNKSMDNDDEGIVLKKVDSYYRPNSREGNCCYKLKAEYSDGL  455
            L   +   + +  E  ++F +++D+  EGIVLKK  S Y+P  R G   YK KA+Y  GL
Sbjct  409  LQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYIKGL  468

Query  456  IEDIDMLILGGYYGENKYAGVISSFLMGVSSSSRSNNSSTDEQSEITIDSNSNLKFLSVG  515
            I + D+LI+G +Y  N+    + SFL+GV   +   +S+  E   I + +N+  +    G
Sbjct  469  ITEFDVLIIGAFY--NRKRTFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQ---RG  523

Query  516  SVSSGLSVDKIKEINERFKPYWSQECPRNIVGPKKYLPDVWIEPKRSLVLQLRATEMIKC  575
             ++  L       +NE   P W    P+   G     PD+WIEP+ S++LQ++A ++   
Sbjct  524  VLNHTLKPHWHDVVNEP-PPLWFHYKPKERSG----CPDLWIEPQNSVILQVKAADLAPN  578

Query  576  DYQPAGYTLRFPRVLRSREDKPWTDVCSLTELKSFIKSDGVVQKLTKRHATMSDVQTDL-  634
                   +L FPR    R+DK W++  +L E          ++KL KR   + DV T   
Sbjct  579  GAFFTRKSLHFPRTEMKRDDKTWSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRK  638

Query  635  SLLGSPSKRLREIKEEMFLKPLKIDSRYFGVNAATVERKTRLFEAKEICVINGEEKLQKP  694
             +  +PS+R R       L     + RY   +A+T    ++LF+    C+++G       
Sbjct  639  QMRMTPSERSR-------LGLAVYEKRY---DASTSASTSKLFDGLSFCILSGSAG----  684

Query  695  GFNDEEKWTKSDIERILISHSAKIVQNPGKN---TFCLIVGNPNSVKVQTQVNCRTYDVV  751
                  + +K  ++ + + +   IV+NP  N    FC+       VK       RT D+V
Sbjct  685  ------RHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIV  738

Query  752  KLDWLRRAAEKNNWAKLVDFYPWELLSCRSVTKERLMKKFDEYYDSYVED-SDEQSLKRS  810
            +++WL R  +K      ++  P +L++     ++ L + FD + DSY +D ++ + L+  
Sbjct  739  RMEWLLRVCQKQE----LELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDL  794

Query  811  LERVCLIKNDL----NVNLNTLDDTDKLINKLRSNKLSLFTNIVGYF--ADVSDWRKYGF  864
            L+ + L  +++      NLN L+  D+L++  ++  L++F N+  +F      +  K  F
Sbjct  795  LQGIELTADNVAGITASNLNALE--DQLLDGKKN--LNMFRNLNAFFYSPHGDEVAKLLF  850

Query  865  LFMNGKLSNTINSLTTHVFV---NNLINNLNNNSGRNNVKLVELYKQVNELGKASIKIID  921
            L   G++ +  +      F+   +++ N+   +   N+ KL             + K+++
Sbjct  851  LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLT------------TDKVLN  898

Query  922  SEWIKGCIEKHELLP  936
            S WI  C  +  LLP
Sbjct  899  SAWIHQCHREGILLP  913


>Q8MS06_DROME unnamed protein product
Length=918

 Score = 342 bits (878),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 277/975 (28%), Positives = 475/975 (49%), Gaps = 103/975 (11%)

Query  1    MSLASKITFQNFCEVLENI-WTARGNKKVEILKKFLDNY--------RQLGREMKEKDPN  51
            + +AS I F++ C + E I  T +   K E+LK + +++        RQ G    + +  
Sbjct  3    VDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPEDG  62

Query  52   VDVSLYPVMRLLLVKSDKHRGPFGLKQINLGKLYVRVFCLGKTSTEAQSIINYRQPSSDR  111
               S Y V+RLLL  +D  R  +GL+   LG+LY+RV  L   S++A  +  +R  +  R
Sbjct  63   AS-SFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRL-QHRNGNMYR  120

Query  112  MQMNDFAERVYWILTSR-LRQSGNLSIEQINNILDKIAEKNAQNGSKDSEFIHL-QKCNA  169
                 + + VY +L  R      NL +++I+ +LD IA ++ +   K  + I   ++ + 
Sbjct  121  ----GYGDVVYSVLKPRCFNPPSNLRLKEIHQMLDTIANEDTE--VKQQQLIRFTEQASP  174

Query  170  MEIKWFTRIILKDIKIGMGEKSIFEAYHPDADWYYGEKCDLKQVCDTLLNLQTQLERNIS  229
             E KW  R++LK + +G+GE+ IF   HP A   Y    DL  VC+ L +  T L+ + S
Sbjct  175  EEQKWLIRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSS  234

Query  230  N-----------VALLSPF---KPMLLERLKVEEIGKLFTSDDTYVIQTKFDGERSQLHM  275
                         +++ PF   +PML ER    +I +L  SD  Y ++TK DGER QLH+
Sbjct  235  KDSKAAVKFVNLNSVIRPFHQIRPMLCERFP-GDIQELMQSDVLY-LETKMDGERFQLHI  292

Query  276  KNGEYKYFTRHGLDITDNSGFGASKSSMNSFLTKAIADLINPQCQSIILDGELVGWHKEK  335
              G + Y +R+G+D T N G      +    LT  +  L+    +SIILDGE++ W   K
Sbjct  293  DRGRFMYISRNGVDYTRNFGHSYDHGT----LTPKLRGLLPLGLESIILDGEMMVWDTNK  348

Query  336  KIFGSKGMSYDVKKLTSRSNYQSCFIAFDVILYNDRLLINLPLHERLKILEAAFKEQEGV  395
              F  KG + DVK L    ++Q CF+ +D++ +N + L++    +R   L+    EQ GV
Sbjct  349  LRFREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGV  408

Query  396  LVRCKNTLVKTKDEVLDIFNKSMDNDDEGIVLKKVDSYYRPNSREGNCCYKLKAEYSDGL  455
            L   +   + +  E  ++F +++D+  EGIVLKK  S Y+P  R G   YK KA+Y  GL
Sbjct  409  LQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYIKGL  468

Query  456  IEDIDMLILGGYYGENKYAGVISSFLMGVSSSSRSNNSSTDEQSEITIDSNSNLKFLSVG  515
            I + D+LI+G +Y  N+    + SFL+GV   +   +S+  E   I + +N+  +    G
Sbjct  469  ITEFDVLIIGAFY--NRKRTFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQ---RG  523

Query  516  SVSSGLSVDKIKEINERFKPYWSQECPRNIVGPKKYLPDVWIEPKRSLVLQLRATEMIKC  575
             ++  L       +NE   P W    P+   G     PD+WIEP+ S++LQ++A ++   
Sbjct  524  VLNHTLKPHWHDVVNEP-PPLWFHYKPKERSG----CPDLWIEPQNSVILQVKAADLAPN  578

Query  576  DYQPAGYTLRFPRVLRSREDKPWTDVCSLTELKSFIKSDGVVQKLTKRHATMSDVQTDL-  634
                   +L FPR    R+DK W++  +L E          ++KL KR   + DV T   
Sbjct  579  GAFFTRKSLHFPRTEMKRDDKTWSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRK  638

Query  635  SLLGSPSKRLREIKEEMFLKPLKIDSRYFGVNAATVERKTRLFEAKEICVINGEEKLQKP  694
             +  +PS+R R       L     + RY   +A+T    ++LF+    C+++G       
Sbjct  639  QMRMTPSERSR-------LGLAVYEKRY---DASTSASTSKLFDGLSFCILSGSAG----  684

Query  695  GFNDEEKWTKSDIERILISHSAKIVQNPGKN---TFCLIVGNPNSVKVQTQVNCRTYDVV  751
                  + +K  ++ + + +   IV+NP  N    FC+       VK       RT D+V
Sbjct  685  ------RHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIV  738

Query  752  KLDWLRRAAEKNNWAKLVDFYPWELLSCRSVTKERLMKKFDEYYDSYVED-SDEQSLKRS  810
            +++WL R  +K      ++  P +L++     ++ L + FD + DSY +D ++ + L+  
Sbjct  739  RMEWLLRVCQKQE----LELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDL  794

Query  811  LERVCLIKNDL----NVNLNTLDDTDKLINKLRSNKLSLFTNIVGYF--ADVSDWRKYGF  864
            L+ + L  +++      NLN L+  D+L++  ++  L++F N+  +F      +  K  F
Sbjct  795  LQGIELTADNVAGITASNLNALE--DQLLDGKKN--LNMFRNLNAFFYSPHGDEVAKLLF  850

Query  865  LFMNGKLSNTINSLTTHVFV---NNLINNLNNNSGRNNVKLVELYKQVNELGKASIKIID  921
            L   G++ +  +      F+   +++ N+   +   N+ KL             + K+++
Sbjct  851  LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLT------------TDKVLN  898

Query  922  SEWIKGCIEKHELLP  936
            S WI  C  +  LLP
Sbjct  899  SAWIHQCHREGILLP  913


>Q95YE6_CAEEL unnamed protein product
Length=741

 Score = 127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 126/505 (25%), Positives = 229/505 (45%), Gaps = 52/505 (10%)

Query  3    LASKITFQNFCEVLENIW-TARGNKKVEILKKFLDNYRQLGREMKEKDPNVDVSLYPVMR  61
            +AS + F    +V   I  T+    K    +K  +++++     K  DP+    ++ ++R
Sbjct  1    MASDVIFDEVVDVFNKIRRTSNVKSKQATFQKNFESWKE-----KCSDPS---DMFVIIR  52

Query  62   LLLVKSDKHRGPFGLKQINLGKLYVRVFCLGKTSTEAQSIINYRQPSSDRMQMNDFAERV  121
              +   ++ R  F +    L     + F       +  S I+    ++ R      AE++
Sbjct  53   FFVSDYERFR-KFDMGPTKLASFMAKTF--HDVRADYVSTISKDASTAARQ----LAEKI  105

Query  122  YWILTSRLRQSGNLSIEQINNILDKIAEKNAQNGSKDSEFIHL-QKCNAMEIKWFTRIIL  180
                 +   +S  +++ ++N ILD +A     +G+K  +   L ++C+  E++W   +IL
Sbjct  106  SEEYRTENDESTVVTVSELNEILDFLAAGPMDDGNKRDKMSKLVKRCSEDELEWIFNVIL  165

Query  181  KDIKIGMGEKS--IFEAYHPDADWYYGEKCDLKQVC-DTLLNLQTQLERNISN----VAL  233
            K+++  +G  S  I +   P A   + +  DLK V    L+  +   E   +N      L
Sbjct  166  KNVESALGAPSNRILDWISPSACAIWDQTHDLKAVLKGKLVENKGTNELGETNDDDDEHL  225

Query  234  LSPFKPMLLERLK-------VEEIGKLFTSDDTYVIQTKFDGERSQLHMKNGEYKYFTRH  286
               + PMLL++ K       +E+ G        + +QTKFDGE   LH K  EY++FTR+
Sbjct  226  FKIWTPMLLQKQKRGDWYANIEKFG-----GQKFFLQTKFDGENVLLHKKGNEYRWFTRN  280

Query  287  GLDITDNSGFGASKSSMNSFLTKAIADLINPQCQSIILDGELVGWHKEKKIF---GSKGM  343
              D +    +G S  ++   L+  I    N +C+S I + EL+ W K+ K          
Sbjct  281  NNDFSKE--YGDSSMAIGK-LSSRIHSFFNKECESAIFNCELMLWDKKTKKLCRHNDAST  337

Query  344  SYDVKKLTSR-----SNYQSCFIAFDVILYNDRLLINLPLHERLKILEAAF--KEQEGVL  396
            + D + L+ R      N Q   + FD++  N +     PLH+RL++L+ A   KE+E  +
Sbjct  338  TSDAQVLSFRHVKPDDNQQLTVVLFDLLYLNGKPFFGAPLHQRLEMLKIAPLKKEREDTI  397

Query  397  VRCKNTLVKTKDEVLDIFNKSMDNDDEGIVLKKVDSYYRPNSREG-NCCYKLKAEYSDGL  455
               K+     K+++   F  +M N++EGIV+K+ DS Y    R   N  +KLK   S   
Sbjct  398  FVAKHEEGSKKEDIQQFFEIAMANNEEGIVVKRTDSVYVKGQRSASNGWFKLKPSASKDC  457

Query  456  IEDIDMLILGGYYGENKYAGVISSF  480
              D+D+ ++  + G  +    +  F
Sbjct  458  --DLDLALVAVHPGAGRNGKTLYRF  480



Lambda      K        H
   0.319    0.135    0.389 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1444367316


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933684.1 putative mediator of RNA polymerase II transcription
subunit 26 [Chelonus insularis]

Length=922
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W384_DROME  unnamed protein product                                 387     8e-122
Q9BIW6_DROME  unnamed protein product                                 387     1e-121


>Q9W384_DROME unnamed protein product
Length=749

 Score = 387 bits (995),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 251/338 (74%), Gaps = 23/338 (7%)

Query  1    MALPQNYKQVALSASGMVS---------TNSRIRTSGNSGSGSGTSKDSSSPFIQTPHGH  51
            MALP NYKQ+A+   G  +                S   G G   +KD +  F  + +G+
Sbjct  1    MALPSNYKQIAVGGQGSATPLQGGGGGSGGGSRSRSSGGGGGGDRNKDQTPIFTHSNYGN  60

Query  52   PGFTPQKVGKNTPA----DSRLPKPPKAPEKPLMPYMRYSRKVWDQVKAQNPELKLWEIG  107
            P FTPQKV K++ +    +SRLPKPPK PEKP++PYMRYS++VWD VKA++PELKLWE+G
Sbjct  61   PAFTPQKVTKSSSSKNQNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELG  120

Query  108  KIIGQMWRDLPEEDKTEFIEEYEAEKIEYEKSLKTYHNSPAYLAYIAAKNRGKSALCVAQ  167
            K IG MW+ LPE++KTEFI+EYEAEK+EYEKSLK YH +PAY AY++AK++ K+      
Sbjct  121  KKIGAMWKLLPEDEKTEFIDEYEAEKLEYEKSLKAYHQTPAYQAYMSAKSKVKT------  174

Query  168  QNNDDRETHERSTSSSKNQSAQDRRIDILPAEDEDDQDDGYSVKHVAYSRYTRNHRLINE  227
                D + HE  +    ++S  +RRIDI PAEDEDDQD+GY+ KH+AY+RY  NHRLINE
Sbjct  175  ----DVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQDEGYTTKHLAYARYLHNHRLINE  230

Query  228  IFSDTVVPDVRSVVTTQRMQVLRRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFIEASEI  287
            IFS+ VVPDVRSVVTT RMQVL+RQV SLTMHQ KLEAELQQ+EEKFEAKK++ +E+SE 
Sbjct  231  IFSEAVVPDVRSVVTTTRMQVLKRQVSSLTMHQTKLEAELQQMEEKFEAKKQRMVESSEA  290

Query  288  FQEELKKHCKPAVDEETFNKMVERQYELLRRERLRGNE  325
            FQEELK+HCKPAVDEETF KMV R YE ++R+R R +E
Sbjct  291  FQEELKRHCKPAVDEETFQKMVLRMYEDIKRDRQRLDE  328


>Q9BIW6_DROME unnamed protein product
Length=749

 Score = 387 bits (994),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 251/338 (74%), Gaps = 23/338 (7%)

Query  1    MALPQNYKQVALSASGMVS---------TNSRIRTSGNSGSGSGTSKDSSSPFIQTPHGH  51
            MALP NYKQ+A+   G  +                S   G G   +KD +  F  + +G+
Sbjct  1    MALPSNYKQIAVGGQGSATPLQGGGGGSGGGSRSRSSGGGGGGDRNKDQTPIFTHSNYGN  60

Query  52   PGFTPQKVGKNTPA----DSRLPKPPKAPEKPLMPYMRYSRKVWDQVKAQNPELKLWEIG  107
            P FTPQKV K++ +    +SRLPKPPK PEKP++PYMRYS++VWD VKA++PELKLWE+G
Sbjct  61   PAFTPQKVTKSSSSKNQNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELG  120

Query  108  KIIGQMWRDLPEEDKTEFIEEYEAEKIEYEKSLKTYHNSPAYLAYIAAKNRGKSALCVAQ  167
            K IG MW+ LPE++KTEFI+EYEAEK+EYEKSLK YH +PAY AY++AK++ K+      
Sbjct  121  KKIGAMWKLLPEDEKTEFIDEYEAEKLEYEKSLKAYHQTPAYQAYMSAKSKVKT------  174

Query  168  QNNDDRETHERSTSSSKNQSAQDRRIDILPAEDEDDQDDGYSVKHVAYSRYTRNHRLINE  227
                D + HE  +    ++S  +RRIDI PAEDEDDQD+GY+ KH+AY+RY  NHRLINE
Sbjct  175  ----DVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQDEGYTTKHLAYARYLHNHRLINE  230

Query  228  IFSDTVVPDVRSVVTTQRMQVLRRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFIEASEI  287
            IFS+ VVPDVRSVVTT RMQVL+RQV SLTMHQ KLEAELQQ+EEKFEAKK++ +E+SE 
Sbjct  231  IFSEAVVPDVRSVVTTTRMQVLKRQVSSLTMHQTKLEAELQQMEEKFEAKKQRMVESSEA  290

Query  288  FQEELKKHCKPAVDEETFNKMVERQYELLRRERLRGNE  325
            FQEELK+HCKPAVDEETF KMV R YE ++R+R R +E
Sbjct  291  FQEELKRHCKPAVDEETFQKMVLRMYEDIKRDRQRLDE  328



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933685.1 DNA ligase 4-like isoform X1 [Chelonus insularis]

Length=943
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYA5_DROME  unnamed protein product                                 345     6e-104
Q8MS06_DROME  unnamed protein product                                 342     5e-103
Q95YE6_CAEEL  unnamed protein product                                 127     1e-29 


>Q9VYA5_DROME unnamed protein product
Length=918

 Score = 345 bits (884),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 278/975 (29%), Positives = 476/975 (49%), Gaps = 103/975 (11%)

Query  1    MSLASKITFQNFCEVLENI-WTARGNKKVEILKKFLDNY--------RQLGREMKEKDPN  51
            + +AS I F++ C + E I  T +   K E+LK + +++        RQ G    + +  
Sbjct  3    VDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPEDG  62

Query  52   VDVSLYPVMRLLLVKSDKHRGPFGLKQINLGKLYVRVFCLGKTSTEAQSIINYRQPSSDR  111
               S Y V+RLLL  +D  R  +GL+   LG+LY+RV  L   S++A  +  +R  +  R
Sbjct  63   AS-SFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRL-QHRNGNMYR  120

Query  112  MQMNDFAERVYWILTSR-LRQSGNLSIEQINNILDKIAEKNAQNGSKDSEFIHL-QKCNA  169
                D+ + VY +L  R      NL +++I+ +LD IA ++ +   K  + I   ++ + 
Sbjct  121  ----DYGDVVYSVLKPRCFNPPSNLRLKEIHQMLDTIANEDTE--VKQQQLIRFTEQASP  174

Query  170  MEIKWFTRIILKDIKIGMGEKSIFEAYHPDADWYYGEKCDLKQVCDTLLNLQTQLERNIS  229
             E KW  R++LK + +G+GE+ IF   HP A   Y    DL  VC+ L +  T L+ + S
Sbjct  175  EEQKWLIRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSS  234

Query  230  NVA-----------LLSPF---KPMLLERLKVEEIGKLFTSDDTYVIQTKFDGERSQLHM  275
              +           ++ PF   +PML ER    +I +L  SD  Y ++TK DGER QLH+
Sbjct  235  KDSKAAVKFVNLNSVIRPFHQIRPMLCERFP-GDIQELMQSDVLY-LETKMDGERFQLHI  292

Query  276  KNGEYKYFTRHGLDITDNSGFGASKSSMNSFLTKAIADLINPQCQSIILDGELVGWHKEK  335
              G + Y +R+G+D T N G      +    LT  +  L+    +SIILDGE++ W   K
Sbjct  293  DRGRFMYISRNGVDYTRNFGHSYDHGT----LTPKLRGLLPLGLESIILDGEMMVWDTNK  348

Query  336  KIFGSKGMSYDVKKLTSRSNYQSCFIAFDVILYNDRLLINLPLHERLKILEAAFKEQEGV  395
              F  KG + DVK L    ++Q CF+ +D++ +N + L++    +R   L+    EQ GV
Sbjct  349  LRFREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGV  408

Query  396  LVRCKNTLVKTKDEVLDIFNKSMDNDDEGIVLKKVDSYYRPNSREGNCCYKLKAEYSDGL  455
            L   +   + +  E  ++F +++D+  EGIVLKK  S Y+P  R G   YK KA+Y  GL
Sbjct  409  LQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYIKGL  468

Query  456  IEDIDMLILGGYYGENKYAGVISSFLMGVSSSSRSNNSSTDEQSEITIDSNSNLKFLSVG  515
            I + D+LI+G +Y  N+    + SFL+GV   +   +S+  E   I + +N+  +    G
Sbjct  469  ITEFDVLIIGAFY--NRKRTFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQ---RG  523

Query  516  SVSSGLSVDKIKEINERFKPYWSQECPRNIVGPKKYLPDVWIEPKRSLVLQLRATEMIKC  575
             ++  L       +NE   P W    P+   G     PD+WIEP+ S++LQ++A ++   
Sbjct  524  VLNHTLKPHWHDVVNEP-PPLWFHYKPKERSG----CPDLWIEPQNSVILQVKAADLAPN  578

Query  576  DYQPAGYTLRFPRVLRSREDKPWTDVCSLTELKSFIKSDGVVQKLTKRHATMSDVQTDL-  634
                   +L FPR    R+DK W++  +L E          ++KL KR   + DV T   
Sbjct  579  GAFFTRKSLHFPRTEMKRDDKTWSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRK  638

Query  635  SLLGSPSKRLREIKEEMFLKPLKIDSRYFGVNAATVERKTRLFEAKEICVINGEEKLQKP  694
             +  +PS+R R       L     + RY   +A+T    ++LF+    C+++G       
Sbjct  639  QMRMTPSERSR-------LGLAVYEKRY---DASTSASTSKLFDGLSFCILSGSAG----  684

Query  695  GFNDEEKWTKSDIERILISHSAKIVQNPGKN---TFCLIVGNPNSVKVQTQVNCRTYDVV  751
                  + +K  ++ + + +   IV+NP  N    FC+       VK       RT D+V
Sbjct  685  ------RHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIV  738

Query  752  KLDWLRRAAEKNNWAKLVDFYPWELLSCRSVTKERLMKKFDEYYDSYVED-SDEQSLKRS  810
            +++WL R  +K      ++  P +L++     ++ L + FD + DSY +D ++ + L+  
Sbjct  739  RMEWLLRVCQKQE----LELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDL  794

Query  811  LERVCLIKNDL----NVNLNTLDDTDKLINKLRSNKLSLFTNIVGYF--ADVSDWRKYGF  864
            L+ + L  +++      NLN L+  D+L++  ++  L++F N+  +F      +  K  F
Sbjct  795  LQGIELTADNVAGITASNLNALE--DQLLDGKKN--LNMFRNLNAFFYSPHGDEVAKLLF  850

Query  865  LFMNGKLSNTINSLTTHVFV---NNLINNLNNNSGRNNVKLVELYKQVNELGKASIKIID  921
            L   G++ +  +      F+   +++ N+   +   N+ KL             + K+++
Sbjct  851  LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLT------------TDKVLN  898

Query  922  SEWIKGCIEKHELLP  936
            S WI  C  +  LLP
Sbjct  899  SAWIHQCHREGILLP  913


>Q8MS06_DROME unnamed protein product
Length=918

 Score = 342 bits (878),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 277/975 (28%), Positives = 475/975 (49%), Gaps = 103/975 (11%)

Query  1    MSLASKITFQNFCEVLENI-WTARGNKKVEILKKFLDNY--------RQLGREMKEKDPN  51
            + +AS I F++ C + E I  T +   K E+LK + +++        RQ G    + +  
Sbjct  3    VDIASTIKFRDICSLFEKIKATQKVANKEEVLKSYYESFCRHRESFRRQTGLNNDQPEDG  62

Query  52   VDVSLYPVMRLLLVKSDKHRGPFGLKQINLGKLYVRVFCLGKTSTEAQSIINYRQPSSDR  111
               S Y V+RLLL  +D  R  +GL+   LG+LY+RV  L   S++A  +  +R  +  R
Sbjct  63   AS-SFYSVLRLLLPGADTGRDTYGLQITALGRLYIRVLQLPTDSSDAIRL-QHRNGNMYR  120

Query  112  MQMNDFAERVYWILTSR-LRQSGNLSIEQINNILDKIAEKNAQNGSKDSEFIHL-QKCNA  169
                 + + VY +L  R      NL +++I+ +LD IA ++ +   K  + I   ++ + 
Sbjct  121  ----GYGDVVYSVLKPRCFNPPSNLRLKEIHQMLDTIANEDTE--VKQQQLIRFTEQASP  174

Query  170  MEIKWFTRIILKDIKIGMGEKSIFEAYHPDADWYYGEKCDLKQVCDTLLNLQTQLERNIS  229
             E KW  R++LK + +G+GE+ IF   HP A   Y    DL  VC+ L +  T L+ + S
Sbjct  175  EEQKWLIRLLLKSLGLGIGEQKIFGVLHPKAQDIYQRCSDLGHVCNLLADRTTDLDASSS  234

Query  230  N-----------VALLSPF---KPMLLERLKVEEIGKLFTSDDTYVIQTKFDGERSQLHM  275
                         +++ PF   +PML ER    +I +L  SD  Y ++TK DGER QLH+
Sbjct  235  KDSKAAVKFVNLNSVIRPFHQIRPMLCERFP-GDIQELMQSDVLY-LETKMDGERFQLHI  292

Query  276  KNGEYKYFTRHGLDITDNSGFGASKSSMNSFLTKAIADLINPQCQSIILDGELVGWHKEK  335
              G + Y +R+G+D T N G      +    LT  +  L+    +SIILDGE++ W   K
Sbjct  293  DRGRFMYISRNGVDYTRNFGHSYDHGT----LTPKLRGLLPLGLESIILDGEMMVWDTNK  348

Query  336  KIFGSKGMSYDVKKLTSRSNYQSCFIAFDVILYNDRLLINLPLHERLKILEAAFKEQEGV  395
              F  KG + DVK L    ++Q CF+ +D++ +N + L++    +R   L+    EQ GV
Sbjct  349  LRFREKGENTDVKSLKPEGSWQPCFVVYDLLYFNGQSLLDHTYIQRAYKLQKLIVEQSGV  408

Query  396  LVRCKNTLVKTKDEVLDIFNKSMDNDDEGIVLKKVDSYYRPNSREGNCCYKLKAEYSDGL  455
            L   +   + +  E  ++F +++D+  EGIVLKK  S Y+P  R G   YK KA+Y  GL
Sbjct  409  LQLMRARKIGSVQEFNELFQQALDSHAEGIVLKKQGSRYQPGVRLGGGWYKDKADYIKGL  468

Query  456  IEDIDMLILGGYYGENKYAGVISSFLMGVSSSSRSNNSSTDEQSEITIDSNSNLKFLSVG  515
            I + D+LI+G +Y  N+    + SFL+GV   +   +S+  E   I + +N+  +    G
Sbjct  469  ITEFDVLIIGAFY--NRKRTFVDSFLLGVLQPAPPGSSNRPEVFSIGVVANNTKQ---RG  523

Query  516  SVSSGLSVDKIKEINERFKPYWSQECPRNIVGPKKYLPDVWIEPKRSLVLQLRATEMIKC  575
             ++  L       +NE   P W    P+   G     PD+WIEP+ S++LQ++A ++   
Sbjct  524  VLNHTLKPHWHDVVNEP-PPLWFHYKPKERSG----CPDLWIEPQNSVILQVKAADLAPN  578

Query  576  DYQPAGYTLRFPRVLRSREDKPWTDVCSLTELKSFIKSDGVVQKLTKRHATMSDVQTDL-  634
                   +L FPR    R+DK W++  +L E          ++KL KR   + DV T   
Sbjct  579  GAFFTRKSLHFPRTEMKRDDKTWSECMTLKEFNDLCGGPLAIKKLNKRQLRLEDVTTKRK  638

Query  635  SLLGSPSKRLREIKEEMFLKPLKIDSRYFGVNAATVERKTRLFEAKEICVINGEEKLQKP  694
             +  +PS+R R       L     + RY   +A+T    ++LF+    C+++G       
Sbjct  639  QMRMTPSERSR-------LGLAVYEKRY---DASTSASTSKLFDGLSFCILSGSAG----  684

Query  695  GFNDEEKWTKSDIERILISHSAKIVQNPGKN---TFCLIVGNPNSVKVQTQVNCRTYDVV  751
                  + +K  ++ + + +   IV+NP  N    FC+       VK       RT D+V
Sbjct  685  ------RHSKHQLQELAVKNGGCIVENPLPNDPKCFCIAGDETFLVKRLILQQPRTCDIV  738

Query  752  KLDWLRRAAEKNNWAKLVDFYPWELLSCRSVTKERLMKKFDEYYDSYVED-SDEQSLKRS  810
            +++WL R  +K      ++  P +L++     ++ L + FD + DSY +D ++ + L+  
Sbjct  739  RMEWLLRVCQKQE----LELKPRDLIAATEPLQQDLAECFDRHGDSYTKDIANVEELQDL  794

Query  811  LERVCLIKNDL----NVNLNTLDDTDKLINKLRSNKLSLFTNIVGYF--ADVSDWRKYGF  864
            L+ + L  +++      NLN L+  D+L++  ++  L++F N+  +F      +  K  F
Sbjct  795  LQGIELTADNVAGITASNLNALE--DQLLDGKKN--LNMFRNLNAFFYSPHGDEVAKLLF  850

Query  865  LFMNGKLSNTINSLTTHVFV---NNLINNLNNNSGRNNVKLVELYKQVNELGKASIKIID  921
            L   G++ +  +      F+   +++ N+   +   N+ KL             + K+++
Sbjct  851  LQNGGRIVDDSDPQLNLGFICMSSDIDNDHFEHWLHNHSKLT------------TDKVLN  898

Query  922  SEWIKGCIEKHELLP  936
            S WI  C  +  LLP
Sbjct  899  SAWIHQCHREGILLP  913


>Q95YE6_CAEEL unnamed protein product
Length=741

 Score = 127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 126/505 (25%), Positives = 229/505 (45%), Gaps = 52/505 (10%)

Query  3    LASKITFQNFCEVLENIW-TARGNKKVEILKKFLDNYRQLGREMKEKDPNVDVSLYPVMR  61
            +AS + F    +V   I  T+    K    +K  +++++     K  DP+    ++ ++R
Sbjct  1    MASDVIFDEVVDVFNKIRRTSNVKSKQATFQKNFESWKE-----KCSDPS---DMFVIIR  52

Query  62   LLLVKSDKHRGPFGLKQINLGKLYVRVFCLGKTSTEAQSIINYRQPSSDRMQMNDFAERV  121
              +   ++ R  F +    L     + F       +  S I+    ++ R      AE++
Sbjct  53   FFVSDYERFR-KFDMGPTKLASFMAKTF--HDVRADYVSTISKDASTAARQ----LAEKI  105

Query  122  YWILTSRLRQSGNLSIEQINNILDKIAEKNAQNGSKDSEFIHL-QKCNAMEIKWFTRIIL  180
                 +   +S  +++ ++N ILD +A     +G+K  +   L ++C+  E++W   +IL
Sbjct  106  SEEYRTENDESTVVTVSELNEILDFLAAGPMDDGNKRDKMSKLVKRCSEDELEWIFNVIL  165

Query  181  KDIKIGMGEKS--IFEAYHPDADWYYGEKCDLKQVC-DTLLNLQTQLERNISN----VAL  233
            K+++  +G  S  I +   P A   + +  DLK V    L+  +   E   +N      L
Sbjct  166  KNVESALGAPSNRILDWISPSACAIWDQTHDLKAVLKGKLVENKGTNELGETNDDDDEHL  225

Query  234  LSPFKPMLLERLK-------VEEIGKLFTSDDTYVIQTKFDGERSQLHMKNGEYKYFTRH  286
               + PMLL++ K       +E+ G        + +QTKFDGE   LH K  EY++FTR+
Sbjct  226  FKIWTPMLLQKQKRGDWYANIEKFG-----GQKFFLQTKFDGENVLLHKKGNEYRWFTRN  280

Query  287  GLDITDNSGFGASKSSMNSFLTKAIADLINPQCQSIILDGELVGWHKEKKIF---GSKGM  343
              D +    +G S  ++   L+  I    N +C+S I + EL+ W K+ K          
Sbjct  281  NNDFSKE--YGDSSMAIGK-LSSRIHSFFNKECESAIFNCELMLWDKKTKKLCRHNDAST  337

Query  344  SYDVKKLTSR-----SNYQSCFIAFDVILYNDRLLINLPLHERLKILEAAF--KEQEGVL  396
            + D + L+ R      N Q   + FD++  N +     PLH+RL++L+ A   KE+E  +
Sbjct  338  TSDAQVLSFRHVKPDDNQQLTVVLFDLLYLNGKPFFGAPLHQRLEMLKIAPLKKEREDTI  397

Query  397  VRCKNTLVKTKDEVLDIFNKSMDNDDEGIVLKKVDSYYRPNSREG-NCCYKLKAEYSDGL  455
               K+     K+++   F  +M N++EGIV+K+ DS Y    R   N  +KLK   S   
Sbjct  398  FVAKHEEGSKKEDIQQFFEIAMANNEEGIVVKRTDSVYVKGQRSASNGWFKLKPSASKDC  457

Query  456  IEDIDMLILGGYYGENKYAGVISSF  480
              D+D+ ++  + G  +    +  F
Sbjct  458  --DLDLALVAVHPGAGRNGKTLYRF  480



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933686.1 general transcription factor 3C polypeptide 3-like
isoform X2 [Chelonus insularis]

Length=907
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KJA9_DROME  unnamed protein product                                 45.4    2e-04
Q9Y148_DROME  unnamed protein product                                 45.1    3e-04
OGT1_CAEEL  unnamed protein product                                   43.9    7e-04


>Q7KJA9_DROME unnamed protein product
Length=1059

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 66/134 (49%), Gaps = 2/134 (1%)

Query  182  GLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMI-YETRDPEKALQFSLIAA  240
            GL+  A+  +   + + A K CM++ RQ  +       L+ I ++ R  +K+ QFS +A 
Sbjct  52   GLLELAHREYQAVDYESAEKHCMQLWRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI  111

Query  241  HLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRAS  300
              NP   + +  L N+  + G +++A+  Y +A++  P  +  Y   A       D+ ++
Sbjct  112  KQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESA  171

Query  301  IKGYMKLIHQLGPE  314
            ++ Y+  + Q  P+
Sbjct  172  VQAYITAL-QYNPD  184


 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 55/119 (46%), Gaps = 1/119 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDPEK-ALQFSLIAAHLNPK  245
            AN++  +G  + A ++ ++ +   P        LA + + +   K AL     A  + P 
Sbjct  363  ANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPT  422

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGY  304
              D +  + N   +  D+  A+ CY++AIQ NP     +   A + + +G++  +I+ Y
Sbjct  423  FADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSY  481


 Score = 39.3 bits (90),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPK  245
            +++ F     D + +     I+Q P   E +  L  +++ R   ++AL     A  L P 
Sbjct  91   SSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPD  150

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
             +D +I LA   + + D++ A+  Y  A+Q NP    +  +   L +  G +  +   Y+
Sbjct  151  FIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL  210

Query  306  KLI  308
            K I
Sbjct  211  KAI  213


 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLA-MIYETRDPEKALQFSLIAAHLNPK  245
            A + + +G  DLAI      I   P+ P+ +  LA  + E    ++A      A  L   
Sbjct  295  ACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSN  354

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
              D    LANI  + G I++A   Y KA++  P   A +   A + +Q G ++ ++  Y 
Sbjct  355  HADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYK  414

Query  306  KLI  308
            + I
Sbjct  415  EAI  417


 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 62/156 (40%), Gaps = 2/156 (1%)

Query  177  PLALQGLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAM-IYETRDPEKALQF  235
            P+  +      N+   +G+   A+      +R  P   + +  LA  +   RD E A+Q 
Sbjct  115  PVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQA  174

Query  236  SLIAAHLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTG  295
             + A   NP        L N+    G +++A  CY KAI+  P     +     +    G
Sbjct  175  YITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQG  234

Query  296  DVRASIKGYMKLIHQLGPEDGEYLINYAKIVAQKFI  331
            ++  +I  + K +  L P   +  IN   ++ +  I
Sbjct  235  EIWLAIHHFEKAV-TLDPNFLDAYINLGNVLKEARI  269


>Q9Y148_DROME unnamed protein product
Length=1011

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 66/134 (49%), Gaps = 2/134 (1%)

Query  182  GLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMI-YETRDPEKALQFSLIAA  240
            GL+  A+  +   + + A K CM++ RQ  +       L+ I ++ R  +K+ QFS +A 
Sbjct  52   GLLELAHREYQAVDYESAEKHCMQLWRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI  111

Query  241  HLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRAS  300
              NP   + +  L N+  + G +++A+  Y +A++  P  +  Y   A       D+ ++
Sbjct  112  KQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESA  171

Query  301  IKGYMKLIHQLGPE  314
            ++ Y+  + Q  P+
Sbjct  172  VQAYITAL-QYNPD  184


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 55/119 (46%), Gaps = 1/119 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDPEK-ALQFSLIAAHLNPK  245
            AN++  +G  + A ++ ++ +   P        LA + + +   K AL     A  + P 
Sbjct  363  ANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPT  422

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGY  304
              D +  + N   +  D+  A+ CY++AIQ NP     +   A + + +G++  +I+ Y
Sbjct  423  FADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSY  481


 Score = 39.3 bits (90),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPK  245
            +++ F     D + +     I+Q P   E +  L  +++ R   ++AL     A  L P 
Sbjct  91   SSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPD  150

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
             +D +I LA   + + D++ A+  Y  A+Q NP    +  +   L +  G +  +   Y+
Sbjct  151  FIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL  210

Query  306  KLI  308
            K I
Sbjct  211  KAI  213


 Score = 38.5 bits (88),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLA-MIYETRDPEKALQFSLIAAHLNPK  245
            A + + +G  DLAI      I   P+ P+ +  LA  + E    ++A      A  L   
Sbjct  295  ACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSN  354

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
              D    LANI  + G I++A   Y KA++  P   A +   A + +Q G ++ ++  Y 
Sbjct  355  HADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYK  414

Query  306  KLI  308
            + I
Sbjct  415  EAI  417


 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 62/156 (40%), Gaps = 2/156 (1%)

Query  177  PLALQGLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAM-IYETRDPEKALQF  235
            P+  +      N+   +G+   A+      +R  P   + +  LA  +   RD E A+Q 
Sbjct  115  PVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQA  174

Query  236  SLIAAHLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTG  295
             + A   NP        L N+    G +++A  CY KAI+  P     +     +    G
Sbjct  175  YITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQG  234

Query  296  DVRASIKGYMKLIHQLGPEDGEYLINYAKIVAQKFI  331
            ++  +I  + K +  L P   +  IN   ++ +  I
Sbjct  235  EIWLAIHHFEKAV-TLDPNFLDAYINLGNVLKEARI  269


>OGT1_CAEEL unnamed protein product
Length=1151

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/121 (25%), Positives = 56/121 (46%), Gaps = 1/121 (1%)

Query  189  LRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPKDV  247
            + F     + +++  M  I+      E +  L   Y+ +   + AL+   +A  L P+ +
Sbjct  168  INFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFI  227

Query  248  DQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYMKL  307
            D +I LA   +  GD++QA+T Y  A+Q NP    +  +   L +  G +  +   Y+K 
Sbjct  228  DAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKA  287

Query  308  I  308
            I
Sbjct  288  I  288


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (46%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLA-MIYETRDPEKALQFSLIAAHLNPK  245
            A + + +G  DLAI    + I   P  P+ +  LA  + E     +A Q  + A  L P 
Sbjct  370  ACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPT  429

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
              D    LANI  + G I+ A   Y KA++  P+  A +   A + +Q G +  +I  Y 
Sbjct  430  HADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYK  489

Query  306  KLI  308
            + I
Sbjct  490  EAI  492


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 54/119 (45%), Gaps = 1/119 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPK  245
            AN++  +G+ + A ++ ++ +   P        LA I + +     A+     A  + P 
Sbjct  438  ANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPT  497

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGY  304
              D +  + N   + GD   AI CY++AIQ NP     +   A + +  G++  +I+ Y
Sbjct  498  FADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSY  556



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933687.1 general transcription factor 3C polypeptide 3-like
isoform X2 [Chelonus insularis]

Length=907
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KJA9_DROME  unnamed protein product                                 45.4    2e-04
Q9Y148_DROME  unnamed protein product                                 45.1    3e-04
OGT1_CAEEL  unnamed protein product                                   43.9    7e-04


>Q7KJA9_DROME unnamed protein product
Length=1059

 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 66/134 (49%), Gaps = 2/134 (1%)

Query  182  GLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMI-YETRDPEKALQFSLIAA  240
            GL+  A+  +   + + A K CM++ RQ  +       L+ I ++ R  +K+ QFS +A 
Sbjct  52   GLLELAHREYQAVDYESAEKHCMQLWRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI  111

Query  241  HLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRAS  300
              NP   + +  L N+  + G +++A+  Y +A++  P  +  Y   A       D+ ++
Sbjct  112  KQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESA  171

Query  301  IKGYMKLIHQLGPE  314
            ++ Y+  + Q  P+
Sbjct  172  VQAYITAL-QYNPD  184


 Score = 43.9 bits (102),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 55/119 (46%), Gaps = 1/119 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDPEK-ALQFSLIAAHLNPK  245
            AN++  +G  + A ++ ++ +   P        LA + + +   K AL     A  + P 
Sbjct  363  ANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPT  422

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGY  304
              D +  + N   +  D+  A+ CY++AIQ NP     +   A + + +G++  +I+ Y
Sbjct  423  FADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSY  481


 Score = 39.3 bits (90),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPK  245
            +++ F     D + +     I+Q P   E +  L  +++ R   ++AL     A  L P 
Sbjct  91   SSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPD  150

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
             +D +I LA   + + D++ A+  Y  A+Q NP    +  +   L +  G +  +   Y+
Sbjct  151  FIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL  210

Query  306  KLI  308
            K I
Sbjct  211  KAI  213


 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLA-MIYETRDPEKALQFSLIAAHLNPK  245
            A + + +G  DLAI      I   P+ P+ +  LA  + E    ++A      A  L   
Sbjct  295  ACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSN  354

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
              D    LANI  + G I++A   Y KA++  P   A +   A + +Q G ++ ++  Y 
Sbjct  355  HADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYK  414

Query  306  KLI  308
            + I
Sbjct  415  EAI  417


 Score = 33.5 bits (75),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 62/156 (40%), Gaps = 2/156 (1%)

Query  177  PLALQGLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAM-IYETRDPEKALQF  235
            P+  +      N+   +G+   A+      +R  P   + +  LA  +   RD E A+Q 
Sbjct  115  PVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQA  174

Query  236  SLIAAHLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTG  295
             + A   NP        L N+    G +++A  CY KAI+  P     +     +    G
Sbjct  175  YITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQG  234

Query  296  DVRASIKGYMKLIHQLGPEDGEYLINYAKIVAQKFI  331
            ++  +I  + K +  L P   +  IN   ++ +  I
Sbjct  235  EIWLAIHHFEKAV-TLDPNFLDAYINLGNVLKEARI  269


>Q9Y148_DROME unnamed protein product
Length=1011

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/134 (24%), Positives = 66/134 (49%), Gaps = 2/134 (1%)

Query  182  GLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMI-YETRDPEKALQFSLIAA  240
            GL+  A+  +   + + A K CM++ RQ  +       L+ I ++ R  +K+ QFS +A 
Sbjct  52   GLLELAHREYQAVDYESAEKHCMQLWRQDSTNTGVLLLLSSIHFQCRRLDKSAQFSTLAI  111

Query  241  HLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRAS  300
              NP   + +  L N+  + G +++A+  Y +A++  P  +  Y   A       D+ ++
Sbjct  112  KQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESA  171

Query  301  IKGYMKLIHQLGPE  314
            ++ Y+  + Q  P+
Sbjct  172  VQAYITAL-QYNPD  184


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/119 (23%), Positives = 55/119 (46%), Gaps = 1/119 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDPEK-ALQFSLIAAHLNPK  245
            AN++  +G  + A ++ ++ +   P        LA + + +   K AL     A  + P 
Sbjct  363  ANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYKEAIRIQPT  422

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGY  304
              D +  + N   +  D+  A+ CY++AIQ NP     +   A + + +G++  +I+ Y
Sbjct  423  FADAYSNMGNTLKELQDVSGALQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSY  481


 Score = 39.3 bits (90),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPK  245
            +++ F     D + +     I+Q P   E +  L  +++ R   ++AL     A  L P 
Sbjct  91   SSIHFQCRRLDKSAQFSTLAIKQNPVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPD  150

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
             +D +I LA   + + D++ A+  Y  A+Q NP    +  +   L +  G +  +   Y+
Sbjct  151  FIDGYINLAAALVAARDMESAVQAYITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYL  210

Query  306  KLI  308
            K I
Sbjct  211  KAI  213


 Score = 38.5 bits (88),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 55/123 (45%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLA-MIYETRDPEKALQFSLIAAHLNPK  245
            A + + +G  DLAI      I   P+ P+ +  LA  + E    ++A      A  L   
Sbjct  295  ACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANALKEKGQVKEAEDCYNTALRLCSN  354

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
              D    LANI  + G I++A   Y KA++  P   A +   A + +Q G ++ ++  Y 
Sbjct  355  HADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLASVLQQQGKLKEALMHYK  414

Query  306  KLI  308
            + I
Sbjct  415  EAI  417


 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 34/156 (22%), Positives = 62/156 (40%), Gaps = 2/156 (1%)

Query  177  PLALQGLMGEANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAM-IYETRDPEKALQF  235
            P+  +      N+   +G+   A+      +R  P   + +  LA  +   RD E A+Q 
Sbjct  115  PVLAEAYSNLGNVFKERGQLQEALDNYRRAVRLKPDFIDGYINLAAALVAARDMESAVQA  174

Query  236  SLIAAHLNPKDVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTG  295
             + A   NP        L N+    G +++A  CY KAI+  P     +     +    G
Sbjct  175  YITALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETCPGFAVAWSNLGCVFNAQG  234

Query  296  DVRASIKGYMKLIHQLGPEDGEYLINYAKIVAQKFI  331
            ++  +I  + K +  L P   +  IN   ++ +  I
Sbjct  235  EIWLAIHHFEKAV-TLDPNFLDAYINLGNVLKEARI  269


>OGT1_CAEEL unnamed protein product
Length=1151

 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/121 (25%), Positives = 56/121 (46%), Gaps = 1/121 (1%)

Query  189  LRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPKDV  247
            + F     + +++  M  I+      E +  L   Y+ +   + AL+   +A  L P+ +
Sbjct  168  INFQTKNLEKSMQYSMLAIKVNNQCAEAYSNLGNYYKEKGQLQDALENYKLAVKLKPEFI  227

Query  248  DQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYMKL  307
            D +I LA   +  GD++QA+T Y  A+Q NP    +  +   L +  G +  +   Y+K 
Sbjct  228  DAYINLAAALVSGGDLEQAVTAYFNALQINPDLYCVRSDLGNLLKAMGRLEEAKVCYLKA  287

Query  308  I  308
            I
Sbjct  288  I  288


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 56/123 (46%), Gaps = 1/123 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLA-MIYETRDPEKALQFSLIAAHLNPK  245
            A + + +G  DLAI    + I   P  P+ +  LA  + E     +A Q  + A  L P 
Sbjct  370  ACVYYEQGLIDLAIDTYKKAIDLQPHFPDAYCNLANALKEKGSVVEAEQMYMKALELCPT  429

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGYM  305
              D    LANI  + G I+ A   Y KA++  P+  A +   A + +Q G +  +I  Y 
Sbjct  430  HADSQNNLANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYK  489

Query  306  KLI  308
            + I
Sbjct  490  EAI  492


 Score = 43.1 bits (100),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 54/119 (45%), Gaps = 1/119 (1%)

Query  187  ANLRFAKGETDLAIKMCMEIIRQVPSAPEPFQTLAMIYETRDP-EKALQFSLIAAHLNPK  245
            AN++  +G+ + A ++ ++ +   P        LA I + +     A+     A  + P 
Sbjct  438  ANIKREQGKIEDATRLYLKALEIYPEFAAAHSNLASILQQQGKLNDAILHYKEAIRIAPT  497

Query  246  DVDQWIKLANISLDSGDIKQAITCYSKAIQANPKDVALYEERAKLQEQTGDVRASIKGY  304
              D +  + N   + GD   AI CY++AIQ NP     +   A + +  G++  +I+ Y
Sbjct  498  FADAYSNMGNTLKEMGDSSAAIACYNRAIQINPAFADAHSNLASIHKDAGNMAEAIQSY  556



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933688.1 uncharacterized protein LOC118063694 [Chelonus
insularis]

Length=330
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U1T5_CAEEL  unnamed protein product                                 46.2    2e-05
ANIS6_ANISI  unnamed protein product                                  36.2    0.004
Q21248_CAEEL  unnamed protein product                                 37.0    0.008


>Q9U1T5_CAEEL unnamed protein product
Length=796

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 58/121 (48%), Gaps = 21/121 (17%)

Query  203  KTCAQPQGPDA-CIAACRVNACECAPGYVRAPNGMCIRQWQCPRNET----VHVQPLRCN  257
            K C Q   P   C+ AC+V  C C  G+VR   G+C+++ +CP   +     + +P +C+
Sbjct  115  KKCPQKNAPQVNCLMACQV-GCSCMDGFVRNNQGVCVKEAECPAIGSQTCGTNEEPNQCH  173

Query  258  RICSGGPHDVCKPCGTRCPPTCENPGPRV-CTKDCAINVCECQEGFVRAPNGQCIRPEFC  316
              C             +CP     P P V C + C I  C C++GF+R   GQC+ P  C
Sbjct  174  NACF----------EKKCP---VKPQPLVNCMEKCDIG-CSCKKGFLRNRQGQCVNPTEC  219

Query  317  P  317
            P
Sbjct  220  P  220


 Score = 36.6 bits (83),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 52/113 (46%), Gaps = 13/113 (12%)

Query  207  QPQGPDACIAACRVNACECAPGYVRAPNGMCIRQWQCPRNETVHVQPLRCNRICSGGPHD  266
            +PQ    C+  C +  C C  G++R   G C+   +CP   +     L C++  +  P+D
Sbjct  184  KPQPLVNCMEKCDI-GCSCKKGFLRNRQGQCVNPTECPATGST----LTCSK--NEEPND  236

Query  267  VCKPCG-TRCPPTCENPGPRV-CTKDCAINVCECQEGFVRAPNGQCIRPEFCP  317
                C   +CP    NP P V C   C    C C++G VR   GQC++   CP
Sbjct  237  CHNSCSEAKCP---VNPQPFVRCMMRCE-KACSCKKGLVRNRQGQCVKLAECP  285


 Score = 36.2 bits (82),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 39/87 (45%), Gaps = 9/87 (10%)

Query  8   ILFTITIIVLMLTIN-EAEAQRGGRCRRRCTGGPRDRCVACGTRCPATCRRPNPGPCTKD  66
           + + + + VL++  N +  A R   C+        +    CGT C  TC  P P  CT  
Sbjct  1   MQYIVLLSVLLIGANAQLSATRDQECKEN------ESFQTCGTACEPTCGLPTPTFCTLQ  54

Query  67  CVINVCQCQRGWV-RAPNGRCVRPNQC  92
           CV+  CQC  G+  R  + RCV    C
Sbjct  55  CVMG-CQCNSGFFRRTSDNRCVEQKDC  80


 Score = 32.3 bits (72),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query  271  CGTRCPPTCENPGPRVCTKDCAINVCECQEGFV-RAPNGQCIRPEFC  316
            CGT C PTC  P P  CT  C +  C+C  GF  R  + +C+  + C
Sbjct  35   CGTACEPTCGLPTPTFCTLQCVMG-CQCNSGFFRRTSDNRCVEQKDC  80


 Score = 30.4 bits (67),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 21/32 (66%), Gaps = 1/32 (3%)

Query  286  VCTKDCAINVCECQEGFVRAPNGQCIRPEFCP  317
            +CTK C    C C  G++R+ +G+C +P+ CP
Sbjct  584  MCTKHCGQG-CACASGYLRSSDGECYKPKDCP  614


 Score = 30.4 bits (67),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 40/92 (43%), Gaps = 14/92 (15%)

Query  182  CNPPCRGGPSDLCLSCASYCPKTCAQPQGPDACIAACRVNACECAPGYVRAPNGMCIRQW  241
            C P C       C  CA  C     +P  P     +C+  AC CAPG+V+  NG C+   
Sbjct  613  CPPECGQNEEYRCEKCAGTCKN--PEPNCPGPKNKSCK-RACICAPGFVKK-NGKCVTLA  668

Query  242  QCPRNETVHVQPL----------RCNRICSGG  263
             CP ++  ++  L          +C ++CSG 
Sbjct  669  SCPDHDHTNITCLGTQEYTDCMPKCQQLCSGA  700


>ANIS6_ANISI unnamed protein product
Length=84

 Score = 36.2 bits (82),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 2/54 (4%)

Query  264  PHDVCKPCGTRCPPTCENPGPRVCTKDCAINVCECQEGFVR-APNGQCIRPEFC  316
            P++    CG  C   C+N  P +CT  C  + C C++G+VR   +G+C+  EFC
Sbjct  27   PNEEYNECGNPCQEKCDNGEPVICTYQCE-HRCFCKQGYVRLTEDGECVPEEFC  79


 Score = 28.9 bits (63),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 32/78 (41%), Gaps = 8/78 (10%)

Query  11  TITIIVLMLTINEAEAQRGGRCRRRCTGGPRDRCVACGTRCPATCRRPNPGPCTKDCVIN  70
           +   +VLM+ +  A       C       P +    CG  C   C    P  CT  C  +
Sbjct  4   STFFLVLMVCVATARFANKDHC------PPNEEYNECGNPCQEKCDNGEPVICTYQCE-H  56

Query  71  VCQCQRGWVR-APNGRCV  87
            C C++G+VR   +G CV
Sbjct  57  RCFCKQGYVRLTEDGECV  74


>Q21248_CAEEL unnamed protein product
Length=171

 Score = 37.0 bits (84),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 33/77 (43%), Gaps = 8/77 (10%)

Query  249  VHVQPLRCNRICSGGPHD-VCKPCGTRCPPTCENPGP------RVCTKDCAINVCECQEG  301
            +HV+  R    C    H  +C P    C  TCEN          +    C    C C +G
Sbjct  42   IHVRSERKAEECQKHEHHLICGP-ERHCDRTCENLFSPPHCLNHLHHAKCYFPRCVCNDG  100

Query  302  FVRAPNGQCIRPEFCPN  318
            +VR+  G CIRP  CPN
Sbjct  101  YVRSEKGICIRPSHCPN  117


 Score = 35.4 bits (80),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query  200  YCPKTCAQPQGPDACI-----AACRVNACECAPGYVRAPNGMCIRQWQCP  244
            +C +TC     P  C+     A C    C C  GYVR+  G+CIR   CP
Sbjct  67   HCDRTCENLFSPPHCLNHLHHAKCYFPRCVCNDGYVRSEKGICIRPSHCP  116


 Score = 30.4 bits (67),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/49 (33%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query  67   CVINVCQCQRGWVRAPNGRCVRPNQCLKS--QGNKMTFSITEISETIIQ  113
            C    C C  G+VR+  G C+RP+ C  +  +   M    TE ++ +IQ
Sbjct  90   CYFPRCVCNDGYVRSEKGICIRPSHCPNTYYEPASMLMDETEDNDMMIQ  138



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933689.1 neither inactivation nor afterpotential protein C
isoform X1 [Chelonus insularis]

Length=1626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1142    0.0  
MYOI_DICDI  unnamed protein product                                   271     7e-73
MYOB_DICDI  unnamed protein product                                   253     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/1308 (46%), Positives = 829/1308 (63%), Gaps = 51/1308 (4%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ  1316
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R 
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRN  1237

Query  1317  ----TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1360
                 +        KK+   QT +         M    NI N  + RDP
Sbjct  1238  PSMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (645),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933690.1 neither inactivation nor afterpotential protein C
isoform X1 [Chelonus insularis]

Length=1626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1142    0.0  
MYOI_DICDI  unnamed protein product                                   271     7e-73
MYOB_DICDI  unnamed protein product                                   253     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/1308 (46%), Positives = 829/1308 (63%), Gaps = 51/1308 (4%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ  1316
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R 
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRN  1237

Query  1317  ----TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1360
                 +        KK+   QT +         M    NI N  + RDP
Sbjct  1238  PSMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (645),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933691.1 neither inactivation nor afterpotential protein C
isoform X1 [Chelonus insularis]

Length=1626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1142    0.0  
MYOI_DICDI  unnamed protein product                                   271     7e-73
MYOB_DICDI  unnamed protein product                                   253     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/1308 (46%), Positives = 829/1308 (63%), Gaps = 51/1308 (4%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ  1316
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R 
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRN  1237

Query  1317  ----TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1360
                 +        KK+   QT +         M    NI N  + RDP
Sbjct  1238  PSMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (645),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


Query= XP_034933692.1 neither inactivation nor afterpotential protein C
isoform X1 [Chelonus insularis]

Length=1626
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1142    0.0  
MYOI_DICDI  unnamed protein product                                   271     7e-73
MYOB_DICDI  unnamed protein product                                   253     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/1308 (46%), Positives = 829/1308 (63%), Gaps = 51/1308 (4%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ  1316
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R 
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRN  1237

Query  1317  ----TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1360
                 +        KK+   QT +         M    NI N  + RDP
Sbjct  1238  PSMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (645),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.304    0.119    0.344 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11631982320


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933693.1 neither inactivation nor afterpotential protein C
isoform X2 [Chelonus insularis]

Length=1585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1139    0.0  
MYOI_DICDI  unnamed protein product                                   270     8e-73
MYOB_DICDI  unnamed protein product                                   253     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/1259 (47%), Positives = 814/1259 (65%), Gaps = 40/1259 (3%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRR  1315
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQR  1236


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 270 bits (691),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (646),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 211/779 (27%), Positives = 362/779 (46%), Gaps = 107/779 (14%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYLSRLYETQVRK----IVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L  L E   +K      KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFL--LEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933694.1 putative mediator of RNA polymerase II transcription
subunit 26 [Chelonus insularis]

Length=922
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W384_DROME  unnamed protein product                                 387     8e-122
Q9BIW6_DROME  unnamed protein product                                 387     1e-121


>Q9W384_DROME unnamed protein product
Length=749

 Score = 387 bits (995),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 251/338 (74%), Gaps = 23/338 (7%)

Query  1    MALPQNYKQVALSASGMVS---------TNSRIRTSGNSGSGSGTSKDSSSPFIQTPHGH  51
            MALP NYKQ+A+   G  +                S   G G   +KD +  F  + +G+
Sbjct  1    MALPSNYKQIAVGGQGSATPLQGGGGGSGGGSRSRSSGGGGGGDRNKDQTPIFTHSNYGN  60

Query  52   PGFTPQKVGKNTPA----DSRLPKPPKAPEKPLMPYMRYSRKVWDQVKAQNPELKLWEIG  107
            P FTPQKV K++ +    +SRLPKPPK PEKP++PYMRYS++VWD VKA++PELKLWE+G
Sbjct  61   PAFTPQKVTKSSSSKNQNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELG  120

Query  108  KIIGQMWRDLPEEDKTEFIEEYEAEKIEYEKSLKTYHNSPAYLAYIAAKNRGKSALCVAQ  167
            K IG MW+ LPE++KTEFI+EYEAEK+EYEKSLK YH +PAY AY++AK++ K+      
Sbjct  121  KKIGAMWKLLPEDEKTEFIDEYEAEKLEYEKSLKAYHQTPAYQAYMSAKSKVKT------  174

Query  168  QNNDDRETHERSTSSSKNQSAQDRRIDILPAEDEDDQDDGYSVKHVAYSRYTRNHRLINE  227
                D + HE  +    ++S  +RRIDI PAEDEDDQD+GY+ KH+AY+RY  NHRLINE
Sbjct  175  ----DVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQDEGYTTKHLAYARYLHNHRLINE  230

Query  228  IFSDTVVPDVRSVVTTQRMQVLRRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFIEASEI  287
            IFS+ VVPDVRSVVTT RMQVL+RQV SLTMHQ KLEAELQQ+EEKFEAKK++ +E+SE 
Sbjct  231  IFSEAVVPDVRSVVTTTRMQVLKRQVSSLTMHQTKLEAELQQMEEKFEAKKQRMVESSEA  290

Query  288  FQEELKKHCKPAVDEETFNKMVERQYELLRRERLRGNE  325
            FQEELK+HCKPAVDEETF KMV R YE ++R+R R +E
Sbjct  291  FQEELKRHCKPAVDEETFQKMVLRMYEDIKRDRQRLDE  328


>Q9BIW6_DROME unnamed protein product
Length=749

 Score = 387 bits (994),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 200/338 (59%), Positives = 251/338 (74%), Gaps = 23/338 (7%)

Query  1    MALPQNYKQVALSASGMVS---------TNSRIRTSGNSGSGSGTSKDSSSPFIQTPHGH  51
            MALP NYKQ+A+   G  +                S   G G   +KD +  F  + +G+
Sbjct  1    MALPSNYKQIAVGGQGSATPLQGGGGGSGGGSRSRSSGGGGGGDRNKDQTPIFTHSNYGN  60

Query  52   PGFTPQKVGKNTPA----DSRLPKPPKAPEKPLMPYMRYSRKVWDQVKAQNPELKLWEIG  107
            P FTPQKV K++ +    +SRLPKPPK PEKP++PYMRYS++VWD VKA++PELKLWE+G
Sbjct  61   PAFTPQKVTKSSSSKNQNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELG  120

Query  108  KIIGQMWRDLPEEDKTEFIEEYEAEKIEYEKSLKTYHNSPAYLAYIAAKNRGKSALCVAQ  167
            K IG MW+ LPE++KTEFI+EYEAEK+EYEKSLK YH +PAY AY++AK++ K+      
Sbjct  121  KKIGAMWKLLPEDEKTEFIDEYEAEKLEYEKSLKAYHQTPAYQAYMSAKSKVKT------  174

Query  168  QNNDDRETHERSTSSSKNQSAQDRRIDILPAEDEDDQDDGYSVKHVAYSRYTRNHRLINE  227
                D + HE  +    ++S  +RRIDI PAEDEDDQD+GY+ KH+AY+RY  NHRLINE
Sbjct  175  ----DVDMHETPSRGGGSKSQHERRIDIQPAEDEDDQDEGYTTKHLAYARYLHNHRLINE  230

Query  228  IFSDTVVPDVRSVVTTQRMQVLRRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFIEASEI  287
            IFS+ VVPDVRSVVTT RMQVL+RQV SLTMHQ KLEAELQQ+EEKFEAKK++ +E+SE 
Sbjct  231  IFSEAVVPDVRSVVTTTRMQVLKRQVSSLTMHQTKLEAELQQMEEKFEAKKQRMVESSEA  290

Query  288  FQEELKKHCKPAVDEETFNKMVERQYELLRRERLRGNE  325
            FQEELK+HCKPAVDEETF KMV R YE ++R+R R +E
Sbjct  291  FQEELKRHCKPAVDEETFQKMVLRMYEDIKRDRQRLDE  328



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933695.1 neither inactivation nor afterpotential protein C
isoform X3 [Chelonus insularis]

Length=1584
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1139    0.0  
MYOI_DICDI  unnamed protein product                                   270     8e-73
MYOB_DICDI  unnamed protein product                                   253     1e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/1259 (47%), Positives = 814/1259 (65%), Gaps = 40/1259 (3%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRR  1315
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQR  1236


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 270 bits (691),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (646),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933696.1 neither inactivation nor afterpotential protein C
isoform X4 [Chelonus insularis]

Length=1435
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1142    0.0  
MYOI_DICDI  unnamed protein product                                   271     2e-73
MYOB_DICDI  unnamed protein product                                   253     8e-69


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1142 bits (2954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/1308 (46%), Positives = 829/1308 (63%), Gaps = 51/1308 (4%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ  1316
                P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R 
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRN  1237

Query  1317  ----TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1360
                 +        KK+   QT +         M    NI N  + RDP
Sbjct  1238  PSMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (694),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 253 bits (647),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 211/779 (27%), Positives = 362/779 (46%), Gaps = 107/779 (14%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYLSRLYETQVRK----IVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L  L E   +K      KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFL--LEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933697.1 neither inactivation nor afterpotential protein C
isoform X5 [Chelonus insularis]

Length=1380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  974     0.0  
MYOI_DICDI  unnamed protein product                                   271     3e-73
MYOB_DICDI  unnamed protein product                                   252     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/1127 (46%), Positives = 713/1127 (63%), Gaps = 48/1127 (4%)

Query  1     MAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPSL  60
             MAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+L
Sbjct  187   MAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPTL  245

Query  61    YRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNARE  120
              RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R+
Sbjct  246   MRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSRD  305

Query  121   KAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFV  180
                  K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F+
Sbjct  306   VKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSFI  365

Query  181   GDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSG  240
             GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ SG
Sbjct  366   GDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLSG  425

Query  241   ESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQLQ  300
             ES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q  
Sbjct  426   ESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQYC  485

Query  301   TTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRR  360
              TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R 
Sbjct  486   LTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADRN  545

Query  361   MRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILIL  418
              RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL +
Sbjct  546   YRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILNI  604

Query  419   GEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEA  478
             G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EEA
Sbjct  605   GNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEEA  663

Query  479   NLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLI  538
               ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL+
Sbjct  664   RDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQLM  723

Query  539   VNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYA  598
             +NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D A
Sbjct  724   INTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDDA  783

Query  599   SRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMI  658
             SR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEMI
Sbjct  784   SRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEMI  842

Query  659   NTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSR  718
              T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S 
Sbjct  843   ETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLSA  892

Query  719   GQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQ  778
             G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+Q
Sbjct  893   GCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQQ  951

Query  779   QIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG  838
             Q++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKMEG
Sbjct  952   QMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKMEG  1011

Query  839   WIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKST  898
             W +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K  
Sbjct  1012  WALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KGG  1059

Query  899   QVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKWK  954
             +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW+
Sbjct  1060  KVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKWR  1119

Query  955   SKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYLD  1014
              KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L 
Sbjct  1120  EKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQLG  1179

Query  1015  NRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ-  1070
               P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R  
Sbjct  1180  PLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRNP  1238

Query  1071  ---TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1114
                +        KK+   QT +         M    NI N  + RDP
Sbjct  1239  SMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  149  TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  208
             ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15   VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  209  RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  268
            R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75   RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  269  IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  328
              + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135  QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  329  RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  388
             S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195  SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  389  FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  432
             + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237  IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  433  IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  492
            + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295  VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  493  LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  552
            + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355  VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  553  RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  610
             +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412  HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  611  KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  668
               +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472  LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  669  IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  728
            I ++FT    +        D  KG + KK   G+                          
Sbjct  532  IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  729  TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  788
                TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560  ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  789  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  842
             +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612  IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  843  KTKVFLK  849
             TKVF++
Sbjct  670  NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 252 bits (644),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  141  KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  200
            K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3    KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  201  HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  260
             E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63   IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  261  GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  317
              ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123  SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  318  QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  377
             LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183  LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  378  VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  427
                 Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230  -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  428  NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  479
               A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285  KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  480  LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  539
              RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345  GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  540  NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  596
            N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403  NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  597  YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  652
             ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463  CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  653  VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  712
            +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522  LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  713  YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  772
                     +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556  ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  773  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  828
               V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596  NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  829  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  881
             +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656  TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933698.1 neither inactivation nor afterpotential protein C
isoform X5 [Chelonus insularis]

Length=1380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  974     0.0  
MYOI_DICDI  unnamed protein product                                   271     3e-73
MYOB_DICDI  unnamed protein product                                   252     2e-68


>NINAC_DROME unnamed protein product
Length=1501

 Score = 974 bits (2517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/1127 (46%), Positives = 713/1127 (63%), Gaps = 48/1127 (4%)

Query  1     MAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPSL  60
             MAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+L
Sbjct  187   MAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPTL  245

Query  61    YRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNARE  120
              RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R+
Sbjct  246   MRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSRD  305

Query  121   KAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFV  180
                  K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F+
Sbjct  306   VKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSFI  365

Query  181   GDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSG  240
             GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ SG
Sbjct  366   GDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLSG  425

Query  241   ESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQLQ  300
             ES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q  
Sbjct  426   ESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQYC  485

Query  301   TTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRR  360
              TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R 
Sbjct  486   LTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADRN  545

Query  361   MRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILIL  418
              RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL +
Sbjct  546   YRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILNI  604

Query  419   GEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEA  478
             G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EEA
Sbjct  605   GNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEEA  663

Query  479   NLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLI  538
               ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL+
Sbjct  664   RDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQLM  723

Query  539   VNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYA  598
             +NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D A
Sbjct  724   INTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDDA  783

Query  599   SRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMI  658
             SR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEMI
Sbjct  784   SRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEMI  842

Query  659   NTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSR  718
              T R+S  E I  +FT QLTK+GNLT   +  +     +R          K    NT S 
Sbjct  843   ETFRSSLDESIMLMFTNQLTKAGNLTMPFEAVQHKDESER----------KSYALNTLSA  892

Query  719   GQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQ  778
             G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+Q
Sbjct  893   GCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQQ  951

Query  779   QIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG  838
             Q++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKMEG
Sbjct  952   QMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKMEG  1011

Query  839   WIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKST  898
             W +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K  
Sbjct  1012  WALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KGG  1059

Query  899   QVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVL---KGEFDENTKQFIEYYSSKWK  954
             +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW+
Sbjct  1060  KVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKWR  1119

Query  955   SKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYLD  1014
              KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L 
Sbjct  1120  EKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQLG  1179

Query  1015  NRPRQVHKLPFDLYNEFPFFDTSYMNDP---LKGRRGTGSICSVSDEEHESWDAPLRRQ-  1070
               P  + K+PF L ++ PF+DT YM DP   +  +     + +   E+ E WD+PL+R  
Sbjct  1180  PLPVPIKKMPFRL-DQIPFYDTQYMVDPANSISRQAFPNQLLTQHMEDDEPWDSPLQRNP  1238

Query  1071  ---TVPWATQPNKKDVEIQTTFSPNRSPRHNMNTGQNIINTPFTRDP  1114
                +        KK+   QT +         M    NI N  + RDP
Sbjct  1239  SMTSCALTYNAYKKEQACQTNWD-------RMGESDNIYNQGYFRDP  1278


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  149  TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  208
             ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15   VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  209  RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  268
            R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75   RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  269  IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  328
              + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135  QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  329  RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  388
             S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195  SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  389  FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  432
             + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237  IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  433  IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  492
            + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295  VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  493  LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  552
            + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355  VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  553  RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  610
             +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412  HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  611  KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  668
               +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472  LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  669  IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  728
            I ++FT    +        D  KG + KK   G+                          
Sbjct  532  IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  729  TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  788
                TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560  ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  789  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  842
             +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612  IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  843  KTKVFLK  849
             TKVF++
Sbjct  670  NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 252 bits (644),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 209/777 (27%), Positives = 360/777 (46%), Gaps = 103/777 (13%)

Query  141  KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  200
            K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3    KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  201  HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  260
             E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63   IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  261  GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  317
              ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123  SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  318  QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  377
             LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183  LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  378  VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  427
                 Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230  -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  428  NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  479
               A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285  KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  480  LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  539
              RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345  GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  540  NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  596
            N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403  NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  597  YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  652
             ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463  CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  653  VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  712
            +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522  LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  713  YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  772
                     +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556  ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  773  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  828
               V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596  NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  829  LLLVRLKMEG--WIIGKTKVFLKYYNEEYL--SRLYETQVRKIVKIQCMLRAFLARK  881
             +   + +E   W +GKTKVF+++    +L    L +       KIQ   R + A+K
Sbjct  656  TIFQDMNLEAGQWQLGKTKVFIRHPETVFLLEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933699.1 neither inactivation nor afterpotential protein C
isoform X6 [Chelonus insularis]

Length=1316
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1130    0.0  
MYOI_DICDI  unnamed protein product                                   271     2e-73
MYOB_DICDI  unnamed protein product                                   254     4e-69


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/1229 (48%), Positives = 801/1229 (65%), Gaps = 37/1229 (3%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +          V  K + E  K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEA---------VQHKDESE-RKSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVLK---GEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP  1288
                P  + K+PF L ++ PF+DT YM DP
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDP  1206


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 254 bits (649),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 211/779 (27%), Positives = 362/779 (46%), Gaps = 107/779 (14%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYLSRLYETQVRK----IVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L  L E   +K      KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFL--LEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


Query= XP_034933700.1 neither inactivation nor afterpotential protein C
isoform X6 [Chelonus insularis]

Length=1316
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1130    0.0  
MYOI_DICDI  unnamed protein product                                   271     2e-73
MYOB_DICDI  unnamed protein product                                   254     4e-69


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/1229 (48%), Positives = 801/1229 (65%), Gaps = 37/1229 (3%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +          V  K + E  K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEA---------VQHKDESE-RKSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVLK---GEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP  1288
                P  + K+PF L ++ PF+DT YM DP
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDP  1206


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 254 bits (649),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 211/779 (27%), Positives = 362/779 (46%), Gaps = 107/779 (14%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYLSRLYETQVRK----IVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L  L E   +K      KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFL--LEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.316    0.133    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20947469920


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jan 24, 2022  2:22 PM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= XP_034933701.1 neither inactivation nor afterpotential protein C
isoform X6 [Chelonus insularis]

Length=1316
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NINAC_DROME  unnamed protein product                                  1130    0.0  
MYOI_DICDI  unnamed protein product                                   271     2e-73
MYOB_DICDI  unnamed protein product                                   254     4e-69


>NINAC_DROME unnamed protein product
Length=1501

 Score = 1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/1229 (48%), Positives = 801/1229 (65%), Gaps = 37/1229 (3%)

Query  66    IQDPGKRYVLNEVIGSGVCGVVYAAVDTQSGSRPVAVKIQPLTSETQEFIVEEYRIFRDH  125
             + DP  ++ + E I  GV   V+ A +  +  R VA+KIQ    E Q  I EEYR  RD+
Sbjct  9     LPDPTDKFEIYEEIAQGVNAKVFRAKELDN-DRIVALKIQHYDEEHQVSIEEEYRTLRDY  67

Query  126   GGHPNIPDFNGIYRKRSGKKTVPDQLWIAMELCSGGPVMDLVRGLAASEKTMREEHISYI  185
               HPN+P+F G+Y+    K   PD++W  ME C+GG  +D+V  L   ++ MREEHI+YI
Sbjct  68    CDHPNLPEFYGVYK--LSKPNGPDEIWFVMEYCAGGTAVDMVNKLLKLDRRMREEHIAYI  125

Query  186   LREVIKALIHLHENNVIHRDVKGSNILITSSGEVKLTDFGLAKQLKSPTSKCKTCIGSPS  245
             +RE  +A I L+ N+V+HRD++G NIL+T +G VKL DFGL++Q+ S   K  TCIGSP 
Sbjct  126   IRETCRAAIELNRNHVLHRDIRGDNILLTKNGRVKLCDFGLSRQVDSTLGKRGTCIGSPC  185

Query  246   WMAPEVVMSKSDDPEGGYDTRADVWSIGITAIELAEGKAPFESMHATRALFQIVRNPPPS  305
             WMAPEVV S  +  E     RADVW++GIT IELA+GK PF  MH TRA+FQI+RNPPP+
Sbjct  186   WMAPEVV-SAMESREPDITVRADVWALGITTIELADGKPPFADMHPTRAMFQIIRNPPPT  244

Query  306   LYRPANWSDNFIDFINECLEKNPENRPVMAEILEHPFLQELPSNDYVLTQELKTLAQNAR  365
             L RP NWS    DFI+E LEKN ENRP+M E++EHPFL EL  N+  +  ++  + + +R
Sbjct  245   LMRPTNWSQQINDFISESLEKNAENRPMMVEMVEHPFLTELIENEDEMRSDIAEMLELSR  304

Query  366   EKAPKSKYPECMVRNGFVKTDKREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAF  425
             +     K PE  V  G+VK    + E+M  EDLAALE   ++ I++ L  RI  G+ ++F
Sbjct  305   DVKTLYKEPELFVDRGYVKRFDEKPEKMYPEDLAALENPVDENIIESLRHRILMGESYSF  364

Query  426   VGDVLIILNPNEIQDIYGLSYHEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFS  485
             +GD+L+ LN NEI+  +   +H KY FKSRS+N PHI+SVAD AYQD+LH++E QHI+ S
Sbjct  365   IGDILLSLNSNEIKQEFPQEFHAKYRFKSRSENQPHIFSVADIAYQDMLHHKEPQHIVLS  424

Query  486   GESKSGKTSNMMNVIKHLMYLGKSTKDIGIRLAKAMDLIQALTHAATPLNPNSTRCVFQL  545
             GES SGK++N   +IKHL YLG   +    R+  ++  I  L +A TP+N +STRCV Q 
Sbjct  425   GESYSGKSTNARLLIKHLCYLGDGNRGATGRVESSIKAILMLVNAGTPVNNDSTRCVLQY  484

Query  546   QTTFGSTGKASGAIFWIYQLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGR  605
               TFG TGK SGA+F +Y LEK RV+  D +Q NFHIFYY YD ++ + +L+EY+L + R
Sbjct  485   CLTFGKTGKMSGAVFNMYMLEKLRVATTDGTQHNFHIFYYFYDFINQQNQLKEYNLKADR  544

Query  606   RMRYLRICEPNYGKASCEVRH-NPQGNCLKFDEINEVLKLMEM-EECTKKIWTILSAILI  663
               RYLR+  P    +  + R  +P+GN  ++ E   +L+ ++   +  + +  +L+AIL 
Sbjct  545   NYRYLRV-PPEVPPSKLKYRRDDPEGNVERYREFENILRDIDFNHKQLETVRKVLAAILN  603

Query  664   LGEVRFIEGSNSEAEIRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEE  723
             +G +RF +     AE+ N D  + +A LL +D+KKF+WSLTN+ M+K G   R ++T EE
Sbjct  604   IGNIRFRQNGKY-AEVENTDIVSRIAELLRVDEKKFMWSLTNFIMVKGGIAERRQYTTEE  662

Query  724   ANLARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQL  783
             A  ARD ++ST+Y+RLVD+IIN +N  +S  R +FGD   I + D+FGFECF+ N LEQL
Sbjct  663   ARDARDAVASTLYSRLVDFIINRINMNMSFPRAVFGDTNAIIIHDMFGFECFNRNGLEQL  722

Query  784   IVNTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDY  843
             ++NT+NEQ+Q +YNQR+F  EM E E E+I     ++YDN+  ++ L+ K  GLF ++D 
Sbjct  723   MINTLNEQMQYHYNQRIFISEMLEMEAEDIDTINLNFYDNKTALDNLLTKPDGLFYIIDD  782

Query  844   ASRESQDTQYILEKMKDKSKGLYVKAISHHEFSVAHYTGKISYDATDIVEKNRDFVPPEM  903
             ASR  QD   I++++ +K    +VK  +  E SVAHYTG+I YD     + NRDFVPPEM
Sbjct  783   ASRSCQDQDLIMDRVSEKHSQ-FVKKHTATEISVAHYTGRIIYDTRAFTDINRDFVPPEM  841

Query  904   INTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSS  963
             I T R+S  E I  +FT QLTK+GNLT   +          V  K + E  K    NT S
Sbjct  842   IETFRSSLDESIMLMFTNQLTKAGNLTMPFEA---------VQHKDESE-RKSYALNTLS  891

Query  964   RGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVR  1023
              G  SQ   +RT AA FR   L +LK LS  ++N G HFVRCIRADLE KPR F+ ++V+
Sbjct  892   AGCISQVNNLRTLAANFRFTCLTLLKMLS-QNANLGVHFVRCIRADLEYKPRSFHSDVVQ  950

Query  1024  QQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKME  1083
             QQ++AL VLDT   RQKGF  R+PF EFLRRY+FLAFDFDE VEMTKDNCRLL +RLKME
Sbjct  951   QQMKALGVLDTVIARQKGFSSRLPFDEFLRRYQFLAFDFDEPVEMTKDNCRLLFLRLKME  1010

Query  1084  GWIIGKTKVFLKYYNEEYLSRLYETQVRKIVKIQCMLRAFLARKKLNKVNQKKKENAKKS  1143
             GW +GKTKVFL+YYN+E+L+RLYE QV+K++K+Q M+RA LARK++            K 
Sbjct  1011  GWALGKTKVFLRYYNDEFLARLYELQVKKVIKVQSMMRALLARKRV------------KG  1058

Query  1144  TQVKKSDSVTMSEED-AALKIQKTFRGHAVRKEMGPVLK---GEFDENTKQFIEYYSSKW  1199
              +V K         D AA KIQK FRG   R  + P++    G+ +ENT  FI  ++ KW
Sbjct  1059  GKVFKLGKKGPEHHDVAASKIQKAFRGFRDRVRLPPLVNEKSGQLNENTADFIRPFAKKW  1118

Query  1200  KSKSIFQVLLQYRAARYQDLVQFCQQVHLYNQTCFANLQENTQRAPLDKIDPNANKNLYL  1259
             + KSIFQVLL YRAAR+QD V   QQVH+YNQ   A L + T+  P ++I+     +  L
Sbjct  1119  REKSIFQVLLHYRAARFQDFVNLSQQVHIYNQRMVAGLNKCTRAVPFERINMREVNSSQL  1178

Query  1260  DNRPRQVHKLPFDLYNEFPFFDTSYMNDP  1288
                P  + K+PF L ++ PF+DT YM DP
Sbjct  1179  GPLPVPIKKMPFRL-DQIPFYDTQYMVDP  1206


>MYOI_DICDI unnamed protein product
Length=2357

 Score = 271 bits (692),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 205/727 (28%), Positives = 352/727 (48%), Gaps = 91/727 (13%)

Query  395   TEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSYHEKYNFKS  454
              ED+  L +LTE+++L  L  R ++ + + + G +L+ +NP EI  IY     + Y  KS
Sbjct  15    VEDMITLPILTEESLLLNLKMRYKKKEIYTYTGSILVAVNPYEILPIYTADIVKSYFAKS  74

Query  455   RSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYLGKSTKDIG  514
             R+   PHI++V+D A+ +++   + Q II SGES +GKT +   +I++L         + 
Sbjct  75    RNLMLPHIFAVSDAAFTNMIEEGKNQSIIISGESGAGKTESTKLIIQYLAARTNRHSQVE  134

Query  515   IRLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIYQLEKWRVSLFD  574
               + ++  +++A  +A T  N NS+R    ++  F   G  SGA    Y LEK R+S   
Sbjct  135   QMIVESSPILEAFGNAKTIRNNNSSRFGKFIEIQFNREGHISGARIINYLLEKSRISHQA  194

Query  575   RSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCEVRHNPQGNCLK  634
              S+ N+HIFY L     A ++L+E           L++ EP       +  +  Q  C++
Sbjct  195   SSERNYHIFYQLLAG--ASDELKE----------KLKLGEPE------DYHYLSQSGCIR  236

Query  635   FDEINE------------VLKLMEMEECTKKIWTILSAILILGEVRFIEGSNSE----AE  678
              + IN+            VL L E ++ T  I++I+SA+L +G ++F +   ++    +E
Sbjct  237   IENINDVEDFEHVKYAMNVLGLPEDKQFT--IFSIVSAVLHIGNLKFEKSEKTQGAEGSE  294

Query  679   IRNVDAANTVANLLGLDQKKFIWSLTNYCMIKKGSVVRCKHTCEEANLARDILSSTVYNR  738
             + N D    +A LL +D  K    LT   ++ +G          EA   RD L+  +Y  
Sbjct  295   VSNKDTLKIIAQLLSVDPVKLETCLTIRHVLIRGQNFVIPLKVNEAEDTRDSLAKALYGN  354

Query  739   LVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIVNTMNEQLQCYYNQ  798
             + +W++  +N K+   +    +   I +LD+FGFE F  N  EQ  +N  NE+LQ ++NQ
Sbjct  355   VFNWLVVFINSKIHKPQK---NSTFIGVLDIFGFENFKKNSFEQFCINFANEKLQQHFNQ  411

Query  799   RVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKNYGLFQVLDYASR--ESQDTQYILE  856
              +F  E +E E+E+I      Y DN+E ++ +  +  G+  +LD  SR  ++ D  Y+ +
Sbjct  412   HIFKLEQEEYEKEKINWSKIVYNDNQECLDLIEKRPLGILSLLDEESRFPQATDLTYLDK  471

Query  857   KMKDKSKGLYVKAI--SHHEFSVAHYTGKISYDATDIVEKNRDFVPPEMINTMRTSTLEI  914
                +  K  Y +    S + F V HY G++ YD    ++KN+D V  ++ + ++ S  + 
Sbjct  472   LHTNHEKHPYYEKPRRSKNTFVVKHYAGEVHYDTQGFLDKNKDTVSDDLSSLLQGSKSKF  531

Query  915   IKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRRYNTSSRGQFSQSRKMR  974
             I ++FT    +        D  KG + KK   G+                          
Sbjct  532   IIELFTPPREEG------DDSDKGREKKKTTAGQ--------------------------  559

Query  975   TCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFYRELVRQQIRALAVLDT  1034
                 TF++  L+ L N+    S+   H+VRCI+ +   +P  + REL++ Q+R   +++T
Sbjct  560   ----TFKT-QLQSLINI---LSSTQPHYVRCIKPNTTKEPAVYDRELIQAQLRYAGMMET  611

Query  1035  AKIRQKGFPHRIPFQEFLRRYKFLAFDFDENVEMTKDNCRLLLVRLKMEG------WIIG  1088
              +IR+ G+P R   +EF  RY  L  D+       K  C  L+  L   G      W +G
Sbjct  612   IRIRKLGYPIRHTHKEFRDRY--LILDYRARSTDHKQTCAGLINLLSGTGGLERDEWQLG  669

Query  1089  KTKVFLK  1095
              TKVF++
Sbjct  670   NTKVFIR  676


>MYOB_DICDI unnamed protein product
Length=1111

 Score = 254 bits (649),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 211/779 (27%), Positives = 362/779 (46%), Gaps = 107/779 (14%)

Query  387   KREAERMLTEDLAALEVLTEDTILDELNERIRQGDFHAFVGDVLIILNPNEIQDIYGLSY  446
             K+   +  T+DL  L  ++ED I + L +R      +  +G VLI +NP    +  G  +
Sbjct  3     KKVQAKQGTDDLVMLPKVSEDEICENLKKRYMNDFIYTNIGPVLISVNPFRNLNNSGPDF  62

Query  447   HEKYNFKSRSDNAPHIYSVADKAYQDVLHNEEAQHIIFSGESKSGKTSNMMNVIKHLMYL  506
              E Y  K   +  PH+Y +A+ AY+ + +++E Q +I SGES +GKT     ++ ++  +
Sbjct  63    IEAYRGKHAQEVPPHVYQLAESAYRAMKNDQENQCVIISGESGAGKTEAAKLIMGYVSAI  122

Query  507   GKSTKDIGI---RLAKAMDLIQALTHAATPLNPNSTRCVFQLQTTFGSTGKASGAIFWIY  563
               ST+ +      + ++  L++A  +A T  N NS+R     +  F   G   G   + Y
Sbjct  123   SGSTEKVEYVKHVILESNPLLEAFGNAKTLRNNNSSRFGKYFEIQFDKAGDPVGGKIYNY  182

Query  564   QLEKWRVSLFDRSQSNFHIFYYLYDALDAKEKLQEYSLPSGRRMRYLRICEPNYGKASCE  623
              LEK RV   +  + NFHIFY L     A+EK ++Y L S     YL             
Sbjct  183   LLEKSRVVYQNPGERNFHIFYQLLAGASAQEK-RDYVLSSPESYYYLN------------  229

Query  624   VRHNPQGNCLKFDEINEVLKLMEMEECTKKIWT----------ILSAILILGEVRFIEGS  673
                  Q  C   D IN+V    E+ +    I            I++ +L +G + FIE  
Sbjct  230   -----QSQCYTVDGINDVSDYAEVRQAMDTIGLTAQEQSDIIRIVACVLHIGNIYFIEDD  284

Query  674   NSEAEIRNVDAANTVANLLGLD----QKKFIWSLTN----YCMIKKGSVVRCKHTCEEAN  725
                A I + +A    A++L +D    Q   ++ + N         + S        E+AN
Sbjct  285   KGNAAIYDPNALELAASMLCIDSATLQNAILFRVINTGGAGGAGNRRSTYNVPQNVEQAN  344

Query  726   LARDILSSTVYNRLVDWIINSVNEKLSMTRTLFGDKFVIDLLDLFGFECFSNNRLEQLIV  785
               RD L+ T+Y+R+  W++  VN+ LS  ++ + +  VI +LD+FGFE F  N  EQ  +
Sbjct  345   GTRDALARTIYDRMFSWLVERVNQSLSYYKSPYQN--VIGILDIFGFEIFEKNGFEQFCI  402

Query  786   NTMNEQLQCYYNQRVFGWEMQEQEEEEIPIEYFHYYDNREVIERLMGKN-YGLFQVLD--  842
             N +NE+LQ ++ +     E +E   E I  E   Y++N+ V + + GK+  G+F +LD  
Sbjct  403   NFVNEKLQQFFIELTLKAEQEEYVREGIKWEPIKYFNNQIVCDLIEGKSPPGIFSLLDDI  462

Query  843   YASRESQDT---QYILEKMKDKSKG-LYVKAISHHEFSVAHYTGKISYDATDIVEKNRDF  898
              ++  +Q T   Q  LEKM     G L+ + ++   F++ HY G+++Y+A    +KN+D 
Sbjct  463   CSTLHAQSTGTDQKFLEKMAGIYDGHLHWRGMT-GAFAIKHYAGEVTYEAEGFSDKNKDT  521

Query  899   VPPEMINTMRTSTLEIIKQIFTGQLTKSGNLTTVSDQPKGPQVKKRVGGKAQQEASKIRR  958
             +  ++I  ++ S +  +  +F        N  T S Q K P                   
Sbjct  522   LFFDLIEAIQCSKMPFLASLF--------NEDTGSLQKKRPT------------------  555

Query  959   YNTSSRGQFSQSRKMRTCAATFRSVSLEILKNLSVGSSNGGTHFVRCIRADLEGKPRGFY  1018
                      +   K++T A        E++K LS  +     H++RCI+ +   K + + 
Sbjct  556   ---------TAGFKIKTSAG-------ELMKALSQCTP----HYIRCIKPNETKKAKDWE  595

Query  1019  RELVRQQIRALAVLDTAKIRQKGFPHRIPFQEFLRRYKFLAFD----FDENVEMTKDNCR  1074
                V+ Q++ L +L+  ++R+ GF +R  F + L+RYK L+      + E      + C+
Sbjct  596   NSRVKHQVQYLGLLENVRVRRAGFAYRNTFDKVLKRYKKLSSKTWGIWGEWKGDAIEGCK  655

Query  1075  LLLVRLKMEG--WIIGKTKVFLKYYNEEYLSRLYETQVRK----IVKIQCMLRAFLARK  1127
              +   + +E   W +GKTKVF+++    +L  L E   +K      KIQ   R + A+K
Sbjct  656   TIFQDMNLEAGQWQLGKTKVFIRHPETVFL--LEEALDKKDFDCTAKIQKAFRNWKAKK  712



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933702.1 serine--tRNA ligase, cytoplasmic [Chelonus insularis]

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQL1_DROME  unnamed protein product                                 751     0.0   
SYSC_CAEEL  unnamed protein product                                   655     0.0   
Q95TC0_DROME  unnamed protein product                                 441     9e-155


>Q9VQL1_DROME unnamed protein product
Length=501

 Score = 751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/477 (74%), Positives = 407/477 (85%), Gaps = 2/477 (0%)

Query  1    MVLDLDLFRDDKGFNPEKIIENQRKRFKDVGLVTVVIEKDKYWRQLRHRADNLNKLKNLC  60
            MVLDLDLFR DKG NP+ + ENQ+KRFKDV LV  VI KD  WRQ RHRADNLNK+KN+C
Sbjct  1    MVLDLDLFRSDKGGNPDLVRENQKKRFKDVALVETVIAKDTEWRQCRHRADNLNKVKNVC  60

Query  61   SKEIGEKMKKKEPVGD-SDVIPDDVANNLDGVTSDSLKALTVTQIKKIRALIDDEIEKNN  119
            SK IGEKMKKKEPVG  S+ +P DV  +L  + +++L+ LTV QIK++R LIDD + +N 
Sbjct  61   SKVIGEKMKKKEPVGAMSEDLPADVTKDLTEIVAETLQPLTVNQIKQLRVLIDDAMTENQ  120

Query  120  QELIKTEAERNSALREVGNHLDPSVPVSNDEEENKVERTFGDCTQRKQYSHVDLIHMIDG  179
            + L   E  RN++LREVGNHL  SVPVSNDE+EN+VERTFGDC +R +YSHVDLI MIDG
Sbjct  121  KSLELAEQTRNTSLREVGNHLHESVPVSNDEDENRVERTFGDCEKRGKYSHVDLIVMIDG  180

Query  180  MDGERGIAVAGGRGYFLKGAAVFLEHALIQFALRKLFKKNYQPLYTPFFMKKDAMQEVAQ  239
            M+ E+G  V+GGRGYFL GAAVFLE ALIQ AL  L+ ++Y PLYTPFFM+K+ MQEVAQ
Sbjct  181  MNAEKGAVVSGGRGYFLTGAAVFLEQALIQHALHLLYARDYVPLYTPFFMRKEVMQEVAQ  240

Query  240  LAQFDEELYKVIGKGADKDDKES-DEKYLIATSEQPIAAFHRNEWIPEASLPIKYAGLST  298
            L+QFDEELYKV+GKG++K ++   DEKYLIATSEQPIAA+HR+EW+PE+SLPIKYAGLST
Sbjct  241  LSQFDEELYKVVGKGSEKAEEVGIDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAGLST  300

Query  299  CFRQEVGSHGRDTRGIFRVHQFEKVEQFCLTSPHDNKSWEMMEEMIKNAEEFYQELNIPY  358
            CFRQEVGSHGRDTRGIFRVHQFEKVEQF LTSPHDNKSWEMM+EMI NAE+F Q L IPY
Sbjct  301  CFRQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPY  360

Query  359  RIVNIVSGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLDYQARRLLVRYGQTKKMNAA  418
            R+VNIVSGALNHAA+KKLDLEAWF GSGA+RELVSCSNCLDYQARRLLVR+GQTKKMNAA
Sbjct  361  RVVNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAA  420

Query  419  VDYVHMLNATMCATTRVICAILEVNQTETGINIPEAISSLMPPEFQRHIPFVKPPPI  475
            VDYVHMLNATMCA TRVICAILE +QTETGI +PE +   MP +FQ  IPFVKP PI
Sbjct  421  VDYVHMLNATMCAATRVICAILETHQTETGIKVPEPLKKYMPAKFQDEIPFVKPAPI  477


>SYSC_CAEEL unnamed protein product
Length=487

 Score = 655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/487 (65%), Positives = 374/487 (77%), Gaps = 1/487 (0%)

Query  1    MVLDLDLFRDDKGFNPEKIIENQRKRFKDVGLVTVVIEKDKYWRQLRHRADNLNKLKNLC  60
            MVLD+D+FR +KG NPE I ++Q+ RFKD  LV  VIE D+ WR+ R  AD LN+ KN  
Sbjct  1    MVLDIDMFRTEKGGNPEIIRKSQQDRFKDPKLVDEVIELDEKWRKERFVADQLNRQKNAI  60

Query  61   SKEIGEKMKKKEPVGDSDVIPDDVANNLDGVTSDSLKALTVTQIKKIRALIDDEIEKNNQ  120
            SK IGEKMKKKEP G  D + DD+   L  +  D L  LTV Q+KK+R L+D++  +   
Sbjct  61   SKAIGEKMKKKEPQGTDDSVADDIVARLAELKIDELSQLTVVQLKKLRVLVDEKSVQTAA  120

Query  121  ELIKTEAERNSALREVGNHLDPSVPVSNDEEENKVERTFGDCTQRKQYSHVDLIHMIDGM  180
             +I  E  R+  L ++GN +  SV VS DE  NK+ERTFGD + +K+YSHVDL+ M+DG 
Sbjct  121  AVIANENARHEKLIQIGNLIHSSVVVSKDEANNKIERTFGDLSTKKKYSHVDLVVMVDGF  180

Query  181  DGERGIAVAGGRGYFLKGAAVFLEHALIQFALRKLFKKNYQPLYTPFFMKKDAMQEVAQL  240
            DGERG  VAGGRGYFLKG  VFLE A+IQ AL++L  K Y PLYTPFFM+K+ MQEVAQL
Sbjct  181  DGERGTVVAGGRGYFLKGPLVFLEQAIIQLALQRLNVKGYVPLYTPFFMRKEVMQEVAQL  240

Query  241  AQFDEELYKVIGKGAD-KDDKESDEKYLIATSEQPIAAFHRNEWIPEASLPIKYAGLSTC  299
            +QFD+ELYKV  KG++   D   DEKYLIATSEQPIAA+HRNEWI E  LPIKYAG+STC
Sbjct  241  SQFDDELYKVSSKGSEIAGDTSVDEKYLIATSEQPIAAYHRNEWIKETELPIKYAGVSTC  300

Query  300  FRQEVGSHGRDTRGIFRVHQFEKVEQFCLTSPHDNKSWEMMEEMIKNAEEFYQELNIPYR  359
            FRQEVGSHGRDTRGIFRVHQFEK+EQF L SP+DN+SW + +EMI NAE +YQEL IPY+
Sbjct  301  FRQEVGSHGRDTRGIFRVHQFEKIEQFVLCSPNDNESWTLFDEMIGNAESYYQELQIPYQ  360

Query  360  IVNIVSGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLDYQARRLLVRYGQTKKMNAAV  419
            +VNIVSG LN+AAAKK DLEAWFPGSGA+RELVSCSNCLDYQ+RRL VRYGQTKK++  V
Sbjct  361  VVNIVSGELNNAAAKKFDLEAWFPGSGAYRELVSCSNCLDYQSRRLKVRYGQTKKLSGEV  420

Query  420  DYVHMLNATMCATTRVICAILEVNQTETGINIPEAISSLMPPEFQRHIPFVKPPPIVESE  479
             +VHMLNATMCATTRVICAILE NQTE GIN+P AI   MP  ++  IPFVKP PI E  
Sbjct  421  PFVHMLNATMCATTRVICAILENNQTEEGINVPTAIQQWMPENYRTFIPFVKPAPIDEDA  480

Query  480  MKKQKKQ  486
             K   K+
Sbjct  481  KKATGKK  487


>Q95TC0_DROME unnamed protein product
Length=272

 Score = 441 bits (1135),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 204/248 (82%), Positives = 226/248 (91%), Gaps = 1/248 (0%)

Query  229  MKKDAMQEVAQLAQFDEELYKVIGKGADKDDKES-DEKYLIATSEQPIAAFHRNEWIPEA  287
            M+K+ MQEVAQL+QFDEELYKV+GKG++K ++   DEKYLIATSEQPIAA+HR+EW+PE+
Sbjct  1    MRKEVMQEVAQLSQFDEELYKVVGKGSEKAEEVGIDEKYLIATSEQPIAAYHRDEWLPES  60

Query  288  SLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQFCLTSPHDNKSWEMMEEMIKNA  347
            SLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQF LTSPHDNKSWEMM+EMI NA
Sbjct  61   SLPIKYAGLSTCFRQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNA  120

Query  348  EEFYQELNIPYRIVNIVSGALNHAAAKKLDLEAWFPGSGAFRELVSCSNCLDYQARRLLV  407
            E+F Q L IPYR+VNIVSGALNHAA+KKLDLEAWF GSGA+RELVSCSNCLDYQARRLLV
Sbjct  121  EQFCQSLGIPYRVVNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLV  180

Query  408  RYGQTKKMNAAVDYVHMLNATMCATTRVICAILEVNQTETGINIPEAISSLMPPEFQRHI  467
            R+GQTKKMNAAVDYVHMLNATMCA TRVICAILE +QTETGI +PE +   MP +FQ  I
Sbjct  181  RFGQTKKMNAAVDYVHMLNATMCAATRVICAILETHQTETGIKVPEPLKKYMPAKFQDEI  240

Query  468  PFVKPPPI  475
            PFVKP PI
Sbjct  241  PFVKPAPI  248



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933703.1 protein phosphatase 1 regulatory subunit 37 [Chelonus
insularis]

Length=1057
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ROCO5_DICDI  unnamed protein product                                  58.9    3e-08
Q57ZL7_TRYB2  unnamed protein product                                 50.8    5e-06
CARML_DICDI  unnamed protein product                                  49.3    2e-05


>ROCO5_DICDI unnamed protein product
Length=2800

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 67/122 (55%), Gaps = 13/122 (11%)

Query  308  ISALKHNTGLKELYLADNGLGNPDAVQLGALLRANHHLQLLDVSNNNLQDHGVRDILDGL  367
            +  +  N  +  L L+ N + +P AV LG +LR NH L  +D+S N + D G+  ++DG+
Sbjct  771  LGMMSLNKSITHLTLSQNSINDPCAVALGDMLRYNHSLIQMDLSENTIADKGLISLIDGI  830

Query  368  VTQSKEAHGSQGLSILILWNNHITKESSGRFAELLAISKSLETL-----NIGQNLMGDEF  422
            +     +H S  ++++IL  N IT   +   ++LL  +++L  L     NI Q+ MG E 
Sbjct  831  L-----SHPS--ITVVILTQNQITDTGAKHISKLLKFNQTLNALFLEDNNITQS-MGAEI  882

Query  423  LE  424
            ++
Sbjct  883  ID  884


 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 62/115 (54%), Gaps = 2/115 (2%)

Query  401  LLAISKSLETLNIGQNLMGDEFLEVCKDALKKNNSLLQLGVQATGLMQKGILALAEVIEK  460
            +++++KS+  L + QN + D       D L+ N+SL+Q+ +    +  KG+++L + I  
Sbjct  773  MMSLNKSITHLTLSQNSINDPCAVALGDMLRYNHSLIQMDLSENTIADKGLISLIDGILS  832

Query  461  NDTLQRIDLRDNNLQLTGLTFLSIALKKNSSITRIDLDDKAWSKS--PPLIEQYA  513
            + ++  + L  N +  TG   +S  LK N ++  + L+D   ++S    +I+Q+ 
Sbjct  833  HPSITVVILTQNQITDTGAKHISKLLKFNQTLNALFLEDNNITQSMGAEIIDQWV  887


 Score = 32.0 bits (71),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 41/207 (20%), Positives = 82/207 (40%), Gaps = 31/207 (15%)

Query  164  IAQLEKLELINERCEELTLKNEQLSRNFCEPLEEVLKRLQF-KKIDLESASLDDESAETL  222
            IA   K+ +  +R  ++ L ++ L  +  +PL   L    F  ++     +++D+  +  
Sbjct  712  IALFCKMIISGQR-PKVELTSQMLKISDPKPLFAALASTHFVNQLIFIPLTMNDKYMQMT  770

Query  223  FDMFEYYESVTHLNISSNCNIGERGWQACSQMIKKTQCLEQLEARDIVLTQQHMNILKRP  282
              M    +S+THL +S N +I +    A   M++    L Q++                 
Sbjct  771  LGMMSLNKSITHLTLSQN-SINDPCAVALGDMLRYNHSLIQMD-----------------  812

Query  283  LQLVTHLHVLKLENCGLAGRAFIILISALKHNTGLKELYLADNGLGNPDAVQLGALLRAN  342
                       L    +A +  I LI  +  +  +  + L  N + +  A  +  LL+ N
Sbjct  813  -----------LSENTIADKGLISLIDGILSHPSITVVILTQNQITDTGAKHISKLLKFN  861

Query  343  HHLQLLDVSNNNLQDHGVRDILDGLVT  369
              L  L + +NN+      +I+D  V+
Sbjct  862  QTLNALFLEDNNITQSMGAEIIDQWVS  888


 Score = 31.2 bits (69),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 19/80 (24%), Positives = 40/80 (50%), Gaps = 0/80 (0%)

Query  418  MGDEFLEVCKDALKKNNSLLQLGVQATGLMQKGILALAEVIEKNDTLQRIDLRDNNLQLT  477
            M D+++++    +  N S+  L +    +     +AL +++  N +L ++DL +N +   
Sbjct  762  MNDKYMQMTLGMMSLNKSITHLTLSQNSINDPCAVALGDMLRYNHSLIQMDLSENTIADK  821

Query  478  GLTFLSIALKKNSSITRIDL  497
            GL  L   +  + SIT + L
Sbjct  822  GLISLIDGILSHPSITVVIL  841


>Q57ZL7_TRYB2 unnamed protein product
Length=759

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 116/261 (44%), Gaps = 17/261 (7%)

Query  207  IDLESASLDDESAETLFDMFEYYESVTHLNISSNCNIGERG----WQACSQMIKKTQ-CL  261
            +D+   +L  E A+ + D+ E    +THL++  N N+ + G    ++A +  ++  +  +
Sbjct  290  LDISVNNLGYEGAKIIADVLES-SCITHLSLQRN-NLTDSGGMVIFRAIAAAVENGEDRI  347

Query  262  EQLEARDIVLTQQHMNILKRPLQLVTHLHVLKLE-NCGLAGRAFIILISALKHNTGLKEL  320
            E L      L+      +++ L + + L  L++  NC   G A   ++  L  N GLK L
Sbjct  348  EFLNIESNDLSTNSAKAIQKVLTVSSALKQLRISLNC--FGSASKFILEGLAENKGLKSL  405

Query  321  YLADNGLGNPDAVQLGALLRANHHLQLLDVSNNNLQDHGVRDILDGLVTQSKEAHGSQGL  380
            ++A   +   D       L  N  LQ LD+S N L+D     I + L T       ++GL
Sbjct  406  HMASCEIRETDGQPFVTGLSTNATLQHLDLSRNKLRDAATICIAEALKT-------NKGL  458

Query  381  SILILWNNHITKESSGRFAELLAISKSLETLNIGQNLMGDEFLEVCKDALKKNNSLLQLG  440
              L L  N+I  E     A  L  + +L  L + +N M +   ++  + L+ N SL  + 
Sbjct  459  VSLDLSCNNIMDEGGSAIAMFLKSNSTLRELRLRRNCMSNVTGDLLDEQLRSNTSLENMD  518

Query  441  VQATGLMQKGILALAEVIEKN  461
            +       K +L +   + +N
Sbjct  519  ITYNDFRYKCLLGIRATLARN  539


 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 92/223 (41%), Gaps = 33/223 (15%)

Query  304  FIILISALKHNTGLKELYLADNGLGNPDAVQLGALLRANHHLQLLDVSNNNLQDHGVRDI  363
            F+ LISA   N   K   L ++GLG   A  +  +L +N+   +LD+S N L D G   I
Sbjct  131  FMELISA---NCKGKFFCLRESGLGPMSAEAIAHILSSNNKYTILDLSGNRLLDEGACFI  187

Query  364  LDGLVTQSKEAH-----------GSQGLSILILWNN----------------HITKESSG  396
               +       H           G + L+  +L NN                HI  E + 
Sbjct  188  AKLISVNRTLVHVGLRSNDIGHIGGEALADALLENNTIISLDVGAHSGINGNHIATEGAK  247

Query  397  RFAELLAISKSLETLNIGQNLMGDEFLEVCKDALKKNNSLLQLGVQATGLMQKGILALAE  456
                +L  +K L  LN+G N +G   +      L  N SL  L +    L  +G   +A+
Sbjct  248  AIGNVLKSNKVLAKLNLGCNGLGHAGISHIASGLDGNESLTHLDISVNNLGYEGAKIIAD  307

Query  457  VIEKNDTLQRIDLRDNNLQLTG--LTFLSIALKKNSSITRIDL  497
            V+E +  +  + L+ NNL  +G  + F +IA    +   RI+ 
Sbjct  308  VLE-SSCITHLSLQRNNLTDSGGMVIFRAIAAAVENGEDRIEF  349


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 70/306 (23%), Positives = 132/306 (43%), Gaps = 54/306 (18%)

Query  230  ESVTHLNISSNCNIGERGWQACSQMIKKTQCLEQLEARDIVLTQQHMNILKRPLQLVT--  287
            ES+THL+IS N N+G  G +  + +++ + C+  L  +   LT     ++ R +      
Sbjct  285  ESLTHLDISVN-NLGYEGAKIIADVLE-SSCITHLSLQRNNLTDSGGMVIFRAIAAAVEN  342

Query  288  ---HLHVLKLENCGLAGRAFIILISALKHNTGLKELYLADNGLGNPDAVQLGALLRANHH  344
                +  L +E+  L+  +   +   L  ++ LK+L ++ N  G+               
Sbjct  343  GEDRIEFLNIESNDLSTNSAKAIQKVLTVSSALKQLRISLNCFGSASKF-----------  391

Query  345  LQLLDVSNNNLQDHGVRDILDGLVTQSKEAHGSQGLSILILWNNHITKESSGR-FAELLA  403
                              IL+GL         ++GL  L + +  I +E+ G+ F   L+
Sbjct  392  ------------------ILEGLAE-------NKGLKSLHMASCEI-RETDGQPFVTGLS  425

Query  404  ISKSLETLNIGQNLMGDEFLEVCKDALKKNNSLLQLGVQATGLMQKGILALAEVIEKNDT  463
             + +L+ L++ +N + D       +ALK N  L+ L +    +M +G  A+A  ++ N T
Sbjct  426  TNATLQHLDLSRNKLRDAATICIAEALKTNKGLVSLDLSCNNIMDEGGSAIAMFLKSNST  485

Query  464  LQRIDLRDNNLQLTGLTFLSIALKKNSSITRIDLDDKAWSKSPPLIEQYAELIQEIRSYC  523
            L+ + LR N +       L   L+ N+S+  +D+    +        +Y  L+  IR+  
Sbjct  486  LRELRLRRNCMSNVTGDLLDEQLRSNTSLENMDITYNDF--------RYKCLLG-IRATL  536

Query  524  LRNEET  529
             RN ET
Sbjct  537  ARNAET  542


 Score = 35.4 bits (80),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 28/105 (27%), Positives = 51/105 (49%), Gaps = 0/105 (0%)

Query  393  ESSGRFAELLAISKSLETLNIGQNLMGDEFLEVCKDALKKNNSLLQLGVQATGLMQKGIL  452
            E   RF EL++ +   +   + ++ +G    E     L  NN    L +    L+ +G  
Sbjct  126  ERKMRFMELISANCKGKFFCLRESGLGPMSAEAIAHILSSNNKYTILDLSGNRLLDEGAC  185

Query  453  ALAEVIEKNDTLQRIDLRDNNLQLTGLTFLSIALKKNSSITRIDL  497
             +A++I  N TL  + LR N++   G   L+ AL +N++I  +D+
Sbjct  186  FIAKLISVNRTLVHVGLRSNDIGHIGGEALADALLENNTIISLDV  230


>CARML_DICDI unnamed protein product
Length=1050

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 105/236 (44%), Gaps = 26/236 (11%)

Query  307  LISALKHNTGLKE--LYLADNGLGNPDAVQLGALLRAN-HHLQLLDVSNNNLQDHGVRDI  363
            L+ A+  N  L++  L L +N LG   A  L +L      ++  LDVS N+  D GV  I
Sbjct  432  LVVAITSNIYLQDVVLDLKNNDLGIAGARMLASLATDKLSNVIYLDVSENDFGDEGVSVI  491

Query  364  LDGLVTQSKEAHGSQGLSILILWNNHITKESSGR------FAELLAISKSLETLNI----  413
             DG V       G+  +  LIL  N    ++  R         LL     LETL++    
Sbjct  492  CDGFV-------GNSTIKKLILNGNFKQSKTKSRPSAIESVISLLESECPLETLHMTVGN  544

Query  414  GQNLMGDEFLEVCKDALKKNNSLLQLGVQATGLMQKGILALAEVIEKNDTLQRIDLRDNN  473
             ++ +  + L +   +L  N+SLL+L +    +  KG + L + ++ N TL  +   DN 
Sbjct  545  SKSPLKADILSLIY-SLATNSSLLELDISGHQMGPKGAIGLGKALQTNKTLHTLIWDDNL  603

Query  474  LQLTGLTFLSIALKKNSSITRI--DLDDKAWSKSPPLIEQYAELIQEIRSYCLRNE  527
                G     + L++N ++  +   L+D       P   ++ ++ +EI S   RN+
Sbjct  604  TTAIGFAGFQVGLERNLTLKNMPTPLNDIIQCHREP---KFQQIWKEIDSCINRNQ  656


 Score = 35.4 bits (80),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 95/247 (38%), Gaps = 32/247 (13%)

Query  283  LQLVTHLHVLKLENCGLAGRAFIILISALKHNTGLKELYLADNGLGNPDAVQLGALLRAN  342
            L+   +       N       F  L   LK N+ +++L L + GL +     +   L +N
Sbjct  207  LKYNNYFKSFNFNNYTFNKEQFGYLAEVLKCNSTVEDLSLNNVGLKHDTMPIIATALSSN  266

Query  343  HHLQL--LDVSNNNLQDHG-------VRDILDGLVT-------------------QSKEA  374
             +L L  +D+SNN ++D G       V   L G+ +                     K  
Sbjct  267  KNLALTAIDISNNQIEDKGMTAFSSYVASSLRGIASLDVSNTNCNKAGISVLTNALKKNI  326

Query  375  HGSQGLSILILWNNHITKESSGRFAELLAISKSLETLNIGQNLMGDEFLEVCKDALKKNN  434
              S  LS L L  N +  + S   +  LA   +L+TLNI         +E    AL    
Sbjct  327  KMSSTLSYLNLSGNKMEADGSAGLSSFLASPNTLKTLNISNTTPS---METIVGALVIGC  383

Query  435  SLLQ-LGVQATGLMQKGILALAEVIEKNDTLQRIDLRDNNLQLTGLTFLSIALKKNSSIT  493
            + L+ + +    L +K +  L   I  + TL+  +L    + +  L  L +A+  N  + 
Sbjct  384  AELKTIDISDNKLTKKEVPHLVRFIGASSTLKHFNLSGTKVPVENLKELVVAITSNIYLQ  443

Query  494  RIDLDDK  500
             + LD K
Sbjct  444  DVVLDLK  450



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933704.1 cytosolic carboxypeptidase 2 [Chelonus insularis]

Length=991
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NNAD_DROME  unnamed protein product                                   632     0.0  
CBPC1_CAEEL  unnamed protein product                                  293     4e-84
CBPC6_CAEEL  unnamed protein product                                  231     8e-67


>NNAD_DROME unnamed protein product
Length=1201

 Score = 632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/471 (62%), Positives = 366/471 (78%), Gaps = 26/471 (6%)

Query  130   FSRSCIGGTSVLTDSNTLSYFLEQSTEPPEPQIIHNNTDLHFESRFESGNLGKVIKITDT  189
             FSRS +GG   +T+ +           P  P+       L FESRFESGNL K ++IT T
Sbjct  708   FSRSAVGGARFMTNCH-----------PMNPEEYDG---LEFESRFESGNLAKAVQITPT  753

Query  190   YYQLHLRKDLYTQRHMQWFYFRISNTRSRIMYRLSIVNLCKEDSLYNEGLKPLLYSNKDA  249
             YY+L+LR DLYT R  QWFYFR+  TR +++YR SIVNL K DSLYN+G++P++YS   A
Sbjct  754   YYELYLRPDLYTSRSKQWFYFRVRRTRRKMLYRFSIVNLVKSDSLYNDGMQPVMYSTLGA  813

Query  250   DMNSVGWRRCGENISYYKNDS---------SDEEKEKHTLTFNITFPHDQDTVYLAHCYP  300
                S GWRRCG+NI YY+ND           DE+   +TLTF I F HD DTV+ AH YP
Sbjct  814   KEKSEGWRRCGDNICYYRNDDESASSSANEDDEDNSTYTLTFTIEFEHDDDTVFFAHSYP  873

Query  301   YTYSDLQEYLVKLSSDPVKTKFTKLRLLCRTLAGNSVHYLTITAPNCTDDS-RKKKGIVI  359
             YTYSDLQ+YL+++   PVK+KF KLRLLCRTLAGN+V+YLT+TAP+  +++ R+KK IV+
Sbjct  874   YTYSDLQDYLMEIQRHPVKSKFCKLRLLCRTLAGNNVYYLTVTAPSSNEENMRRKKSIVV  933

Query  360   TARVHPGETPSSWMMKGIIDFLTGESSQARELRERFIFKLVPMLNPDGVIVGNNRCSLSG  419
             +ARVHP ETP+SWMMKG++DF+TG+++ A+ LR +FIFKLVPMLNPDGVIVGN R SL+G
Sbjct  934   SARVHPSETPASWMMKGLMDFITGDTTVAKRLRHKFIFKLVPMLNPDGVIVGNTRNSLTG  993

Query  420   KDLNRQYRTVMRESYPSVWHTKLMIRRLMEECGIAMYCDLHAHSRKHNIFIYGCENKRTS  479
             KDLNRQYRTV+RE+YPS+W+TK MIRRL+EECG+AMYCD+HAHSRKHNIFIYGCENKR  
Sbjct  994   KDLNRQYRTVIRETYPSIWYTKAMIRRLIEECGVAMYCDMHAHSRKHNIFIYGCENKRNP  1053

Query  480   CYGKLAEQIFPLMLHKNAADKFSFENCKFYIEKGKEGTSRVVVWLMGIQNSYTMEASMGG  539
                KL EQ+FPLMLHKN+AD+FSFE+CKF I++ KEGT R+VVW++GI NSYT+EAS GG
Sbjct  1054  -EKKLTEQVFPLMLHKNSADRFSFESCKFKIQRSKEGTGRIVVWMLGITNSYTIEASFGG  1112

Query  540   SKLGSRSGTHFSAQDYEQIGKAFCETLIDFSDDDPIKEKLRNKILLRLIKE  590
             S LGSR GTHF+ QDYE +G+AFCETL+D+ D++P K K R+  L + IK+
Sbjct  1113  SSLGSRKGTHFNTQDYEHMGRAFCETLLDYCDENPNKVK-RHAKLFKQIKK  1162


 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 44/65 (68%), Gaps = 0/65 (0%)

Query  65   DIVAQEPRWPTECKVIQERVRHIDYNPPNPEPYYSPTGREPKPKPVSEELGTVVFNYCPT  124
            D   Q PRWP EC+VI+ER+ HI Y P  PEP  +PTG E KP+PV EE G VVF+Y P 
Sbjct  190  DCSQQAPRWPVECQVIEERIIHIPYVPAVPEPLNAPTGNELKPRPVGEENGIVVFSYSPI  249

Query  125  SVTNY  129
            S  NY
Sbjct  250  SAVNY  254


>CBPC1_CAEEL unnamed protein product
Length=1015

 Score = 293 bits (750),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 160/434 (37%), Positives = 250/434 (58%), Gaps = 37/434 (9%)

Query  168   DLHFESRFESGNLGKVIKITDTYYQLHLRKDLYTQR-HMQWFYFRISNTRSRIMYRLSIV  226
             DL F+SRFESGNL  VI++  T+Y+L L  D+   R H QWF+F++SN R  + Y   IV
Sbjct  586   DLQFDSRFESGNLRMVIQVAPTHYELFLSPDVNQLRDHYQWFFFQVSNMRKSVKYTFEIV  645

Query  227   NLCKEDSLYNEGLKPLLYSNKDADMNSVGWRRCGENISYYKN------------DSSDEE  274
             N  K  SLY++G++P++YS  ++   + GWRR GEN+ Y++N            +   ++
Sbjct  646   NCLKSTSLYSQGMQPVMYSMMES---ANGWRRVGENVCYFRNLYINENEEKKNVEEQKKK  702

Query  275   KEKHTLTFNITFPHDQDTVYLAHCYPYTYSDLQEYLVKLSSDPVKTKFTKLRLLCRTLAG  334
             K  +++ FN+TF +  D  Y+A+ YPYTYS L   L  L     +  + +  ++  +LAG
Sbjct  703   KYYYSIRFNVTFQNTGDICYIAYHYPYTYSFLNSSLSMLKKRKQENVYCREDVIGHSLAG  762

Query  335   NSVHYLTITAPNCTDDSRKKKGIVITARVHPGETPSSWMMKGIID-FLTGESSQARELRE  393
             N +  LTIT P    +   ++ IV++ARVHPGET +SW+M+GI++  L  +S++   LRE
Sbjct  763   NPIKMLTITTPASAAEIAAREVIVLSARVHPGETNASWIMQGILENLLCRQSNEMYRLRE  822

Query  394   RFIFKLVPMLNPDGVIVGNNRCSLSGKDLNRQYRTVMRESYPSVWHTKLMIRRLMEECGI  453
              FIFK+VPM+NPDGV  G++RCSL+G DLNR +       +P V+ TK +I+ L   C +
Sbjct  823   SFIFKIVPMINPDGVTNGSHRCSLAGIDLNRMWDRPNEALHPEVFATKAIIQYL---CEV  879

Query  454   A-----MYCDLHAHSRKHNIFIYG---CENKRTS-----CYGKLAEQI---FPLMLHKNA  497
             A      Y D+H HS+K + F+YG    E+ R          +L E++    P  L    
Sbjct  880   ANKKPFAYVDIHGHSKKWDYFVYGNNASESWRADDVLDVGAAQLEEELHLALPKALEATC  939

Query  498   ADKFSFENCKFYIEKGKEGTSRVVVW-LMGIQNSYTMEASMGGSKLGSRSGTHFSAQDYE  556
               +F+   C+F I + KE ++RV VW   G+  +YT+E++  G   G  SG   +  D +
Sbjct  940   PSRFNASECRFNITRAKESSARVNVWRQFGVSTAYTLESTFCGFHKGQNSGYQINTSDLK  999

Query  557   QIGKAFCETLIDFS  570
             +IG+    + ++ +
Sbjct  1000  EIGRDLLHSFLEMT  1013


>CBPC6_CAEEL unnamed protein product
Length=459

 Score = 231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 158/441 (36%), Positives = 232/441 (53%), Gaps = 27/441 (6%)

Query  160  PQIIHNNTDLHFESRFESGNLGKVIKITDTYYQLHLRKDLYTQRHMQWFYFRISNTRSRI  219
            P  I    +L FE+ FESGNLG+V K++ + Y L +R D    ++  WFYF   N     
Sbjct  10   PDTIPGQGNLVFEASFESGNLGRVDKVSCSEYDLFIRPDTLNNKYRVWFYFECKNASENQ  69

Query  220  MYRLSIVNLCKEDSLYNEGLK-PLLYSNKDADMNSVGWRRC-GENISYYKNDSSDEEKEK  277
                +IVN  K+ +L+  G+  P++ SN     NS  W R    +I YY+   S +  ++
Sbjct  70   RAIFNIVNFSKQRTLFEMGIAAPVVKSNAQ---NS--WARIPSRHIYYYR---SSQHNDR  121

Query  278  HTLTFNITFPHDQDTVYLAHCYPYTYSDLQEYLVKLSSDPVKTKFTKLRLLCRTLAGNSV  337
              L+F   F    D V  A+C PYTY  +Q +L +L S   K  F    LL +T+    V
Sbjct  122  WILSFAFIF-ESPDPVQFAYCIPYTYGQMQIWLNELESR--KYPFFHRDLLVQTVQKRRV  178

Query  338  HYLTITA-PNCTDDSRKKKGIVITARVHPGETPSSWMMKGIIDFLTGESSQARELRERFI  396
              +TI A P+    S  KK I +TARVHPGE+PSS +M GII+FL  +  +A++LR+ + 
Sbjct  179  DLITIDATPDTFQGS--KKMIFLTARVHPGESPSSHVMHGIIEFLVSKDDRAQKLRKVYC  236

Query  397  FKLVPMLNPDGVIVGNNRCSLSGKDLNRQYRTVMRESYPSVWHTKLMIRRLME--ECGIA  454
            FK++PMLNPDGV +GN RCSL G DLNR +RT    ++PS++  K ++ +     +    
Sbjct  237  FKIIPMLNPDGVFLGNYRCSLMGHDLNRMWRTPSDWAHPSIYAVKNLLTQYDNNPQAQTV  296

Query  455  MYCDLHAHSRKHNIFIYGCENKRTSCYGKLAEQIFPLMLHKNAADKFSFENCKFYIEKGK  514
            +Y DLHAHS+K N F+YG  N           Q++   L  + ++ +S E  +F  +  K
Sbjct  297  IYVDLHAHSQKPNCFLYGNVNMSAVEEKSTFRQLWLPHLLADLSEDYSLEFTQFNTDVEK  356

Query  515  EGTSRVVVWLMGIQNSYTMEASMGGSKLGSRSG------THFSAQDYEQIGKAFCETLID  568
             GT R  +  +     YT+E S    +    SG      T +    YE +G+AFC  L++
Sbjct  357  AGTGRRTMGDLLSCLCYTLEVSFFSYRHTDSSGNGIQHCTPYLQYKYEALGEAFCRALLN  416

Query  569  FSDDDPIKEKLRNKILLRLIK  589
            F + D     LR  +L R  K
Sbjct  417  FYEADC---GLREIVLERPFK  434



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933705.1 transcriptional regulator ovo isoform X1 [Chelonus
insularis]

Length=900
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OVO_DROME  unnamed protein product                                    307     2e-88
G5EDU6_CAEEL  unnamed protein product                                 239     3e-72
G5EDE1_CAEEL  unnamed protein product                                 83.6    6e-17


>OVO_DROME unnamed protein product
Length=1351

 Score = 307 bits (787),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 138/148 (93%), Gaps = 0/148 (0%)

Query  749   NRFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  808
             N+F CRVC K FSLQRLLNRHMKCHSD+KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK
Sbjct  1195  NKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  1254

Query  809   CNLCEKSFTQRCSLESHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDK  868
             CNLCEKSFTQRCSLESHC KVH VQHQYAYKERR K+YVCEECGHTT EPEVHYLHLK+ 
Sbjct  1255  CNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNN  1314

Query  869   HPYSPALLKFYDKRHFKFTNSNFANMLL  896
             HP+SPALLKFYDKRHFKFTNS FAN LL
Sbjct  1315  HPFSPALLKFYDKRHFKFTNSQFANNLL  1342


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 123/251 (49%), Gaps = 52/251 (21%)

Query  156  TRVSVIQRVPPQTQPPRQEHTKIEIPCLSE--PEQDQPIDYAVPKKK-------EEIDD-  205
             R SVIQR P Q+Q P        +P L +  PEQ +PIDY VPK++       EE++  
Sbjct  344  VRCSVIQRAP-QSQLPTSR-AGFLLPPLDQLGPEQQEPIDYHVPKRRSPSYDSDEELNAR  401

Query  206  --EQSREGAKASRTMGNSIARPLLAM------RL--SGPQTVNAAAGHGRSTSSGGSGSS  255
              E++R+  +A R      AR LLA       RL  S P  + AAAGHGR++SS    + 
Sbjct  402  RLERARQVREARRRSTILAARVLLAQSQRLNPRLVRSLPGILAAAAGHGRNSSSSSGAAG  461

Query  256  SGGSNASSGSTGGGGSYSSSSSGGGDGGGSLGGGGGGGGNGDGGMNPGGNGGRGHYGPSS  315
             G  ++  GS   G   SS +   G G GS G G GGGG   GG +  GN     YGP+S
Sbjct  462  QGFQSSGFGSQNSGSGSSSGNQNAGSGAGSPGSGAGGGGGMGGGRDGRGN-----YGPNS  516

Query  316  PPSGSLPPFYESLKGGNNLANFVNQYSGTQNNGYLTPTPSVGMECDTGQQEVSQHNQYNA  375
            PP+G+LPPFYESLK G        Q S   NN              TGQ   + H+ +NA
Sbjct  517  PPTGALPPFYESLKSG--------QQSTASNN--------------TGQSPGANHSHFNA  554

Query  376  QEGKQYSLLQN  386
                  + LQN
Sbjct  555  NPA---NFLQN  562


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)

Query  696   LQQRLGLPGDCQLEFVNGGHGIKNPLAIEG  725
             L Q LGLP D QLEFVNGGHGIKNPLA+E 
Sbjct  1066  LIQSLGLPPDLQLEFVNGGHGIKNPLAVEN  1095


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 89/206 (43%), Gaps = 52/206 (25%)

Query  294  GNGDGGMNPGGNGGRGHYGPSSPPSGSLPPFYESLKGGNNLANFVNQYSGTQNNGYLTPT  353
            G G+G +N GG GG         P+ SL         GNNL NF +  +  ++N      
Sbjct  605  GGGNGYINCGGVGG---------PNNSL--------DGNNLLNFASVSNYNESNSKFHNH  647

Query  354  PSVGMECDT-----GQQEVSQHNQYNAQEGKQYSLLQNACASYGLVLKEE------EEEE  402
                   +      GQ  +  H  Y               ++YG++LK+E      E + 
Sbjct  648  HHHHQHNNNNNNNGGQTSMMGHPFYGGNP-----------SAYGIILKDEPDIEYDEAKI  696

Query  403  DLADYK---IQPNDLLSGQYGAYDVTDSGMMVDMVT-----GAVVDPLQFTATLTFSSPS  454
            D+  +    IQ     SGQ+ A    D+ +M D+ +        VDPLQFTATL  SS +
Sbjct  697  DIGTFAQNIIQATMGSSGQFNASAYEDA-IMSDLASSGQCPNGAVDPLQFTATLMLSSQT  755

Query  455  DHTALLESLSDAADL--FLPRLPTDD  478
            DH  LLE LSDA DL  FL R   DD
Sbjct  756  DH--LLEQLSDAVDLSSFLQRSCVDD  779


 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 39/80 (49%), Gaps = 25/80 (31%)

Query  1   MPKIFLIKNRLHQQQLRLLEAQHLSKSPPPSGKDSPLSSEPLSLIVNKHQYRDKTDDDRA  60
           MPKIFLIKNRLHQQQ RLLE+Q                    +L+ +K+Q     DD+R 
Sbjct  1   MPKIFLIKNRLHQQQQRLLESQ--------------------NLLQHKNQ-----DDERL  35

Query  61  TTPESLRSNSPANSPPPQWQ  80
             P S   +    SP P  Q
Sbjct  36  VPPLSPSGSGSGPSPTPTSQ  55


>G5EDU6_CAEEL unnamed protein product
Length=280

 Score = 239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 135/175 (77%), Gaps = 4/175 (2%)

Query  708  LEFVNGGHGIKNPLA--IEGQRQAS--NRDEERANRQPSSKDDDPNRFTCRVCSKNFSLQ  763
            +EFVNGG+G+KNPLA  I      S        ++   SSKD+  +  TC +C K F LQ
Sbjct  86   VEFVNGGYGVKNPLAPLISSFETTSIPCSTVSPSSLISSSKDEFQDSLTCHICGKKFGLQ  145

Query  764  RLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLE  823
            RLLNRH+KCHSD+KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  CEKSFTQRCSLE
Sbjct  146  RLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLE  205

Query  824  SHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDKHPYSPALLKF  878
            SH  KVHGV HQYAYKERR+KV+VCE+CG+T ++ EV+  H+K  HP+S A L+F
Sbjct  206  SHLRKVHGVTHQYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFSAAYLRF  260


>G5EDE1_CAEEL unnamed protein product
Length=336

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 63/124 (51%), Gaps = 11/124 (9%)

Query  750  RFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  809
            +F C+ C K F     L+ H+  HSD + Y C +CGK F+   D+K+HT  HTG +P+KC
Sbjct  153  QFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKC  212

Query  810  NLCEKSFTQRCSLESHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDKH  869
             +C K+F+Q  +L +H  K  G            K + C+ CG T Q       H +  H
Sbjct  213  TVCGKAFSQSSNLITHTRKHTGF-----------KPFACDVCGRTFQRKVDRRRHRESHH  261

Query  870  PYSP  873
            P  P
Sbjct  262  PGHP  265


 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)

Query  747  DPNRFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRP  806
            D   + C  C K F  +  + +H   H+  K + CT CGK F+ + +L  HTR HTG +P
Sbjct  178  DTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKP  237

Query  807  YKCNLCEKSFTQRCSLESH  825
            + C++C ++F ++     H
Sbjct  238  FACDVCGRTFQRKVDRRRH  256


 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 0/57 (0%)

Query  753  CRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  809
            C VC K FS    L  H + H+  K + C  CG+ F    D +RH  +H    P +C
Sbjct  212  CTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPGHPEEC  268


 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 47/98 (48%), Gaps = 15/98 (15%)

Query  775  DVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCLKVHGVQH  834
            ++K + C  C K F+    L++H + H   + ++C  C K+F +  +L +H L +H    
Sbjct  122  EIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLL-IHS---  177

Query  835  QYAYKERRTKVYVCEECG---HTTQEPEVH-YLHLKDK  868
                    T+ Y CE CG   H   + + H Y+H  +K
Sbjct  178  -------DTRPYPCEYCGKRFHQKSDMKKHTYIHTGEK  208



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933706.1 transcriptional regulator ovo isoform X2 [Chelonus
insularis]

Length=899
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OVO_DROME  unnamed protein product                                    308     2e-88
G5EDU6_CAEEL  unnamed protein product                                 239     3e-72
G5EDE1_CAEEL  unnamed protein product                                 83.2    7e-17


>OVO_DROME unnamed protein product
Length=1351

 Score = 308 bits (788),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 138/148 (93%), Gaps = 0/148 (0%)

Query  749   NRFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  808
             N+F CRVC K FSLQRLLNRHMKCHSD+KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK
Sbjct  1195  NKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  1254

Query  809   CNLCEKSFTQRCSLESHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDK  868
             CNLCEKSFTQRCSLESHC KVH VQHQYAYKERR K+YVCEECGHTT EPEVHYLHLK+ 
Sbjct  1255  CNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNN  1314

Query  869   HPYSPALLKFYDKRHFKFTNSNFANMLL  896
             HP+SPALLKFYDKRHFKFTNS FAN LL
Sbjct  1315  HPFSPALLKFYDKRHFKFTNSQFANNLL  1342


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 123/251 (49%), Gaps = 52/251 (21%)

Query  156  TRVSVIQRVPPQTQPPRQEHTKIEIPCLSE--PEQDQPIDYAVPKKK-------EEIDD-  205
             R SVIQR P Q+Q P        +P L +  PEQ +PIDY VPK++       EE++  
Sbjct  344  VRCSVIQRAP-QSQLPTSR-AGFLLPPLDQLGPEQQEPIDYHVPKRRSPSYDSDEELNAR  401

Query  206  --EQSREGAKASRTMGNSIARPLLAM------RL--SGPQTVNAAAGHGRSTSSGGSGSS  255
              E++R+  +A R      AR LLA       RL  S P  + AAAGHGR++SS    + 
Sbjct  402  RLERARQVREARRRSTILAARVLLAQSQRLNPRLVRSLPGILAAAAGHGRNSSSSSGAAG  461

Query  256  SGGSNASSGSTGGGGSYSSSSSGGGDGGGSLGGGGGGGGNGDGGMNPGGNGGRGHYGPSS  315
             G  ++  GS   G   SS +   G G GS G G GGGG   GG +  GN     YGP+S
Sbjct  462  QGFQSSGFGSQNSGSGSSSGNQNAGSGAGSPGSGAGGGGGMGGGRDGRGN-----YGPNS  516

Query  316  PPSGSLPPFYESLKGGNNLANFVNQYSGTQNNGYLTPTPSVGMECDTGQQEVSQHNQYNA  375
            PP+G+LPPFYESLK G        Q S   NN              TGQ   + H+ +NA
Sbjct  517  PPTGALPPFYESLKSG--------QQSTASNN--------------TGQSPGANHSHFNA  554

Query  376  QEGKQYSLLQN  386
                  + LQN
Sbjct  555  NPA---NFLQN  562


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)

Query  696   LQQRLGLPGDCQLEFVNGGHGIKNPLAIEG  725
             L Q LGLP D QLEFVNGGHGIKNPLA+E 
Sbjct  1066  LIQSLGLPPDLQLEFVNGGHGIKNPLAVEN  1095


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 89/206 (43%), Gaps = 52/206 (25%)

Query  294  GNGDGGMNPGGNGGRGHYGPSSPPSGSLPPFYESLKGGNNLANFVNQYSGTQNNGYLTPT  353
            G G+G +N GG GG         P+ SL         GNNL NF +  +  ++N      
Sbjct  605  GGGNGYINCGGVGG---------PNNSL--------DGNNLLNFASVSNYNESNSKFHNH  647

Query  354  PSVGMECDT-----GQQEVSQHNQYNAQEGKQYSLLQNACASYGLVLKEE------EEEE  402
                   +      GQ  +  H  Y               ++YG++LK+E      E + 
Sbjct  648  HHHHQHNNNNNNNGGQTSMMGHPFYGGNP-----------SAYGIILKDEPDIEYDEAKI  696

Query  403  DLADYK---IQPNDLLSGQYGAYDVTDSGMMVDMVT-----GAVVDPLQFTATLTFSSPS  454
            D+  +    IQ     SGQ+ A    D+ +M D+ +        VDPLQFTATL  SS +
Sbjct  697  DIGTFAQNIIQATMGSSGQFNASAYEDA-IMSDLASSGQCPNGAVDPLQFTATLMLSSQT  755

Query  455  DHTALLESLSDAADL--FLPRLPTDD  478
            DH  LLE LSDA DL  FL R   DD
Sbjct  756  DH--LLEQLSDAVDLSSFLQRSCVDD  779


 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 39/80 (49%), Gaps = 25/80 (31%)

Query  1   MPKIFLIKNRLHQQQLRLLEAQHLSKSPPPSGKDSPLSSEPLSLIVNKHQYRDKTDDDRA  60
           MPKIFLIKNRLHQQQ RLLE+Q                    +L+ +K+Q     DD+R 
Sbjct  1   MPKIFLIKNRLHQQQQRLLESQ--------------------NLLQHKNQ-----DDERL  35

Query  61  TTPESLRSNSPANSPPPQWQ  80
             P S   +    SP P  Q
Sbjct  36  VPPLSPSGSGSGPSPTPTSQ  55


>G5EDU6_CAEEL unnamed protein product
Length=280

 Score = 239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 135/175 (77%), Gaps = 4/175 (2%)

Query  708  LEFVNGGHGIKNPLA--IEGQRQAS--NRDEERANRQPSSKDDDPNRFTCRVCSKNFSLQ  763
            +EFVNGG+G+KNPLA  I      S        ++   SSKD+  +  TC +C K F LQ
Sbjct  86   VEFVNGGYGVKNPLAPLISSFETTSIPCSTVSPSSLISSSKDEFQDSLTCHICGKKFGLQ  145

Query  764  RLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLE  823
            RLLNRH+KCHSD+KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  CEKSFTQRCSLE
Sbjct  146  RLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLE  205

Query  824  SHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDKHPYSPALLKF  878
            SH  KVHGV HQYAYKERR+KV+VCE+CG+T ++ EV+  H+K  HP+S A L+F
Sbjct  206  SHLRKVHGVTHQYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFSAAYLRF  260


>G5EDE1_CAEEL unnamed protein product
Length=336

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 63/124 (51%), Gaps = 11/124 (9%)

Query  750  RFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  809
            +F C+ C K F     L+ H+  HSD + Y C +CGK F+   D+K+HT  HTG +P+KC
Sbjct  153  QFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKC  212

Query  810  NLCEKSFTQRCSLESHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDKH  869
             +C K+F+Q  +L +H  K  G            K + C+ CG T Q       H +  H
Sbjct  213  TVCGKAFSQSSNLITHTRKHTGF-----------KPFACDVCGRTFQRKVDRRRHRESHH  261

Query  870  PYSP  873
            P  P
Sbjct  262  PGHP  265


 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)

Query  747  DPNRFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRP  806
            D   + C  C K F  +  + +H   H+  K + CT CGK F+ + +L  HTR HTG +P
Sbjct  178  DTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKP  237

Query  807  YKCNLCEKSFTQRCSLESH  825
            + C++C ++F ++     H
Sbjct  238  FACDVCGRTFQRKVDRRRH  256


 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 0/57 (0%)

Query  753  CRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  809
            C VC K FS    L  H + H+  K + C  CG+ F    D +RH  +H    P +C
Sbjct  212  CTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPGHPEEC  268


 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 47/98 (48%), Gaps = 15/98 (15%)

Query  775  DVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCLKVHGVQH  834
            ++K + C  C K F+    L++H + H   + ++C  C K+F +  +L +H L +H    
Sbjct  122  EIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLL-IHS---  177

Query  835  QYAYKERRTKVYVCEECG---HTTQEPEVH-YLHLKDK  868
                    T+ Y CE CG   H   + + H Y+H  +K
Sbjct  178  -------DTRPYPCEYCGKRFHQKSDMKKHTYIHTGEK  208



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933707.1 malignant T-cell-amplified sequence 1 homolog isoform
X1 [Chelonus insularis]

Length=185
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCTS1_DROME  unnamed protein product                                  283     1e-98
Q57Y82_TRYB2  unnamed protein product                                 48.9    6e-07
Q8I2S7_PLAF7  unnamed protein product                                 28.5    3.6  


>MCTS1_DROME unnamed protein product
Length=182

 Score = 283 bits (724),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 156/178 (88%), Gaps = 0/178 (0%)

Query  8    FDEKDSVSGIQQLKSSVQKSIRLKLLEQYPYLESHIDQIIPKKDSFRLVKCHDHIEIMVN  67
            F+EKDS+S IQQLKSSVQK IR KLLE YP LESHID I+PKKDS+R+ KCHDHIE+++N
Sbjct  5    FEEKDSISSIQQLKSSVQKGIRAKLLEAYPKLESHIDLILPKKDSYRIAKCHDHIELLLN  64

Query  68   NAGELLFFRQREGLWLPTLKLLHKYPFFLPIEQVDKGAIRFVLSGANIMCPGLTSKGAKM  127
             AG+ +FFR R+G W+PTL+LLHK+P+F+ ++QVDKGAIRFVLSGAN+MCPGLTS GA M
Sbjct  65   GAGDQVFFRHRDGPWMPTLRLLHKFPYFVTMQQVDKGAIRFVLSGANVMCPGLTSPGACM  124

Query  128  SPVPKGTVVAVMAEGKQHALAIGVTTLSTEEILKVNKGVGIENYHYLNDGLWQMKPIK  185
            +P  K TVVA+MAEGK+HALA+G+ TLST+EIL  NKG+GIE YH+LNDGLW+ KP+K
Sbjct  125  TPADKDTVVAIMAEGKEHALAVGLLTLSTQEILAKNKGIGIETYHFLNDGLWKSKPVK  182


>Q57Y82_TRYB2 unnamed protein product
Length=663

 Score = 48.9 bits (115),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 17/113 (15%)

Query  83   LPTLKLLHKYPFFLPIEQVDKGAI------------RFVLSGANIMCPGLTSKGAKM-SP  129
            +PTL +L     +   E  D G++            RF+LSGA++M PG+  +  +  +P
Sbjct  94   VPTLFMLSLMRCYYKKEDTDFGSLFGARVFCHGPTSRFILSGAHLMLPGIIERRTQTDTP  153

Query  130  VPKGTVVAVMAEGKQHALAIGVTTLSTEEILKVN-KGVGIENYHYLNDGLWQM  181
            V KG +V + + G     A+G   L+T+ +   N +G G+   H   DGLW +
Sbjct  154  VRKGDLVFIYSLGNLFPYAVG---LATDGLAGSNQRGKGVYVIHSYKDGLWNL  203


>Q8I2S7_PLAF7 unnamed protein product
Length=301

 Score = 28.5 bits (62),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 25/47 (53%), Gaps = 5/47 (11%)

Query  59   HDHIEIMVNNAG---ELLFFRQREGLWLPTLKLLHKYPFFL--PIEQ  100
            H +++I+VNNAG   + LF R +   W   L+      F++  PI +
Sbjct  135  HKNVDILVNNAGITRDNLFLRMKNDEWEDVLRTNLNSLFYITQPISK  181



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933708.1 transcriptional regulator ovo isoform X3 [Chelonus
insularis]

Length=895
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OVO_DROME  unnamed protein product                                    307     2e-88
G5EDU6_CAEEL  unnamed protein product                                 239     2e-72
G5EDE1_CAEEL  unnamed protein product                                 83.2    7e-17


>OVO_DROME unnamed protein product
Length=1351

 Score = 307 bits (787),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 138/148 (93%), Gaps = 0/148 (0%)

Query  744   NRFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  803
             N+F CRVC K FSLQRLLNRHMKCHSD+KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK
Sbjct  1195  NKFVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYK  1254

Query  804   CNLCEKSFTQRCSLESHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDK  863
             CNLCEKSFTQRCSLESHC KVH VQHQYAYKERR K+YVCEECGHTT EPEVHYLHLK+ 
Sbjct  1255  CNLCEKSFTQRCSLESHCQKVHSVQHQYAYKERRAKMYVCEECGHTTCEPEVHYLHLKNN  1314

Query  864   HPYSPALLKFYDKRHFKFTNSNFANMLL  891
             HP+SPALLKFYDKRHFKFTNS FAN LL
Sbjct  1315  HPFSPALLKFYDKRHFKFTNSQFANNLL  1342


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 123/251 (49%), Gaps = 52/251 (21%)

Query  156  TRVSVIQRVPPQTQPPRQEHTKIEIPCLSE--PEQDQPIDYAVPKKK-------EEIDD-  205
             R SVIQR P Q+Q P        +P L +  PEQ +PIDY VPK++       EE++  
Sbjct  344  VRCSVIQRAP-QSQLPTSR-AGFLLPPLDQLGPEQQEPIDYHVPKRRSPSYDSDEELNAR  401

Query  206  --EQSREGAKASRTMGNSIARPLLAM------RL--SGPQTVNAAAGHGRSTSSGGSGSS  255
              E++R+  +A R      AR LLA       RL  S P  + AAAGHGR++SS    + 
Sbjct  402  RLERARQVREARRRSTILAARVLLAQSQRLNPRLVRSLPGILAAAAGHGRNSSSSSGAAG  461

Query  256  SGGSNASSGSTGGGGSYSSSSSGGGDGGGSLGGGGGGGGNGDGGMNPGGNGGRGHYGPSS  315
             G  ++  GS   G   SS +   G G GS G G GGGG   GG +  GN     YGP+S
Sbjct  462  QGFQSSGFGSQNSGSGSSSGNQNAGSGAGSPGSGAGGGGGMGGGRDGRGN-----YGPNS  516

Query  316  PPSGSLPPFYESLKGGNNLANFVNQYSGTQNNGYLTPTPSVGMECDTGQQEVSQHNQYNA  375
            PP+G+LPPFYESLK G        Q S   NN              TGQ   + H+ +NA
Sbjct  517  PPTGALPPFYESLKSG--------QQSTASNN--------------TGQSPGANHSHFNA  554

Query  376  QEGKQYSLLQN  386
                  + LQN
Sbjct  555  NPA---NFLQN  562


 Score = 53.5 bits (127),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)

Query  691   LQQRLGLPGDCQLEFVNGGHGIKNPLAIEG  720
             L Q LGLP D QLEFVNGGHGIKNPLA+E 
Sbjct  1066  LIQSLGLPPDLQLEFVNGGHGIKNPLAVEN  1095


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 89/206 (43%), Gaps = 52/206 (25%)

Query  294  GNGDGGMNPGGNGGRGHYGPSSPPSGSLPPFYESLKGGNNLANFVNQYSGTQNNGYLTPT  353
            G G+G +N GG GG         P+ SL         GNNL NF +  +  ++N      
Sbjct  605  GGGNGYINCGGVGG---------PNNSL--------DGNNLLNFASVSNYNESNSKFHNH  647

Query  354  PSVGMECDT-----GQQEVSQHNQYNAQEGKQYSLLQNACASYGLVLKEE------EEEE  402
                   +      GQ  +  H  Y               ++YG++LK+E      E + 
Sbjct  648  HHHHQHNNNNNNNGGQTSMMGHPFYGGNP-----------SAYGIILKDEPDIEYDEAKI  696

Query  403  DLADYK---IQPNDLLSGQYGAYDVTDSGMMVDMVT-----GAVVDPLQFTATLTFSSPS  454
            D+  +    IQ     SGQ+ A    D+ +M D+ +        VDPLQFTATL  SS +
Sbjct  697  DIGTFAQNIIQATMGSSGQFNASAYEDA-IMSDLASSGQCPNGAVDPLQFTATLMLSSQT  755

Query  455  DHTALLESLSDAADL--FLPRLPTDD  478
            DH  LLE LSDA DL  FL R   DD
Sbjct  756  DH--LLEQLSDAVDLSSFLQRSCVDD  779


 Score = 32.7 bits (73),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 39/80 (49%), Gaps = 25/80 (31%)

Query  1   MPKIFLIKNRLHQQQLRLLEAQHLSKSPPPSGKDSPLSSEPLSLIVNKHQYRDKTDDDRA  60
           MPKIFLIKNRLHQQQ RLLE+Q                    +L+ +K+Q     DD+R 
Sbjct  1   MPKIFLIKNRLHQQQQRLLESQ--------------------NLLQHKNQ-----DDERL  35

Query  61  TTPESLRSNSPANSPPPQWQ  80
             P S   +    SP P  Q
Sbjct  36  VPPLSPSGSGSGPSPTPTSQ  55


>G5EDU6_CAEEL unnamed protein product
Length=280

 Score = 239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 135/175 (77%), Gaps = 4/175 (2%)

Query  703  LEFVNGGHGIKNPLA--IEGQRQAS--NRDEERANRQPSSKDDDPNRFTCRVCSKNFSLQ  758
            +EFVNGG+G+KNPLA  I      S        ++   SSKD+  +  TC +C K F LQ
Sbjct  86   VEFVNGGYGVKNPLAPLISSFETTSIPCSTVSPSSLISSSKDEFQDSLTCHICGKKFGLQ  145

Query  759  RLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLE  818
            RLLNRH+KCHSD+KRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  CEKSFTQRCSLE
Sbjct  146  RLLNRHIKCHSDLKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCEQCEKSFTQRCSLE  205

Query  819  SHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDKHPYSPALLKF  873
            SH  KVHGV HQYAYKERR+KV+VCE+CG+T ++ EV+  H+K  HP+S A L+F
Sbjct  206  SHLRKVHGVTHQYAYKERRSKVFVCEDCGYTDEKFEVYLSHIKVVHPFSAAYLRF  260


>G5EDE1_CAEEL unnamed protein product
Length=336

 Score = 83.2 bits (204),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 63/124 (51%), Gaps = 11/124 (9%)

Query  745  RFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  804
            +F C+ C K F     L+ H+  HSD + Y C +CGK F+   D+K+HT  HTG +P+KC
Sbjct  153  QFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKC  212

Query  805  NLCEKSFTQRCSLESHCLKVHGVQHQYAYKERRTKVYVCEECGHTTQEPEVHYLHLKDKH  864
             +C K+F+Q  +L +H  K  G            K + C+ CG T Q       H +  H
Sbjct  213  TVCGKAFSQSSNLITHTRKHTGF-----------KPFACDVCGRTFQRKVDRRRHRESHH  261

Query  865  PYSP  868
            P  P
Sbjct  262  PGHP  265


 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)

Query  742  DPNRFTCRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRP  801
            D   + C  C K F  +  + +H   H+  K + CT CGK F+ + +L  HTR HTG +P
Sbjct  178  DTRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKP  237

Query  802  YKCNLCEKSFTQRCSLESH  820
            + C++C ++F ++     H
Sbjct  238  FACDVCGRTFQRKVDRRRH  256


 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 0/57 (0%)

Query  748  CRVCSKNFSLQRLLNRHMKCHSDVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKC  804
            C VC K FS    L  H + H+  K + C  CG+ F    D +RH  +H    P +C
Sbjct  212  CTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHPGHPEEC  268


 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 47/98 (48%), Gaps = 15/98 (15%)

Query  770  DVKRYLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCNLCEKSFTQRCSLESHCLKVHGVQH  829
            ++K + C  C K F+    L++H + H   + ++C  C K+F +  +L +H L +H    
Sbjct  122  EIKPFHCQKCTKLFSTIAALEQHQQVHVSDKQFECKQCGKTFKRSSTLSTHLL-IHS---  177

Query  830  QYAYKERRTKVYVCEECG---HTTQEPEVH-YLHLKDK  863
                    T+ Y CE CG   H   + + H Y+H  +K
Sbjct  178  -------DTRPYPCEYCGKRFHQKSDMKKHTYIHTGEK  208



Lambda      K        H
   0.318    0.134    0.391 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 17200711352


Query= XP_034933709.1 transcriptional regulator ovo isoform X4 [Chelonus
insularis]

Length=874
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OVO_DROME  unnamed protein product                                    307     2e-88
G5EDU6_CAEEL  unnamed protein product