BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold8165-size76499-augustus-gene-0.4-mRNA-1

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VN75_DROME  unnamed protein product                                 48.9    2e-07
Q9W0B2_DROME  unnamed protein product                                 47.8    6e-07
A0A0S0WGR0_DROME  unnamed protein product                             47.4    1e-06


>Q9VN75_DROME unnamed protein product
Length=193

 Score = 48.9 bits (115),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/166 (26%), Positives = 71/166 (43%), Gaps = 34/166 (20%)

Query  21   KVQSLQTTVLMGT----GDFIAQTYVEGKTVKDVD--------------AGPSLHLWYSW  62
            K + L+  +  GT    G  I QT +E KT +  D               GP++++W   
Sbjct  11   KYKVLRGMISYGTLWPCGSLIEQTMIEKKTFRTYDWMKCLRFSLFGFFFMGPTIYVWI--  68

Query  63   LDRVAGVRGSWAVGK----KVLLDQMVAAPVMLCAILSAVSLLGGADLPAVAAKLRQDYV  118
              R+A V       K    K + +Q    P+ + + L  ++L+ G       A+ +++  
Sbjct  69   --RLASVMWPRTDIKSSLCKAITEQTAYDPMAISSFLFFMTLMEGNSY----AEAKREVS  122

Query  119  PVLLANYKV----WPLVQLCNFTLVPLRYRVLVVQTVALLWNTYLS  160
               L  YKV    WP VQ  NF  VP R +V+     ++ W T+L+
Sbjct  123  DKFLDAYKVGVIYWPCVQTVNFAFVPARNQVVFTSFFSMCWTTFLA  168


>Q9W0B2_DROME unnamed protein product
Length=191

 Score = 47.8 bits (112),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/167 (23%), Positives = 75/167 (45%), Gaps = 13/167 (8%)

Query  8    WGRYQLVLKRHPYKVQSLQTTVLMGTGDFIAQTYVEGKTVKD-----------VDAGPSL  56
            +G Y   L  HP + +S+   VL  + +  +Q     KT+             +  G   
Sbjct  11   FGTYLEQLFNHPVRTKSITACVLATSANVTSQRLAGAKTLNQQSVFAYGLFGLIFGGSVP  70

Query  57   HLWYSWLDRVAGVRGSWAVGKKVLLDQMVAAPVMLCAILSAVSLLGGADLPAVAAK-LRQ  115
            H +Y+ ++R+      +      L +++V AP+     L  ++L  G   P+ A K + +
Sbjct  71   HYFYTTVERLFSQDVRFRRFFLFLSERLVYAPIYQALSLFFLALFEGKS-PSTALKNVEK  129

Query  116  DYVPVLLANYKVWPLVQLCNFTLVPLRYRVLVVQTVALLWNTYLSRK  162
             Y P+L AN++   +    NF  VP  +R + +  ++ +W  Y+++K
Sbjct  130  LYWPLLKANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQK  176


>A0A0S0WGR0_DROME unnamed protein product
Length=255

 Score = 47.4 bits (111),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/166 (21%), Positives = 71/166 (43%), Gaps = 11/166 (7%)

Query  8    WGRYQLVLKRHPYKVQSLQTTVLMGTGDFIAQTYVEGKTVKD-----------VDAGPSL  56
            +G Y   L  HP + +S+   VL  + +  +Q     KT+             +  G   
Sbjct  75   FGTYLEQLFNHPVRTKSITACVLATSANVTSQRLAGAKTLNQQSVFAYGLFGLIFGGSVP  134

Query  57   HLWYSWLDRVAGVRGSWAVGKKVLLDQMVAAPVMLCAILSAVSLLGGADLPAVAAKLRQD  116
            H +Y+ ++R+      +      L +++V AP+     L  ++L  G         + + 
Sbjct  135  HYFYTTVERLFSQDVRFRRFFLFLSERLVYAPIYQALSLFFLALFEGKSPSTALKNVEKL  194

Query  117  YVPVLLANYKVWPLVQLCNFTLVPLRYRVLVVQTVALLWNTYLSRK  162
            Y P+L AN++   +    NF  VP  +R + +  ++ +W  Y+++K
Sbjct  195  YWPLLKANWQYLSVFVYLNFAYVPPMFRSISMAIISFIWVVYIAQK  240



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold2953-size302469-augustus-gene-2.4-mRNA-1

Length=132
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LOLAL_DROME  unnamed protein product                                  135     7e-42
MMD4_DROME  unnamed protein product                                   139     2e-39
BAB1_DROME  unnamed protein product                                   140     2e-39


>LOLAL_DROME unnamed protein product
Length=127

 Score = 135 bits (339),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 2/121 (2%)

Query  8    NNSEQFSLRWNNFHSNLSTGFHAFLQGEDLVDVTLAAGGQFVQAHKLVLSVCSPYLKNLF  67
            ++ +QF L+WN+F +N+ T F      +   DVTLA  GQ  +AHK+VLS CSPY K L 
Sbjct  3    SSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALL  62

Query  68   KLNPCKHPIVILKDVGHKELVHILEFMYRGEVNVRQDDLTEFLKTAEMLQVKGLTGDETP  127
            + NP KHPI+ILKDV +  L  ILEFMY GEVNV Q+ L  FLKTA+ L+VKGL   ETP
Sbjct  63   EENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLA--ETP  120

Query  128  A  128
            +
Sbjct  121  S  121


>MMD4_DROME unnamed protein product
Length=610

 Score = 139 bits (350),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 86/121 (71%), Gaps = 2/121 (2%)

Query  9    NSEQFSLRWNNFHSNLSTGFHAFLQGEDLVDVTLAAGGQFVQAHKLVLSVCSPYLKNLFK  68
            + EQFSL WNNF++NLS GFH  L   DLVDV+LAA GQ V+AH+LVLSVCSP+ + +F 
Sbjct  3    DDEQFSLCWNNFNTNLSAGFHESLCRGDLVDVSLAAEGQIVKAHRLVLSVCSPFFRKMFT  62

Query  69   LNPCK-HPIVILKDVGHKELVHILEFMYRGEVNVRQDDLTEFLKTAEMLQVKGLTGDETP  127
              P   H IV L +V H  L  +++FMY GEVNV+QD L  F+ TAE LQ+KGLT D  P
Sbjct  63   QMPSNTHAIVFLNNVSHSALKDLIQFMYCGEVNVKQDALPAFISTAESLQIKGLT-DNDP  121

Query  128  A  128
            A
Sbjct  122  A  122


>BAB1_DROME unnamed protein product
Length=977

 Score = 140 bits (352),  Expect = 2e-39, Method: Composition-based stats.
 Identities = 62/111 (56%), Positives = 81/111 (73%), Gaps = 0/111 (0%)

Query  11   EQFSLRWNNFHSNLSTGFHAFLQGEDLVDVTLAAGGQFVQAHKLVLSVCSPYLKNLFKLN  70
            +QF LRWNN+ +NL+T F   LQ E  VDVTLA  G+ ++AHK+VLS CSPY + L    
Sbjct  100  QQFCLRWNNYQTNLTTIFDQLLQNECFVDVTLACDGRSMKAHKMVLSACSPYFQTLLAET  159

Query  71   PCKHPIVILKDVGHKELVHILEFMYRGEVNVRQDDLTEFLKTAEMLQVKGL  121
            PC+HPIVI++DV   +L  I+EFMYRGE+NV QD +   L+ AEML+V+GL
Sbjct  160  PCQHPIVIMRDVNWSDLKAIVEFMYRGEINVSQDQIGPLLRIAEMLKVRGL  210



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold2391-size359415-augustus-gene-2.4-mRNA-1

Length=184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR28B_DROME  unnamed protein product                                  60.1    8e-11
GR33A_DROME  unnamed protein product                                  36.2    0.009
GR66A_DROME  unnamed protein product                                  36.2    0.011


>GR28B_DROME unnamed protein product
Length=470

 Score = 60.1 bits (144),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 74/153 (48%), Gaps = 11/153 (7%)

Query  38   AACISKVMDQHMKLCQVSEMLNSTHSLQIV--------LWILSSSYTMTSCICIAFEESV  89
            A  I + M+ H  +C+ +   N   + Q++        + +  + Y + + +  +  ES 
Sbjct  282  AEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLLGKSKRESK  341

Query  90   LPMTLGVGEFTCLGIWVVYHIARICIIVHAAHTTALQANNMGVIITRLLTQIDDPALSNQ  149
                  V  F+C    ++Y IA I I V  ++    ++   G I+  LL +     +  +
Sbjct  342  FKTVEFVTFFSCQ--MILYLIAIISI-VEGSNRAIKKSEKTGGIVHSLLNKTKSAEVKEK  398

Query  150  LQQYSLQLLHRKIQFTGLGMFPLDYTLLYNVSG  182
            LQQ+S+QL+H KI FT  G+F +D TL + +SG
Sbjct  399  LQQFSMQLMHLKINFTAAGLFNIDRTLYFTISG  431


>GR33A_DROME unnamed protein product
Length=475

 Score = 36.2 bits (82),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 25/34 (74%), Gaps = 2/34 (6%)

Query  148  NQLQQYSLQLLHRK--IQFTGLGMFPLDYTLLYN  179
            N+++ ++LQ LH +   QF G+G+F LDYT +++
Sbjct  414  NKMKSFTLQFLHWEGFFQFNGVGLFALDYTFIFS  447


>GR66A_DROME unnamed protein product
Length=527

 Score = 36.2 bits (82),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 30/139 (22%), Positives = 62/139 (45%), Gaps = 4/139 (3%)

Query  48   HMKLCQVSEMLNSTHSLQIVLWILSSSYTMTSCICI---AFEESVLPMTLGVGEFTCLGI  104
            H ++C++ + LN   S  I+  +       T+ +     A +   +P      +   + +
Sbjct  328  HDEICEIGKALNELWSYPILSLMAYGFLIFTAQLYFLYCATQYQSIPSLFRSAKNPFITV  387

Query  105  WVVYHIARICI-IVHAAHTTALQANNMGVIITRLLTQIDDPALSNQLQQYSLQLLHRKIQ  163
             V+ + +  C+ +++ +  T+  +   G+ + +     DD  L   +   SL+LL+  + 
Sbjct  388  IVLSYTSGKCVYLIYLSWKTSQASKRTGISLHKCGVVADDNLLYEIVNHLSLKLLNHSVD  447

Query  164  FTGLGMFPLDYTLLYNVSG  182
            F+  G F LD   LY VSG
Sbjct  448  FSACGFFTLDMETLYGVSG  466



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= augustus-scaffold26640-size15616-processed-gene-0.0-mRNA-1

Length=98
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JHM5_DROME  unnamed protein product                                 26.6    4.0  
Q9I7L8_DROME  unnamed protein product                                 26.6    4.3  
SRC64_DROME  unnamed protein product                                  26.2    5.4  


>E1JHM5_DROME unnamed protein product
Length=351

 Score = 26.6 bits (57),  Expect = 4.0, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query  3    RTYDCCLRSSRGSLLCLCSSRPWRFLHFLATGLGSTTSMILTTPRTASGMEPVILTAMAV  62
            R YD    + R      C S   RFLHF ++ +      + +T   A+  EP  +  +A 
Sbjct  86   REYDRAAHAVRN-----CESSVPRFLHFYSSYMAREKRRLDSTTDQANLHEPNQMRDLA-  139

Query  63   WDLKATTSLE  72
             DL AT  +E
Sbjct  140  -DLLATLRME  148


>Q9I7L8_DROME unnamed protein product
Length=678

 Score = 26.6 bits (57),  Expect = 4.3, Method: Composition-based stats.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query  3    RTYDCCLRSSRGSLLCLCSSRPWRFLHFLATGLGSTTSMILTTPRTASGMEPVILTAMAV  62
            R YD    + R      C S   RFLHF ++ +      + +T   A+  EP  +  +A 
Sbjct  86   REYDRAAHAVRN-----CESSVPRFLHFYSSYMAREKRRLDSTTDQANLHEPNQMRDLA-  139

Query  63   WDLKATTSLE  72
             DL AT  +E
Sbjct  140  -DLLATLRME  148


>SRC64_DROME unnamed protein product
Length=552

 Score = 26.2 bits (56),  Expect = 5.4, Method: Composition-based stats.
 Identities = 22/80 (28%), Positives = 31/80 (39%), Gaps = 8/80 (10%)

Query  12   SRGSLLCLCSSRPWRFLHFLATGLGSTTSMILTTPRTASGMEPVILTAMAVWDLKATTSL  71
            S+GSLL        R+LHF          +I    + ASGME +    +   DL A   L
Sbjct  360  SKGSLLDFLREGDGRYLHF--------EDLIYIATQVASGMEYLESKQLIHRDLAARNVL  411

Query  72   EDATKATEVLRRAVCRVAKD  91
                   ++    + RV  D
Sbjct  412  IGENNVAKICDFGLARVIAD  431



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold1469-size491399-augustus-gene-3.3-mRNA-1

Length=214
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HP1_DROME  unnamed protein product                                    57.0    7e-10
Q54RN0_DICDI  unnamed protein product                                 53.1    2e-08
Q54RQ4_DICDI  unnamed protein product                                 51.2    8e-08


>HP1_DROME unnamed protein product
Length=206

 Score = 57.0 bits (136),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)

Query  81   YEVESIVDAKLHKGKRQFKIRWKGYGEDSDTWEFEENLKCPEIIEAY  127
            Y VE I+D ++ KGK ++ ++WKGY E  +TWE E NL C ++I+ Y
Sbjct  24   YAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQY  70


>Q54RN0_DICDI unnamed protein product
Length=225

 Score = 53.1 bits (126),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 35/48 (73%), Gaps = 1/48 (2%)

Query  81   YEVESIVDAKLHKGKRQFKIRWKGYGEDSDTWEFEENLK-CPEIIEAY  127
            +EVE I+D ++  G+ Q+ IRWKG+  D DTWE E+N+  CPE+++ +
Sbjct  22   FEVEKILDKRVQHGRIQYSIRWKGFTADYDTWEDEDNVAGCPELVKEF  69


>Q54RQ4_DICDI unnamed protein product
Length=244

 Score = 51.2 bits (121),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 34/48 (71%), Gaps = 1/48 (2%)

Query  81   YEVESIVDAKLHKGKRQFKIRWKGYGEDSDTWEFEENLK-CPEIIEAY  127
            +EVE I+D ++  G+ Q+ +RW G+  D DTWE E+N+  CPE+++ +
Sbjct  23   FEVEKILDKRVQHGRIQYNVRWIGFSSDYDTWEDEDNVAGCPELVKEF  70



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold12146-size24706-augustus-gene-0.1-mRNA-1

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPN_DROME  unnamed protein product                                    29.3    3.9  
G5EDY8_CAEEL  unnamed protein product                                 28.1    9.7  
Q8WQC9_CAEEL  unnamed protein product                                 28.1    9.7  


>PPN_DROME unnamed protein product
Length=2898

 Score = 29.3 bits (64),  Expect = 3.9, Method: Composition-based stats.
 Identities = 25/84 (30%), Positives = 32/84 (38%), Gaps = 5/84 (6%)

Query  174   PGYVDTQVRPWNAGSTRHRQHGQYYG--ANWRNALASRARVISITSFN-EWHEGTQIEPA  230
             PG  D     WN   T  R    YYG      N  A+     +  S N +   G      
Sbjct  2007  PGQCDKWALHWNYNETEGRCQSFYYGGCGGNDNRFATEEECSARCSVNIDIRIGADPVEH  2066

Query  231   VTRPNYLDYEPGGPAFYLNLTRWW  254
              T   +L +EPG    Y N+TRW+
Sbjct  2067  DTSKCFLAFEPGN--CYNNVTRWF  2088


>G5EDY8_CAEEL unnamed protein product
Length=705

 Score = 28.1 bits (61),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  48   PVNMAEQVRYIILQYNSHPA  67
            PVN+ EQ+R +IL Y S+P+
Sbjct  161  PVNIEEQIREMILLYISNPS  180


>Q8WQC9_CAEEL unnamed protein product
Length=712

 Score = 28.1 bits (61),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 16/20 (80%), Gaps = 0/20 (0%)

Query  48   PVNMAEQVRYIILQYNSHPA  67
            PVN+ EQ+R +IL Y S+P+
Sbjct  161  PVNIEEQIREMILLYISNPS  180



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold4724-size192311-augustus-gene-0.6-mRNA-1

Length=168
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SURF4_DROME  unnamed protein product                                  240     1e-80
SURF4_CAEEL  unnamed protein product                                  167     4e-52
Q38F55_TRYB2  unnamed protein product                                 30.4    0.60 


>SURF4_DROME unnamed protein product
Length=270

 Score = 240 bits (612),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)

Query  17   MSSQNQWLTKAEDFADQVLRHGKHVLPTVARLCLISTFLEDGIRMWVQWSEQAEYMDMSW  76
            MS  N+++ K ED A+QV++ GK+VLPTVARLCLI+TF EDG+RM++QW+EQ EYMDMSW
Sbjct  1    MSIPNEYIAKTEDVAEQVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSW  60

Query  77   GCGKFLANMFVIVNFFGQLGGCVMVLGRFRVSIACGILFFIVVLQTFAYSILWDLQFLFR  136
            GCGKFLA +FV+VN  GQLGGC MV+ RF+V IA G+LFFIVVLQT AYSILWD QFL R
Sbjct  61   GCGKFLATVFVLVNLLGQLGGCGMVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLR  120

Query  137  NLALIGALLLVLAESRVEGRSLFAGVPSLGK  167
            N ALIGALLLVLAE+R+EGRSLFAGVPS+G+
Sbjct  121  NFALIGALLLVLAEARIEGRSLFAGVPSMGE  151


>SURF4_CAEEL unnamed protein product
Length=277

 Score = 167 bits (423),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 110/147 (75%), Gaps = 0/147 (0%)

Query  20   QNQWLTKAEDFADQVLRHGKHVLPTVARLCLISTFLEDGIRMWVQWSEQAEYMDMSWGCG  79
            QN+ L KAED A+   R  +  LP +ARLCL+STFLEDGIRM+ QW +Q ++M  SW CG
Sbjct  10   QNEMLAKAEDAAEDFFRKTRTYLPHIARLCLVSTFLEDGIRMYFQWDDQKQFMQESWSCG  69

Query  80   KFLANMFVIVNFFGQLGGCVMVLGRFRVSIACGILFFIVVLQTFAYSILWDLQFLFRNLA  139
             F+A +FVI NFFGQ    +M++ R +V +ACGIL  IV+LQT AY ILWDL+FL RN+A
Sbjct  70   WFIATLFVIYNFFGQFIPVLMIMLRKKVLVACGILASIVILQTIAYHILWDLKFLARNIA  129

Query  140  LIGALLLVLAESRVEGRSLFAGVPSLG  166
            + G LLL+LAE++ E  SLFAGVP++G
Sbjct  130  VGGGLLLLLAETQEEKASLFAGVPTMG  156


>Q38F55_TRYB2 unnamed protein product
Length=409

 Score = 30.4 bits (67),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 29/66 (44%), Gaps = 9/66 (14%)

Query  14  VGNMSSQNQWLTKAEDFADQVLRHGKHVLPTVARLCLISTFLEDGI---RMWVQWSEQAE  70
           VGN +  N  +     F+     +   V P++A LC      ED +   R+W   +E+ E
Sbjct  24  VGNTTELNDVIALLRSFSGVPKSYTTLVTPSLAELC------EDAVGVERLWTSSAERTE  77

Query  71  YMDMSW  76
             D +W
Sbjct  78  PKDFAW  83



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold5434-size160956-augustus-gene-0.3-mRNA-1

Length=293
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPX2_DROME  unnamed protein product                                 80.9    7e-17
Q9VR44_DROME  unnamed protein product                                 69.7    4e-13
Q9VKC9_DROME  unnamed protein product                                 68.2    1e-12


>Q9VPX2_DROME unnamed protein product
Length=512

 Score = 80.9 bits (198),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 87/186 (47%), Gaps = 11/186 (6%)

Query  102  ASGMLSALPYLFGGVACMGFGIISQWLQEKGYLSRMAAYRTFNGISA-----CLILLTFA  156
            ++  LSALPY    +  +  G +   LQ KG ++   A +T   I       CL++L + 
Sbjct  327  SNAALSALPYFPMIIFSICLGKLLDSLQAKGKITTTVARKTATSICTLIPGVCLLVLCYI  386

Query  157  NGTT-ETIALMVCTLVLFNAYYGGSFTNFLDLAINYAGILTGIQLTFANSMGIFSAQIAG  215
                 E +++M   +V   + + G  +N +D+A N+AG L  +  T A   GI      G
Sbjct  387  GCRHYEAVSVMSVGIVAMGSMFSGFLSNHIDIAPNFAGTLVALTNTAATLPGIVVPLFVG  446

Query  216  ILTDGKQTPEQWAKVFYIAAGAVAPQYIFYLFFGSIEEQPWNKQGEDDEETSPDPEIQEI  275
             +T G Q    W  +F +     A +++ ++F GS  EQPWNK G     T  DPE ++ 
Sbjct  447  FVTKGNQNIGAWRIIFGVTIVLFALEFLVFVFLGSGSEQPWNKAG-----TPKDPEAKDE  501

Query  276  NMSIKR  281
               +K 
Sbjct  502  KTPLKE  507


 Score = 47.4 bits (111),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 0/74 (0%)

Query  26   GEFEWSGTMQGFVLSAFYYGYITTQVLGGWLSERFGPKYVMACGVVGGGALMMLGPVAAR  85
            G F+WS  +QG +LS +++GY+ +Q+    ++E F  K+VM   V       +L PV   
Sbjct  98   GPFDWSEPLQGTLLSCYFWGYLVSQIPLAHVAENFSAKWVMLFSVAINVVCTLLTPVFTE  157

Query  86   LNVYAFAAVRILIG  99
            L+      +R+L G
Sbjct  158  LHYGGLILMRVLEG  171


>Q9VR44_DROME unnamed protein product
Length=493

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 85/187 (45%), Gaps = 9/187 (5%)

Query  103  SGMLSALPYLFGGVACMGFGIISQWLQEKGYLSRMAAYRTFNG----ISACLILLTFANG  158
            +G+ S+LPYL   V  +    ++ +L++KG LS  A  + F      I   L+++    G
Sbjct  310  NGLFSSLPYLGKYVMAVASSYLADYLRKKGTLSTTATRKLFTTFALVIPGLLMIVQVFLG  369

Query  159  TTETIALMVCTLVLF--NAYYGGSFTNFLDLAINYAGILTGIQLTFANSMGIFSAQIAGI  216
               T ++ + +L LF   A   G   N LD+A N+ G + G+  T ++  G  S  + G 
Sbjct  370  YDATWSVTIFSLALFAHGAVTAGYLGNGLDIAPNFGGTIFGLANTLSSFGGFLSTSMVGA  429

Query  217  LTDGKQTPEQWAKVFYIAAGAVAPQYIFYLFFGSIEEQPWNKQGEDDEETSPDPEIQEIN  276
            LT   Q+   W  VF+I A       + +   GS E QPWN      E        QE  
Sbjct  430  LTYKDQSFHSWQIVFWILAATYISAAVVFAILGSGELQPWN---NPPERVRISDVTQEEG  486

Query  277  MSIKRKK  283
            + +K +K
Sbjct  487  VPLKNEK  493


 Score = 44.3 bits (103),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 0/61 (0%)

Query  27   EFEWSGTMQGFVLSAFYYGYITTQVLGGWLSERFGPKYVMACGVVGGGALMMLGPVAARL  86
             F W      FVL  F++GYI T++ GG L+E  G + V    ++    L ++ P+AA +
Sbjct  82   RFPWDSYQTNFVLGCFFWGYILTELPGGRLAELIGGRRVFGHSMLWASLLTLITPLAAHI  141

Query  87   N  87
            N
Sbjct  142  N  142


>Q9VKC9_DROME unnamed protein product
Length=496

 Score = 68.2 bits (165),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 86/179 (48%), Gaps = 9/179 (5%)

Query  102  ASGMLSALPYLFGGVACMGFGIISQWLQEKGYLSRMAAYRTFNGISA--CLILLTFAN--  157
            A+G+ S+LPY+   +  +G G ++ W+  +G LS     +   G++A    I +  A+  
Sbjct  306  ANGLYSSLPYVMMWIVSVGSGFVADWMIRRGVLSTTNTRKVMTGLAAFGPAIFMVGASYA  365

Query  158  GTTETIALMVCTLV--LFNAYYGGSFTNFLDLAINYAGILTGIQLTFANSMGIFSAQIAG  215
            G    + +++ T+   L  AYY G   + LD++ NYAG L  I        G+ +  + G
Sbjct  366  GCDRVLVVVLFTICMGLMGAYYAGMKLSPLDMSPNYAGTLMAITNGIGAITGVITPYLVG  425

Query  216  ILTDGKQTPEQWAKVFYIAAGAVAPQYIFYLFFGSIEEQPWNKQGEDDEETSPDPEIQE  274
            ++T      E W  VF++A G +    + Y  + S E QP+N      +  S D E QE
Sbjct  426  VMTPNASLLE-WRLVFWVAFGVLCFTAVIYCIWASGEVQPFNNA--PIQPRSVDFEAQE  481


 Score = 63.9 bits (154),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)

Query  25   GGEFEWSGTMQGFVLSAFYYGYITTQVLGGWLSERFGPKYVMACGVVGGGALMMLGPVA  83
            GG+FEWS  +QG +LS+FY GYI T + GG L+E+FG K+ +  G++      ML P+A
Sbjct  75   GGDFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLA  133



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold9080-size58286-augustus-gene-0.1-mRNA-1

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C15C1_BOMMO  unnamed protein product                                  104     5e-25
C15A1_DIPPU  unnamed protein product                                  89.0    1e-19
CP303_DROME  unnamed protein product                                  78.2    4e-16


>C15C1_BOMMO unnamed protein product
Length=493

 Score = 104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 81/291 (28%), Positives = 130/291 (45%), Gaps = 73/291 (25%)

Query  1    LCATEGPARCPILGNAL--LLKSKKT---HLLAQDLRQRYGNVVGLYLFSKPLVLVSGLQ  55
            LC   GP   PI+GN L  L +S+K    HL+ Q   Q+YGN++GL L S  +V+V+G++
Sbjct  23   LCYPPGPTPLPIVGNLLSVLWESRKFKCHHLIWQSWSQKYGNLLGLRLGSINVVVVTGIE  82

Query  56   EIREALAKPELQGRPMGAIREMENDKTGILEQQTTVKFYKRLCEFTIESFAMIETCTPKT  115
                              IRE+ N +  + E +    FY      T+ SF          
Sbjct  83   -----------------LIREVSNRE--VFEGRPDGFFY------TMRSFG---------  108

Query  116  PRAALLYASGINTAQGTDSLKDGECTGRSRTGQGIIFMDGDLWHEQRRFTLRHLRELGMG  175
                                             G++F DG  WH  RRF L++L+  G  
Sbjct  109  ------------------------------KKLGLVFSDGPTWHRTRRFVLKYLKNFGYN  138

Query  176  RHMMEDCIVEEARSLMRDARRLAGDAWQRPVPVHELISASGVNIILQLLAGQRFDRLDPR  235
               M   I +E  +L++     AG+    P+ V+++   + VNI+ +L+AG+R+D  D R
Sbjct  139  SRFMNVYIGDECEALVQLRLADAGE----PILVNQMFHITIVNILWRLVAGKRYDLEDQR  194

Query  236  MLELMAVVRSLTTTLDSTGGVANSFPFMLHYLPALTEYPTVKVIREKVRSY  286
            + EL ++V  L   +D +GG  N  PF+ H++P L  +  ++ I   +  Y
Sbjct  195  LKELCSLVMRLFKLVDMSGGFLNFLPFLRHFVPRLIGFTELQEIHNALHQY  245


>C15A1_DIPPU unnamed protein product
Length=493

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 76/138 (55%), Gaps = 1/138 (1%)

Query  149  GIIFMDGDLWHEQRRFTLRHLRELGMGRHMMEDCIVEEARSLMRDARRLAGDAWQRPVPV  208
            G++F DG +W EQRRF ++HLR+LG+G   ME  I EEAR L+    R +       +P+
Sbjct  110  GVVFTDGPVWQEQRRFCMQHLRKLGLGSRSMEAHIEEEARDLVASLHRRSNGGLT-AIPM  168

Query  209  HELISASGVNIILQLLAGQRFDRLDPRMLELMAVVRSLTTTLDSTGGVANSFPFMLHYLP  268
            H++     +N +  +LAG RFD  D R+++L+ +V      +D +GG+ N  P +    P
Sbjct  169  HDVFDICVLNSLWAMLAGHRFDLDDQRLVDLLDIVHKCFRMIDPSGGLLNQMPPLRFIAP  228

Query  269  ALTEYPTVKVIREKVRSY  286
              + Y  +     ++ ++
Sbjct  229  RHSGYTNLMTHLNRIWNF  246


 Score = 48.5 bits (114),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/72 (35%), Positives = 38/72 (53%), Gaps = 5/72 (7%)

Query  6   GPARCPILGNALLLKSKKT-----HLLAQDLRQRYGNVVGLYLFSKPLVLVSGLQEIREA  60
           GP   P++G+ L  + +K+     HL+   L  RYG V G+ L +  +V+  G   IR+ 
Sbjct  26  GPVWLPVVGSYLWFRREKSRVGYYHLVWSSLSSRYGPVTGMRLGTDYIVVACGYDAIRDI  85

Query  61  LAKPELQGRPMG  72
           L + E  GRP G
Sbjct  86  LLRDEFDGRPDG  97


>CP303_DROME unnamed protein product
Length=503

 Score = 78.2 bits (191),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 79/165 (48%), Gaps = 8/165 (5%)

Query  117  RAALLYASGINTAQGTDSLKDGECTG---RSRTGQ---GIIFMDGDLWHEQRRFTLRHLR  170
            +  + Y +   +   T+   DG   G   R RT     G++  DG++W EQRRF LRHL+
Sbjct  79   KVVIAYTNDAISEMMTNEDIDGRPDGIFYRLRTFNSRLGVLLTDGEMWVEQRRFILRHLK  138

Query  171  ELGMGRHMMEDCIVEEARSLMRDARR--LAGDAWQRPVPVHELISASGVNIILQLLAGQR  228
              G  R  M D +  EA  L++D +   L     Q  + +H+L S   +N +  +L+G+R
Sbjct  139  NFGFARSGMMDIVHNEATCLLQDLKDKVLKSGGKQTRIEMHDLTSVYVLNTLWCMLSGRR  198

Query  229  FDRLDPRMLELMAVVRSLTTTLDSTGGVANSFPFMLHYLPALTEY  273
            ++   P + +L+     L   +D  G + + FP +    P  + Y
Sbjct  199  YEPGSPEITQLLETFFELFKNIDMVGALFSHFPLLRFIAPNFSGY  243


 Score = 30.0 bits (66),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 23/90 (26%), Positives = 39/90 (43%), Gaps = 10/90 (11%)

Query  6    GPARCPILGNALLLKSKKTHL-----LAQDLRQRYGNVVGLY---LFSKPLVLVSGLQEI  57
            GPA  PI+G+AL +   +  L     +     ++Y N  G Y   +    +V+      I
Sbjct  30   GPAWYPIVGSALQVSQLRCRLGMFCKVIDVFARQYVNPYGFYGLKIGKDKVVIAYTNDAI  89

Query  58   REALAKPELQGRPMGAIREME--NDKTGIL  85
             E +   ++ GRP G    +   N + G+L
Sbjct  90   SEMMTNEDIDGRPDGIFYRLRTFNSRLGVL  119



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold6175-size130531-augustus-gene-0.6-mRNA-1

Length=474
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

5NTC_DICDI  unnamed protein product                                   313     1e-100
NHR47_CAEEL  unnamed protein product                                  32.3    0.86  
GMD1_CAEEL  unnamed protein product                                   30.8    2.3   


>5NTC_DICDI unnamed protein product
Length=592

 Score = 313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 175/454 (39%), Positives = 249/454 (55%), Gaps = 70/454 (15%)

Query  40   YKSPQYERLGFNLLKERLVSMGYPQEILAFEYDPSFPV----------------------  77
            Y SP +E L ++++ ++L+ +GYP+ I   +YDP+FP                       
Sbjct  130  YNSPDFEELAYDMVLDKLIDIGYPKSIRKLKYDPNFPTRGLFLDRELGNLLKIDSFGNII  189

Query  78   ----------SSQVYELYPNKFLLLDE---SRVYVLNTLFNLPETYMLACLIDFF-----  119
                       ++  E YP+  +  DE   +R Y+LNTLF LPE  + A L+D       
Sbjct  190  ICVHGRTTLSKNRTAEFYPSMRVSSDEIARNRFYLLNTLFTLPEACLYADLVDHLERESG  249

Query  120  -------------TNSPQYTR---------EKMGVKGGDLFMSFKSILQDVRNAVDWVHI  157
                          NSP  +          E      GDL  SF ++ QDVR A D VH 
Sbjct  250  LRLTEEVADEQQQMNSPPLSSLGSESVRIDESNHQPEGDL--SFSNLFQDVRTACDLVHN  307

Query  158  QGDLKTRTIQHLDEYVKKDERLPMFLNRIRESGAKVFLLTNSDYCFTDKIMTYLFDLPHG  217
             G LKTR +  L  Y++K   +P+F +R+R++  KVFLLTNS++ +T+K+M+Y+ +   G
Sbjct  308  DGSLKTRVLDDLPRYIRKTPDMPVFFDRLRQNKNKVFLLTNSEFYYTNKVMSYMMN---G  364

Query  218  ARPEEPHRDWKTYFDTIVVDARKPLFFGEGTILRQVDTTTGALKIGTHMGPLQKGQVYSG  277
              P   ++ W+ YFD I+V A KP FF EGT +R+VDT TG L+I       ++G+VY G
Sbjct  365  YNPN--YQSWRDYFDVIIVGADKPRFFSEGTTIREVDTETGNLRITNVKDRFEQGKVYHG  422

Query  278  GSCDVFTELMGAKGKDVLYIGDHIFGDILKSKKIRGWRTFLVVPELVQELHVWTDKCQLF  337
            GS  +F +L GAKG  VLYIGDHIF DI+KSKK  GWR  LVVPEL  EL V   +    
Sbjct  423  GSLSLFQKLTGAKGSRVLYIGDHIFADIIKSKKTHGWRNLLVVPELQHELEVMNQQKDTT  482

Query  338  AELQTLDVMLGDMYKNLDSSAKEKPDISKLRAAIRDVTHKMDLSYG-MMGSLFRSGSRQT  396
              L  L+ +  ++Y+ LDS +   PDI  L   +++   K++ +Y    GSLF++GS+ T
Sbjct  483  IHLMNLEFIRAEIYRGLDSESTTPPDIEVLHQHLKNTNDKLNFAYNKYFGSLFKNGSKST  542

Query  397  FFSSQVVRYADLYAASFLNLIYYPFSYMFRAPAM  430
            FFS QV RYADLY + +LNL+ YP  Y F A ++
Sbjct  543  FFSMQVQRYADLYTSDYLNLLNYPLFYHFCANSL  576


>NHR47_CAEEL unnamed protein product
Length=579

 Score = 32.3 bits (72),  Expect = 0.86, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 30/66 (45%), Gaps = 4/66 (6%)

Query  395  QTFFSSQVVRYADLYAASFLNLIYYPFSYMFRAPAMLVVEHAQSQVPHVRPETPRSVTHN  454
            +TF + + + YAD  A     +  +  S+M    A    EH +S V   RP+ P  VT N
Sbjct  219  KTFSTFRSLPYADKVAM----VTNHASSFMIMCEAFRTPEHMKSDVVRKRPDLPNIVTSN  274

Query  455  HDEDCS  460
                CS
Sbjct  275  SGSGCS  280


>GMD1_CAEEL unnamed protein product
Length=399

 Score = 30.8 bits (68),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  301  IFGDILKSKKIRGWRTFLVVPELVQEL  327
            + G+  K+KK  GW   + VPELV+E+
Sbjct  359  LLGNAEKAKKTLGWEAKVTVPELVKEM  385



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= augustus-scaffold2650-size332655-processed-gene-2.0-mRNA-1

Length=264
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SADA_DICDI  unnamed protein product                                   33.5    0.19 
Q7KVA7_DROME  unnamed protein product                                 32.0    0.57 
Q57VJ1_TRYB2  unnamed protein product                                 30.8    1.0  


>SADA_DICDI unnamed protein product
Length=952

 Score = 33.5 bits (75),  Expect = 0.19, Method: Composition-based stats.
 Identities = 21/73 (29%), Positives = 33/73 (45%), Gaps = 9/73 (12%)

Query  116  HLRAWLVIYMTMAIVNMAVILFSLVHVRRDEPGGESILFGSLLHLRALRRRAVVVCAATV  175
            H + WL   +T   +N+  +  SL H++     GE  L   L+   AL     V C A  
Sbjct  865  HYQLWLEYLLTA--INIVTVSLSLTHIKSPSAAGE--LIACLIQALAL-----VACIAAY  915

Query  176  LYMWLLVYSHYVK  188
            +  WL + S ++K
Sbjct  916  VVAWLQMRSSFIK  928


>Q7KVA7_DROME unnamed protein product
Length=3964

 Score = 32.0 bits (71),  Expect = 0.57, Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 4/38 (11%)

Query  200   GGEGDAAPR----VFLRGSWEVTPPPPRGRAGRGPTPP  233
             GG  D A R    VFL+  W+  PPPP        TPP
Sbjct  1809  GGVLDTASREKFDVFLKKLWDTDPPPPEPLGKMEITPP  1846


>Q57VJ1_TRYB2 unnamed protein product
Length=284

 Score = 30.8 bits (68),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 32/70 (46%), Gaps = 10/70 (14%)

Query  78   DKADNATAMPANATD-WQDN---LTVQRQCTSGKSSSDDSCKHLRAWLVIYMTMAIVNMA  133
            D    A AM  N T  W  N    T++R   SG S+S      L   L   M+  ++ + 
Sbjct  139  DMIQTAYAMATNPTSLWHQNGAAPTLRRGLASGNSAS------LHVTLFAVMSYVMMGLV  192

Query  134  VILFSLVHVR  143
             ++FSLV VR
Sbjct  193  AVIFSLVVVR  202



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= augustus-scaffold4781-size184258-processed-gene-0.3-mRNA-1

Length=224
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q381U3_TRYB2  unnamed protein product                                 28.9    4.3  


>Q381U3_TRYB2 unnamed protein product
Length=3270

 Score = 28.9 bits (63),  Expect = 4.3, Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 20/31 (65%), Gaps = 0/31 (0%)

Query  6     SFSRLPLGDATTIIFSSPMFVMVLSFIFLRE  36
             SFSR  +G A TIIF   +F  +++ IF +E
Sbjct  1550  SFSRNTVGGAMTIIFLRGLFYDLVTLIFSKE  1580



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold9534-size49576-augustus-gene-0.1-mRNA-1

Length=202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5ED98_CAEEL  unnamed protein product                                 28.1    6.5  
HSP83_BOMMO  unnamed protein product                                  27.7    9.2  


>G5ED98_CAEEL unnamed protein product
Length=1497

 Score = 28.1 bits (61),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 21/66 (32%), Positives = 35/66 (53%), Gaps = 13/66 (20%)

Query  54   VPEPRKVPL-------FVQCK---LFYNLAKETFRVMNIL--KSNTASLVKKRQVMKVTF  101
            VP P+K PL       F QC    +  N+A+ +FR+   +  +  TA +VK R++++   
Sbjct  732  VPIPKKEPLLVDRRHAFAQCNRGAILDNVAR-SFRLFGGINFRRRTAQIVKHRKIVETEK  790

Query  102  DDYRAK  107
              +RAK
Sbjct  791  QPFRAK  796


>HSP83_BOMMO unnamed protein product
Length=716

 Score = 27.7 bits (60),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 13/20 (65%), Gaps = 0/20 (0%)

Query  10   YGDDYQGITSTWEDQLVEVH  29
            YGD Y+ +T+ WED L   H
Sbjct  294  YGDFYKSLTNDWEDHLAVKH  313



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold4134-size272088-augustus-gene-1.12-mRNA-1

Length=166
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PEB3_DROME  unnamed protein product                                   103     9e-29
Q9W0X2_DROME  unnamed protein product                                 97.1    2e-26
Q38FL2_TRYB2  unnamed protein product                                 28.5    2.8  


>PEB3_DROME unnamed protein product
Length=126

 Score = 103 bits (256),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 67/99 (68%), Gaps = 1/99 (1%)

Query  61   QSAYTTQYDGVDLQSILNNDRLRKNYIDCLLDRSPRCSPDAKTLKGSIADALKDECAKCS  120
            +  YTT+YD +D+  IL +DRL  NY  CL+D   +C+P+ + LK S+ DALK EC+KCS
Sbjct  18   EDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDNG-KCTPEGRELKKSLPDALKTECSKCS  76

Query  121  EKQKSGTKTVLEFLRSKKPDELKLLTDKYDPDGVYQRRY  159
            EKQ+  T  V+ ++   KP+E K L  KYDPD +Y +RY
Sbjct  77   EKQRQNTDKVIRYIIENKPEEWKQLQAKYDPDEIYIKRY  115


>Q9W0X2_DROME unnamed protein product
Length=121

 Score = 97.1 bits (240),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 78/125 (62%), Gaps = 9/125 (7%)

Query  37   MKTVAAVV--VLAGLAAVVQCARLARQSAYTTQYDGVDLQSILNNDRLRKNYIDCLLDRS  94
            MK   A+V  V  GLAA       A +  YT +YD V++  +L N+R+  NY+ CL+D+ 
Sbjct  1    MKASLALVFCVCVGLAAA------APEKTYTNKYDSVNVDEVLGNNRVLGNYLKCLMDKG  54

Query  95   PRCSPDAKTLKGSIADALKDECAKCSEKQKSGTKTVLEFLRSKKPDELKLLTDKYDPDGV  154
            P C+ + + LK  + DAL  +C+KC+E Q+  ++ V+ +LR+ K  E KLL +KYDP G+
Sbjct  55   P-CTAEGRELKRLLPDALHSDCSKCTEVQRKNSQKVINYLRANKAGEWKLLLNKYDPQGI  113

Query  155  YQRRY  159
            Y+ ++
Sbjct  114  YRAKH  118


>Q38FL2_TRYB2 unnamed protein product
Length=566

 Score = 28.5 bits (62),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (49%), Gaps = 0/41 (0%)

Query  27   ADTFLPPAADMKTVAAVVVLAGLAAVVQCARLARQSAYTTQ  67
            +D FL PA   K VA   V+A L  V  CA  +  S   T+
Sbjct  193  SDNFLEPAGGPKVVAGDTVVANLKKVSMCAGFSLCSTLFTK  233



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold5534-size157983-augustus-gene-0.3-mRNA-1

Length=158
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0S0WN65_DROME  unnamed protein product                             57.8    4e-10
Q9VMR4_DROME  unnamed protein product                                 57.4    4e-10
A8DYV6_DROME  unnamed protein product                                 57.4    4e-10


>A0A0S0WN65_DROME unnamed protein product
Length=1755

 Score = 57.8 bits (138),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)

Query  79    YGYKQL--MLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNA  136
             +G+ Q+  +LL +GA++N  D    TPL  AA  G+LE+VKLL +AGA   +    G  A
Sbjct  1054  HGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAA  1113

Query  137   IYLAKSLGHTAVQQYL  152
             I+ A S GH  V +YL
Sbjct  1114  IWFAASEGHNEVLRYL  1129


 Score = 49.3 bits (116),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query  82   KQLMLLSRGADVNGRDNY-DNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLA  140
            ++LM   R   ++ R+   D TPL  AA  G+ ++VK LV+AGA  T   K G+ A++LA
Sbjct  844  EELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLA  903

Query  141  KSLGHTAVQQYLE  153
               GH  V   L+
Sbjct  904  AQNGHGQVLDVLK  916


 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query  85    MLLSRGADV-NGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSL  143
             +LLSR A++   +D    T L  AA  G++++V++L+  GA+  AT++ G+  ++ A   
Sbjct  1028  LLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKA  1087

Query  144   GHTAVQQYL  152
             GH  V + L
Sbjct  1088  GHLEVVKLL  1096


 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 44/82 (54%), Gaps = 1/82 (1%)

Query  77   GYYGYKQLMLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNA  136
            G+    + ++    A ++       TPL  AAA G +E+ +LL++ GA+  AT+  G   
Sbjct  737  GFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKP  796

Query  137  IYLAKSLGHTAVQQ-YLEQLPA  157
            I++A    ++ V + +L+Q P+
Sbjct  797  IHVAAQNNYSEVAKLFLQQHPS  818


 Score = 33.1 bits (74),  Expect = 0.093, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  102   TPLMGAAARGNLEIVKLLV-QAGADT-TATEKGGYNAIYLAKSLGHTAV  148
             TPL  AA  GN  +V+LL+  AG     AT + GYN ++LA   GH +V
Sbjct  977   TPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSV  1025


 Score = 28.5 bits (62),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 31/69 (45%), Gaps = 0/69 (0%)

Query  84   LMLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSL  143
            LMLL  GA  N   +   TP+  AA  GNL  +  L++   D       G   +++A   
Sbjct  486  LMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRA  545

Query  144  GHTAVQQYL  152
             H  + ++L
Sbjct  546  CHPDIVRHL  554


 Score = 28.1 bits (61),  Expect = 3.7, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  102  TPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSLGHTAVQQYL  152
            TPL+ A  RG++E+V  L+   A     +  G +A++LA   G+  V   L
Sbjct  662  TPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDAL  712


 Score = 26.9 bits (58),  Expect = 9.2, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  98   NYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLA  140
            N   TPLM A       I+  +++ GAD  A     YN +++A
Sbjct  125  NTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIA  167


>Q9VMR4_DROME unnamed protein product
Length=1761

 Score = 57.4 bits (137),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)

Query  79    YGYKQL--MLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNA  136
             +G+ Q+  +LL +GA++N  D    TPL  AA  G+LE+VKLL +AGA   +    G  A
Sbjct  1054  HGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAA  1113

Query  137   IYLAKSLGHTAVQQYL  152
             I+ A S GH  V +YL
Sbjct  1114  IWFAASEGHNEVLRYL  1129


 Score = 48.9 bits (115),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query  82   KQLMLLSRGADVNGRDNY-DNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLA  140
            ++LM   R   ++ R+   D TPL  AA  G+ ++VK LV+AGA  T   K G+ A++LA
Sbjct  844  EELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLA  903

Query  141  KSLGHTAVQQYLE  153
               GH  V   L+
Sbjct  904  AQNGHGQVLDVLK  916


 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query  85    MLLSRGADV-NGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSL  143
             +LLSR A++   +D    T L  AA  G++++V++L+  GA+  AT++ G+  ++ A   
Sbjct  1028  LLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKA  1087

Query  144   GHTAVQQYL  152
             GH  V + L
Sbjct  1088  GHLEVVKLL  1096


 Score = 37.7 bits (86),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 44/82 (54%), Gaps = 1/82 (1%)

Query  77   GYYGYKQLMLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNA  136
            G+    + ++    A ++       TPL  AAA G +E+ +LL++ GA+  AT+  G   
Sbjct  737  GFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKP  796

Query  137  IYLAKSLGHTAVQQ-YLEQLPA  157
            I++A    ++ V + +L+Q P+
Sbjct  797  IHVAAQNNYSEVAKLFLQQHPS  818


 Score = 33.1 bits (74),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  102   TPLMGAAARGNLEIVKLLV-QAGADT-TATEKGGYNAIYLAKSLGHTAV  148
             TPL  AA  GN  +V+LL+  AG     AT + GYN ++LA   GH +V
Sbjct  977   TPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSV  1025


 Score = 28.5 bits (62),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 31/69 (45%), Gaps = 0/69 (0%)

Query  84   LMLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSL  143
            LMLL  GA  N   +   TP+  AA  GNL  +  L++   D       G   +++A   
Sbjct  486  LMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRA  545

Query  144  GHTAVQQYL  152
             H  + ++L
Sbjct  546  CHPDIVRHL  554


 Score = 28.1 bits (61),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  102  TPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSLGHTAVQQYL  152
            TPL+ A  RG++E+V  L+   A     +  G +A++LA   G+  V   L
Sbjct  662  TPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDAL  712


 Score = 26.9 bits (58),  Expect = 9.4, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 0/43 (0%)

Query  98   NYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLA  140
            N   TPLM A       I+  +++ GAD  A     YN +++A
Sbjct  125  NTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIA  167


>A8DYV6_DROME unnamed protein product
Length=1726

 Score = 57.4 bits (137),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)

Query  79    YGYKQL--MLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNA  136
             +G+ Q+  +LL +GA++N  D    TPL  AA  G+LE+VKLL +AGA   +    G  A
Sbjct  1054  HGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAA  1113

Query  137   IYLAKSLGHTAVQQYL  152
             I+ A S GH  V +YL
Sbjct  1114  IWFAASEGHNEVLRYL  1129


 Score = 48.9 bits (115),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 1/73 (1%)

Query  82   KQLMLLSRGADVNGRDNY-DNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLA  140
            ++LM   R   ++ R+   D TPL  AA  G+ ++VK LV+AGA  T   K G+ A++LA
Sbjct  844  EELMKFDRSGVISARNKLTDATPLQLAAEGGHADVVKALVRAGASCTEENKAGFTAVHLA  903

Query  141  KSLGHTAVQQYLE  153
               GH  V   L+
Sbjct  904  AQNGHGQVLDVLK  916


 Score = 40.4 bits (93),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 41/69 (59%), Gaps = 1/69 (1%)

Query  85    MLLSRGADV-NGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSL  143
             +LLSR A++   +D    T L  AA  G++++V++L+  GA+  AT++ G+  ++ A   
Sbjct  1028  LLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKA  1087

Query  144   GHTAVQQYL  152
             GH  V + L
Sbjct  1088  GHLEVVKLL  1096


 Score = 37.7 bits (86),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 44/82 (54%), Gaps = 1/82 (1%)

Query  77   GYYGYKQLMLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNA  136
            G+    + ++    A ++       TPL  AAA G +E+ +LL++ GA+  AT+  G   
Sbjct  737  GFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKP  796

Query  137  IYLAKSLGHTAVQQ-YLEQLPA  157
            I++A    ++ V + +L+Q P+
Sbjct  797  IHVAAQNNYSEVAKLFLQQHPS  818


 Score = 32.7 bits (73),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query  102   TPLMGAAARGNLEIVKLLV-QAGADT-TATEKGGYNAIYLAKSLGHTAV  148
             TPL  AA  GN  +V+LL+  AG     AT + GYN ++LA   GH +V
Sbjct  977   TPLHLAAFSGNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSV  1025


 Score = 28.1 bits (61),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 31/69 (45%), Gaps = 0/69 (0%)

Query  84   LMLLSRGADVNGRDNYDNTPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSL  143
            LMLL  GA  N   +   TP+  AA  GNL  +  L++   D       G   +++A   
Sbjct  486  LMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEGDPLYKSNTGETPLHMACRA  545

Query  144  GHTAVQQYL  152
             H  + ++L
Sbjct  546  CHPDIVRHL  554


 Score = 28.1 bits (61),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 0/51 (0%)

Query  102  TPLMGAAARGNLEIVKLLVQAGADTTATEKGGYNAIYLAKSLGHTAVQQYL  152
            TPL+ A  RG++E+V  L+   A     +  G +A++LA   G+  V   L
Sbjct  662  TPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHVCDAL  712



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold6361-size123031-augustus-gene-0.3-mRNA-1

Length=1380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRM6_DROME  unnamed protein product                                 32.7    3.2  
H1UBK8_CAEEL  unnamed protein product                                 32.3    3.8  
Q8I103_CAEEL  unnamed protein product                                 32.3    4.0  


>Q9VRM6_DROME unnamed protein product
Length=1929

 Score = 32.7 bits (73),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 34/123 (28%), Positives = 59/123 (48%), Gaps = 9/123 (7%)

Query  704  ADQNEQNIESARAEAEVTRTEEVGDYEVSRDQPSTSGIVVNKASPEDTLKERTHKRKQLK  763
            A+  + N + ++  +E   TE + +   SR+ P     V  K S  +   +RT  R + +
Sbjct  263  AETTDHNSKESKLPSETKSTEPLIENNRSRELPQHKNYVRGKTS--NRSHDRTQNRGRTR  320

Query  764  TSKRESAVETAVNSKNRKERQEKLKS--LKERQEKLKSLCKKVKEAHREETKDILLSKSE  821
               +ES  ++  NSKN+ E + K +   L  R+ + +S  K +  A     K + LSK +
Sbjct  321  ERSKESHGKSTENSKNKDEGRGKGRERDLFRRKSRERSQDKNLNRA-----KSMNLSKEK  375

Query  822  DEV  824
            DEV
Sbjct  376  DEV  378


>H1UBK8_CAEEL unnamed protein product
Length=1163

 Score = 32.3 bits (72),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 33/74 (45%), Gaps = 13/74 (18%)

Query  471   TKSSVVNRRTSPGIVGAERNSCSPAPVVPSRVAAASSPSRTSSLIVEDSGPAETIVSSPA  530
             T+S + N+  + G + A        PVVP+R   ++SP+  S             +S   
Sbjct  949   TQSYIRNKWNNDGAMDARGAENQTPPVVPARTNGSASPANAS-------------ISLTV  995

Query  531   STVPTASSYLSTSP  544
             S VPT SS  S SP
Sbjct  996   SNVPTGSSIASKSP  1009


>Q8I103_CAEEL unnamed protein product
Length=1172

 Score = 32.3 bits (72),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 33/74 (45%), Gaps = 13/74 (18%)

Query  471   TKSSVVNRRTSPGIVGAERNSCSPAPVVPSRVAAASSPSRTSSLIVEDSGPAETIVSSPA  530
             T+S + N+  + G + A        PVVP+R   ++SP+  S             +S   
Sbjct  958   TQSYIRNKWNNDGAMDARGAENQTPPVVPARTNGSASPANAS-------------ISLTV  1004

Query  531   STVPTASSYLSTSP  544
             S VPT SS  S SP
Sbjct  1005  SNVPTGSSIASKSP  1018



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold7161-size99754-augustus-gene-0.3-mRNA-1

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ROR1_DROME  unnamed protein product                                   62.8    1e-11
Q7KJ08_DROME  unnamed protein product                                 56.2    2e-09
Q8SWV4_DROME  unnamed protein product                                 55.8    3e-09


>ROR1_DROME unnamed protein product
Length=685

 Score = 62.8 bits (151),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/78 (41%), Positives = 50/78 (64%), Gaps = 2/78 (3%)

Query  7    VAVKMLKDTATREAEDDFMREVDIMSTFRHTNILSLIGVVLRSSSHSPWMVFEFMPHGDL  66
            VA+K LK+ A+ + + DF RE++++S  +H NI+ ++GVVL    +   M+FE+M +GDL
Sbjct  439  VAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYC--MLFEYMANGDL  496

Query  67   AGVLRSNSKQFWKPVSGL  84
               L SNS    K +S L
Sbjct  497  HEFLISNSPTEGKSLSQL  514


>Q7KJ08_DROME unnamed protein product
Length=1701

 Score = 56.2 bits (134),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 2/67 (3%)

Query  7     VAVKMLKDTATREAEDDFMREVDIMSTFRHTNILSLIGVVLRSSSHSPWMVFEFMPHGDL  66
             VAVK L++   RE E+DF++E  IM+ F H N++ LIGV      +  ++V E +  GDL
Sbjct  1224  VAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQPY--YIVLELLAGGDL  1281

Query  67    AGVLRSN  73
                LR N
Sbjct  1282  QKFLREN  1288


>Q8SWV4_DROME unnamed protein product
Length=1158

 Score = 55.8 bits (133),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 2/74 (3%)

Query  7    VAVKMLKDTATREAEDDFMREVDIMSTFRHTNILSLIGVVLRSSSHSPWMVFEFMPHGDL  66
            VAVK L++   RE E+DF++E  IM+ F H N++ LIGV      +  ++V E +  GDL
Sbjct  681  VAVKTLREDPKREKEEDFLKEAAIMAKFNHPNMVHLIGVCFDRQPY--YIVLELLAGGDL  738

Query  67   AGVLRSNSKQFWKP  80
               LR N     +P
Sbjct  739  QKFLRENRNTPERP  752



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold8610-size67502-augustus-gene-0.1-mRNA-1

Length=426
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMY3_DROME  unnamed protein product                                 233     6e-71
Q9VCJ4_DROME  unnamed protein product                                 223     8e-67
ATG13_DROME  unnamed protein product                                  31.2    1.7  


>Q8IMY3_DROME unnamed protein product
Length=566

 Score = 233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 218/401 (54%), Gaps = 14/401 (3%)

Query  18   VQQNDSYQEMLGFGGAMTDATAINIKSLSDKAAENLMQSYFGEGGSQYTILRNPMGASDF  77
            V++  S+Q +  FGGA T   +  +K L  +  +++ +SYF   G  Y  +R  +G SDF
Sbjct  134  VKREQSFQNVSIFGGAFTGTVSYLLKELPVELQDHVYRSYFHPVGIAYNTIRMSIGGSDF  193

Query  78   SVEYYTYDDVD-GDTELKHFALREEDYKYKVIPVIKRAQELNK-RGIRLFTSAWSAPYWM  135
             +E + Y+++   D +L +F    +    + +  +KR + + K   +++  +AWSAP WM
Sbjct  194  DMEPWAYNELPLHDPKLSNFT-ELDPRDLQKVEQLKRLKIIGKVDSLKIMGAAWSAPTWM  252

Query  136  KKNGTASGTSHLLPENYQPWANYYIKYFDAYAKENVTYWGVTAQNEPTQGDIIPSVI--I  193
            K N   +G   L  E YQ WA Y++K+ +    +N+  W ++  NEP  G I    +  +
Sbjct  253  KSNNRWTGFGQLKSEYYQTWALYHLKFLELMRSKNMPIWAISTGNEPLNGVIGFFFVHFM  312

Query  194  TMGWTAEQQRDWIVEHLGPTLHQGGYDYLKLMILDDNRPFLPQWAITVLSNK-TARNYVS  252
            +MGWT  QQ  W+ ++LGPT+       + +   DD R   P W   + S++  + NY+ 
Sbjct  313  SMGWTPWQQAIWLNDNLGPTIRNSAESKVLIFGNDDQRYTYPTWFRKMRSSRNNSLNYLD  372

Query  253  GVAVHYYEDTSTNPAVLSQTHDDFPDKFILYTEACDLHKIVTS---DLGNWEKGESYGTS  309
            G+AVH+Y D    P ++ Q H D P+K +L TE+C   K   +   +LG+W++GESY  +
Sbjct  373  GLAVHWYWDELIGPQLIDQAHTDMPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRA  432

Query  310  ILNSVNNWSAGWTDWNMVLDTEGGPTWSPKPFNAPIIANATA-DEFYKQPMYYFLAHFSS  368
                + +   GW DWN+VLD +GGP +     +APII NAT+  E YKQP++Y + HFS 
Sbjct  433  YTQDLTHNFNGWLDWNLVLDEQGGPNYVKNFVDAPIIVNATSRSEIYKQPIFYAIGHFSK  492

Query  369  FVPPDSRRVGLITQHTDNVLS----AAFLTPEEETVVVIMN  405
            F+PPDS R+    ++  N  +      F  P+    ++I N
Sbjct  493  FLPPDSVRIETRIENQSNPFTQLSVVGFQRPDGSVALIIYN  533


>Q9VCJ4_DROME unnamed protein product
Length=561

 Score = 223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 129/406 (32%), Positives = 219/406 (54%), Gaps = 19/406 (5%)

Query  14   LNLTVQQNDSYQEMLGFGGAMTDATAINIKSLS-DKAAENLMQSYFGEGGSQYTILRNPM  72
            + L + ++ ++Q+M+GFGG+ T A    +++    + A++L +S++ E G  + ++R  +
Sbjct  130  VTLRLDRSKTHQKMVGFGGSYTGAVEYLVENFKHSELADHLYKSFYAEDGLGFNLMRVSI  189

Query  73   GASDFSVEYYTYDDVDGDTELKHFALREEDYKYKVIPV--IKRAQELNK-RGIRLFTSAW  129
            G  DF +E ++Y + +GDTEL      +E   + V  V  IKR  E++  + + +  +AW
Sbjct  190  GGCDFDLEPWSYAEEEGDTELSDM---DELNAHDVTRVAQIKRLIEVSGVKNLLVKGAAW  246

Query  130  SAPYWMKKNGTASGTSHLLPENYQPWANYYIKYFDAYAKENVTYWGVTAQNEPTQGDIIP  189
            S+P WMK N   +G   L    YQ WA+Y++++        +  W ++  NEP  G I  
Sbjct  247  SSPPWMKTNNRWTGFGRLKRAYYQTWADYHLRWLRLMKDNGIPIWAISTGNEPLNGIIFM  306

Query  190  SVI--ITMGWTAEQQRDWIVEHLGPTLHQGGYDYLKLMILDDNRPFLPQWAITVLSNKTA  247
              +  +++GWT + Q  W+ ++LGPT+    +  + L   DD R   P W    + N+T 
Sbjct  307  YFVKFMSLGWTPQTQAIWLNDYLGPTIRNSEFKDITLFGNDDQRYSFPHWF--KMMNRTR  364

Query  248  RN---YVSGVAVHYYEDTSTNPAVLSQTHDDFPDKFILYTEACDLHK---IVTSDLGNWE  301
             N   Y+ G+++H+Y D     + + QT +  PDK ++ +E+C   K        LG+WE
Sbjct  365  PNSIDYLDGLSLHWYWDEIFGNSFIEQTKEYAPDKILIVSESCIGDKPWQAAAPLLGSWE  424

Query  302  KGESYGTSILNSVNNWSAGWTDWNMVLDTEGGPTWSPKPFNAPIIANATA-DEFYKQPMY  360
            + E Y    L ++     GW DWN+ LD  GGP +     +AP+I N T  +EFYKQPM+
Sbjct  425  RAEKYARDYLLNIKLGFHGWIDWNICLDEIGGPNYVDNTVDAPVIVNTTTFEEFYKQPMF  484

Query  361  YFLAHFSSFVPPDSRRVGLITQHTDNVLSAAFLTPEEETVVVIMNT  406
            Y + HFS +VP  S R+  +  +  N+ S AFL P+ +   V+ N+
Sbjct  485  YAIGHFSKWVPEGSVRIDAVPSNV-NLDSVAFLRPDNKITAVLFNS  529


>ATG13_DROME unnamed protein product
Length=523

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 5/120 (4%)

Query  42   IKSLSDKAAENLMQSYFGEGGSQYTILRNPMGASD-FSVEYYTYDDVDGDTELKHFALRE  100
            IK L  K+ + ++QS  GE   +     NP+  SD F++    + +V  +T+ +   L+ 
Sbjct  17   IKFLVLKSTQVVVQSRLGE---KMQTQCNPLAGSDWFNIAVQDHPEVLDETK-RALNLKT  72

Query  101  EDYKYKVIPVIKRAQELNKRGIRLFTSAWSAPYWMKKNGTASGTSHLLPENYQPWANYYI  160
             +   + +P+          G ++    WS      +NG +  T+ L PE     A + I
Sbjct  73   GESILQRLPLCVEISLKTTEGDQMVLEVWSLDLLQPQNGASPATNDLNPEGQTLKAAHAI  132



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold5270-size167834-augustus-gene-0.6-mRNA-1

Length=420
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q17800_CAEEL  unnamed protein product                                 175     8e-48
Q8MRY3_DROME  unnamed protein product                                 164     9e-47
Q52V24_ASTLP  unnamed protein product                                 156     4e-45


>Q17800_CAEEL unnamed protein product
Length=951

 Score = 175 bits (444),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 100/279 (36%), Positives = 150/279 (54%), Gaps = 30/279 (11%)

Query  139  CGTREVRHNPPRAG-TPTAKIVGGAAAPYGAYPWMAEIQVYRKDSRQYTHQCGGAVISSR  197
            CG R V  N   A  +  A++VGG     GA+PW A +    ++     H CG +++   
Sbjct  693  CGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAAL----RNKATKAHHCGASILDKT  748

Query  198  LVVTAAHCLQ-GEQPDRLRVVLGEHRLSAWDEHEQMFKVDKVVLHPSFRKVGTYSHDIAV  256
             ++TAAHC +  E+     VV+G+   +  D +EQ+F + ++  +P ++ +  +SHDIA+
Sbjct  749  HLITAAHCFEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDI--FSHDIAI  806

Query  257  ARLKATGGRGVLFGSKVRPICLPEKRSRSPDGMWCVVTGWGAQNQVRARRVFAAEDVQTQ  316
              +   G   + F    +PICLP K      G  CVV+GWG+     A R          
Sbjct  807  LEIPYPG---IEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSMGLRYAER----------  853

Query  317  SESLQVAAVSLLN-LDVCRGDDIYGGRHQSILDSMLCAGVLEGGVDACGGDSGGPLACE-  374
               LQ A + ++N  D      IY     S+  S  CAG LEGG+D+C GDSGGP AC  
Sbjct  854  ---LQAALIPIINRFDCVNSSQIYS----SMSRSAFCAGYLEGGIDSCQGDSGGPFACRR  906

Query  375  LNGKFVLMGLVSWGDGCAKKNRPGVYTRISYYIDWINEV  413
             +G FVL G++SWGDGCA+K +PG+YT ++ Y+ WI+ +
Sbjct  907  EDGAFVLAGVISWGDGCAQKKQPGIYTMVAPYLSWISAI  945


>Q8MRY3_DROME unnamed protein product
Length=371

 Score = 164 bits (416),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 137/256 (54%), Gaps = 18/256 (7%)

Query  157  KIVGGAAAPYGAYPWMAEIQVYRKDSRQYTHQCGGAVISSRLVVTAAHCLQGEQPDRLRV  216
            ++V G  A  G +PW A I+  R      +H CG  VIS R ++TAAHCL G       V
Sbjct  125  RVVRGNVAQRGRHPWQATIRT-RGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFV  183

Query  217  VLGEHRLSAWDEHEQMFKVDKVVLHPSFRKVGTYSHDIAVARLKATGGRGVLFGSKVRPI  276
             +G+H  +  +  E    ++   LH +FRK    ++DIA+  LK      + F   V+PI
Sbjct  184  RVGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTP----LKFSDYVQPI  239

Query  277  CLPEKRSRSPDGMWCVVTGWGAQNQVRARRVFAAEDVQTQSESLQVAAVSLLNLDVCRGD  336
            CLP+K +   +   C ++GWG+              V T ++ L  A + +L   VC+  
Sbjct  240  CLPDKNAELVEDRKCTISGWGS----------IKSGVSTPAQVLGSAELPILADHVCKQS  289

Query  337  DIYGGRHQSILDSMLCAGVLEGGVDACGGDSGGPLACELNGKFVLMGLVSWGDGCAKKNR  396
            ++YG    ++ + M CAG ++  VDAC GDSGGPL C  +    L GL+SWG  C  KNR
Sbjct  290  NVYG---SAMSEGMFCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNR  346

Query  397  PGVYTRISYYIDWINE  412
            PGVY R+++YIDWI E
Sbjct  347  PGVYVRVNHYIDWIYE  362


>Q52V24_ASTLP unnamed protein product
Length=237

 Score = 156 bits (395),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/256 (38%), Positives = 133/256 (52%), Gaps = 27/256 (11%)

Query  158  IVGGAAAPYGAYPWMAEIQVYRKDSRQYTHQCGGAVISSRLVVTAAHCLQG---EQPDRL  214
            IVGG  A  G +P+    Q          H CG ++ +    +TA HC  G   E P  L
Sbjct  1    IVGGTDATLGEFPYQLSFQ--ETFIGFSFHFCGASIYNENYAITAGHCAYGDDYENPSGL  58

Query  215  RVVLGEHRLSAWDEHEQMFKVDKVVLHPSFRKVGTYSHDIAVARLKATGGRGVLFGSKVR  274
            ++V GE  +S  +  EQ+  V K++LH +F       +DI++ +L  +    + F   V 
Sbjct  59   QIVAGELDMSVNEGSEQIITVSKIILHENF-DYNLLDNDISLLKLSGS----LTFNDNVA  113

Query  275  PICLPEKRSRSPDGMWCVVTGWGAQNQVRARRVFAAEDVQTQSESLQVAAVSLLNLDVCR  334
            PI LPE+   +   +  +VTGWG  ++                + LQ   V L++ + CR
Sbjct  114  PIALPEQGHTATGDV--IVTGWGTTSEGG-----------NTPDVLQKVTVPLVSDEDCR  160

Query  335  GDDIYGGRHQSILDSMLCAGVLEGGVDACGGDSGGPLACELNGKFVLMGLVSWGDGCAKK  394
             D  YG     ILDSM+CAGV EGG D+C GDSGGPLA    G   L G+VSWG GCA+ 
Sbjct  161  AD--YGADE--ILDSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARP  216

Query  395  NRPGVYTRISYYIDWI  410
              PGVYT +SY++DWI
Sbjct  217  GYPGVYTEVSYHVDWI  232



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= augustus-scaffold4621-size196199-processed-gene-0.1-mRNA-1

Length=548
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGT3_DROME  unnamed protein product                                 283     7e-89
Q9V9X9_DROME  unnamed protein product                                 254     1e-77
Q93242_CAEEL  unnamed protein product                                 135     7e-34


>Q9VGT3_DROME unnamed protein product
Length=528

 Score = 283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 163/454 (36%), Positives = 261/454 (57%), Gaps = 19/454 (4%)

Query  10   HHVVVLNNFPQRKPYPNYTDIDVSGSAVSEVDNCTIDTALATDMISLVDYIWTYTR---Q  66
            H V +++ F  +KP  N  D  V   ++       I   L +    ++  I  +     +
Sbjct  54   HQVTIISPFELKKPIKNIKD--VPAKSILTSMQGRIANLLQSSKEPIIKQIINFHEMGIE  111

Query  67   MCRDTMDHPNSQALLKSSENYDLVITEIFGCECTIGFAHKFKAPVINVISSVALPWAHSR  126
            +    +  P+   L+KS++ +D VI+E+F  E   GFA  FKAP+I + +  A+ W    
Sbjct  112  ITELLLKEPSVIELMKSNQTFDAVISEVFLNEAHFGFAEHFKAPLIGLGTFGAISWNTDL  171

Query  127  IGNPDHPAYVPNYFTPYSNNMNFWQRLVN----TIVRVWLNIGNHVYNNIPTSTVL-REY  181
            +G+P  P+YVP+    +S+ M+  +R+ N    T   ++LN     Y  +P   VL R+Y
Sbjct  172  VGSPSPPSYVPSALLKFSDRMSLVERVGNQAFLTYEYIFLN-----YFYLPRQEVLYRKY  226

Query  182  FGDGVPSLEKLVNNVSLVLVNSHFSVTGPRPAVPSFIEVGGLHI-RKPEELPQDIQKFLD  240
            F +       +  N +LVL+N H S++ PRP  P+ IEVGG+HI RK + LP+DI +F++
Sbjct  227  FPNNKQDFYDMRKNTALVLLNQHVSLSFPRPYSPNMIEVGGMHINRKRQPLPKDILEFIE  286

Query  241  ESEHGVVYFSLGTMVQIQTFPPDKLKSLLDAFGALRERVLMKYTGDALPGKPKNVMTSKW  300
             +EHGV+YFS+G+ ++ +T P +K ++L+D F  L++RVL K+    LPGKP NV  S W
Sbjct  287  GAEHGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQRVLWKFEDTDLPGKPANVFISDW  346

Query  301  APQLAVLSHPNTKLFISHGGLMGTQESVHAGVPILGIPLFADQDLNIIGLARLGMAVKLS  360
             PQ  +L+H N   FI+HGGL+ T ES++   P +GIP+F DQ LN+    + G  V + 
Sbjct  347  FPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMARAEQNGYGVTVH  406

Query  361  YYDITRKSLLKAMRTVIDDPTFSASARRLSALFRDRPTSAMETAVFWVEHVLRHRGAPHL  420
            Y +++   LL A++ +I++P  +   R +S  +RD+  + +E AV+WVEHV RH+GA +L
Sbjct  407  YEELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQQQTPLERAVYWVEHVSRHKGAKYL  466

Query  421  RSVAADMPLHQYLLLDVIGVLLLVMTACSCVIYC  454
            RS + D+   QY  LD    +L++      V+YC
Sbjct  467  RSASQDLNFIQYHNLD---AMLILYGGIIFVLYC  497


>Q9V9X9_DROME unnamed protein product
Length=521

 Score = 254 bits (648),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/475 (32%), Positives = 258/475 (54%), Gaps = 30/475 (6%)

Query  2    MKGLADRGHHVVVLNNFPQRKPYPNYTDIDV-----SGSAVSEVDNCTIDTALATDMISL  56
            +K LA  GH +  ++ +PQR+P+ N  DI V     + + V  + +    T  ++D I+ 
Sbjct  39   LKSLASLGHEITSVSPYPQREPFRNIHDIPVPEVFENFNEVLRIASTPRSTWQSSDFIN-  97

Query  57   VDYIWTYTRQMCRDTMDHPNSQALLKSSENYDLVITEIFGCECTIGFAHKFKAPVINVIS  116
             +Y+   T+ +  +  +      L     ++DLVI +++  +   G A  F AP+I  ++
Sbjct  98   -EYVLNLTKTVLNN--EGVRRDILGPQKPHFDLVIMDLWRMDVLSGLAAYFDAPIIG-MA  153

Query  117  SVALPWAHSRI-GNPDHPAYVPNYFTPYSNNMNFWQRLVNTIVRVWLNIGNHVYNNIPTS  175
            S    W    + GN    +Y+ +  + + +   + +RL++ + R + +  N+ + ++   
Sbjct  154  SYGTDWKIDELMGNVSPISYLQSPSSRFYDLEAYGERLLHLMERTF-SYMNYKWRHVRKQ  212

Query  176  TVLREYFGDGVPS---LEKLVNNVSLVLVNSHFSVTGPRPAVPSFIEVGGLHI-RKPEEL  231
              L   F   V     L ++  N  LVLVN HF++  PRP VP+ I+VGGLH+    E L
Sbjct  213  ETLYSQFFPSVAERKPLSEISRNFDLVLVNQHFTLGPPRPYVPNMIQVGGLHVDHSTEAL  272

Query  232  PQDIQKFLDES-EHGVVYFSLGTMVQIQTFPPDKLKSLLDAFGALRERVLMKYTGDALPG  290
              ++  F+  + E GV+YFSLGT V+ ++   D+ K LL+ F +L +R++ K+  + LPG
Sbjct  273  SAELDHFIQGAGESGVIYFSLGTNVKSKSLSEDRRKVLLETFASLPQRIVWKFEDELLPG  332

Query  291  KPKNVMTSKWAPQLAVLSHPNTKLFISHGGLMGTQESVHAGVPILGIPLFADQDLNIIGL  350
            KP NV  SKW PQ A+L+HPN KLFI+HGGL+ T ES+H G P+LG+P   DQ  N+  +
Sbjct  333  KPPNVFISKWFPQQAILAHPNVKLFITHGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHV  392

Query  351  ARLGMAVKLSYYDITRKSLLKAMRTVIDDPTFSASARRLSALFRDRPTSAMETAVFWVEH  410
             ++G+ + L+   +T +     +  ++ + +F  +AR  +A +RD+P   META++W E+
Sbjct  393  RQVGLGLVLNIKQMTSEEFRSTIIRLLTNKSFEETARITAARYRDQPMKPMETAIWWTEY  452

Query  411  VLRHRGAPHLRSVAADMPLHQYLLLDVIGVL-------------LLVMTACSCVI  452
            VL H+GA H++    D+   +Y  LDV G               LLVMT   C+ 
Sbjct  453  VLSHKGAAHMQVAGKDLGFVRYHSLDVFGTFLVGALVILGIVTYLLVMTLRKCLF  507


>Q93242_CAEEL unnamed protein product
Length=530

 Score = 135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 108/399 (27%), Positives = 182/399 (46%), Gaps = 25/399 (6%)

Query  84   SENYDLVITEIFGCECTIGFAHKFKAPV-INVISSVALPWAHSRIGNPDHPAYVPNYFTP  142
            SE +DL ITE F   C  G     + P  ++++S   +      +G P  P+YVP   + 
Sbjct  137  SEKFDLAITEAFDS-CGYGIFEYLQIPAHVSILSCARMDHVSDVLGQPIAPSYVPGTQSL  195

Query  143  YSNNMNFWQRLVNTIVRVWLNIGNHVYNNIPTSTVLREYFGDGVP-SLEKLVNNVSLVLV  201
            YS+ M   QR +N +   +LN GN ++++I            GV  S  +++   S +L 
Sbjct  196  YSDRMTMTQRFLNYLQ--FLN-GNSMFSDIGDYESANAKKLLGVERSWREILPESSFLLT  252

Query  202  NSHFSVTGPRPAVPSFIEVGGLHIRKPEELPQDIQKFLD---ESEHGVVYFSLGTMVQIQ  258
            N    +  P P     + +GG+ + K +E  + ++ + D         V  S G+ ++  
Sbjct  253  NHIPVLEFPAPTFDKIVPIGGISVNKNKETLK-LEHYFDTMVSMRKKNVIISFGSNIKSM  311

Query  259  TFPPDKLKSLLDAFGALRERVLM---------KYTGDALPGKPKNVMTSKWAPQLAVLSH  309
              P +  KSL + F  + +   +         KYT   +     N+   +W PQ  +L+ 
Sbjct  312  DMPDEYKKSLAELFQLMPDVTFIWKYENLADKKYTCGIM-----NINRVEWIPQTELLAD  366

Query  310  PNTKLFISHGGLMGTQESVHAGVPILGIPLFADQDLNIIGLARLGMAVKLSYYDITR-KS  368
                 FI+HGGL    E    G P + IP+FADQ  N   L R G A  L   D+   ++
Sbjct  367  SRVDAFITHGGLGSVTELATMGKPAVVIPIFADQTRNAEMLKRHGGAEVLHKTDLANPET  426

Query  369  LLKAMRTVIDDPTFSASARRLSALFRDRPTSAMETAVFWVEHVLRHRGAPHLRSVAADMP  428
            L K +R V+DDP++  +A+RL+ +  ++PT+  ET V  VE   R    P +        
Sbjct  427  LRKTLRKVMDDPSYRQNAQRLAEMLNNQPTNPKETLVKHVEFAARFGKLPSMDPYGRHQN  486

Query  429  LHQYLLLDVIGVLLLVMTACSCVIYCTVKAVLRAPAGRK  467
            + +Y  LD++ +  +++T    +    V  V+R   G+K
Sbjct  487  IIEYYNLDILAIATILLTLVVYLKIFAVGVVVRCCCGKK  525



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold744-size697364-augustus-gene-2.1-mRNA-1

Length=912
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMO_DROME  unnamed protein product                                    610     0.0  
FRIZ2_DROME  unnamed protein product                                  170     7e-44
FRIZ_DROVI  unnamed protein product                                   153     9e-39


>SMO_DROME unnamed protein product
Length=1036

 Score = 610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/736 (45%), Positives = 450/736 (61%), Gaps = 125/736 (17%)

Query  3    LQERLQFWQGLRHVPKCWAVVQPFLCALYMPKCE--NGS--VYLPS--------------  44
            L ++L  +  L+HVPKCWA +QPFLCA++ PKCE  NG   VYLPS              
Sbjct  123  LNDKLNDYYALKHVPKCWAAIQPFLCAVFKPKCEKINGEDMVYLPSYEMCRITMEPCRIL  182

Query  45   ---------------------QNDVHELKFNTTGRCLGPLVATDSTATFYEGVEGCGIQC  83
                                  N    +KFN TG+CL PLV TD++A++Y G+EGCG++C
Sbjct  183  YNTTFFPKFLRCNETLFPTKCTNGARGMKFNGTGQCLSPLVPTDTSASYYPGIEGCGVRC  242

Query  84   HDPLFTDDERRQIHTLVAWGASVSLILNLFTVVTFMIDWRSANKYPAVVIFYINGCFLVS  143
             DPL+TDDE RQIH L+ W  S+ L+ NLF V TF IDW++ANKYPAV++FYIN CFL++
Sbjct  243  KDPLYTDDEHRQIHKLIGWAGSICLLSNLFVVSTFFIDWKNANKYPAVIVFYINLCFLIA  302

Query  144  CVGWLTQFLPGARDDIVCRKDHTLRMAEPSAGENLSCVVVFVLVYYFVIAAMVWFVILTF  203
            CVGWL QF  G+R+DIVCRKD TLR +EP+AGENLSC+V+FVLVYYF+ A MVWFV LT+
Sbjct  303  CVGWLLQFTSGSREDIVCRKDGTLRHSEPTAGENLSCIVIFVLVYYFLTAGMVWFVFLTY  362

Query  204  AWYISFQALGKIQHRIDKKGAYFHMVAWSLPLVFTITTMALGEIDGNSMAGICFVGYRNY  263
            AW+  ++A+G +Q RIDKKG+YFH+VAWSLPLV TITTMA  E+DGNS+ GICFVGY N+
Sbjct  363  AWH--WRAMGHVQDRIDKKGSYFHLVAWSLPLVLTITTMAFSEVDGNSIVGICFVGYINH  420

Query  264  AARAGLLLGPVIIMLLVGGFLLCKGLLTLIQLQVTSQEVISERANAKIRETIYRIGLFSI  323
            + RAGLLLGP+  ++L+GG+ + +G++ L  L+  + ++ S  A+ KI   I R+G    
Sbjct  421  SMRAGLLLGPLCGVILIGGYFITRGMVMLFGLKHFANDIKSTSASNKIHLIIMRMG----  476

Query  324  FAVVFVLVTIMCHVYEFKHHHEWQESFREHVICRITNSVFLAPDSCKMKARPSVMMLQLH  383
                                           +C +   VF+            ++ +  H
Sbjct  477  -------------------------------VCALLTLVFI------------LVAIACH  493

Query  384  LLIFFSAGVVMSSWVWTAATVDTWKRYITSCRITNSVFLAPDSCKMKARPSVMMLQLHLL  443
            +  F  A      W        +++++I  C+I+ SVF    SC+++ RPSV +LQLHLL
Sbjct  494  VTEFRHA----DEWA------QSFRQFII-CKIS-SVFEEKSSCRIENRPSVGVLQLHLL  541

Query  444  IFFSAGVVMSSWVWTAATVDTWKRYITRKFNGQVEEPVRLKKHKVIAQAFAKRKTFNSAG  503
              FS+G+VMS+W WT ++++TWKRYI +K   +V E V++ KHKVIAQ +AKRK F   G
Sbjct  542  CLFSSGIVMSTWCWTPSSIETWKRYIRKKCGKEVVEEVKMPKHKVIAQTWAKRKDFEDKG  601

Query  504  RVSISFHSTHEDPVGLNLDINSIAS---QDLSSTWAAALPKLMTRRGALIG-PTGSASSH  559
            R+SI+ ++TH DPVGLN D+N + S    D+SSTWAA LP+ + RR AL G  TG++SSH
Sbjct  602  RLSITLYNTHTDPVGLNFDVNDLNSSETNDISSTWAAYLPQCVKRRMALTGAATGNSSSH  661

Query  560  --------SEISLSVRRVSVESRRHSLDSQVSVQIAEVTATRKVATTTSMPGVSGSRSSK  611
                    SEIS+SVR VSVESRR+S+DSQVSV+IAE+    KVA+ +   G  G  SS 
Sbjct  662  GPRKNSLDSEISVSVRHVSVESRRNSVDSQVSVKIAEMKT--KVASRSR--GKHGGSSSN  717

Query  612  SFRPKRRRREFGRHRTSRVAPMTAKKSSTASPEKQL-------GAHILNALAIGNPSIQA  664
              R  +RRR++    T + +      +S  S    L        +H +   A  +   Q 
Sbjct  718  --RRTQRRRDYIAAATGKSSRRRESSTSVESQVIALKKTTYPNASHKVGVFAHHSSKKQH  775

Query  665  LVPKLMKRRFATAGLE  680
                 MKRR A AGL+
Sbjct  776  NYTSSMKRRTANAGLD  791


>FRIZ2_DROME unnamed protein product
Length=694

 Score = 170 bits (430),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/343 (29%), Positives = 177/343 (52%), Gaps = 29/343 (8%)

Query  75   GVEGCGIQCHDPLFTDDERRQIHTLVAWGASVSLILNLFTVVTFMIDWRSANKYPAVVIF  134
            GV  CGI C  P F++DE+      +A  + +     L T+ TF+ID     KYP   I 
Sbjct  296  GVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIID-TERFKYPERPIV  354

Query  135  YINGCFLVSCVGWLTQ-FLPGARDDIVCRKDHTLRMAEPSAGENLSCVVVFVLVYYFVIA  193
            +++ C+ +  VG+L++ FL    ++I C     L + E S G + SC +VF+L Y+F +A
Sbjct  355  FLSACYFMVAVGYLSRNFL--QNEEIAC---DGLLLRESSTGPH-SCTLVFLLTYFFGMA  408

Query  194  AMVWFVILTFAWYISFQALGKIQHRIDKKGAYFHMVAWSLPLVFTITTMALGEIDGNSMA  253
            + +W+VIL+F W+++   L      I K   YFH+ AW +P V ++  + L  +DG+ + 
Sbjct  409  SSIWWVILSFTWFLA-AGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPIL  467

Query  254  GICFVGYRNYAARAGLLLGPVIIMLLVGGFLLCKGLLTLIQLQ--VTSQEVISERANA-K  310
            GIC+VG  N       +L P+ + L++G   L  G ++L +++  +  Q  +     A K
Sbjct  468  GICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADK  527

Query  311  IRETIYRIGLFSIFAVVFVLVTIMCHVYEFKHHHEWQESFREHVICRITNSVFLAPDSCK  370
            + + + RIG+FS+   V   + I C++YE  +  +W ++              LA    +
Sbjct  528  LEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKA--------------LACPCAQ  573

Query  371  MKA---RPSVMMLQLHLLIFFSAGVVMSSWVWTAATVDTWKRY  410
            +K    +P   +L L   +  + G+    W+W+  T+++W+R+
Sbjct  574  VKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRF  616


 Score = 33.9 bits (76),  Expect = 0.73, Method: Compositional matrix adjust.
 Identities = 18/85 (21%), Positives = 39/85 (46%), Gaps = 14/85 (16%)

Query  390  AGVVMSSWVWTAATVDTWKRYITSCRITNSVFLAPDSCKMKA---RPSVMMLQLHLLIFF  446
            A +V+  +++ AA  + W +            LA    ++K    +P   +L L   +  
Sbjct  546  ATIVIGCYLYEAAYFEDWIKA-----------LACPCAQVKGPGKKPLYSVLMLKYFMAL  594

Query  447  SAGVVMSSWVWTAATVDTWKRYITR  471
            + G+    W+W+  T+++W+R+  R
Sbjct  595  AVGITSGVWIWSGKTLESWRRFWRR  619


>FRIZ_DROVI unnamed protein product
Length=580

 Score = 153 bits (386),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 95/343 (28%), Positives = 172/343 (50%), Gaps = 16/343 (5%)

Query  79   CGIQCHDPLFTDDERRQIHTLVAWGASVSLILNLFTVVTFMIDWRSANKYPAVVIFYING  138
            CG  CH   F + ER  +   V   A++ +   LFTV+TF+ID  S  +YP   I ++  
Sbjct  228  CGAPCHAMFFPERERTVLRYWVGSWAAICVASCLFTVLTFLID-SSRFRYPERAIVFLAV  286

Query  139  CFLVSCVGWLTQFLPGARDDIVCRKDHT--------LRMAEPSAG--ENLSCVVVFVLVY  188
            C+LV    ++     GA D + CR+             M+  + G  +  +C V+F+ +Y
Sbjct  287  CYLVVGCAYVAGL--GAGDSVSCREPFPPPVKLGRLQMMSTITQGHRQTTACTVLFMALY  344

Query  189  YFVIAAMVWFVILTFAWYISFQALGKIQHRIDKKGAYFHMVAWSLPLVFTITTMALGEID  248
            +  +AA  W+  L FAW+++   L      I+ K   FH+VAW++P + TI+ +AL +++
Sbjct  345  FCCMAAFAWWSCLAFAWFLA-AGLKWGHEAIENKSHLFHLVAWAVPALQTISVLALAKVE  403

Query  249  GNSMAGICFVGYRNYAARAGLLLGPVIIMLLVGGFLLCKGLLTLIQLQVTSQEVISERAN  308
            G+ ++G+CFVG  +  +  G L+ P+ I L +G   L  G ++L +++ T  +   +R +
Sbjct  404  GDILSGVCFVGQLDTHSLGGFLILPLCIYLSIGALFLLAGFISLFRIR-TVMKTDGKRTD  462

Query  309  AKIRETIYRIGLFSIFAVVFVLVTIMCHVYEFKHHHEWQESFREHVICRITNSVFLAPDS  368
             K+   + RIG FS   ++  L  + C  YE+ +  EW   +   +    +     A   
Sbjct  463  -KLERLMLRIGFFSGLFILPALGLLGCLFYEYYNFDEWMIQWHRDICKPFSIPCPAARPP  521

Query  369  CKMKARPSVMMLQLHLLIFFSAGVVMSSWVWTAATVDTWKRYI  411
               +ARP   +  +  L     GV  S W++++ T+ +W+ ++
Sbjct  522  GTPEARPIFQIYMVKYLCSMLVGVTSSVWLYSSKTMVSWRNFV  564



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold1196-size551535-augustus-gene-3.2-mRNA-1

Length=745
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9X9_DROME  unnamed protein product                                 260     3e-78
Q9VGT3_DROME  unnamed protein product                                 246     8e-73
O17757_CAEEL  unnamed protein product                                 119     4e-28


>Q9V9X9_DROME unnamed protein product
Length=521

 Score = 260 bits (665),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 173/508 (34%), Positives = 266/508 (52%), Gaps = 22/508 (4%)

Query  242  ESARILGVFPITSVSHQIVYRGLMMELARGGHELVVITPDPVKDPSLANYTEIDVSFMYK  301
            E ARIL VFP+ S SH       +  LA  GHE+  ++P P ++P   N  +I V  +++
Sbjct  16   EGARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREP-FRNIHDIPVPEVFE  74

Query  302  EFRKVFDFAD--RRVEDSSGYTILKALLQFGSRLCEMLLEHEPVGKLISPDNKDEHFDLV  359
             F +V   A   R    SS +     + ++   L + +L +E V + I    K  HFDLV
Sbjct  75   NFNEVLRIASTPRSTWQSSDF-----INEYVLNLTKTVLNNEGVRRDILGPQK-PHFDLV  128

Query  360  FLEWLSTPATYGFTYRFSAPMIGILSLPPSGFSYDSVGNPTNPSYIPETFLPYSDRTTFF  419
             ++        G    F AP+IG+ S        + +GN +  SY+      + D   + 
Sbjct  129  IMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSPSSRFYDLEAYG  188

Query  420  ERLDNLVYALRTRHFFFNTMMPIH---QDIANRHFGPSPPD---LMKLHYNVSMLFVNFD  473
            ERL +L+     R F +      H   Q+     F PS  +   L ++  N  ++ VN  
Sbjct  189  ERLLHLM----ERTFSYMNYKWRHVRKQETLYSQFFPSVAERKPLSEISRNFDLVLVNQH  244

Query  474  PNFYPPRPEVPAIVHMTGLHM-KPPKPLPQDLQQYLDYAPE-GVVYFSLGTNVRSDRLDA  531
                PPRP VP ++ + GLH+    + L  +L  ++  A E GV+YFSLGTNV+S  L  
Sbjct  245  FTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKSKSLSE  304

Query  532  RTRQMFLDAFAELDGYRVLWKWESDNLPGQPSNVVVRKWMPQPDILRHPKLKAYIMQGGL  591
              R++ L+ FA L   R++WK+E + LPG+P NV + KW PQ  IL HP +K +I  GGL
Sbjct  305  DRRKVLLETFASLPQ-RIVWKFEDELLPGKPPNVFISKWFPQQAILAHPNVKLFITHGGL  363

Query  592  QSTEEAIHSGVPLISIPFFSDQDFNTKRIVEKGIGLKLDISEVSKEKILKALRTILYDKS  651
             ST E+IH G P++ +P   DQ  N   + + G+GL L+I +++ E+    +  +L +KS
Sbjct  364  LSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRLLTNKS  423

Query  652  FRDNARRLSALMKDKPMSSMDNAVWWTEYVLRHKGAAHLRTAAVDMPWYQYLLLDVVAFL  711
            F + AR  +A  +D+PM  M+ A+WWTEYVL HKGAAH++ A  D+ + +Y  LDV    
Sbjct  424  FEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLDVFGTF  483

Query  712  VVSALLAVWLLWRLAAFVCSRLLAPVAR  739
            +V AL+ + ++  L      + L  + R
Sbjct  484  LVGALVILGIVTYLLVMTLRKCLFLIKR  511


>Q9VGT3_DROME unnamed protein product
Length=528

 Score = 246 bits (628),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 150/468 (32%), Positives = 255/468 (54%), Gaps = 28/468 (6%)

Query  273  HELVVITPDPVKDPSLANYTEIDVSFMYKEFRKVFDFADRRVED---SSGYTILKALLQF  329
            H++ +I+P  +K P + N  ++         + +      R+ +   SS   I+K ++ F
Sbjct  54   HQVTIISPFELKKP-IKNIKDVPA-------KSILTSMQGRIANLLQSSKEPIIKQIINF  105

Query  330  ---GSRLCEMLLEHEPVGKLISPDNKDEHFDLVFLEWLSTPATYGFTYRFSAPMIGILSL  386
               G  + E+LL+   V +L+     ++ FD V  E     A +GF   F AP+IG+ + 
Sbjct  106  HEMGIEITELLLKEPSVIELMK---SNQTFDAVISEVFLNEAHFGFAEHFKAPLIGLGTF  162

Query  387  PPSGFSYDSVGNPTNPSYIPETFLPYSDRTTFFERLDNLVYALRTRHFFFNTM-MPIHQD  445
                ++ D VG+P+ PSY+P   L +SDR +  ER+ N  + L   + F N   +P  + 
Sbjct  163  GAISWNTDLVGSPSPPSYVPSALLKFSDRMSLVERVGNQAF-LTYEYIFLNYFYLPRQEV  221

Query  446  IANRHFGPSPPDLMKLHYNVSMLFVNFDPNFYPPRPEVPAIVHMTGLHM-KPPKPLPQDL  504
            +  ++F  +  D   +  N +++ +N   +   PRP  P ++ + G+H+ +  +PLP+D+
Sbjct  222  LYRKYFPNNKQDFYDMRKNTALVLLNQHVSLSFPRPYSPNMIEVGGMHINRKRQPLPKDI  281

Query  505  QQYLDYAPEGVVYFSLGTNVRSDRLDARTRQMFLDAFAELDGYRVLWKWESDNLPGQPSN  564
             ++++ A  GV+YFS+G+N++S  L    RQ  +D FA+L   RVLWK+E  +LPG+P+N
Sbjct  282  LEFIEGAEHGVIYFSMGSNLKSKTLPLEKRQALIDTFAQLKQ-RVLWKFEDTDLPGKPAN  340

Query  565  VVVRKWMPQPDILRHPKLKAYIMQGGLQSTEEAIHSGVPLISIPFFSDQDFNTKRIVEKG  624
            V +  W PQ DIL H  + A+I  GGL ST E+I+   P + IP F DQ  N  R  + G
Sbjct  341  VFISDWFPQDDILAHDNVLAFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMARAEQNG  400

Query  625  IGLKLDISEVSKEKILKALRTILYDKSFRDNARRLSALMKDKPMSSMDNAVWWTEYVLRH  684
             G+ +   E+S  K+L A++ I+ +       R +S   +D+  + ++ AV+W E+V RH
Sbjct  401  YGVTVHYEELSSAKLLAAIQKIINNPEATQRVRDMSDRYRDQQQTPLERAVYWVEHVSRH  460

Query  685  KGAAHLRTAAVDMPWYQYLLLDV-------VAFLVVSALLAVWLLWRL  725
            KGA +LR+A+ D+ + QY  LD        + F++    L + L+WRL
Sbjct  461  KGAKYLRSASQDLNFIQYHNLDAMLILYGGIIFVLYCIFLLIRLVWRL  508


>O17757_CAEEL unnamed protein product
Length=542

 Score = 119 bits (299),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 92/389 (24%), Positives = 175/389 (45%), Gaps = 16/389 (4%)

Query  334  CEMLLEHEPVGKLISPDNKDEHFDLVFLEWLSTPATYGFTYRFSAPMIGILSLPPSGFSY  393
            C+ + ++E +   +    +D+ FD+   E L T     F +      I   S      S 
Sbjct  131  CKNVFQNEDLINYL----RDQRFDVAISEPLYTCGFALFDHLGIETTISTDSHLGLEVSK  186

Query  394  DSVGNPTNPSYIPETFLPYSDRTTFFERLDNLVYALRTRHFFFNTMMPIHQDIANRHFGP  453
             + G   + SY+P  F   S+R T   R  N  Y     +++FN+ +  ++         
Sbjct  187  IAHGASISTSYLPAVFSSGSERMTLIGRAKN--YVESYFNYYFNSKIYENELAGIEGIYK  244

Query  454  SPPDLMKLHYNVSMLFVNFDPNFYPPRPEVPAIVHMTGLHMKPPKP--LPQDLQQYLDYA  511
            +     +L    + +FVN +P    P P     + + G+   P K   LP++  + L   
Sbjct  245  NGKGWRELSRKNAYMFVNSNPQMDIPSPRTSKFIEIGGISSGPVKQERLPEEYDRVLSLR  304

Query  512  PEGVVYFSLGTNVRSDRLDARTRQMFLDAFAELDGYRVLWKWESDNLP------GQPSNV  565
             + V+  S GTN +S  +    ++  +  F  +     +WK+E+  +        + +NV
Sbjct  305  KKNVL-ISFGTNAKSMFMSDDMKESLIKTFESMPDTTFIWKYENTTVDIVKQYNKRINNV  363

Query  566  VVRKWMPQPDILRHPKLKAYIMQGGLQSTEEAIHSGVPLISIPFFSDQDFNTKRIVEKGI  625
            ++  WMPQ  +L  P+L  ++  GGL ST E   SG P I +P F DQ  N + +    +
Sbjct  364  MLTDWMPQTALLADPRLTLFVTHGGLGSTNEVAFSGKPSIMVPVFGDQTRNARMLERHEV  423

Query  626  GLKLDISEVSK-EKILKALRTILYDKSFRDNARRLSALMKDKPMSSMDNAVWWTEYVLRH  684
             L L   +++  +K+   +R +L DKS+   A +L+ +++++P S  +  + +  +V R 
Sbjct  424  ALVLTKYDLTNFKKVRGTIRKMLNDKSYSMKAEKLAQMLRNQPESPKEIFIKYFNFVARF  483

Query  685  KGAAHLRTAAVDMPWYQYLLLDVVAFLVV  713
                 L + A +M + ++  +D +A L +
Sbjct  484  GKPHGLDSYAAEMSFIEFYYIDFMAILSI  512



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold1289-size526270-augustus-gene-4.7-mRNA-1

Length=303
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O76522_DROME  unnamed protein product                                 432     7e-151
Q9UB78_DROME  unnamed protein product                                 432     9e-151
Q9V455_DROME  unnamed protein product                                 432     9e-151


>O76522_DROME unnamed protein product
Length=514

 Score = 432 bits (1112),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 253/339 (75%), Gaps = 44/339 (13%)

Query  7    GNIIGDGPQLRDYVIGLGVVNPLLTFIKPDIPISFLRNVTWVIVNLCRNKDPPPPVQTIA  66
            GNIIGDGP LRD+VI  GVV PLL+FIKPDIPI+FLRNVTWVIVNLCRNKDP PP  TI 
Sbjct  177  GNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIH  236

Query  67   DILPALNMLIHHTDIN------------------------------------------VQ  84
            +ILPALN+LIHHTD N                                          VQ
Sbjct  237  EILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQ  296

Query  85   TAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHQKEKICKEAVWFLSNITAGNQQQV  144
            TAALRAVGNIVTG+DEQTQVVLN DALS+FP LL+H KEKI KEAVWFLSNITAGNQ QV
Sbjct  297  TAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQV  356

Query  145  QAVIDADLLPKIIRNLSKGEFQTQKEAAWAISNLTISGNREQVARLIQEGVIPPFCNLLG  204
            QAVI+  LLPKII NLSKGEFQTQKEAAWAISNLTISGNREQV  LI+EGVIPPFC+LL 
Sbjct  357  QAVINVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLS  416

Query  205  CKDSQVIQVVLDGINNMLKLAGPQVEALANMIEECGGLDKIEGLQNHENVEIYKLAYDII  264
            C+D+QVI VVLDG+NNMLK+A   VEA+AN IEEC GL KIE LQ+HENVEIYKLAY+II
Sbjct  417  CQDTQVINVVLDGLNNMLKVADSHVEAVANCIEECEGLAKIERLQSHENVEIYKLAYEII  476

Query  265  EQYFSEDVEDDPNVAPQTSDSGYQFDPNT-SIPSDGFKF  302
            +QYF+++ E   N+AP +  + Y FDP+   +  + F F
Sbjct  477  DQYFTDEGEQT-NMAPSSDGAQYNFDPHADRLTMNSFNF  514


 Score = 62.8 bits (151),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 100/253 (40%), Gaps = 49/253 (19%)

Query  52   LCRNKDPPPPVQTIADILPAL-NMLIHHTDINVQTAALRAVGNIVTGTDEQTQVVLNCDA  110
            L  +K+PP      +DILP L   L  H    +Q  A  A+ NI +GT  QT  V+   A
Sbjct  94   LSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGA  153

Query  111  LSHFPALLTHQKEKICKEAVWFLSNITA------------GNQQQVQAVIDADLLPKIIR  158
            +  F  LL      +C++AVW L NI              G  Q + + I  D+    +R
Sbjct  154  VPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLR  213

Query  159  NLS-------------------------------KGEFQTQKEAAWAISNLTISGNREQV  187
            N++                                 +     +  WAIS LT  GN +Q+
Sbjct  214  NVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGN-DQI  272

Query  188  ARLIQEGVIPPFCNLLGCKDSQVIQVVLDGINNMLKLAGPQVEALANMIEECGGLDKIEG  247
              +I+ GV+P    LLG  + +V    L  + N++  +  Q + + N       L    G
Sbjct  273  QMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNY----DALSYFPG  328

Query  248  LQNHENVEIYKLA  260
            L +H   +I K A
Sbjct  329  LLSHPKEKIRKEA  341


>Q9UB78_DROME unnamed protein product
Length=514

 Score = 432 bits (1112),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 253/339 (75%), Gaps = 44/339 (13%)

Query  7    GNIIGDGPQLRDYVIGLGVVNPLLTFIKPDIPISFLRNVTWVIVNLCRNKDPPPPVQTIA  66
            GNIIGDGP LRD+VI  GVV PLL+FIKPDIPI+FLRNVTWVIVNLCRNKDP PP  TI 
Sbjct  177  GNIIGDGPFLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIH  236

Query  67   DILPALNMLIHHTDIN------------------------------------------VQ  84
            +ILPALN+LIHHTD N                                          VQ
Sbjct  237  EILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQ  296

Query  85   TAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHQKEKICKEAVWFLSNITAGNQQQV  144
            TAALRAVGNIVTG+DEQTQVVLN DALS+FP LL+H KEKI KEAVWFLSNITAGNQ QV
Sbjct  297  TAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQV  356

Query  145  QAVIDADLLPKIIRNLSKGEFQTQKEAAWAISNLTISGNREQVARLIQEGVIPPFCNLLG  204
            QAVI+  LLPKII NLSKGEFQTQKEAAWAISNLTISGNREQV  LI+EGVIPPFC+LL 
Sbjct  357  QAVINVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLS  416

Query  205  CKDSQVIQVVLDGINNMLKLAGPQVEALANMIEECGGLDKIEGLQNHENVEIYKLAYDII  264
            C+D+QVI VVLDG+NNMLK+A   VEA+AN IEEC GL KIE LQ+HENVEIYKLAY+II
Sbjct  417  CQDTQVINVVLDGLNNMLKVADSHVEAVANCIEECEGLAKIERLQSHENVEIYKLAYEII  476

Query  265  EQYFSEDVEDDPNVAPQTSDSGYQFDPNT-SIPSDGFKF  302
            +QYF+++ E   N+AP +  + Y FDP+   +  + F F
Sbjct  477  DQYFTDEGEQT-NMAPSSDGAQYNFDPHADRLTMNSFNF  514


 Score = 62.4 bits (150),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 100/253 (40%), Gaps = 49/253 (19%)

Query  52   LCRNKDPPPPVQTIADILPAL-NMLIHHTDINVQTAALRAVGNIVTGTDEQTQVVLNCDA  110
            L  +K+PP      +DILP L   L  H    +Q  A  A+ NI +GT  QT  V+   A
Sbjct  94   LSLDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGA  153

Query  111  LSHFPALLTHQKEKICKEAVWFLSNITA------------GNQQQVQAVIDADLLPKIIR  158
            +  F  LL      +C++AVW L NI              G  Q + + I  D+    +R
Sbjct  154  VPLFLQLLNSPAPNVCEQAVWALGNIIGDGPFLRDFVIKHGVVQPLLSFIKPDIPITFLR  213

Query  159  NLS-------------------------------KGEFQTQKEAAWAISNLTISGNREQV  187
            N++                                 +     +  WAIS LT  GN +Q+
Sbjct  214  NVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGN-DQI  272

Query  188  ARLIQEGVIPPFCNLLGCKDSQVIQVVLDGINNMLKLAGPQVEALANMIEECGGLDKIEG  247
              +I+ GV+P    LLG  + +V    L  + N++  +  Q + + N       L    G
Sbjct  273  QMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNY----DALSYFPG  328

Query  248  LQNHENVEIYKLA  260
            L +H   +I K A
Sbjct  329  LLSHPKEKIRKEA  341


>Q9V455_DROME unnamed protein product
Length=514

 Score = 432 bits (1111),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 253/339 (75%), Gaps = 44/339 (13%)

Query  7    GNIIGDGPQLRDYVIGLGVVNPLLTFIKPDIPISFLRNVTWVIVNLCRNKDPPPPVQTIA  66
            GNIIGDGP LRD+VI  GVV PLL+FIKPDIPI+FLRNVTWVIVNLCRNKDP PP  TI 
Sbjct  177  GNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLRNVTWVIVNLCRNKDPAPPTATIH  236

Query  67   DILPALNMLIHHTDIN------------------------------------------VQ  84
            +ILPALN+LIHHTD N                                          VQ
Sbjct  237  EILPALNVLIHHTDTNILVDTVWAISYLTDGGNDQIQMVIESGVVPKLIPLLGNSEVKVQ  296

Query  85   TAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHQKEKICKEAVWFLSNITAGNQQQV  144
            TAALRAVGNIVTG+DEQTQVVLN DALS+FP LL+H KEKI KEAVWFLSNITAGNQ QV
Sbjct  297  TAALRAVGNIVTGSDEQTQVVLNYDALSYFPGLLSHPKEKIRKEAVWFLSNITAGNQSQV  356

Query  145  QAVIDADLLPKIIRNLSKGEFQTQKEAAWAISNLTISGNREQVARLIQEGVIPPFCNLLG  204
            QAVI+  LLPKII NLSKGEFQTQKEAAWAISNLTISGNREQV  LI+EGVIPPFC+LL 
Sbjct  357  QAVINVGLLPKIIENLSKGEFQTQKEAAWAISNLTISGNREQVFTLIKEGVIPPFCDLLS  416

Query  205  CKDSQVIQVVLDGINNMLKLAGPQVEALANMIEECGGLDKIEGLQNHENVEIYKLAYDII  264
            C+D+QVI VVLDG+NNMLK+A   VEA+AN IEEC GL KIE LQ+HENVEIYKLAY+II
Sbjct  417  CQDTQVINVVLDGLNNMLKVADSHVEAVANCIEECEGLAKIERLQSHENVEIYKLAYEII  476

Query  265  EQYFSEDVEDDPNVAPQTSDSGYQFDPNT-SIPSDGFKF  302
            +QYF+++ E   N+AP +  + Y FDP+   +  + F F
Sbjct  477  DQYFTDEGEQT-NMAPTSDGAQYNFDPHADRLTMNSFNF  514


 Score = 62.8 bits (151),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 100/253 (40%), Gaps = 49/253 (19%)

Query  52   LCRNKDPPPPVQTIADILPAL-NMLIHHTDINVQTAALRAVGNIVTGTDEQTQVVLNCDA  110
            L  +K+PP      +DILP L   L  H    +Q  A  A+ NI +GT  QT  V+   A
Sbjct  94   LSSDKNPPINDLIQSDILPILVECLKQHNHTMLQFEAAWALTNIASGTSAQTNEVVAAGA  153

Query  111  LSHFPALLTHQKEKICKEAVWFLSNITA------------GNQQQVQAVIDADLLPKIIR  158
            +  F  LL      +C++AVW L NI              G  Q + + I  D+    +R
Sbjct  154  VPLFLQLLNSPAPNVCEQAVWALGNIIGDGPLLRDFVIKHGVVQPLLSFIKPDIPITFLR  213

Query  159  NLS-------------------------------KGEFQTQKEAAWAISNLTISGNREQV  187
            N++                                 +     +  WAIS LT  GN +Q+
Sbjct  214  NVTWVIVNLCRNKDPAPPTATIHEILPALNVLIHHTDTNILVDTVWAISYLTDGGN-DQI  272

Query  188  ARLIQEGVIPPFCNLLGCKDSQVIQVVLDGINNMLKLAGPQVEALANMIEECGGLDKIEG  247
              +I+ GV+P    LLG  + +V    L  + N++  +  Q + + N       L    G
Sbjct  273  QMVIESGVVPKLIPLLGNSEVKVQTAALRAVGNIVTGSDEQTQVVLNY----DALSYFPG  328

Query  248  LQNHENVEIYKLA  260
            L +H   +I K A
Sbjct  329  LLSHPKEKIRKEA  341



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold5846-size220886-augustus-gene-0.1-mRNA-1

Length=269
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01953_BOMMO  unnamed protein product                                 93.2    3e-22
TRYDT_DROME  unnamed protein product                                  92.4    4e-22
Q9VW19_DROME  unnamed protein product                                 85.9    5e-19


>O01953_BOMMO unnamed protein product
Length=284

 Score = 93.2 bits (230),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 104/191 (54%), Gaps = 16/191 (8%)

Query  57   TRIVNGVPASRDLLPYQAALFL---DGR-NFCGGSLISNSWILTAAHC----TANVGLVT  108
            TRIV G  A+    P+ A L +   +GR + CG SL++N+  +TAAHC     A     T
Sbjct  49   TRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQARQFT  108

Query  109  AHLGAVNLNADEDGQVAITTRGIINHANYNPRNLNNDVALIHLPGPVALSRHISLVSLPS  168
              LG  N+ +   G   +TT  +  H +YN   L+NDVA+I+    V  + +I  ++L S
Sbjct  109  LALGTANIFS---GGTRVTTSNVQMHGSYNMDTLHNDVAIIN-HNHVGFTNNIQRINLAS  164

Query  169  FSQVFESFANHQARASGWGRISDTANTIS-PHLNFVDLNVISNSICASTYGPDIVVPGTL  227
             S    +FA   A A+G+GR SD A+  +      V L VI+N++CA T+G ++++  TL
Sbjct  165  GS---NNFAGTWAWAAGFGRTSDAASGANNQQKRQVSLQVITNAVCARTFGNNVIIASTL  221

Query  228  CAAAPGGRSTC  238
            C     GRSTC
Sbjct  222  CVDGSNGRSTC  232


>TRYDT_DROME unnamed protein product
Length=253

 Score = 92.4 bits (228),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 95/189 (50%), Gaps = 8/189 (4%)

Query  53   PAISTRIVNGVPASRDLLPYQAALFLDGRNFCGGSLISNSWILTAAHCTANVGLVTAHLG  112
            P +  RIV G   +    P+Q +L   G + CGGS+ S++ I+TAAHC  +V      + 
Sbjct  25   PQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIR  84

Query  113  AVNLNADEDGQVAITTRGIINHANYNPRNLNNDVALIHLPGPVALSRHISLVSLPSFSQV  172
            A   +    G V  +     NH  YN   + ND+A+I + G +  S  I  + L S    
Sbjct  85   A-GSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLAS----  139

Query  173  FESFANHQARA-SGWGRISDTANTISPHLNFVDLNVISNSICA-STYGPDIVVPGTLCAA  230
              + AN  A + SGWG +S  +++I   L +V++N++S S CA STYG    +  T+  A
Sbjct  140  -SNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICA  198

Query  231  APGGRSTCN  239
            A  G+  C 
Sbjct  199  AASGKDACQ  207


>Q9VW19_DROME unnamed protein product
Length=408

 Score = 85.9 bits (211),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 70/229 (31%), Positives = 108/229 (47%), Gaps = 19/229 (8%)

Query  21   TAAQAAPSLDGNAVNIKPIIKYMPVLGGAPVYPAISTRIVNGVPASRDLLPYQAALFLDG  80
            T+ + +P +  +A   +P I   P   G  +      R+  G PA  D  P+ AAL  +G
Sbjct  136  TSNRFSPQVVTSADGDEPRIVNKPEQRGCGITSRQFPRLTGGRPAEPDEWPWMAALLQEG  195

Query  81   RNF--CGGSLISNSWILTAAHC--TANVGLVTAHLGAVNLNA-DEDGQVAITTRGIINHA  135
              F  CGG LI++  +LTAAHC    N   +   LG  N +  +E          ++ H 
Sbjct  196  LPFVWCGGVLITDRHVLTAAHCIYKKNKEDIFVRLGEYNTHMLNETRARDFRIANMVLHI  255

Query  136  NYNPRNLNNDVALIHLPGPVALSRHISLVSLPSFSQVFESFANHQARASGWGRISDTANT  195
            +YNP+N +ND+A++ +      + +I  V +P    V E +++  A  +GWG    T   
Sbjct  256  DYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPP---VNEDWSDRNAIVTGWG----TQKF  308

Query  196  ISPHLNF---VDLNVISNSICASTYGPDIVVPGT-LCAAAP-GGRSTCN  239
              PH N    V+L V   S C S++     VP T +CA  P GG+ +C 
Sbjct  309  GGPHSNILMEVNLPVWKQSDCRSSFVQH--VPDTAMCAGFPEGGQDSCQ  355



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold8912-size60967-augustus-gene-0.4-mRNA-1

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MSRA_DROME  unnamed protein product                                   146     3e-44
O02089_CAEEL  unnamed protein product                                 110     1e-30
Q57YH5_TRYB2  unnamed protein product                                 68.2    1e-14


>MSRA_DROME unnamed protein product
Length=246

 Score = 146 bits (369),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 93/133 (70%), Gaps = 2/133 (2%)

Query  43   SLLHNVDVPTKKATFAMGCFWGPDSLFGAMKGVIRTSVGYAGGSKKNPTYKSIGDHTEAI  102
            S +H+V+V    ATF MGCFWG +SL+GA +GV+RT+VGYAGGS   PTY+ +GDHTE +
Sbjct  30   SPVHDVNVTKATATFGMGCFWGAESLYGATRGVLRTTVGYAGGSSDLPTYRKMGDHTEVL  89

Query  103  DIDYDPKETSYEDLLKAFWANHD--PSSSYSKQYTSLILYHDAEQKELAEKILKEEEEKK  160
            +IDYDP   S+++LL  FW NH+   ++   +QY SLILYHD EQK++A     EE+E++
Sbjct  90   EIDYDPTVISFKELLDLFWNNHEYGLTTPIKRQYASLILYHDEEQKQVAHASKLEEQERR  149

Query  161  GKVFVTKVLQFKE  173
                +T  +  KE
Sbjct  150  APEIITTEIASKE  162


>O02089_CAEEL unnamed protein product
Length=207

 Score = 110 bits (276),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 74/111 (67%), Gaps = 1/111 (1%)

Query  53   KKATFAMGCFWGPDSLFGAMKGVIRTSVGYAGGSKKNPTYKSIGDHTEAIDIDYDPKETS  112
            ++A F + CFWG +S +  +KGV+ T VGYAGG + NPTYK+I DHTE  +I +DPK   
Sbjct  5    ERAYFGLQCFWG-ESAWAKLKGVVVTRVGYAGGKQPNPTYKNIKDHTEITEITFDPKVIE  63

Query  113  YEDLLKAFWANHDPSSSYSKQYTSLILYHDAEQKELAEKILKEEEEKKGKV  163
            Y  L   FW +H+P+    KQY S ILY + +QK++AE+ LK  ++K G +
Sbjct  64   YSKLTNFFWKHHNPAERRKKQYQSAILYVNDDQKKVAEETLKVAKDKHGDI  114


>Q57YH5_TRYB2 unnamed protein product
Length=177

 Score = 68.2 bits (165),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 15/118 (13%)

Query  51   PTKKATFAMGCFWGPDSLFGAMKG--VIRTSVGYAGGSKKNP--TYKSI--GD--HTEAI  102
            P   ATFA GCFWG +  F    G  +I   VG+ GG K+ P   Y+ +  GD  H E +
Sbjct  3    PNAVATFAAGCFWGTEHFFVRQFGAALISHKVGFMGG-KELPEMNYQLVKKGDTGHAEVL  61

Query  103  DIDYDPKETSYEDLLKAFWANHDPSS------SYSKQYTSLILYHDAEQKELAEKILK  154
             + Y+  E +Y+ LL  F+  H+P++          QY S I YH+ EQ+  AE  ++
Sbjct  62   QVTYNTNELTYDALLNFFFRMHNPTTLNRQEGDVGTQYRSTIFYHNEEQRNEAESFIE  119



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= maker-scaffold246-size1067647-augustus-gene-0.3-mRNA-1

Length=1236


***** No hits found *****



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


Query= augustus-scaffold8439-size76474-processed-gene-0.0-mRNA-1

Length=292
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VAQ3_DROME  unnamed protein product                                 165     6e-49
SNAK_DROME  unnamed protein product                                   168     6e-49
HAYAN_DROME  unnamed protein product                                  150     3e-41


>Q9VAQ3_DROME unnamed protein product
Length=319

 Score = 165 bits (418),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 107/280 (38%), Positives = 135/280 (48%), Gaps = 37/280 (13%)

Query  8    AELIVGGERANPKEFPHMAVIGFGDKK-NIEWLCGGSLISERFVLTAAHCVSAGNRGLAR  66
            A LI+GG  A PKEFPH A +G  D+   +EW CGG+LIS+R VLTAAHC     +G   
Sbjct  70   APLIIGGGPAVPKEFPHAARLGHKDENGEVEWFCGGTLISDRHVLTAAHC-HYSPQGSVN  128

Query  67   WVRLGDLNLANNNDDARPQQFAVAEHIRHPGYSAFSHYDDIALLRLDAGATFNAYVRPAC  126
              RLGDL    NNDDA P+ F V +   HP +S  + Y+DI+++RL    TFN Y  PAC
Sbjct  129  IARLGDLEFDTNNDDADPEDFDVKDFTAHPEFSYPAIYNDISVVRLSRPVTFNDYKHPAC  188

Query  127  LNADRSVALRYFLASGWGLTDWAEEEGSDDLMKVQLEAVSAATCSKAYRSLVGTRKLKFG  186
            L  D       F+A GWG  +      +  L KV+L          A R+     +L  G
Sbjct  189  LPFDDGRLGTSFIAIGWGQLEIVPRTENKKLQKVKLYNYGTRCRITADRN----DELPEG  244

Query  187  IQDDKMMCAGVAEGGKDTCRVSRQSTGEILPCRLSEVTSPYTVPPSWLQGDSGGPLQFVL  246
                  +C G  E  KDTC                              GDSGGP+    
Sbjct  245  YNATTQLCIGSNE-HKDTC-----------------------------NGDSGGPVLIYH  274

Query  247  KKPSCMYSVVGLTSFGSTVCGARNSPAVYTRVSHYLPWIE  286
                CMY V+G+TS G   C   + PA+YTRV  YL WI+
Sbjct  275  MDYPCMYHVMGITSIG-VACDTPDLPAMYTRVHFYLDWIK  313


>SNAK_DROME unnamed protein product
Length=435

 Score = 168 bits (425),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 154/289 (53%), Gaps = 43/289 (15%)

Query  7    SAELIVGGERANPKEFPHMAVIGF----GDK-KNIEWLCGGSLISERFVLTAAHCVSAGN  61
            S  LIVGG       FPHMA +G+    G K ++I+W CGG+L+SE +VLTAAHC ++G+
Sbjct  182  SVPLIVGGTPTRHGLFPHMAALGWTQGSGSKDQDIKWGCGGALVSELYVLTAAHCATSGS  241

Query  62   RGLARWVRLGDLNLANNNDDARPQQFAVAEHIRHPGYSAFSHYDDIALLRLDAGATFNAY  121
            +     VRLG   L  N   A  Q   +   + HP Y + ++Y DIALL+L     F+  
Sbjct  242  KP-PDMVRLGARQL--NETSATQQDIKILIIVLHPKYRSSAYYHDIALLKLTRRVKFSEQ  298

Query  122  VRPACLNADRSVALRYFLASGWGLTDWAEEEGSDDLMKVQLEAVSAATCSKAYRSLVGTR  181
            VRPACL     + +   +A+GWG T++   + S+ L +V L+ V   TC + YR     R
Sbjct  299  VRPACLWQLPELQIPTVVAAGWGRTEFLGAK-SNALRQVDLDVVPQMTCKQIYRK---ER  354

Query  182  KLKFGIQDDKMMCAGVAEGGKDTCRVSRQSTGEILPCRLSEVTSPYTVPPSWLQGDSGGP  241
            +L  GI + +  CAG   GG+DTC                             QGDSGGP
Sbjct  355  RLPRGIIEGQ-FCAGYLPGGRDTC-----------------------------QGDSGGP  384

Query  242  LQFVLKKPSCMYSVVGLTSFGSTVCGARNSPAVYTRVSHYLPWIEGIVW  290
            +  +L + +C+  VVG+TSFG   C A N+P VYTR+  YL WIE I +
Sbjct  385  IHALLPEYNCVAFVVGITSFGK-FCAAPNAPGVYTRLYSYLDWIEKIAF  432


>HAYAN_DROME unnamed protein product
Length=637

 Score = 150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 142/285 (50%), Gaps = 40/285 (14%)

Query  11   IVGGERANPKEFPHMAVIGFGDKKNIEWLCGGSLISERFVLTAAHCVSAGNRGLARWVRL  70
            I+ GER +   +PHMA I +    +  + CGGSLI+ RFVLTAAHCV++ +     +VRL
Sbjct  385  ILDGERVDRGVYPHMAAIAYNSFGSAAFRCGGSLIASRFVLTAAHCVNSDD-STPSFVRL  443

Query  71   GDLNLANNNDDARPQQFAVAEHIRHPGYSAFSHYDDIALLRLDAGATFNAYVRPACLNAD  130
            G LN+   N +   Q   V +   HP YS  S Y DIA+L+L   A  +  +RPACL  D
Sbjct  444  GALNI--ENPEPGYQDINVIDVQIHPDYSGSSKYYDIAILQLAEDAKESDVIRPACLYTD  501

Query  131  RS---VALRYFLASGWGLTDWAEEEGSDDLMKVQLEAVSAATCSKAY-RSLVGTRKLKFG  186
            RS      +YF+A GWG+ +      S  L++  L+ V A  C+ ++       R L+ G
Sbjct  502  RSDPPANYKYFVA-GWGVMNVTNRAVSKILLRAALDLVPADECNASFAEQPSANRTLRRG  560

Query  187  IQDDKMMCAGVAEGGKDTCRVSRQSTGEILPCRLSEVTSPYTVPPSWLQGDSGGPLQFVL  246
            +   + +CA      KD C                             QGDSGGPL   +
Sbjct  561  VIASQ-LCAADKNQRKDAC-----------------------------QGDSGGPLILEI  590

Query  247  KKPSCMYSVVGLTSFGSTVCGARNSPAVYTRVSHYLPWIEGIVWP  291
                  YS+VG+ S G     A  +P +YTRVS +L +IEGIVWP
Sbjct  591  DDVDGTYSIVGVISSG--FGCATKTPGLYTRVSSFLDYIEGIVWP  633



Lambda      K        H
   0.328    0.139    0.445 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1109162850


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold159-size1264154-augustus-gene-9.7-mRNA-1

Length=344
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KML1_DROME  unnamed protein product                                 47.0    1e-05
B7Z001_DROME  unnamed protein product                                 47.4    2e-05
Q9VQL7_DROME  unnamed protein product                                 47.0    2e-05


>Q7KML1_DROME unnamed protein product
Length=898

 Score = 47.0 bits (110),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query  229  SLVEVGTRTPCMAHVREVHPLYIIPGLQGPANSTAKALARKLTCPAIIVQMPGGI--DDL  286
            ++V++ T+ P  +   +  P++ I  ++G A S  + LA++L  PA  +Q    +  D L
Sbjct  628  AIVQLDTKAPANS---KQSPIFFISPIEGFA-SALEPLAKRLEVPAYGLQYTEAVPSDSL  683

Query  287  QENVAAIVQELTNLQQGGIYNIAGISCGGVYAIEVAKQLQARGEKTHVFLLDGLP  341
            +      +++L  +Q  G Y +AG S G +    +A  L+   E  +V +LDG P
Sbjct  684  ESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNEVANVIMLDGAP  738


>B7Z001_DROME unnamed protein product
Length=2540

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query  229   SLVEVGTRTPCMAHVREVHPLYIIPGLQGPANSTAKALARKLTCPAIIVQMPGGI--DDL  286
             ++V++ T+ P  +   +  P++ I  ++G A S  + LA++L  PA  +Q    +  D L
Sbjct  2270  AIVQLDTKAPANS---KQSPIFFISPIEGFA-SALEPLAKRLEVPAYGLQYTEAVPSDSL  2325

Query  287   QENVAAIVQELTNLQQGGIYNIAGISCGGVYAIEVAKQLQARGEKTHVFLLDGLP  341
             +      +++L  +Q  G Y +AG S G +    +A  L+   E  +V +LDG P
Sbjct  2326  ESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNEVANVIMLDGAP  2380


>Q9VQL7_DROME unnamed protein product
Length=2438

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/115 (28%), Positives = 59/115 (51%), Gaps = 6/115 (5%)

Query  229   SLVEVGTRTPCMAHVREVHPLYIIPGLQGPANSTAKALARKLTCPAIIVQMPGGI--DDL  286
             ++V++ T+ P  +   +  P++ I  ++G A S  + LA++L  PA  +Q    +  D L
Sbjct  2168  AIVQLDTKAPANS---KQSPIFFISPIEGFA-SALEPLAKRLEVPAYGLQYTEAVPSDSL  2223

Query  287   QENVAAIVQELTNLQQGGIYNIAGISCGGVYAIEVAKQLQARGEKTHVFLLDGLP  341
             +      +++L  +Q  G Y +AG S G +    +A  L+   E  +V +LDG P
Sbjct  2224  ESAAKFFIKQLRTVQPKGPYKLAGYSFGCLLTYVMAGILEETNEVANVIMLDGAP  2278



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold5323-size164559-augustus-gene-0.8-mRNA-1

Length=374
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ACE_DROME  unnamed protein product                                    237     1e-72
ACER_DROME  unnamed protein product                                   230     9e-70
ACN1_CAEEL  unnamed protein product                                   131     3e-33


>ACE_DROME unnamed protein product
Length=615

 Score = 237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/396 (34%), Positives = 201/396 (51%), Gaps = 75/396 (19%)

Query  1    MWAQSWDSLSDVVCPGKQ---LNLTAALNRKNYTVWDMARRAEDFYTSLGLDAMTPAFWK  57
            MWAQ W  ++D+V P  +   ++++A + ++ YT   M +  +DF+TS+ L  +   FW 
Sbjct  262  MWAQQWSEIADIVSPFPEKPLVDVSAEMEKQGYTPLKMFQMGDDFFTSMNLTKLPQDFWD  321

Query  58   HSVVGASSNA---TCHGTAANMMLL-------CAEVTAEDFYVINHEMGHIEYYMSYRDQ  107
             S++   ++     CH +A +  L        C  VT +  + ++HE+GHI+Y++ Y+ Q
Sbjct  322  KSIIEKPTDGRDLVCHASAWDFYLTDDVRIKQCTRVTQDQLFTVHHELGHIQYFLQYQHQ  381

Query  108  PVIFQDGANSAFQEAVGDAVMYGVLTPQHLQRLGLVDDDVAFSTASCEVALVCVDVDMEL  167
            P +++ GAN  F EAVGD +   V TP+HL+++GL+ D V                D E 
Sbjct  382  PFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVR---------------DDEA  426

Query  168  LLQQALAKPPQLQVTLNELHVASREVALVCVDVEMELLLQQALAKLPQLPFGLLVDKWRW  227
             + Q                                 L   AL K+  LPF   +DK+RW
Sbjct  427  RINQ---------------------------------LFLTALDKIVFLPFAFTMDKYRW  453

Query  228  AVFRGEVTPAEYNDAWWALRLSYQGVSPPVPRAADDFDPAAKY----------FLANFL-  276
            ++FRGEV  A +N A+W LR  Y G+ PPV R+  DFD  AKY          +L +F+ 
Sbjct  454  SLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAKYHISADVEYLRYLVSFII  513

Query  277  QMQIFKAMCEAAVLGRVGSRVRLQLPLHQCDIYGSKDAGKRLRAMMSLGSSRHWPDTLQA  336
            Q Q +K+ C  A  G+      ++LPL  CDIYGS  AG     M+S+G+S+ WPD L+A
Sbjct  514  QFQFYKSACIKA--GQYDPD-NVELPLDNCDIYGSAAAGAAFHNMLSMGASKPWPDALEA  570

Query  337  VAGTRDYSAGPLLEYYAPLSDWLEHQVRDNNIPVGW  372
              G R  S   + EY+ PL  WLE +   NN+ +GW
Sbjct  571  FNGERIMSGKAIAEYFEPLRVWLEAENIKNNVHIGW  606


>ACER_DROME unnamed protein product
Length=630

 Score = 230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 129/395 (33%), Positives = 197/395 (50%), Gaps = 74/395 (19%)

Query  1    MWAQSWDSLSDVVCPGKQ---LNLTAALNRKNYTVWDMARRAEDFYTSLGLDAMTPAFWK  57
            MW QSW+ L D+  P  +   +++ A + ++ YTV  +    + F+ SLG+ A+ P+FW 
Sbjct  271  MWGQSWNELLDLFTPYPEKPFVDVKAEMEKQGYTVQKLFELGDQFFQSLGMRALPPSFWN  330

Query  58   HSVVGA--SSNATCHGTAANM-------MLLCAEVTAEDFYVINHEMGHIEYYMSYRDQP  108
             SV+      +  CH +A +        + +C EV +  FYV++HE+GHI+YY+ Y  QP
Sbjct  331  LSVLTRPDDRHVVCHASAWDFYQDSDVRIKMCTEVDSHYFYVVHHELGHIQYYLQYEQQP  390

Query  109  VIFQDGANSAFQEAVGDAVMYGVLTPQHLQRLGLVDDDVAFSTASCEVALVCVDVDMELL  168
             +++   N  F EAVGD +   V++ +HL+ +GL+++                       
Sbjct  391  AVYRGAPNPGFHEAVGDVIALSVMSAKHLKAIGLIEN-----------------------  427

Query  169  LQQALAKPPQLQVTLNELHVASREVALVCVDVEMELLLQQALAKLPQLPFGLLVDKWRWA  228
                             L   SR          +  L +QAL+K+  LPFG  VDK+R+A
Sbjct  428  ---------------GRLDEKSR----------INQLFKQALSKIVFLPFGYAVDKYRYA  462

Query  229  VFRGEVTPAEYNDAWWALRLSYQGVSPPVPRAADDFDPAAK-----------YFLANFLQ  277
            VFR E+  +++N  +W +R  + GV PPV R   DFDP AK           YF A+  Q
Sbjct  463  VFRNELDESQWNCGFWQMRSEFGGVEPPVFRTEKDFDPPAKYHIDADVEYLRYFAAHIFQ  522

Query  278  MQIFKAMCEAAVLGRVGSRVRLQLPLHQCDIYGSKDAGKRLRAMMSLGSSRHWPDTLQAV  337
             Q  KA+C  A  G+       +L L  CDI+GSK AG+ L   +S G+SRHW + L+  
Sbjct  523  FQFHKALCRKA--GQYAPN-NSRLTLDNCDIFGSKAAGRSLSQFLSKGNSRHWKEVLEEF  579

Query  338  AGTRDYSAGPLLEYYAPLSDWLEHQVRDNNIPVGW  372
             G  +     LLEY+ PL  WL+ +     +P+GW
Sbjct  580  TGETEMDPAALLEYFEPLYQWLKQENSRLGVPLGW  614


>ACN1_CAEEL unnamed protein product
Length=906

 Score = 131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 93/375 (25%), Positives = 154/375 (41%), Gaps = 81/375 (22%)

Query  21   LTAALNRKNYTVWDMARRAEDFYTSLGLDAMTPAFWKHSVVGA--SSNATCHGTAANMML  78
            + +A N +NYT   M   A  ++ S G   +  ++W  S+     S +  CH  AA  M 
Sbjct  450  MLSAFNTQNYTTKKMFVTAYRYFKSAGFPHLPKSYWTSSIFARVWSKDMICHPAAALDMR  509

Query  79   L--------CAEVTAEDFYVINHEMGHIEYYMSYRDQPVIFQDGANSAFQEAVGDAVMYG  130
                     CA++   DF   +  +    Y   Y+DQ ++F++ A+    +A+ +A  + 
Sbjct  510  APNDFRVKACAQLGEPDFEQAHSLLVQTYYQYLYKDQSLLFREQASPVITDAIANAFAHL  569

Query  131  VLTPQHLQRLGLVDDDVAFSTASCEVALVCVDVDMELLLQQALAKPPQLQVTLNELHVAS  190
               P +L    LV  +              +D+   +++ +                   
Sbjct  570  STNPHYLYSQKLVPSE-------------HLDIKDSVIINK-------------------  597

Query  191  REVALVCVDVEMELLLQQALAKLPQLPFGLLVDKWRWAVFRGEVTPAEYNDAWWALRLSY  250
                          L +++L    +LPF +  D WR+ +F G V   + ND WW +R  Y
Sbjct  598  --------------LYKESLESFTKLPFTIAADNWRYELFDGTVPKNKLNDRWWEIRNKY  643

Query  251  QGVSPPVPRAADDFD------------PAAKYFLANFLQMQIFKAMCEAAVLGRVGSRVR  298
            +GV  P P    + D            PA +  ++  L+ QI KA+C    +   G    
Sbjct  644  EGVRSPQPYNTSNLDALIHNSVSQVHSPATRTLISYVLKFQILKALCPEGTILSEG----  699

Query  299  LQLPLHQCDIYGSKDAGKRLRAMMSLGSSRHWPDTLQAVAGTRDYSAGPLLEYYAPLSDW  358
                   C +  S+D  ++LR  M LGSS  W   L+ ++G  +  A PLLEYY PL +W
Sbjct  700  -------CIL--SEDTTEKLRETMKLGSSITWLKALEMISGKGELDAQPLLEYYEPLINW  750

Query  359  LEHQVRDNNIPVGWD  373
            L +    + + VGWD
Sbjct  751  LRNTNEIDQVVVGWD  765



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold17007-size14461-augustus-gene-0.1-mRNA-1

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDQ3_DROME  unnamed protein product                                 35.0    0.058
Q8SZN9_DROME  unnamed protein product                                 33.5    0.19 
Q7KSP5_DROME  unnamed protein product                                 33.5    0.19 


>Q9VDQ3_DROME unnamed protein product
Length=521

 Score = 35.0 bits (79),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 0/25 (0%)

Query  272  CTLCYKTFTYKKSLQKHLVIHAGSK  296
            C +C+KTFTY  +L+ H +IH G K
Sbjct  446  CDVCHKTFTYTNTLKFHKMIHTGEK  470


>Q8SZN9_DROME unnamed protein product
Length=380

 Score = 33.5 bits (75),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  271  ICTLCYKTFTYKKSLQKHLVIHAGSK  296
            +C +C K+F  K+ L  H+VIH+G K
Sbjct  293  VCNICMKSFKRKEQLTLHIVIHSGEK  318


>Q7KSP5_DROME unnamed protein product
Length=447

 Score = 33.5 bits (75),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  271  ICTLCYKTFTYKKSLQKHLVIHAGSK  296
            +C +C K+F  K+ L  H+VIH+G K
Sbjct  360  VCNICMKSFKRKEQLTLHIVIHSGEK  385



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold301-size1419381-augustus-gene-12.10-mRNA-1

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIN1_DROME  unnamed protein product                                   289     1e-91
SIN1_CAEEL  unnamed protein product                                   52.8    4e-07
SICK_DROME  unnamed protein product                                   35.0    0.16 


>SIN1_DROME unnamed protein product
Length=569

 Score = 289 bits (740),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 197/593 (33%), Positives = 305/593 (51%), Gaps = 158/593 (27%)

Query  1    MALYDNRHWLLSHSSNSFISSDDTGICEMVILGEEIP----RKFENQS------------  44
            MA Y N+HWLLSH  NSFIS+DDTG+CE V+L +++P    RKF N              
Sbjct  1    MATYSNQHWLLSHIRNSFISTDDTGMCETVMLSDDMPKHYLRKFGNSGAGGDHYHWRRAH  60

Query  45   -----------------------KLDY--YPGIDDSGDEDDAFDSLGQSFDIQTDIEFGA  79
                                   ++D+  YPG+D S DE+D       SFDIQ   E GA
Sbjct  61   KTPPTGGGTTPERNTRHPDAPLQEVDFICYPGLDLSDDEEDMS---THSFDIQMYPEVGA  117

Query  80   HRQRSNTAQRLEKMEQDRRRAALVKNVKWEWSPALLTDDERSSLFEKRDLKKDSGESKKV  139
            HR RSNTAQ+LEK++  +RRAA +K+V ++     +   E    F++++L     E  K 
Sbjct  118  HRFRSNTAQKLEKLDIAKRRAARIKSVNYQEE---VQPPESDDFFKRKELPLSKAERVKN  174

Query  140  K------------MQSLLSEQLEKSPDLPQNPFLEYAKYDGNALIGVATRKYGIFLTVLP  187
            +            +QS L+EQL KSP   QN F+E+A++DG + +G+ T++  +FL +LP
Sbjct  175  EPKANDDDLSDEGVQSQLTEQLAKSPKQAQNRFIEFARFDGTSQVGMQTKRINVFLNMLP  234

Query  188  PEQRNYPIHVTVVATAKVQDLVGLICWKCSLEHPDCKLKQGVEHYGLYIAEDDGEVDWDF  247
               RNYP+ + VVATAK+Q+++G +C++ SL++PD  LK  ++HY LY+ ED+ +++ DF
Sbjct  235  EPDRNYPLKICVVATAKIQEVIGFVCYRTSLQYPDVPLK-SLQHYALYMTEDNDDME-DF  292

Query  248  PCLEARETVAKFGFGFLAL-----------VEYTEKILQRERTEETYEVFNFLEDTALLE  296
            P L+ RE  +KFGF  L L           V+Y  ++  +  T         +ED   L 
Sbjct  293  PPLDNREPCSKFGFSQLTLAERRPLAPVTRVDYHSQLGSKSMTS--------VEDKTALS  344

Query  297  NAAKKAQMQEV--------------------DDL----QRMKGHMTAMEAPLYQSYRVNI  332
            +AA KA +Q +                    D++    +R+  H   +EAP+++++R+NI
Sbjct  345  DAAVKA-LQNISLNGGTSDPGGGGGGGDSPHDNVKEYEKRLLNHNDMLEAPMHRTFRLNI  403

Query  333  INKMRSKSEIHLEPLLAGVSGEKVEIDPVVQQKVSARFWNKQRAVSYDIDSVAACDLTET  392
            I+K   KS++ L     G+SGE++EID    Q  +A+FW +++ VS  ID VA C++ E 
Sbjct  404  IDKRFFKSDVTL-----GISGERIEID----QCKNAKFWPQKKPVSTPIDFVAHCEILE-  453

Query  393  KSNGRATFRL-------------ACHHAEPASQLGN------------------------  415
            + + +A  R+              C  A   + +                          
Sbjct  454  RRHLKALLRIWLKSNSSSPSFSTGCTSAPINASVTTLNAGSGSGGIAHSPSSPGHSSGLF  513

Query  416  ------FKQHDFEADQRTAEEIVRKINHILELRSSSVRKEYTALRERKAHRRR  462
                  FK +DF+ D  TAE+I  K+N ILE+RSS +R+E+   R+RK  +R+
Sbjct  514  SSSNIRFKHYDFDTDTHTAEQIHNKLNCILEMRSSDLRREFLLQRDRKQEKRQ  566


>SIN1_CAEEL unnamed protein product
Length=642

 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 69/132 (52%), Gaps = 4/132 (3%)

Query  142  QSLLSEQLEKSPDLPQNPFLEYAKYDGNALIGVATRKYGIFLTVLPPEQRNY-PIHVTVV  200
            +S +   LE++     NP  EY+K+   A     +R+  I + +   E+  +  + + V+
Sbjct  129  KSAIERYLEENSANLNNPLGEYSKF--AATTTDPSRQIEIIIPMSCDEEIGFKTLKIEVL  186

Query  201  ATAKVQDLVGLICWKCSLEHPDCKLKQGVEHYGLYIAEDDGEVDWDFPCLEARETVAKFG  260
             TA++++++G    +  L   D  L   V+ Y  Y+AE+DGE++ + P L++ + V + G
Sbjct  187  TTARIREVIGYCLLQYYLTF-DSYLPGEVDDYQFYLAEEDGEIEHELPPLDSSKLVGQVG  245

Query  261  FGFLALVEYTEK  272
            F  L LV   +K
Sbjct  246  FTCLGLVSRIKK  257


>SICK_DROME unnamed protein product
Length=2197

 Score = 35.0 bits (79),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query  312   RMKGHMTAMEAPLYQSYRVNIINKMRSKSEIHLEPLLAGVSGEKVEIDP  360
             +M G M+  E+P  QS R+N  N +RS     + P +   +GE VEI+P
Sbjct  1097  QMAGQMSGNESPYVQSPRMNRSNSIRSTKSEKMYPSMMSRAGE-VEIEP  1144



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold25723-size15449-augustus-gene-0.1-mRNA-1

Length=154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0D7_DROME  unnamed protein product                                 44.3    1e-05
RNF5_CAEEL  unnamed protein product                                   43.5    2e-05
Q9VSK2_DROME  unnamed protein product                                 43.1    3e-05


>Q9W0D7_DROME unnamed protein product
Length=299

 Score = 44.3 bits (103),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query  76   ECCICLERKPDVML-PCAHSYCLPCIQQWNVNNNTCPLCREFLDSDEA  122
            +C +CLE + D  L PC H +C  C+ +W    + CPLCRE L   + 
Sbjct  245  QCILCLEPRSDSSLTPCGHIFCWSCLLEWLEERDECPLCRESLKKSQV  292


>RNF5_CAEEL unnamed protein product
Length=235

 Score = 43.5 bits (101),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (57%), Gaps = 4/51 (8%)

Query  76   ECCICLERKPDVMLP-CAHSYCLPCIQQW---NVNNNTCPLCREFLDSDEA  122
            EC ICL+   D ++  C H +C PC+ QW     NN  CP+C+  +D ++ 
Sbjct  25   ECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNNQVCPVCKSAIDGNKV  75


>Q9VSK2_DROME unnamed protein product
Length=878

 Score = 43.1 bits (100),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 3/65 (5%)

Query  64   HEMAAAEGDKLTECCICLERKPDVML-PCAHSYCLPCIQQWNVNN--NTCPLCREFLDSD  120
            +E+    G     C IC E   D+ + PC H  C PC+  W V++    CP CR  +   
Sbjct  356  YELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVDSEGQGCPFCRAEIKGT  415

Query  121  EAWVI  125
            E  V+
Sbjct  416  EQIVV  420



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold4957-size181419-augustus-gene-0.2-mRNA-1

Length=387
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IF2B_DROME  unnamed protein product                                   344     2e-117
IF2B_CAEEL  unnamed protein product                                   227     1e-72 
Q57Z81_TRYB2  unnamed protein product                                 87.8    3e-19 


>IF2B_DROME unnamed protein product
Length=312

 Score = 344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 237/318 (75%), Gaps = 22/318 (7%)

Query  3    DEETIFDPSLKKKKKKKKTTFDIDAALAEGNAGDNNEAADQQATDKENQEPSKTDDFKDI  62
            D E  FDP+L KKKKKKKTTFD+DAAL      D+ +  D Q         +  +D    
Sbjct  2    DAEDGFDPTLLKKKKKKKTTFDLDAALG---LEDDTKKEDPQDEASAEGGAAAEED----  54

Query  63   DIDDGNLDLETFGKKKKKKKK-FNMDEIEGALPELSAKSNDLSMDVDGPQEDGQAEEDFD  121
                 NLDLE+FGKKKKKKKK FNMDEIE A+P             D    +   EE+ +
Sbjct  55   -----NLDLESFGKKKKKKKKPFNMDEIEAAIPSFGGD--------DVAASEEPEEEEIN  101

Query  122  LDMDFSTKTKKKKKKKKDLDELVAED-EKDAAEDTENVEGSQTAWFGVDRDYTYDELLTR  180
            LDMDFS   KKKK KKK+LDEL A+  + D +ED EN E + + WFG DRDYTYDELL R
Sbjct  102  LDMDFSMAKKKKKSKKKELDELFADQADDDKSEDKENDEDNSSTWFGSDRDYTYDELLKR  161

Query  181  VFDIMRDKNPDMVAGKKQKFVMRPPQVVRIGTKKTSFANFTEICKTLHRQPKHLLDFLLA  240
            VF+I+ DKNPDM AG+K KFVMRPPQV+R+GTKKTSFANF +I KTLHR PKHLLDFLLA
Sbjct  162  VFEIILDKNPDMAAGRKPKFVMRPPQVLRVGTKKTSFANFMDIAKTLHRLPKHLLDFLLA  221

Query  241  ELGTSGSVDGNNQLIIKGRFQQKQIENVLRRYIKEYVTCHTCRSPDTILQKDTRLFFLQC  300
            ELGTSGS+DGN QLIIKGRFQ KQIENVLRRYIKEYVTCHTCRSP+TILQKDTRLFFLQC
Sbjct  222  ELGTSGSMDGNQQLIIKGRFQPKQIENVLRRYIKEYVTCHTCRSPETILQKDTRLFFLQC  281

Query  301  ETCGSRCSVASIKSGFQA  318
            E+CGSRCSVASIKSGFQA
Sbjct  282  ESCGSRCSVASIKSGFQA  299


>IF2B_CAEEL unnamed protein product
Length=250

 Score = 227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 132/164 (80%), Gaps = 5/164 (3%)

Query  155  TENVEGSQTAWFGVDRDYTYDELLTRVFDIMRDKNPDMVAGKKQKFVMRPPQVVRIGTKK  214
             +N+  ++ AW     DYTY+E LT V+ +M+DKNPD  AG K+KF ++ P+V R G+KK
Sbjct  74   AQNLIDAKGAW----PDYTYEEALTLVYQVMKDKNPDF-AGDKKKFAIKLPEVARAGSKK  128

Query  215  TSFANFTEICKTLHRQPKHLLDFLLAELGTSGSVDGNNQLIIKGRFQQKQIENVLRRYIK  274
            T+F+NF EIC+ + RQ KH+L FLLAELGT+GS+DG+N LI+KGR+QQKQ E+VLR+YIK
Sbjct  129  TAFSNFLEICRLMKRQDKHVLQFLLAELGTTGSIDGSNCLIVKGRWQQKQFESVLRKYIK  188

Query  275  EYVTCHTCRSPDTILQKDTRLFFLQCETCGSRCSVASIKSGFQA  318
            EYV CHTC+SP+T L KDTRLFFLQC  CGSRCSV +IKSGF+A
Sbjct  189  EYVMCHTCKSPETQLTKDTRLFFLQCTNCGSRCSVTAIKSGFKA  232


>Q57Z81_TRYB2 unnamed protein product
Length=313

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 81/145 (56%), Gaps = 3/145 (2%)

Query  172  YTYDELLTRVFDIMRDKNPDMVAGKKQKFVMRPPQVVRIGTKKTSFANFTEICKTLHRQP  231
            YTY+++L R+F I  ++N +  +G  ++  +  PQV +I  KK    NF  IC+   R  
Sbjct  152  YTYNDMLQRIF-IALNRNKES-SGMSERNQLPVPQVEKISKKKVVIVNFRRICEVFSRPI  209

Query  232  KHLLDFLLAELGTSGSVDGNNQLIIKGRFQQ-KQIENVLRRYIKEYVTCHTCRSPDTILQ  290
            + + D++  EL   G++D N+ LI+K   Q+    + +L +Y+ EYV C++C   DT L 
Sbjct  210  EDVKDYIEKELSVGGNLDSNDSLILKYEIQKVTDFDKILIKYLDEYVKCNSCHKIDTTLT  269

Query  291  KDTRLFFLQCETCGSRCSVASIKSG  315
            K+ R   L+C  C +  SV ++ S 
Sbjct  270  KEGRRMELRCNWCTATRSVQAVGSA  294



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold719-size703734-augustus-gene-5.2-mRNA-1

Length=308
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q52V24_ASTLP  unnamed protein product                                 190     2e-59
STUB_DROME  unnamed protein product                                   166     6e-46
TRYDT_DROME  unnamed protein product                                  150     7e-44


>Q52V24_ASTLP unnamed protein product
Length=237

 Score = 190 bits (483),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 148/247 (60%), Gaps = 23/247 (9%)

Query  71   IVGGNQTTIQNYPYMVSVREDYEGLFESHTCGGSIISENFVVTAGHCCTDED---TSSLV  127
            IVGG   T+  +PY +S +E + G F  H CG SI +EN+ +TAGHC   +D    S L 
Sbjct  1    IVGGTDATLGEFPYQLSFQETFIG-FSFHFCGASIYNENYAITAGHCAYGDDYENPSGLQ  59

Query  128  VRVGNTDADQGEKHE----LSKIILHPDF-YELDSVPYNDICLLKVSKPFVYSDSIKPVK  182
            +  G  D    E  E    +SKIILH +F Y L     NDI LLK+S    ++D++ P+ 
Sbjct  60   IVAGELDMSVNEGSEQIITVSKIILHENFDYNLLD---NDISLLKLSGSLTFNDNVAPIA  116

Query  183  LPEANSEVSVGTLAVTSGWGSVYYDGDVVENLREVSVPIVSRSDCVTEYGKNKYGANYIN  242
            LPE     + G + VT GWG+    G+  + L++V+VP+VS  DC     +  YGA+ I 
Sbjct  117  LPE-QGHTATGDVIVT-GWGTTSEGGNTPDVLQKVTVPLVSDEDC-----RADYGADEIL  169

Query  243  DTMICAGFLQGGKDACQGDSGGPLAVSGT----LVGLVSWGAGCAEPKYAGVYTNVAYFR  298
            D+MICAG  +GGKD+CQGDSGGPLA S T    L G+VSWG GCA P Y GVYT V+Y  
Sbjct  170  DSMICAGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHV  229

Query  299  EWLKQEA  305
            +W+K  A
Sbjct  230  DWIKANA  236


>STUB_DROME unnamed protein product
Length=787

 Score = 166 bits (419),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 138/246 (56%), Gaps = 16/246 (7%)

Query  68   DGKIVGGNQTTIQNYPYMVSVRE-DYEGLFESHTCGGSIISENFVVTAGHCCTDEDTSSL  126
            + +IVGG       +P+ VSVR   + G   +H CGG++I+EN++ TAGHC  D   S +
Sbjct  541  ETRIVGGKSAAFGRWPWQVSVRRTSFFGFSSTHRCGGALINENWIATAGHCVDDLLISQI  600

Query  127  VVRVGNTDADQGEKHE------LSKIILHPDFYELDSVPYNDICLLKVSKPFVYSDSIKP  180
             +RVG  D    ++        ++K ++HP  Y   +  Y D+ L+K+ +P  ++  + P
Sbjct  601  RIRVGEYDFSHVQEQLPYIERGVAKKVVHPK-YSFLTYEY-DLALVKLEQPLEFAPHVSP  658

Query  181  VKLPEANSEVSVGTLAVTSGWGSVYYDGDVVENLREVSVPIVSRSDCVTEYGKNKYGANY  240
            + LPE +S + +G  A  +GWG +   G +   L+EVSVPIVS  +C + + +      +
Sbjct  659  ICLPETDSLL-IGMNATVTGWGRLSEGGTLPSVLQEVSVPIVSNDNCKSMFMRAGR-QEF  716

Query  241  INDTMICAGFLQGGKDACQGDSGGPLAVSGT-----LVGLVSWGAGCAEPKYAGVYTNVA  295
            I D  +CAG+  GG+D+CQGDSGGPL          L G++SWG GCAE    GV T ++
Sbjct  717  IPDIFLCAGYETGGQDSCQGDSGGPLQAKSQDGRFFLAGIISWGIGCAEANLPGVCTRIS  776

Query  296  YFREWL  301
             F  W+
Sbjct  777  KFTPWI  782


>TRYDT_DROME unnamed protein product
Length=253

 Score = 150 bits (380),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 138/243 (57%), Gaps = 18/243 (7%)

Query  66   HLDGKIVGGNQTTIQNYPYMVSVREDYEGLFESHTCGGSIISENFVVTAGHCCTDEDTSS  125
             LDG+IVGG+ TTI ++P+ +S++        SH+CGGSI S N +VTA HC      S 
Sbjct  26   QLDGRIVGGSATTISSFPWQISLQRS-----GSHSCGGSIYSSNVIVTAAHCLQSVSASV  80

Query  126  LVVRVGNTD-ADQGEKHELSKIILHPDFYELDSVPYNDICLLKVSKPFVYSDSIKPVKLP  184
            L +R G++  +  G    +S    H  +     V  NDI ++K++    +S +IK + L 
Sbjct  81   LQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV--NDIAIIKINGALTFSSTIKAIGL-  137

Query  185  EANSEVSVGTLAVTSGWGSVYY-DGDVVENLREVSVPIVSRSDCVTE-YGKNKYGANYIN  242
             A+S  + G  A  SGWG++ Y    +   L+ V+V IVS+S C +  YG   YG+  I 
Sbjct  138  -ASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG---YGSQ-IR  192

Query  243  DTMICAGFLQGGKDACQGDSGGPLAVSGTLVGLVSWGAGCAEPKYAGVYTNVAYFREWLK  302
             TMICA     GKDACQGDSGGPL   G LVG+VSWG GCA   Y GVY +VA  R W+ 
Sbjct  193  STMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI  250

Query  303  QEA  305
              A
Sbjct  251  SNA  253



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold13414-size18530-augustus-gene-0.0-mRNA-1

Length=176
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MYO7A_DROME  unnamed protein product                                  207     3e-62
HUM6_CAEEL  unnamed protein product                                   167     2e-48
Q8IPH6_DROME  unnamed protein product                                 157     1e-44


>MYO7A_DROME unnamed protein product
Length=2167

 Score = 207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 130/162 (80%), Gaps = 3/162 (2%)

Query  4    VFDRNLCCRQLRYSGMMETAKIRRAGFPIRHGFKEFVYRYRMLVPGIPHASKTDCREATI  63
            +FDR LCCRQLRYSGMMET +IRRAG+PIRHGF+EFV RYR L+PG+P A +TDC+ AT 
Sbjct  640  MFDRGLCCRQLRYSGMMETIRIRRAGYPIRHGFREFVERYRFLIPGVPPAHRTDCQAATS  699

Query  64   KICAAVLGSGGAEIYQLGKTKVFLKDAHDTILEQQREQVLAKSILILQRSIKTWVYRRRF  123
            +ICA VLG      YQLG TKVFLKDAHD  LEQ+R++VL + ILILQRSI+ WVYRRRF
Sbjct  700  RICAVVLGKSD---YQLGHTKVFLKDAHDLFLEQERDRVLTRKILILQRSIRGWVYRRRF  756

Query  124  LRQRKAAIVFQKYWRGRKPRQHFLCIRKGYLRLQALIRSRLL  165
            LR R AAI  Q++W+G   R+ +  +R GY+RLQALIRSR+L
Sbjct  757  LRLRAAAITVQRFWKGYAQRKRYRNMRVGYMRLQALIRSRVL  798


>HUM6_CAEEL unnamed protein product
Length=2098

 Score = 167 bits (424),  Expect = 2e-48, Method: Composition-based stats.
 Identities = 82/167 (49%), Positives = 114/167 (68%), Gaps = 3/167 (2%)

Query  4    VFDRNLCCRQLRYSGMMETAKIRRAGFPIRHGFKEFVYRYRMLVPGIPH-ASKTDCREAT  62
            V DR+L  RQLRYSGMMET KIRR+G+PIRH +  FV+RYR+LV  I    ++ D  +A 
Sbjct  637  VMDRDLVLRQLRYSGMMETIKIRRSGYPIRHDYYPFVFRYRVLVSSIQGPVNRIDLHDAA  696

Query  63   IKICAAVLGSGGAEIYQLGKTKVFLKDAHDTILEQQREQVLAKSILILQRSIKTWVYRRR  122
             KIC  +LG+     YQLGKTKVFLKD HD +LEQ+  ++L    +++Q++++ W+ R+ 
Sbjct  697  KKICHMILGTNAD--YQLGKTKVFLKDKHDLVLEQEYYRILKDKAIVIQKNVRRWLVRKD  754

Query  123  FLRQRKAAIVFQKYWRGRKPRQHFLCIRKGYLRLQALIRSRLLRSSY  169
            F +QR+AA+  Q  WRG   R+ +  I  G+ RLQA++RSR L S Y
Sbjct  755  FEKQRQAAVTIQTAWRGFDQRKRYRQIISGFSRLQAVLRSRQLVSHY  801


>Q8IPH6_DROME unnamed protein product
Length=1033

 Score = 157 bits (396),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 110/165 (67%), Gaps = 2/165 (1%)

Query  5    FDRNLCCRQLRYSGMMETAKIRRAGFPIRHGFKEFVYRYRMLVPGIPHASKTDCREATIK  64
            FD+ LC RQLRYSGMMETA+IRRAG+PIRH ++ FV RYR+LVP +    + DCR+   +
Sbjct  644  FDKELCVRQLRYSGMMETARIRRAGYPIRHAYRAFVERYRLLVPPVGPLEQCDCRKLARQ  703

Query  65   ICAAVLGSGGAEIYQLGKTKVFLKDAHDTILEQQREQVLAKSILILQRSIKTWVYRRRFL  124
            IC   L +     Y  GKTK+FL+D  D  LE QR Q++ KSI+ +QR I+  ++RR   
Sbjct  704  ICEVALPADSDRQY--GKTKLFLRDEDDASLELQRSQLMLKSIVTIQRGIRRVLFRRYMK  761

Query  125  RQRKAAIVFQKYWRGRKPRQHFLCIRKGYLRLQALIRSRLLRSSY  169
            R R+A I  Q+YWRGR  R+ +  +R+G+ RL A I ++ L + +
Sbjct  762  RYREAIITVQRYWRGRLQRRKYQVMRQGFHRLGACIAAQQLTTKF  806



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= augustus-scaffold8883-size67267-processed-gene-0.1-mRNA-1

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLR8_DROME  unnamed protein product                                 335     2e-108
Q95SK1_DROME  unnamed protein product                                 318     2e-101
Q9V9U2_DROME  unnamed protein product                                 318     2e-101


>Q9VLR8_DROME unnamed protein product
Length=600

 Score = 335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 191/498 (38%), Positives = 285/498 (57%), Gaps = 26/498 (5%)

Query  12   FGWADYTAFGLMVAVSTIVGTLIGLCGKQDTKVD-------------------------Y  46
            FG  DY  F  M+ +ST  G   G   K   K++                         Y
Sbjct  14   FGSVDYAVFLGMIVLSTSTGIYFGCIKKSKVKLEEAEPTLPTTTPKRRKHDFGSEKMSEY  73

Query  47   LLGGRSMKVLPIAVSLVFSSISGVSMIGVPTEVYTHGTQYYAIAFSLVIACVINNYVFLP  106
            LLG R++KV P+A+SL+ S ISGV+++G  +E+Y +GTQY+ IA ++++  +  +YV++P
Sbjct  74   LLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGTQYWFIAIAIMLQGIAVSYVYIP  133

Query  107  VFFDLKLTSTYEYLEMRFNKQVRFLVSLLFDLSIFLYIPIAIYVPALAFNQVSGIDLHIA  166
            VF  L++ S+YEYLEMRF+  VR + S +F L   L++P  +YVPA+A NQVSGI+LH+ 
Sbjct  134  VFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIALNQVSGINLHVI  193

Query  167  TLTVPVTCIVYTTLGGLKAVVWTDFLQSFVTVGSSVIIIAIGVAHVGGIGEVFDRSYEGQ  226
             + + V C+ YT +GG+KAVV TD  Q  V   S + +  +   +  G+  +FD + +G 
Sbjct  194  AVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLNVLFDDAAKGG  253

Query  227  RLELFNFDPSPLARNTFWTVTVGMTFAWLSSMAASQGMVQKIIALPDIHSARKSIYWFCA  286
            RL   N +PSP  R+T W+V +G    W S  A +Q MVQ+ ++LP +  AR S+  F  
Sbjct  254  RLIFNNTNPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYMSLPSLKKARASMAIFTI  313

Query  287  GNILMKSVMMMTGLTIYATYFECDPISTKQVRKADQVVPYFVMDTVGSIPGLPGLFIAGI  346
            G     SV    GL IY  Y +CDP+S   +   DQ++P FV+ +VG I G+ GLFIAGI
Sbjct  314  GVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQSVGHIYGMSGLFIAGI  373

Query  347  FSAALSTMSSELNSLSATVYEDFLLPCVKRKKNLERNAHIALKIIVVVFGALCVLMVYIV  406
            F AALS++S  LNS S  + ED +  C K + + ER + I +K  V+V G + + +V+++
Sbjct  374  FGAALSSLSVVLNSTSLVILEDIVRGCFKMQPS-ERASTILVKSTVIVLGFVALSLVFVL  432

Query  407  EHMGTVFDVSMSINGVTQGIFLGVYCLGMIFPWANEKGVMAGTICSIIVMSWIIFGAGKA  466
            E +  +  +  S+  +  G   G++ LGM+ PWAN  G   G I S ++  WI FG    
Sbjct  433  EQLSGILSICTSMTAIAAGTTFGLFTLGMLVPWANTVGTAVGGIASALLAGWISFGTQFT  492

Query  467  AADDLLTYPYLPMSTDGC  484
             A   L    LP+S +GC
Sbjct  493  IAAGELNSQKLPVSVEGC  510


>Q95SK1_DROME unnamed protein product
Length=622

 Score = 318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/477 (37%), Positives = 285/477 (60%), Gaps = 5/477 (1%)

Query  10   VYFGWADYTAFGLMVAVSTIVGTLIGLCGK-QDTKVDYLLGGRSMKVLPIAVSLVFSSIS  68
            ++F   DY  F LM++ S  +G   G   K ++T  +YL GG+ M  LP+A+SLV S +S
Sbjct  23   LHFSLTDYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSSQLS  82

Query  69   GVSMIGVPTEVYTHGTQYYAIAFSLVIACVINNYVFLPVFFDLKLTSTYEYLEMRFNKQV  128
            GV+M+ VP E Y+ G     + +++V++  +  Y+ +PVF+D  +++ YEYLE+RF+K+ 
Sbjct  83   GVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRT  142

Query  129  RFLVSLLFDLSIFLYIPIAIYVPALAFNQVSGIDLHIATLTVPVTCIVYTTLGGLKAVVW  188
            R LV++ F L+ FL +P+ ++VP+LAF+QV+G ++H+    V   C+ YT LGG+KAVVW
Sbjct  143  RQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVW  202

Query  189  TDFLQSFVTVGSSVIIIAIGVAHVGGIGEVFDRSYEGQRLELFNFDPSPLARNTFWTVTV  248
            TD +Q  V + S V++  +G ++ GGI  V + + EG R + F+F   P  R TF +   
Sbjct  203  TDVVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFD-FSFGIDPRLRLTFISGMA  261

Query  249  GMTFAWLSSMAASQGMVQKIIALPDIHSARKSIYWFCAGNILMKSVMMMTGLTIYATYFE  308
                 W   +   Q  VQ+I++LP    A++ +     G +L+ S    TG+ ++A Y+ 
Sbjct  262  SGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAYYYG  321

Query  309  CDPISTKQVRKADQVVPYFVMDTVGSIPGLPGLFIAGIFSAALSTMSSELNSLSATVYED  368
            CDPI    V K D+++P+F+ D +G + G+PG+FI+ +FSA+LS++S+ LNS +  VY D
Sbjct  322  CDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFD  381

Query  369  FLLPCVKRKKNLERNAHIALKIIVVVFGALCVLMVYIVEHMGTVFDVSMSINGVTQGIFL  428
            ++ P   R  + E  A+  +K+++VV GA C++  +IV++  ++     +I G+  G  +
Sbjct  382  YIKP---RINHSEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGINMGAVV  438

Query  429  GVYCLGMIFPWANEKGVMAGTICSIIVMSWIIFGAGKAAADDLLTYPYLPMSTDGCS  485
            GV+CLGM  P  N K  ++G   S +VM WII          L+ Y  LP   D C 
Sbjct  439  GVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMNLKAGLIKYDPLPNGLDQCE  495


>Q9V9U2_DROME unnamed protein product
Length=622

 Score = 318 bits (814),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 175/477 (37%), Positives = 285/477 (60%), Gaps = 5/477 (1%)

Query  10   VYFGWADYTAFGLMVAVSTIVGTLIGLCGK-QDTKVDYLLGGRSMKVLPIAVSLVFSSIS  68
            ++F   DY  F LM++ S  +G   G   K ++T  +YL GG+ M  LP+A+SLV S +S
Sbjct  23   LHFSLTDYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSSQLS  82

Query  69   GVSMIGVPTEVYTHGTQYYAIAFSLVIACVINNYVFLPVFFDLKLTSTYEYLEMRFNKQV  128
            GV+M+ VP E Y+ G     + +++V++  +  Y+ +PVF+D  +++ YEYLE+RF+K+ 
Sbjct  83   GVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRT  142

Query  129  RFLVSLLFDLSIFLYIPIAIYVPALAFNQVSGIDLHIATLTVPVTCIVYTTLGGLKAVVW  188
            R LV++ F L+ FL +P+ ++VP+LAF+QV+G ++H+    V   C+ YT LGG+KAVVW
Sbjct  143  RQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVW  202

Query  189  TDFLQSFVTVGSSVIIIAIGVAHVGGIGEVFDRSYEGQRLELFNFDPSPLARNTFWTVTV  248
            TD +Q  V + S V++  +G ++ GGI  V + + EG R + F+F   P  R TF +   
Sbjct  203  TDVVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFD-FSFGIDPRLRLTFISGMA  261

Query  249  GMTFAWLSSMAASQGMVQKIIALPDIHSARKSIYWFCAGNILMKSVMMMTGLTIYATYFE  308
                 W   +   Q  VQ+I++LP    A++ +     G +L+ S    TG+ ++A Y+ 
Sbjct  262  SGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAYYYG  321

Query  309  CDPISTKQVRKADQVVPYFVMDTVGSIPGLPGLFIAGIFSAALSTMSSELNSLSATVYED  368
            CDPI    V K D+++P+F+ D +G + G+PG+FI+ +FSA+LS++S+ LNS +  VY D
Sbjct  322  CDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFD  381

Query  369  FLLPCVKRKKNLERNAHIALKIIVVVFGALCVLMVYIVEHMGTVFDVSMSINGVTQGIFL  428
            ++ P   R  + E  A+  +K+++VV GA C++  +IV++  ++     +I G+  G  +
Sbjct  382  YIKP---RINHSEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGINMGAVV  438

Query  429  GVYCLGMIFPWANEKGVMAGTICSIIVMSWIIFGAGKAAADDLLTYPYLPMSTDGCS  485
            GV+CLGM  P  N K  ++G   S +VM WII          L+ Y  LP   D C 
Sbjct  439  GVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMNFKAGLIKYDPLPNGLDQCE  495



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold1179-size556351-augustus-gene-2.4-mRNA-1

Length=541
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8JUR0_DROME  unnamed protein product                                 228     2e-67
Q9VWJ2_DROME  unnamed protein product                                 177     3e-49
Q6AWN8_DROME  unnamed protein product                                 139     1e-35


>A8JUR0_DROME unnamed protein product
Length=563

 Score = 228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 166/527 (31%), Positives = 253/527 (48%), Gaps = 84/527 (16%)

Query  35   GVARATMEN---GGPAEQPPEED----HAPEGGWGWIVALGMSVMFTVVVGPMGSFGLVF  87
            G+   T+E+     PA Q  +       AP+GGWG +V +GM++ FT  +  + SFGLVF
Sbjct  5    GIVWLTIEHRLQSRPAYQMKKSKSYTLEAPDGGWGILVCIGMALPFTSALAALPSFGLVF  64

Query  88   GEFLEDVGGGTQAFTLINSVFVTALSFTGLVTNFTMKEFSCRQVAVTGCLIAFTGNILAI  147
            GEFL+ +G  T A  +I S F +++SF GL +    + F  RQV VTG ++ F G  + +
Sbjct  65   GEFLKSIGAETSAMAIITSAFFSSMSFAGLFSGSLFQRFGMRQVGVTGGILYFLGTGMQL  124

Query  148  FATSVNYMVVTYGIVQAQKRKGIVREEGTLAGVGFGLMITPSFTAFNTYFIRRRNFAMGL  207
            FATS  ++++ + +VQ               G  FGLM+   +T FN YF++ R   M  
Sbjct  125  FATSTLHLIMAFSVVQ---------------GFAFGLMVPTCYTTFNHYFVKNRVMWMSF  169

Query  208  SQ--------------------------IAVLTALGLHALPAMMTYQPVSWHMPARRGSP  241
            +Q                          + +LT L  HA+  M+   PV WHM  RR   
Sbjct  170  AQTLIGLGSMLYPIVMQKLMSWYGFRGCLLILTGLNAHAVFGMLVMHPVEWHM--RRVPI  227

Query  242  LLSAQDKVKTAAETT-----------ADLEKAVGNHDQEEAKKLLNQEQQSP---AGHDE  287
                Q+++K  + T            A  E+   +     A+KL + E+Q     +    
Sbjct  228  QPEEQEELKELSPTVVIRVQPETPLKATREEPNFHTADPGARKLSHAEEQMLKVLSSRAS  287

Query  288  QVESGDKWRKSFV-----EERGRSYNTTPRTSVDSVPVSSVLVLGHRGSSAPPPRVDDKT  342
             + S   W    V      +   S  T+ R S          + G  G+ AP      K+
Sbjct  288  SITSLGNWSGPVVVSDASPQMMHSLQTSRRPST---------IAGASGAVAPA-HATKKS  337

Query  343  YSRMTIAEKVVDFFDLKLMQDPVYVSIAMGLSAAMVADMSFFNVLPVYLAHLGVAQVDIA  402
            + R      +VDF DL L++ P++V+I +G++ A+ +D++FF + PVYL  LG ++ D A
Sbjct  338  WVR-----TIVDFLDLTLLKKPIFVNIVLGITFALYSDITFFTMQPVYLFELGYSRPDTA  392

Query  403  VCIAVGAACDLGGRVALALLGLVLVVDSRTLVLIGLVFTIIFRTVFIFYTDYIYLTIFTG  462
              IA+GAA DL  R+ LA+  + + V SR + L G VFT+  R  F   T ++ +   T 
Sbjct  393  TIIAIGAAADLASRIFLAITAVCIQVPSRYIYLAGAVFTVFARFAFNGITQFVGMACITA  452

Query  463  FISIFRPFLLIELPLVFAEYCSLQRFPSAYGLFMITSGMFALTLGPI  509
             I   R +L + LPLVFA+Y   +RF + YGLFM   G     +GPI
Sbjct  453  VIGFLRTWLHVPLPLVFADYLPKERFATGYGLFMFIQGNAMFLIGPI  499


>Q9VWJ2_DROME unnamed protein product
Length=486

 Score = 177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 136/452 (30%), Positives = 210/452 (46%), Gaps = 77/452 (17%)

Query  103  LINSVFVTALSFTGLVTNFTMKEFSCRQVAVTGCLIAFTGNILAIFATSVNYMVVTYGIV  162
            +I S F +++SF GL +    + F  RQV VTG ++ F G  + +FATS  ++++ + +V
Sbjct  3    IITSAFFSSMSFAGLFSGSLFQRFGMRQVGVTGGILYFLGTGMQLFATSTLHLIMAFSVV  62

Query  163  QAQKRKGIVREEGTLAGVGFGLMITPSFTAFNTYFIRRRNFAMGLSQ-------------  209
            Q               G  FGLM+   +T FN YF++ R   M  +Q             
Sbjct  63   Q---------------GFAFGLMVPTCYTTFNHYFVKNRVMWMSFAQTLIGLGSMLYPIV  107

Query  210  -------------IAVLTALGLHALPAMMTYQPVSWHMPARRGSPLLSAQDKVKTAAETT  256
                         + +LT L  HA+  M+   PV WHM  RR       Q+++K  + T 
Sbjct  108  MQKLMSWYGFRGCLLILTGLNAHAVFGMLVMHPVEWHM--RRVPIQPEEQEELKELSPTV  165

Query  257  -----------ADLEKAVGNHDQEEAKKLLNQEQQSP---AGHDEQVESGDKWRKSFV--  300
                       A  E+   +     A+KL + E+Q     +     + S   W    V  
Sbjct  166  VIRVQPETPLKATREEPNFHTADPGARKLSHAEEQMLKVLSSRASSITSLGNWSGPVVVS  225

Query  301  ---EERGRSYNTTPRTSVDSVPVSSVLVLGHRGSSAPPPRVDDKTYSRMTIAEKVVDFFD  357
                +   S  T+ R S          + G  G+ AP      K++ R      +VDF D
Sbjct  226  DASPQMMHSLQTSRRPST---------IAGASGAVAPA-HATKKSWVR-----TIVDFLD  270

Query  358  LKLMQDPVYVSIAMGLSAAMVADMSFFNVLPVYLAHLGVAQVDIAVCIAVGAACDLGGRV  417
            L L++ P++V+I +G++ A+ +D++FF + PVYL  LG ++ D A  IA+GAA DL  R+
Sbjct  271  LTLLKKPIFVNIVLGITFALYSDITFFTMQPVYLFELGYSRPDTATIIAIGAAADLASRI  330

Query  418  ALALLGLVLVVDSRTLVLIGLVFTIIFRTVFIFYTDYIYLTIFTGFISIFRPFLLIELPL  477
             LA+  + + V SR + L G VFT+  R  F   T ++ +   T  I   R +L + LPL
Sbjct  331  FLAITAVCIQVPSRYIYLAGAVFTVFARFAFNGITQFVGMACITAVIGFLRTWLHVPLPL  390

Query  478  VFAEYCSLQRFPSAYGLFMITSGMFALTLGPI  509
            VFA+Y   +RF + YGLFM   G     +GPI
Sbjct  391  VFADYLPKERFATGYGLFMFIQGNAMFLIGPI  422


>Q6AWN8_DROME unnamed protein product
Length=462

 Score = 139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/388 (29%), Positives = 177/388 (46%), Gaps = 77/388 (20%)

Query  103  LINSVFVTALSFTGLVTNFTMKEFSCRQVAVTGCLIAFTGNILAIFATSVNYMVVTYGIV  162
            +I S F +++SF GL +    + F  RQV VTG ++ F G  + +FATS  ++++ + +V
Sbjct  3    IITSAFFSSMSFAGLFSGSLFQRFGMRQVGVTGGILYFLGTGMQLFATSTLHLIMAFSVV  62

Query  163  QAQKRKGIVREEGTLAGVGFGLMITPSFTAFNTYFIRRRNFAMGLSQ-------------  209
            Q               G  FGLM+   +T FN YF++ R   M  +Q             
Sbjct  63   Q---------------GFAFGLMVPTCYTTFNHYFVKNRVMWMSFAQTLIGLGSMLYPIV  107

Query  210  -------------IAVLTALGLHALPAMMTYQPVSWHMPARRGSPLLSAQDKVKTAAETT  256
                         + +LT L  HA+  M+   PV WHM  RR       Q+++K  + T 
Sbjct  108  MQKLMSWYGFRGCLLILTGLNAHAVFGMLVMHPVEWHM--RRVPIQPEEQEELKELSPTV  165

Query  257  -----------ADLEKAVGNHDQEEAKKLLNQEQQSP---AGHDEQVESGDKWRKSFV--  300
                       A  E+   +     A+KL + E+Q     +     + S   W    V  
Sbjct  166  VIRVQPETPLKATREEPNFHTADPGARKLSHAEEQMLKVLSSRASSITSLGNWSGPVVVS  225

Query  301  ---EERGRSYNTTPRTSVDSVPVSSVLVLGHRGSSAPPPRVDDKTYSRMTIAEKVVDFFD  357
                +   S  T+ R S          + G  G+ AP      K++ R      +VDF D
Sbjct  226  DASPQMMHSLQTSRRPST---------IAGASGAVAPA-HATKKSWVR-----TIVDFLD  270

Query  358  LKLMQDPVYVSIAMGLSAAMVADMSFFNVLPVYLAHLGVAQVDIAVCIAVGAACDLGGRV  417
            L L++ P++V+I +G++ A+ +D++FF + PVYL  LG ++ D A  IA+GAA DL  R+
Sbjct  271  LTLLKKPIFVNIVLGITFALYSDITFFTMQPVYLFELGYSRPDTATIIAIGAAADLASRI  330

Query  418  ALALLGLVLVVDSRTLVLIGLVFTIIFR  445
             LA+  + + V SR + L G VFT+  R
Sbjct  331  FLAITAVCIQVPSRYIYLAGAVFTVFAR  358



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold1633-size589899-augustus-gene-3.6-mRNA-1

Length=199
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CADH3_CAEEL  unnamed protein product                                  30.8    0.80 


>CADH3_CAEEL unnamed protein product
Length=3343

 Score = 30.8 bits (68),  Expect = 0.80, Method: Composition-based stats.
 Identities = 26/84 (31%), Positives = 42/84 (50%), Gaps = 9/84 (11%)

Query  29    IFVKV-EVKDEIDVFEEPVEYKTLSPQSAA------VSDTHSSNN-QLRHKVKGLSADAA  80
             +FV V +V D   +FE+P EY  +S +++A       SD  S NN ++R+ V        
Sbjct  2231  LFVNVKDVNDNAPIFEKP-EYLFISEENSAEIGQFHASDMDSENNGKIRYSVTSPYFKIE  2289

Query  81    PTGPVLQTRLRLVPNPCLRLTRTS  104
             P+  VL    + +P P + L  T+
Sbjct  2290  PSTGVLSRFRQQLPQPLMSLKVTA  2313



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold436-size882841-augustus-gene-5.1-mRNA-1

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARMET_DROME  unnamed protein product                                  237     6e-81
MANF_CAEEL  unnamed protein product                                   176     5e-57
Q57VK1_TRYB2  unnamed protein product                                 34.3    0.022


>ARMET_DROME unnamed protein product
Length=173

 Score = 237 bits (605),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 140/176 (80%), Gaps = 3/176 (2%)

Query  1    MASLQTVVLTAILSCFIFEITHVLSAKKEDCEVCVAVVEKFSNTLADDVKSNPKKIEKEF  60
            M +   VV+   L+         L+ K+EDCEVCV  V +F+++L D  K + K+IE  F
Sbjct  1    MKTWYMVVVIGFLATLA---QTSLALKEEDCEVCVKTVRRFADSLDDSTKKDYKQIETAF  57

Query  61   KKFCKTTKSKENRFCYYLGGLEESATGILGELSKPLSWSMPANKVCEKLKKKDSQICDLR  120
            KKFCK  K+KE+RFCYYLGGLEESATGIL ELSKPLSWSMPA K+CEKLKKKD+QICDLR
Sbjct  58   KKFCKAQKNKEHRFCYYLGGLEESATGILNELSKPLSWSMPAEKICEKLKKKDAQICDLR  117

Query  121  YDKTIDLKTVDLKKLKVRDLRKILSDWDETCEGCIEKSDFIKRIEELKPQYMHSEL  176
            Y+K IDL +VDLKKLKVRDL+KIL+DWDE+C+GC+EK DFIKRIEELKP+Y  SEL
Sbjct  118  YEKQIDLNSVDLKKLKVRDLKKILNDWDESCDGCLEKGDFIKRIEELKPKYSRSEL  173


>MANF_CAEEL unnamed protein product
Length=168

 Score = 176 bits (447),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 117/165 (71%), Gaps = 1/165 (1%)

Query  13   LSCFIFEITHVLSAKKEDCEVCVAVVEKFSNTLADDVKSNPKKIEKEFKKFCKTTKSKEN  72
            L   I  +  V SA    CEVC  V++     +    KS P  I K  ++ C+TT++KEN
Sbjct  4    LVLLISLVIVVASAAAPQCEVCKKVLDDVMAKVPAGDKSKPDAIGKVIREHCETTRNKEN  63

Query  73   RFCYYLGGLEESATGILGELSKPLSWSMPANKVC-EKLKKKDSQICDLRYDKTIDLKTVD  131
            +FC+Y+G L ESAT I+ E++KPLSWSMP  KVC EKLK KD+QIC+L+YDK +D KT+D
Sbjct  64   KFCFYIGALPESATSIMNEVTKPLSWSMPTEKVCLEKLKGKDAQICELKYDKPLDWKTID  123

Query  132  LKKLKVRDLRKILSDWDETCEGCIEKSDFIKRIEELKPQYMHSEL  176
            LKK++V++L+ IL +W E C+GC EK++ IKRIEELKP+Y+  EL
Sbjct  124  LKKMRVKELKNILGEWGEVCKGCTEKAELIKRIEELKPKYVKEEL  168


>Q57VK1_TRYB2 unnamed protein product
Length=159

 Score = 34.3 bits (77),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 0/40 (0%)

Query  131  DLKKLKVRDLRKILSDWDETCEGCIEKSDFIKRIEELKPQ  170
            D+  + V  L+ +L D   +C GC+E+   ++R+ E++ Q
Sbjct  75   DIYSMSVGQLKNMLRDRQVSCVGCVERGHLVERVVEMRHQ  114



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold2290-size369435-augustus-gene-2.6-mRNA-1

Length=249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQL7_DROME  unnamed protein product                                 314     4e-98
B7Z001_DROME  unnamed protein product                                 313     4e-98
Q9VQL6_DROME  unnamed protein product                                 244     9e-74


>Q9VQL7_DROME unnamed protein product
Length=2438

 Score = 314 bits (804),  Expect = 4e-98, Method: Composition-based stats.
 Identities = 144/247 (58%), Positives = 184/247 (74%), Gaps = 7/247 (3%)

Query  1    LVDTLASLGIHPDGMLGHSVGELGCAYADGAFTAEQAVLAAYWRGRVICDASLSPGAMAA  60
            L D L+SLGIHPDG++GHSVGELGCAYADG FT EQ VLAAYWRG+ I D  L+ G MAA
Sbjct  601  LTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLAKGKMAA  660

Query  61   VGLTWEEATTRCPNDVWPACHNSADNVTVSGSVEAVRDFVQQLKEEGVFAKEVDSSGIAF  120
            VGL+WE+A +R P+D +P CHNS DN T+SG   ++   V +L  EGVFAK V+SSG AF
Sbjct  661  VGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSGYAF  720

Query  121  HSRLIAQMGPVLRKHLEKVRLADQSVVPSPKQRSRRWVSSSVSEARWQSPLARFSSAAYH  180
            HS+ IA+ GP LRK LEK       ++P+ K R+ RW+S+S+ E+ W +P+A+ SSAAYH
Sbjct  721  HSKYIAEAGPKLRKSLEK-------IIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYH  773

Query  181  VNNMLSPVLFHEALAHVPENAVVVEVSPHCLLQAVLRRALPSTCVAVGLAKRLHPDNLHV  240
            VNN+LSPVLFHEAL HVP+NA+ VE++PH LLQA+L+RAL      + L KR H +N+  
Sbjct  774  VNNLLSPVLFHEALQHVPKNAISVEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEF  833

Query  241  FLAGLGR  247
            FL  +G+
Sbjct  834  FLTNVGK  840


>B7Z001_DROME unnamed protein product
Length=2540

 Score = 313 bits (803),  Expect = 4e-98, Method: Composition-based stats.
 Identities = 144/247 (58%), Positives = 184/247 (74%), Gaps = 7/247 (3%)

Query  1    LVDTLASLGIHPDGMLGHSVGELGCAYADGAFTAEQAVLAAYWRGRVICDASLSPGAMAA  60
            L D L+SLGIHPDG++GHSVGELGCAYADG FT EQ VLAAYWRG+ I D  L+ G MAA
Sbjct  703  LTDLLSSLGIHPDGIVGHSVGELGCAYADGCFTPEQTVLAAYWRGKSILDTQLAKGKMAA  762

Query  61   VGLTWEEATTRCPNDVWPACHNSADNVTVSGSVEAVRDFVQQLKEEGVFAKEVDSSGIAF  120
            VGL+WE+A +R P+D +P CHNS DN T+SG   ++   V +L  EGVFAK V+SSG AF
Sbjct  763  VGLSWEDAHSRVPSDCFPVCHNSEDNCTISGPEASIEALVAKLNAEGVFAKAVNSSGYAF  822

Query  121  HSRLIAQMGPVLRKHLEKVRLADQSVVPSPKQRSRRWVSSSVSEARWQSPLARFSSAAYH  180
            HS+ IA+ GP LRK LEK       ++P+ K R+ RW+S+S+ E+ W +P+A+ SSAAYH
Sbjct  823  HSKYIAEAGPKLRKSLEK-------IIPNAKNRTARWISTSIPESAWNTPVAKQSSAAYH  875

Query  181  VNNMLSPVLFHEALAHVPENAVVVEVSPHCLLQAVLRRALPSTCVAVGLAKRLHPDNLHV  240
            VNN+LSPVLFHEAL HVP+NA+ VE++PH LLQA+L+RAL      + L KR H +N+  
Sbjct  876  VNNLLSPVLFHEALQHVPKNAISVEIAPHGLLQAILKRALGPDATNLSLVKRGHENNVEF  935

Query  241  FLAGLGR  247
            FL  +G+
Sbjct  936  FLTNVGK  942


>Q9VQL6_DROME unnamed protein product
Length=2409

 Score = 244 bits (622),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 159/248 (64%), Gaps = 9/248 (4%)

Query  1    LVDTLASLGIHPDGMLGHSVGELGCAYADGAFTAEQAVLAAYWRGRVICDA-SLSPGAMA  59
            L D L  L I PDG++GHS GELG AY DG  TAEQ VLAAYWRGR + D   L  G MA
Sbjct  588  LTDLLRVLDIRPDGIIGHSAGELGAAYMDGCLTAEQTVLAAYWRGRSVLDTPDLPRGKMA  647

Query  60   AVGLTWEEATTRCPNDVWPACHNSADNVTVSGSVEAVRDFVQQLKEEGVFAKEVDSSGIA  119
            AVGL+WE+  ++ P D +P CHNS DN TVSG   ++   ++ L  +G+F +EV S G A
Sbjct  648  AVGLSWEQIGSQIPKDCYPVCHNSDDNCTVSGPPSSMDAMIEDLTAKGIFVREVGSGGYA  707

Query  120  FHSRLIAQMGPVLRKHLEKVRLADQSVVPSPKQRSRRWVSSSVSEARWQSPLARFSSAAY  179
            FHS  I    P+LR+ LE++       +  PK++S RW+S+SV EA W S     +SA Y
Sbjct  708  FHSPYIEGAAPMLRRSLERL-------ITEPKKKSIRWLSTSVKEAEWDSEKNHLASAGY  760

Query  180  HVNNMLSPVLFHEALAHVPENAVVVEVSPHCLLQAVLRRALPSTCVAVGLAKRLHPDNLH  239
             +NN++SPVLFH+A+  +P+NA++VE++PH L +A+LR   P     V L +R H +N  
Sbjct  761  FINNLISPVLFHQAVKRIPQNALIVEIAPHGLFRAILRSLSPQISY-VSLMQRGHANNFE  819

Query  240  VFLAGLGR  247
              L+ LGR
Sbjct  820  FLLSQLGR  827



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= augustus-scaffold261-size1668889-processed-gene-0.1-mRNA-1

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

STAUH_APLCA  unnamed protein product                                  29.6    5.9  


>STAUH_APLCA unnamed protein product
Length=950

 Score = 29.6 bits (65),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 17/46 (37%), Positives = 22/46 (48%), Gaps = 2/46 (4%)

Query  131  MPPAAGPPVPTEDQDISTPKNKRRKKNKYKSAKSKMVVRPNYFVGI  176
            +PP A P  P     I    NK++ +N  KS   +    PNY VGI
Sbjct  646  LPPLATPAFPRPKSKIQM--NKKKNRNLIKSELQQQKADPNYGVGI  689



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold4053-size226683-augustus-gene-0.7-mRNA-1

Length=306


***** No hits found *****



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold176-size1212597-augustus-gene-8.1-mRNA-1

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38AX7_TRYB2  unnamed protein product                                 377     1e-125
DDX49_DROME  unnamed protein product                                  276     2e-86 
Q389T9_TRYB2  unnamed protein product                                 266     7e-83 


>Q38AX7_TRYB2 unnamed protein product
Length=512

 Score = 377 bits (968),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 184/392 (47%), Positives = 263/392 (67%), Gaps = 2/392 (1%)

Query  35   SLELTFKDLGVVDVLCEACEQIKWKTPSKIQREAIPLALKGKDVIGLAETGSGKTGAFAL  94
            S ++TFK LG+ + L  AC++  W+ P++IQ   IP+  +G+D+IG+A+TGSGKTGA+ L
Sbjct  37   SKDVTFKSLGLCEELIGACKEAGWRMPTRIQVATIPVVSEGRDIIGVAQTGSGKTGAYVL  96

Query  95   PILQALLENPQRYF--ALILTPTRELAFQISEQFEALGASIGVKCAVIVGGMDMMSQALV  152
            P++  LL   +  +   L++ PTRELA Q++ QF  LG+S+G++ A +VGG DM+ QA  
Sbjct  97   PLVNWLLTQAKVPYLSILVMVPTRELAQQVAAQFVMLGSSVGLRVATLVGGADMVDQACE  156

Query  153  LAKKPHIIIATPGRLVDHLENTKGFNLRALKFLVMDEADRILNMDFEVEVDKILKVVPRE  212
            L+++PH+++ TPGR+ DHL NTKGF L  L  LV+DEAD++L MD+E E++ IL+ +P  
Sbjct  157  LSRRPHVVVGTPGRVKDHLNNTKGFQLVKLHALVLDEADKMLEMDYEKEINAILEHLPHN  216

Query  213  RHTFLFSATMTKKVQKLQRASLKDPVKVEVSTKYHTVDKLQQYYIFIPVKFKDVYLVHIL  272
            R T LFSAT++ K+ +LQ ASL DPV +EV  K  TVD L+QYY+F P      YL   L
Sbjct  217  RQTLLFSATLSTKIDRLQNASLNDPVLLEVHRKNTTVDTLKQYYVFAPFAQMLPYLHLYL  276

Query  273  NEMAGNSFMIFCATCSNTMRTALLLRSLGLMAVPLHGQMSQNKRLAALTKFRARARLILI  332
               +GN  ++FC + +   R  L LR LG  A+PL G+M Q  R  ALTKF+     IL+
Sbjct  277  TRESGNHILVFCRSAALVHRITLTLRVLGHQALPLMGRMDQKNRNIALTKFKEGRVRILV  336

Query  333  STDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAMTFVTQYDVELYQRI  392
             TDVA RGLDIP  DVV+NF +P   +DYIHRVGRTARAG  GKA+  ++QYD+ L Q++
Sbjct  337  CTDVAQRGLDIPRTDVVVNFALPDRVEDYIHRVGRTARAGAQGKAVNIISQYDIVLLQKV  396

Query  393  EHLIGKQLPLYKTEEQEVMVLQERVAEAQRAA  424
            E   G +   +   + +V  + +RV +A++ A
Sbjct  397  EASTGVKCEEWPISDGDVAAVLQRVEDAEQEA  428


>DDX49_DROME unnamed protein product
Length=521

 Score = 276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 158/393 (40%), Positives = 236/393 (60%), Gaps = 6/393 (2%)

Query  40   FKDLGVVDVLCEACEQIKWKTPSKIQREAIPLALKGKDVIGLAETGSGKTGAFALPILQA  99
            F+ LG+   L +   ++  K  + IQ++ IP  L G+D IG A+TGSGKT AFALPIL+ 
Sbjct  9    FQILGLRPWLVKQLTKLGLKGATPIQQKCIPAILAGQDCIGAAKTGSGKTFAFALPILER  68

Query  100  LLENPQRYFALILTPTRELAFQISEQFEALGASIGVKCAVIVGGMDMMSQALVLAKKPHI  159
            L E P  +FAL+LTPT ELA+QISEQF   G ++GV+  V+ GG D M ++  L ++PHI
Sbjct  69   LSEEPVSHFALVLTPTHELAYQISEQFLVAGQAMGVRVCVVSGGTDQMVESQKLMQRPHI  128

Query  160  IIATPGRLVDHLENTKGFNLRALKFLVMDEADRILNMDFEVEVDKILKVVPRERHTFLFS  219
            ++A PGRL DHL     F+   LK+LV+DEADR+LN DF+  +  I + +P+ R    FS
Sbjct  129  VVAMPGRLADHLTGCDTFSFDNLKYLVVDEADRMLNGDFDESLSIIERCLPKTRQNLFFS  188

Query  220  ATMTKKVQKLQRASL-KDPVKVEVSTKYHTVDKLQQYYIFIPVKFKDVYLVHIL----NE  274
            ATM   +++     +  D  +    +   TV+ L Q Y+      +D+ L+  L     E
Sbjct  189  ATMKDFIKESSIFPIASDCFEWSQDSDVATVETLDQRYLLCADYDRDMVLIEALRKYREE  248

Query  275  MAGNSFMIFCATCSNTMRTALLLRSLGLMAVPLHGQMSQNKRLAALTKFRARARLILIST  334
                + MIF  T       ++ L+++ +  V LHG M Q +R+AAL++F++     LI+T
Sbjct  249  NENANVMIFTNTKKYCQLLSMTLKNMEIDNVCLHGFMRQKERVAALSRFKSNQIRTLIAT  308

Query  335  DVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKAMT-FVTQYDVELYQRIE  393
            DVA+RGLDIP V++V+N  +P   K+YIHRVGRTARAGR G +++ F    D+EL   IE
Sbjct  309  DVAARGLDIPSVELVMNHMLPRTPKEYIHRVGRTARAGRKGMSISIFRFPRDLELLAAIE  368

Query  394  HLIGKQLPLYKTEEQEVMVLQERVAEAQRAAKM  426
              I  +L  +  +++ V  +  +V   +R ++M
Sbjct  369  EEINTKLTEHPIDQRMVERIFMQVNVTRRESEM  401


>Q389T9_TRYB2 unnamed protein product
Length=520

 Score = 266 bits (681),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 167/434 (38%), Positives = 246/434 (57%), Gaps = 47/434 (11%)

Query  40   FKDLGVVDVLCEACEQIKWKTPSKIQREAIPLALKGKDVIGLAETGSGKTGAFALPILQA  99
            F+ LGV   L + C  +    P+ IQ+  IP  L GK V+G A TGSGKT AF LP+LQ 
Sbjct  4    FEALGVHQWLSKQCAYMALHHPTPIQKLCIPSILAGKCVVGGAATGSGKTAAFVLPLLQI  63

Query  100  LLENPQRYFALILTPTRELAFQISEQFEALGASIGVKCAVIVGGMDMMSQALVLAKKPHI  159
            L E+P   FAL+LTP+RELA+QI +QF ALGA + ++ A+ +GG+    Q  VL  +PH+
Sbjct  64   LAEDPYGVFALVLTPSRELAYQILDQFVALGAPLHIRAALAIGGVPHEQQVSVLHGRPHV  123

Query  160  IIATPGRLVDHL----ENTKGFNLRALKFLVMDEADRILNMDFEVEVDKILKVV--PRE-  212
            ++ATPGRL   L    E  K F+   L+FLV+DEADR+   D E +V  +++++  PR  
Sbjct  124  VVATPGRLKFLLGTFPEARKAFS--HLRFLVLDEADRLTTDDMEGDVSDVVELLQPPRPT  181

Query  213  RHTFLFSATMTK---KVQK---LQRASLKDPV-KVE------------------------  241
            R T LF+AT+ +   +V+K   L+R  + D   ++E                        
Sbjct  182  RRTLLFTATLEQHLVRVEKGGWLERLGISDAAGQLEVHATNTVMNMPDVARKSDNESSGS  241

Query  242  ---VSTKYHTVDKLQQYYIFIPVKFKDVYLVHILNEMAGN-SFMIFCATCSNTMRTALLL  297
               V T Y   D L+Q Y+FIP   K  YLV  L  +  + + +IF  +C       L L
Sbjct  242  GNSVGTSYTVADSLRQTYLFIPNMVKLAYLVAALRSVGSDQTTIIFANSCMRCEIVRLTL  301

Query  298  RSLGLMAVPLHGQMSQNKRLAALTKFRARARLILISTDVASRGLDIPHVDVVINFDIPTH  357
            + LG     L+  +SQ  R+  L  F+     +L++TD+ASRGLDIP V  V+++D+P  
Sbjct  302  QLLGFPVCSLNSIISQKHRIDNLATFKLGIARVLVATDIASRGLDIPAVGAVVHYDLPKQ  361

Query  358  SKDYIHRVGRTARAGRSGKAMTFVTQYDVELYQRIEHLIGKQLPLYKTE---EQEVMVLQ  414
            S  Y+HRVGRTARAGR G ++  +T+ DV L +R+E  +   L L+K +   E++V+ + 
Sbjct  362  SSTYLHRVGRTARAGRKGLSVALITENDVSLVKRLEKKLQCTLELWKVKGVGEKDVLKIL  421

Query  415  ERVAEAQRAAKMVI  428
            + V+ A+  AK+ I
Sbjct  422  DEVSSAKVQAKLQI  435



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold3965-size425434-augustus-gene-3.5-mRNA-1

Length=365
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5BI62_DROME  unnamed protein product                                 311     4e-96
Q24393_DROME  unnamed protein product                                 309     2e-95
M9PEB5_DROME  unnamed protein product                                 190     2e-53


>Q5BI62_DROME unnamed protein product
Length=1313

 Score = 311 bits (797),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 217/316 (69%), Gaps = 11/316 (3%)

Query  46    EVPSLRSKKQEPTLVMEEV----------PATEPSSLLQVLQLNRPEWSLLLVGSVCAIV  95
             E+  L   + E  +V +E              E   +L+V+++N+PEW  + VG + +++
Sbjct  696   EIKVLSEDEDEDVMVTDEKNKKKKKKKVKDPNEVKPMLEVMKMNKPEWLQIAVGCISSVI  755

Query  96    MGCSYPVFAILFGDILQVLSLPDATE-VRDETNVYCIYFLVAAVVIGISSVIQVAAISVA  154
             MGC+ P+FA+LFG ILQ+LS+ D  + VR+ +N Y +YFL+A +V+GI++ +Q+    +A
Sbjct  756   MGCAMPIFAVLFGSILQILSVKDNDQYVRENSNQYSLYFLIAGIVVGIATFLQIYFFGIA  815

Query  155   GEKLTTRLRGRLFEAMLRQEVAWFDHKDNTSGSLCARLSADASQVQGATGQRVSLLVQSL  214
             GE+LT RLRG +FEAMLRQEVAWFD K N +GSLCARLS DA+ VQGATGQR+  +VQS+
Sbjct  816   GERLTERLRGLMFEAMLRQEVAWFDDKANGTGSLCARLSGDAAAVQGATGQRIGTIVQSI  875

Query  215   ATVVVGISLALYYEWRLGLVALSFSPFIILAQYLFGLLLSGTLLSNRQSLEKAVNVAVEA  274
             +T+ +GI+L++YYEW LGLVAL+F+PFI++A Y+   L++   + + +++E    +AVE 
Sbjct  876   STLALGIALSMYYEWSLGLVALAFTPFILIAFYMQRTLMAKENMGSAKTMENCTKLAVEV  935

Query  275   IGNIRTVVGLGQEKLFLDQFSSHLQVMHTHALCNTHFRGLVFGLASSIMYFGYAACMYYG  334
             + NIRTV  LG+E++F   +   L      +  NTHFRGLV+GLA S+M+F YAACMYYG
Sbjct  936   VSNIRTVASLGREEMFHQNYIGMLIPAVEISKRNTHFRGLVYGLARSLMFFAYAACMYYG  995

Query  335   GRLVQWDGLPYSSVFK  350
                V   G+ +  VFK
Sbjct  996   TWCVIHRGILFGDVFK  1011


 Score = 70.5 bits (171),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/309 (23%), Positives = 128/309 (41%), Gaps = 23/309 (7%)

Query  51   RSKKQEPTLVMEEVPATEPSSLLQV--LQLNR----PEWSLLLVGSVCAIVMGCSYPVFA  104
            +SK  E     EE  +     + QV   QL R     + +L ++G + A+  G + P  +
Sbjct  47   KSKHDESDASDEEDGSQYHEDVKQVSYFQLFRYATKKDRALYVIGLLSAVATGLTTPANS  106

Query  105  ILFGDILQVL-------------SLPDA--TEVRDETNVYCIYFLVAAVVIGISSVIQVA  149
            ++FG++   +                DA  T + D+   + +      +++ + S + + 
Sbjct  107  LIFGNLANDMIDLGGLLESGKSYRADDAISTLLLDKVRQFSLQNTYIGIIMLVCSYLSIT  166

Query  150  AISVAGEKLTTRLRGRLFEAMLRQEVAWFDHKDNTSGSLCARLSADASQVQGATGQRVSL  209
              + A       +R + F ++L Q++ W+D   N SG + +R++ D S+++    ++V +
Sbjct  167  CFNYAAHSQILTIRSKFFRSILHQDMKWYDF--NQSGEVASRMNEDLSKMEDGLAEKVVM  224

Query  210  LVQSLATVVVGISLALYYEWRLGLVALSFSPFIILAQYLFGLLLSGTLLSNRQSLEKAVN  269
             V  L   V  + LA    W+L LV L+  P   +A  L  +  S            A  
Sbjct  225  FVHYLVAFVGSLVLAFVKGWQLSLVCLTSLPLTFIAMGLVAVATSRLAKKEVTMYAGAAV  284

Query  270  VAVEAIGNIRTVVGLGQEKLFLDQFSSHLQVMHTHALCNTHFRGLVFGLASSIMYFGYAA  329
            VA  A+  IRTV     E   +  +   +       +    F G+ FGL    +Y  YA 
Sbjct  285  VAEGALSGIRTVKAFEGEAKEVAAYKERVVAAKILNIKRNMFSGIGFGLLWFFIYASYAL  344

Query  330  CMYYGGRLV  338
              +YG  LV
Sbjct  345  AFWYGVGLV  353


>Q24393_DROME unnamed protein product
Length=1283

 Score = 309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 216/316 (68%), Gaps = 11/316 (3%)

Query  46   EVPSLRSKKQEPTLVMEEV----------PATEPSSLLQVLQLNRPEWSLLLVGSVCAIV  95
            E+  L   + E  +V +E              E   +L+V+++N+PEW  + VG + +++
Sbjct  666  EIKVLSEDEDEDVMVTDEKNKKKKMKKVKDPNEVKPMLEVMKMNKPEWLQIAVGCISSVI  725

Query  96   MGCSYPVFAILFGDILQVLSLPDATE-VRDETNVYCIYFLVAAVVIGISSVIQVAAISVA  154
            MGC+ P+FA+LFG ILQ+LS+ D  + VR+ +N Y +YFL+A +V+GI++ +Q+    +A
Sbjct  726  MGCAMPIFAVLFGSILQILSVKDNDQYVRENSNQYSLYFLIAGIVVGIATFLQIYFFGIA  785

Query  155  GEKLTTRLRGRLFEAMLRQEVAWFDHKDNTSGSLCARLSADASQVQGATGQRVSLLVQSL  214
            GE+LT RLRG +FEAMLRQEVAWFD K N +GSLCARLS DA+ VQGATGQR+  ++QS+
Sbjct  786  GERLTERLRGLMFEAMLRQEVAWFDDKANGTGSLCARLSGDAAAVQGATGQRIGTIIQSI  845

Query  215  ATVVVGISLALYYEWRLGLVALSFSPFIILAQYLFGLLLSGTLLSNRQSLEKAVNVAVEA  274
            +T+ +GI+L++YYEW LGLVAL+F+PFI++A Y+   L++   +   +++E    +AVE 
Sbjct  846  STLALGIALSMYYEWSLGLVALAFTPFILIAFYMQRTLMAKENMRPAKTMENCTKLAVEV  905

Query  275  IGNIRTVVGLGQEKLFLDQFSSHLQVMHTHALCNTHFRGLVFGLASSIMYFGYAACMYYG  334
            + NIRTV  LG+E++F   +   L      +  NTHFRGLV+GLA S+M+F YAACMYYG
Sbjct  906  VSNIRTVASLGREEMFHQNYIGMLIPAVEISKRNTHFRGLVYGLARSLMFFAYAACMYYG  965

Query  335  GRLVQWDGLPYSSVFK  350
               V   G+ +  VFK
Sbjct  966  TWCVIHRGILFGDVFK  981


>M9PEB5_DROME unnamed protein product
Length=1206

 Score = 190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/281 (34%), Positives = 157/281 (56%), Gaps = 0/281 (0%)

Query  70   SSLLQVLQLNRPEWSLLLVGSVCAIVMGCSYPVFAILFGDILQVLSLPDATEVRDETNVY  129
            S+  ++L   RPEWS L++G++CA + G + PVF+++  ++   L+ P   EV +++   
Sbjct  614  STFFRILGWARPEWSFLIIGAICAGLYGVTMPVFSVVLAELYGSLAKPTDEEVLEQSASM  673

Query  130  CIYFLVAAVVIGISSVIQVAAISVAGEKLTTRLRGRLFEAMLRQEVAWFDHKDNTSGSLC  189
             I  LV  +  G+   IQ    ++AG  LTTR+R + F  ++ QE+ WFD K+N+ G+L 
Sbjct  674  AIISLVIGIAAGVVCYIQTFFFNLAGVWLTTRMRSKTFRCIMNQEMGWFDRKENSIGALS  733

Query  190  ARLSADASQVQGATGQRVSLLVQSLATVVVGISLALYYEWRLGLVALSFSPFIILAQYLF  249
            ARLS DA+ VQGA G  +S ++Q+    +  I++A  Y W L L+ LS SPF++ +    
Sbjct  734  ARLSGDAASVQGAIGFPLSNIIQAFTNFICSIAIAFPYSWELALICLSTSPFMVASIVFE  793

Query  250  GLLLSGTLLSNRQSLEKAVNVAVEAIGNIRTVVGLGQEKLFLDQFSSHLQVMHTHALCNT  309
                  + L  ++ LE+   +A E I  IRTV GL +E+  +  +   ++      L   
Sbjct  794  ARFGEKSALKEKEVLEETSRIATETITQIRTVAGLRREEELIKIYDKEVERYRHQILSRL  853

Query  310  HFRGLVFGLASSIMYFGYAACMYYGGRLVQWDGLPYSSVFK  350
             +RGLV  L  S+M+FGYA  + YGG +     + + ++ K
Sbjct  854  KWRGLVNSLGKSLMFFGYAVTLTYGGHMCADGKIKFETIMK  894


 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 98/218 (45%), Gaps = 2/218 (1%)

Query  121  EVRDETNVYCIYFLVAAVVIGISSVIQVAAISVAGEKLTTRLRGRLFEAMLRQEVAWFDH  180
            E+R ++  + I   +  +++  S V  V A +    KLT R+R   F+A LRQE+ W D 
Sbjct  3    ELRKDSVSFGILMTLNTLLMLFSGVYYVDAFNRLALKLTVRMRREFFKATLRQEIGWHDM  62

Query  181  KDNTSGSLCARLSADASQVQGATGQRVSLLVQSLATVVVGISLALYYEWRLGLVALSFSP  240
              +   +   R++ +  +++    + +   V+ +  V++ + L+  Y W+L L  + + P
Sbjct  63   AKDQ--NFAVRITDNMEKIRSGIAENLGHYVEIMCDVIISVVLSFIYGWKLALAIVFYIP  120

Query  241  FIILAQYLFGLLLSGTLLSNRQSLEKAVNVAVEAIGNIRTVVGLGQEKLFLDQFSSHLQV  300
              ++                + S  +A +V  E IG IRTVV  G E+    ++ S L+ 
Sbjct  121  LTLVVNSAVAHYQGKLTGQEQSSYVRASSVVEEVIGAIRTVVAFGGERSESLRYDSLLKP  180

Query  301  MHTHALCNTHFRGLVFGLASSIMYFGYAACMYYGGRLV  338
                      F GL   +  ++++   A   +YG  L+
Sbjct  181  ALKAGKWKGAFSGLSDTVMKAMLFITGAGSFWYGANLI  218



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold195-size1135307-augustus-gene-1.2-mRNA-1

Length=261


***** No hits found *****



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold1463-size493393-augustus-gene-2.1-mRNA-1

Length=1004
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2J8E9_DROME  unnamed protein product                                 191     5e-49
DS_DROME  unnamed protein product                                     190     6e-49
FAT2_DROME  unnamed protein product                                   171     6e-43


>X2J8E9_DROME unnamed protein product
Length=3556

 Score = 191 bits (484),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 169/588 (29%), Positives = 267/588 (45%), Gaps = 82/588 (14%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             V + E   +   I+++ A D D G+NA I Y I  +  +  +T          +F I P 
Sbjct  1043  VNVSESRSINAQIIQVNASDLDTGNNARITYRIV-DAGVDNVTNSISSSDVSQHFGIFPN  1101

Query  134   NGEVSVARVLPPETEFRMNFT--AIDGGGLSDNVSVRIFVK--DVNDHAPVFKKSWYMFD  189
             +G + +   L  ET  R   T  A D G  + +   R+ V+  D ND+ P F+KS Y F 
Sbjct  1102  SGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFR  1161

Query  190   LKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDR  249
             ++E    G ++G V A+D D G+NA I Y+++   +S     F+V    GEIS    +DR
Sbjct  1162  IEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDR  1216

Query  250   EFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDK  309
             E ++ Y   + ARD G P  +++ V V + + D+NDNAP   +        Q  V     
Sbjct  1217  ELRELYDLVVEARDQGTP-VRSARVPVRIHVSDVNDNAPEIAD-------PQEDV-----  1263

Query  310   FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAF  369
                             SV E  P GT V +V A D D   N +          +DG   F
Sbjct  1264  ---------------VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLF  1308

Query  370   GIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRP  429
              ID   G+IRT   LD+E +S Y + + ASD GNP   +  +L V V+D+ +      RP
Sbjct  1309  SIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLND-----NRP  1363

Query  430   MFSHRYYELEVPENS------------EVPAPILHLNVTEAYQNMNLKFTLVPTAG---S  474
              F+       V E++            E PA ++  +V E+++++ + +TL P       
Sbjct  1364  TFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIE  1423

Query  475   DNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANE  534
               F I+  +G L +A+ LDRE +S + L +R                L      +  ++ 
Sbjct  1424  AAFDIDRHSGNLVVARLLDREVQSEFRLEIRA---------------LDTTASNNPQSSA  1468

Query  535   VKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILG  594
             + V + V DVNDNAP++  +  PI   +  +   G  I    ATDAD G N D++Y ++ 
Sbjct  1469  ITVKIEVADVNDNAPEWPQD--PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIR  1526

Query  595   RAD--GESRK-----FAIDALTGQVRSIVSFAKDAGRVFGFDVKATDR  635
                   ES++     F +D+LTG +        +A + +   V+A D+
Sbjct  1527  YFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ  1574


 Score = 148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 253/545 (46%), Gaps = 91/545 (17%)

Query  83   GMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNGEVSVARV  142
            G S+L++LA DRD G N+ + YS++ ET         P+  ++ +F I P  G ++    
Sbjct  520  GTSVLQVLAHDRDEGLNSALTYSLA-ET---------PETHAQ-WFQIDPQTGLITTRSH  568

Query  143  LPPETEF--RMNFTAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGY  198
            +  ETE   ++   A DGG   LS   +V + + DVND+ P+F +S+Y   + E    G 
Sbjct  569  IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGR  628

Query  199  IIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFKDSYKFR  258
             I KV A+D D G NA ++YTI   E       F+V  + GEI  +G +D E + SY+F 
Sbjct  629  CILKVSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFP  686

Query  259  IMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLL  318
            ++A D G     ++  ++++ + D+NDN P FY  +     Y+ S+  + K    A    
Sbjct  687  VLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPRE-----YKVSLRESPKASSQA----  734

Query  319  LIPIYYASVLENSPTGTIVSKVSANDSDFQGNGN-GLLLFNIPHQTDGSDA--FGIDSKE  375
                          + T +  V A D D+   GN G + + I     G++A  F ID   
Sbjct  735  --------------SSTPIVAVVATDPDY---GNFGQVSYRI---VAGNEAGIFRIDRST  774

Query  376  GLIRTI--GKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSH  433
            G I  +    L   TQ  + + I A+D GN   ++ A++ +S++D  +     + P+F  
Sbjct  775  GEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQ-----RPPIFEK  829

Query  434  RYYELEVPENSEVPAPILHLNVTEAYQNMN----LKFTLVPTAGSDNFKINTRNGTLYLA  489
              Y   V E  ++P   +  +V  A  ++     +++++        F I T +G + +A
Sbjct  830  ARYNYYVKE--DIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIA  887

Query  490  KSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNAP  549
            K LD E KS   L +     +   G P +                 +V + V+DVNDNAP
Sbjct  888  KPLDHEAKSQVLLNI-----QATLGEPPVY-------------GHTQVNIEVEDVNDNAP  929

Query  550  KFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESRK--FAIDA  607
            +F      +  ++P SA  G  +    A D D G +  + Y ++     ES K  FAIDA
Sbjct  930  EF--EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLV----KESGKGLFAIDA  983

Query  608  LTGQV  612
             +G +
Sbjct  984  RSGHL  988


 Score = 148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 150/570 (26%), Positives = 249/570 (44%), Gaps = 77/570 (14%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             + ED P G  +  ++A   D    + + YSI S         G P      YF I   +G
Sbjct  836   VKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS---------GDP----DGYFSIETNSG  882

Query  136   EVSVARVLPPE--TEFRMNFTAIDGG-GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKE  192
              + +A+ L  E  ++  +N  A  G   +  +  V I V+DVND+AP F+ S     + E
Sbjct  883   NIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE  942

Query  193   GFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFK  252
                 G  +    A D D G + +++Y++++         F +    G +  S ++D E  
Sbjct  943   SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL---FAIDARSGHLILSQHLDYESS  999

Query  253   DSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQ  312
               +   + A DGG P    ++ ++ VD+ D+NDN P F   ++       SVNV++    
Sbjct  1000  QRHTLIVTATDGGVPSLSTNLTIL-VDVQDVNDNPPVFEKDEY-------SVNVSESRSI  1051

Query  313   SANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGID  372
             +A  + +     AS L+      I  ++   D+      N +        +D S  FGI 
Sbjct  1052  NAQIIQV----NASDLDTGNNARITYRIV--DAGVDNVTNSI------SSSDVSQHFGIF  1099

Query  373   SKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFS  432
                G I     LD ET+  Y +T++A+D G P+  +   + V V+D  +       P F 
Sbjct  1100  PNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDAND-----NDPKFQ  1154

Query  433   HRYYELEVPENSE-------VPAPILHLNVTEAYQNMNLKFTLVPTAGSDNFKINTRNGT  485
                YE  + EN         V A  L L      +N  ++++L+P   S  F+++   G 
Sbjct  1155  KSKYEFRIEENLRRGSVVGVVTASDLDLG-----ENAAIRYSLLPINSS--FQVHPVTGE  1207

Query  486   LYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVN  545
             +   + LDRE + LY+L V      + +G PV              +  V V + V DVN
Sbjct  1208  ISTREPLDRELRELYDLVVEA----RDQGTPV-------------RSARVPVRIHVSDVN  1250

Query  546   DNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHIL-GRADGESRKFA  604
             DNAP+ + + +  V ++      G  +VR++A D D G NA I Y I+ GR       F+
Sbjct  1251  DNAPE-IADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFS  1309

Query  605   IDALTGQVRSIVSFAKDAGRVFGFDVKATD  634
             ID  +G +R+ V    +   ++   V A+D
Sbjct  1310  IDPTSGVIRTRVVLDHEERSIYRLGVAASD  1339


 Score = 142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 171/663 (26%), Positives = 283/663 (43%), Gaps = 113/663 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             + + E TPVG  I    A D D G+N  + Y +    Y P+  L   +  + S F +   
Sbjct  1492  LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIR--YFPQ--LNESQEQAMSLFRMDSL  1547

Query  134   NGEVSVARVLPPET--EFRMNFTAIDGGG-----LSDNVSVRIFVKDVNDHAPVF-----  181
              G +S+   L  E   E+ +   A+D        L  +V+VR+ + D NDHAP F     
Sbjct  1548  TGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNS  1607

Query  182   --KKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDG  239
                K+  +F + +    G ++  + A D D G N +++Y I           F+++   G
Sbjct  1608  SGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR---FRINSQTG  1663

Query  240   EISASGNI-----DREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYD  294
              I    ++     D E    +   I A+D G+P  K S + + + +   ++N P F    
Sbjct  1664  IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRF----  1719

Query  295   HILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGL  354
                                     L  +Y A++LEN P+G+ V +V+A      G  N  
Sbjct  1720  ------------------------LQAVYRATILENVPSGSFVLQVTAK--SLHGAENAN  1753

Query  355   LLFNIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPS-LSSTAI--  411
             L + IP     +D F +D + G+I T G+ D E+Q+ Y + +   D    S LSS+A+  
Sbjct  1754  LSYEIPAGV-ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRK  1812

Query  412   --------------------LAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPIL  451
                                 + ++V DV +   E  RP      Y L VPENSE P  I 
Sbjct  1813  QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE-FRP---GSCYGLSVPENSE-PGVIH  1867

Query  452   HLNVTEAYQNMNLKFTLVPTAGS--DNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHH  509
              +  ++  +  N       T G+  + F I++ +G L  A+ LDRE+ S Y L+++    
Sbjct  1868  TVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQA---  1923

Query  510   KKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYG  569
                RG P                    + + V+D NDNAP+F ++      ++   A  G
Sbjct  1924  -SDRGQP------------KSRQGHCNITIFVEDQNDNAPRFKLSK--YTGSVQEDAPLG  1968

Query  570   YHIVRLQATDADEGVNADIRYHILGRADGESRKFAIDALTGQVRSIVSFAKDAGRVFGFD  629
               +V++ A DAD GVNA + Y +   A+    +FAID  +G + ++    ++    + F 
Sbjct  1969  TSVVQISAVDADLGVNARLVYSL---ANETQWQFAIDGQSGLITTVGKLDRELQASYNFM  2025

Query  630   VKATDRRGADDGRSAITNV-FNMFCCRTDLYLYAVDPLMNVVIDM-ETLQNVLRSKRADI  687
             V ATD  G  + RSA   V  N+     +  ++   P +  V  + +  Q +L+ +  D 
Sbjct  2026  VLATD-GGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDA  2084

Query  688   DRG  690
             D G
Sbjct  2085  DLG  2087


 Score = 142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 160/608 (26%), Positives = 272/608 (45%), Gaps = 107/608 (18%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             +++PE++  G+ I  ++A D D G NA + YSI+         LG       + F I  +
Sbjct  1855  LSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGN------LG-------NKFSIDSS  1900

Query  134   NGEVSVARVLPPE--TEFRMNFTAIDGG---GLSDNVSVRIFVKDVNDHAPVFKKSWYMF  188
             +GE+S AR L  E  + + +   A D G       + ++ IFV+D ND+AP FK S Y  
Sbjct  1901  SGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG  1959

Query  189   DLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNID  248
              ++E    G  + ++ A DAD G NA + Y++  NE   T   F +    G I+  G +D
Sbjct  1960  SVQEDAPLGTSVVQISAVDADLGVNARLVYSL-ANE---TQWQFAIDGQSGLITTVGKLD  2015

Query  249   REFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVND  308
             RE + SY F ++A DGG+   +++ V V++++LDINDN P F  Y +I Q+         
Sbjct  2016  RELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQV---------  2066

Query  309   KFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDA  368
                      L+ P            G  + KV A D+D   N   +   N    +  S  
Sbjct  2067  -------PALIQP------------GQTLLKVQALDADLGANAEIVYSLNA-ENSAVSAK  2106

Query  369   FGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQR  428
             F I+   G +     L  E+    ++ +VA D GNP  SS  ++ + + +  +  G P  
Sbjct  2107  FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQ--GTPVL  2164

Query  429   PMFSHRYYELEVPENSEVPAPILHLNVTEA---YQNMNLKFTLVPTAGSDN--FKINTRN  483
               F +  Y + + ENS     +L +    +    Q +   F     AG+++    +++ +
Sbjct  2165  -RFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSF----GAGNEDGILSLDSLS  2219

Query  484   GTLYLAKS--LDREEKSLYEL----RVRVDHHKKGRGMPVLLYPLPADR-----------  526
             G + + K   LD +  S   +    R R  H+++         P  + R           
Sbjct  2220  GEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFA  2279

Query  527   LADLAANEVKV------------------IVRVKDVNDNAPKFVVNGRPIVAAIPTSASY  568
             L +   NE++V                  ++ ++D NDN+PKF  + +  VA +    + 
Sbjct  2280  LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKF--SQKQFVATVSEGNNK  2337

Query  569   GYHIVRLQATDADEGVNADIRYHILGRADGE-SRKFAID-ALTGQVRSIVSFAKDAGRVF  626
             G  + ++ A D+D G NA +RYHI+   DG     F I+ A +G VR+ +   ++   ++
Sbjct  2338  GTFVAQVHAFDSDAGSNARLRYHIV---DGNHDNAFVIEPAFSGIVRTNIVLDREIRDIY  2394

Query  627   GFDVKATD  634
                + ATD
Sbjct  2395  KLKIIATD  2402


 Score = 135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 144/535 (27%), Positives = 228/535 (43%), Gaps = 91/535 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             V++ E+ PVG  IL++ A D D G NA + Y+I  E +              + F +   
Sbjct  618   VSVAENEPVGRCILKVSASDPDCGVNAMVNYTI-GEGF-----------KHLTEFEVRSA  665

Query  134   NGEVSVARVLPPE--TEFRMNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLK  191
             +GE+ +A  L  E  + +     A D GGLS    +++ + DVND+ PVF    Y   L+
Sbjct  666   SGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLR  725

Query  192   E-----GFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISA--S  244
             E        S   I  V ATD D+G   ++SY I+    +     F++ RS GEI     
Sbjct  726   ESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI---FRIDRSTGEIFVVRP  782

Query  245   GNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTF----YNYDHILQMY  300
               +    +  +   I A DGG   + N+  VV + I+D     P F    YNY       
Sbjct  783   DMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNY-------  834

Query  301   QNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIP  360
                                       V E+ P GT+V  V A   D        + ++I 
Sbjct  835   -------------------------YVKEDIPRGTVVGSVIAASGDVAHRSP--VRYSI-  866

Query  361   HQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQ  420
             +  D    F I++  G IR    LD+E +S   + I A+ +G P +     + + V DV 
Sbjct  867   YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVN  925

Query  421   EQLGEPQRPMFSHRYYELEVPENSEVPAPIL--HLNVTEAYQNMNLKFTLVPTAGSDNFK  478
             +       P F      + VPE++E+ AP+   H +  ++  +  + ++LV  +G   F 
Sbjct  926   DNA-----PEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFA  980

Query  479   INTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVI  538
             I+ R+G L L++ LD E    + L V         G+P L             +  + ++
Sbjct  981   IDARSGHLILSQHLDYESSQRHTLIVTA----TDGGVPSL-------------STNLTIL  1023

Query  539   VRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHIL  593
             V V+DVNDN P F  +   +   +  S S    I+++ A+D D G NA I Y I+
Sbjct  1024  VDVQDVNDNPPVFEKDEYSV--NVSESRSINAQIIQVNASDLDTGNNARITYRIV  1076


 Score = 130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 151/544 (28%), Positives = 234/544 (43%), Gaps = 110/544 (20%)

Query  34    ISEPTVPGAGDANMTSEELVHHLSTTNFTNHDSILFMAPLV--TIPEDTPVGMSILRLLA  91
             + EP V G    N+  E++          N ++  F A +V  ++PE   +G  +    A
Sbjct  906   LGEPPVYGHTQVNIEVEDV----------NDNAPEFEASMVRISVPESAELGAPLYAAHA  955

Query  92    DDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNGEVSVARVLPPETEFRM  151
              D+D+GS+  + YS+  E             S K  F I   +G + +++ L  E+  R 
Sbjct  956   HDKDSGSSGQVTYSLVKE-------------SGKGLFAIDARSGHLILSQHLDYESSQRH  1002

Query  152   NF--TAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATD  207
                 TA DGG   LS N+++ + V+DVND+ PVF+K  Y  ++ E       I +V A+D
Sbjct  1003  TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASD  1062

Query  208   ADFGKNAEISYTIIQ-------NENSSTALP--FKVSRSDGEISASGNIDREFKDSYKFR  258
              D G NA I+Y I+        N  SS+ +   F +  + G I     +DRE +D Y+  
Sbjct  1063  LDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLT  1122

Query  259   IMARDGGKP--HKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANN  316
             ++A D G P  H K  ++   V +LD NDN P                    KF +S   
Sbjct  1123  VLATDNGTPAAHAKTRVI---VRVLDANDNDP--------------------KFQKSK--  1157

Query  317   LLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGN---GLLLFNIPHQTDGSDAFGIDS  373
                   Y   + EN   G++V  V+A+D D   N      LL  N         +F +  
Sbjct  1158  ------YEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN--------SSFQVHP  1203

Query  374   KEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQE---QLGEPQRPM  430
               G I T   LD E +  Y++ + A D G P  S+   + + V DV +   ++ +PQ  +
Sbjct  1204  VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV  1263

Query  431   FSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN---FKINTRNGTLY  487
              S R    E P  +EV    +     +  QN ++ +++V    SD    F I+  +G + 
Sbjct  1264  VSVRE---EQPPGTEVVR--VRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIR  1318

Query  488   LAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDN  547
                 LD EE+S+Y L V         G P    P    R+         + V V D+NDN
Sbjct  1319  TRVVLDHEERSIYRLGVAA----SDGGNP----PRETVRM---------LRVEVLDLNDN  1361

Query  548   APKF  551
              P F
Sbjct  1362  RPTF  1365


 Score = 128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 209/495 (42%), Gaps = 78/495 (16%)

Query  135  GEVSVARVLPPETEFRMNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGF  194
            GE+     L  ET    +  AI   G   N+ V + VKD ND+AP F ++    +  E  
Sbjct  130  GEIRTKVKLDRETRASYSLVAIPLSG--RNIRVLVTVKDENDNAPTFPQTSMHIEFPENT  187

Query  195  YSGYIIGKVEATDADFGKNAEISYTIIQ-NENSSTALPFKVSRSDG----EISASGNIDR  249
                    + A D D        Y I+  N N +  L     R DG    ++  SG +DR
Sbjct  188  PREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRER-DGVLYLDLQISGFLDR  246

Query  250  EFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDK  309
            E    Y   I A DGG P  +   + V + I D+NDN P F                   
Sbjct  247  ETTPGYSLLIEALDGGTPPLRG-FMTVNITIQDVNDNQPIF-------------------  286

Query  310  FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNI-PHQTDGSDA  368
             +QS         Y+A+V EN+  GT V +V A+D+D   + NGL+ + I   Q+D    
Sbjct  287  -NQSR--------YFATVPENATVGTSVLQVYASDTD--ADENGLVEYAINRRQSDKEQM  335

Query  369  FGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQ------  422
            F ID + G I     LD+ET+  + + +VA D G   L +TA +++ V DV +       
Sbjct  336  FRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINV  395

Query  423  --LGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDNFKIN  480
              L +   P  S      E      V  P    +    Y N+N+        G  +F + 
Sbjct  396  IFLSDDASPKISESAQPGEFVARISVHDP----DSKTEYANVNVTL----NGGDGHFALT  447

Query  481  TRNGTLYLA---KSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKV  537
            TR+ ++YL      LDRE  S Y L V        +G P    PL A +          +
Sbjct  448  TRDNSIYLVIVHLPLDREIVSNYTLSVVA----TDKGTP----PLHASK---------SI  490

Query  538  IVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRAD  597
             +R+ DVNDN P+F  +     A +   A  G  ++++ A D DEG+N+ + Y +    +
Sbjct  491  FLRITDVNDNPPEFEQD--LYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPE  548

Query  598  GESRKFAIDALTGQV  612
              ++ F ID  TG +
Sbjct  549  THAQWFQIDPQTGLI  563


 Score = 125 bits (315),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 149/561 (27%), Positives = 235/561 (42%), Gaps = 96/561 (17%)

Query  73   LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHP  132
              T+PE+  VG S+L++ A D DA  N  + Y+I+             +   +  F I P
Sbjct  292  FATVPENATVGTSVLQVYASDTDADENGLVEYAINRR-----------QSDKEQMFRIDP  340

Query  133  TNGEVSVARVLPPETE--FRMNFTAIDGGG--LSDNVSVRIFVKDVNDHAPVFKKSWYMF  188
              G + + + L  ET+    +   A D G   L     V I V DVND+ P     +   
Sbjct  341  RTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD  400

Query  189  D----LKEGFYSGYIIGKVEATDADFGKN-AEISYTIIQNENSSTALPFKVSRSDGEIS-  242
            D    + E    G  + ++   D D     A ++ T+   +       F ++  D  I  
Sbjct  401  DASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH-----FALTTRDNSIYL  455

Query  243  --ASGNIDREFKDSYKFRIMARDGGKP--HKKNSIVVVEVDILDINDNAPTFYNYDHILQ  298
                  +DRE   +Y   ++A D G P  H   SI    + I D+NDN P          
Sbjct  456  VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIF---LRITDVNDNPP----------  502

Query  299  MYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFN  358
                      +F+Q         +Y+A+V+E +  GT V +V A+D D     N  L ++
Sbjct  503  ----------EFEQD--------LYHANVMEVADPGTSVLQVLAHDRD--EGLNSALTYS  542

Query  359  IPHQTDG-SDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVV  417
            +    +  +  F ID + GLI T   +D ET+    +T+VA D G P LSSTA + V++ 
Sbjct  543  LAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIH  602

Query  418  DVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN-  476
            DV +       P+F   +Y + V EN  V   IL ++ ++    +N         G  + 
Sbjct  603  DVND-----NEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL  657

Query  477  --FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANE  534
              F++ + +G + +A  LD E +S YE  V                 L  DR        
Sbjct  658  TEFEVRSASGEICIAGELDFERRSSYEFPV-----------------LATDRGGLSTTAM  700

Query  535  VKVIVRVKDVNDNAPKFVVNGRPI-VAAIPTSASYGYH--IVRLQATDADEGVNADIRYH  591
            +K  +++ DVNDN P F      + +   P ++S      IV + ATD D G    + Y 
Sbjct  701  IK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYR  758

Query  592  ILGRADGESRKFAIDALTGQV  612
            I+  A  E+  F ID  TG++
Sbjct  759  IV--AGNEAGIFRIDRSTGEI  777


 Score = 119 bits (299),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 144/574 (25%), Positives = 240/574 (42%), Gaps = 65/574 (11%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             I + T +G  +  ++A D D+G N  + Y I+               + +  F I+   G
Sbjct  1617  ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-------------NGEGRFRINSQTG  1663

Query  136   EVSVARVLPPETE-------FRMNFTAIDGGG---LSDNVSVRIFVKDVNDHAPVFKKSW  185
              + + + LPP TE       F +   A D G       ++++ + V+  +++ P F ++ 
Sbjct  1664  IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAV  1723

Query  186   YMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASG  245
             Y   + E   SG  + +V A      +NA +SY I     +     F V    G I+  G
Sbjct  1724  YRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRG  1780

Query  246   NIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVN  305
               DRE + SY   +  RD  +    +S  V +    D   +     ++D +  +Y    +
Sbjct  1781  QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFD-VATIYITVGD  1839

Query  306   VNDKFDQSANNLLLIP--IYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQT  363
             VND      N+    P   Y  SV ENS  G I + V+   SD     N  L+++I    
Sbjct  1840  VND------NSPEFRPGSCYGLSVPENSEPGVIHTVVA---SDLDEGPNADLIYSITGGN  1890

Query  364   DGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNP-SLSSTAILAVSVVDVQEQ  422
              G + F IDS  G + +   LD E  S Y + I ASD G P S      + + V D  + 
Sbjct  1891  LG-NKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDN  1948

Query  423   LGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTL-VPTAGSDNFKINT  481
                   P F    Y   V E++ +   ++ ++  +A   +N +    +       F I+ 
Sbjct  1949  A-----PRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDG  2003

Query  482   RNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRV  541
             ++G +     LDRE ++ Y   V       GR               ++ +  V V + V
Sbjct  2004  QSGLITTVGKLDRELQASYNFMVLAT--DGGR--------------YEVRSATVPVQINV  2047

Query  542   KDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESR  601
              D+NDN P F     P +  +P     G  ++++QA DAD G NA+I Y +       S 
Sbjct  2048  LDINDNRPIF--ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSA  2105

Query  602   KFAIDALTGQVRSIVSFAKDAGRVFGFDVKATDR  635
             KF I+  TG + +  S A ++G++   +V A D+
Sbjct  2106  KFRINPSTGALSASQSLASESGKLLHLEVVARDK  2139


 Score = 105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 128/500 (26%), Positives = 210/500 (42%), Gaps = 101/500 (20%)

Query  1    LNSEAKLTIYVDDVNDNAPNFLQLVALQDQDIEISEPTVPGAGDANMTSEELVHHL-STT  59
            L + A ++I V DVNDN P    +    D   +ISE   PG   A ++    VH   S T
Sbjct  373  LETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARIS----VHDPDSKT  428

Query  60   NFTNHDSILFMAP--LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTL  117
             + N +  L            D  + + I+ L   DR+  SN T++   + +        
Sbjct  429  EYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPL-DREIVSNYTLSVVATDKG-------  480

Query  118  GPPKPSSKSYFFIHPTNGEVSVARVLPPETEFRMNFTAIDGGGLSDNVSVRIFVKDVNDH  177
             PP  +SKS F                                        + + DVND+
Sbjct  481  TPPLHASKSIF----------------------------------------LRITDVNDN  500

Query  178  APVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRS  237
             P F++  Y  ++ E    G  + +V A D D G N+ ++Y++ +   +  A  F++   
Sbjct  501  PPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH-AQWFQIDPQ  559

Query  238  DGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHIL  297
             G I+   +ID E +   +  ++ARDGG P   +S   V V I D+NDN P         
Sbjct  560  TGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPI--------  610

Query  298  QMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLF  357
                        FDQS         Y  SV EN P G  + KVSA+D D     N ++ +
Sbjct  611  ------------FDQS--------FYNVSVAENEPVGRCILKVSASDPDC--GVNAMVNY  648

Query  358  NIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVV  417
             I         F + S  G I   G+LD+E +S Y   ++A+D G   LS+TA++ + + 
Sbjct  649  TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLT  706

Query  418  DVQEQLGEPQRPMFSHRYYELEVPENSEVPA-----PILHLNVTEA-YQNM-NLKFTLVP  470
            DV +      RP+F  R Y++ + E+ +  +     PI+ +  T+  Y N   + + +V 
Sbjct  707  DVND-----NRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVA  761

Query  471  TAGSDNFKINTRNGTLYLAK  490
               +  F+I+   G +++ +
Sbjct  762  GNEAGIFRIDRSTGEIFVVR  781


 Score = 105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 138/556 (25%), Positives = 233/556 (42%), Gaps = 91/556 (16%)

Query  73    LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHP  132
             + T+ E    G  + ++ A D DAGSNA + Y I    +              + F I P
Sbjct  2328  VATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH-------------DNAFVIEP  2374

Query  133   T-NGEVSVARVLPPETE--FRMNFTAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYM  187
               +G V    VL  E    +++   A D G   ++   ++R+ + DVND+ P F  +  +
Sbjct  2375  AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPN-NL  2433

Query  188   FDLKEGFYSGYIIGKVEATDAD------FGKNAEISYTIIQNENSSTALPFKVSRSDGEI  241
               + E    G +I  + A D D      +   AE +  I   EN S    F + R  G++
Sbjct  2434  VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDI---ENMSI---FALDRYSGKL  2487

Query  242   SASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQ  301
                  +D E +  Y+  ++A D    H+  +++ V V+  D NDNAP F           
Sbjct  2488  VLKRRLDYELQQEYELDVIASDAA--HEARTVLTVRVN--DENDNAPVFLA---------  2534

Query  302   NSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPH  361
                       Q      ++P   + + E+      +  V+A D+D +GN + ++    P 
Sbjct  2535  ---------QQPPAYFAILPAI-SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA  2584

Query  362   QTDGSDAFGIDSKEGLIRT-IGKLDYETQSG--YNVTIVASDMGNPSLSSTAILAVSVVD  418
             Q    + F +    G++   + +L     S   Y V I+A D G P+L S+ +L V   D
Sbjct  2585  Q----EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQAND  2640

Query  419   VQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN--  476
                      R  F    Y  ++ E + + + +L L      Q++ +       AG++   
Sbjct  2641  -----NGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI------IAGNEESA  2689

Query  477   FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVK  536
             F++  ++  + L K LDRE   LY+LR+ + H              P    +  +++ + 
Sbjct  2690  FEL-LQSKAIVLVKPLDRERNDLYKLRLVLSHPHG-----------PPLISSLNSSSGIS  2737

Query  537   VIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADE--GVNADIRYHILG  594
             VI+ + D NDN P F  + +   A I   A   Y I +LQA DAD+    N+++ Y I  
Sbjct  2738  VIITILDANDNFPIFDRSAK-YEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITS  2796

Query  595   RADGESRKFAIDALTG  610
               D     F ID +TG
Sbjct  2797  GND--EHMFTIDLVTG  2810


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/351 (26%), Positives = 151/351 (43%), Gaps = 52/351 (15%)

Query  148   EFRMNFTA--IDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEA  205
             E R+   A   D   L+    + I ++D ND++P F +  ++  + EG   G  + +V A
Sbjct  2287  EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHA  2346

Query  206   TDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGG  265
              D+D G NA + Y I+   N   A   + + S G +  +  +DRE +D YK +I+A D G
Sbjct  2347  FDSDAGSNARLRYHIVDG-NHDNAFVIEPAFS-GIVRTNIVLDREIRDIYKLKIIATDEG  2404

Query  266   KPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYA  325
              P    +   + V I+D+NDN PTF                        NNL+       
Sbjct  2405  VPQMTGT-ATIRVQIVDVNDNQPTF----------------------PPNNLV-------  2434

Query  326   SVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGIDSKEGLIRTIGKLD  385
             +V E +  G +++ +SAND D        L        +    F +D   G +    +LD
Sbjct  2435  TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLD  2494

Query  386   YETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHR----YYEL---  438
             YE Q  Y + ++ASD  +    +  +L V V D  +       P+F  +    Y+ +   
Sbjct  2495  YELQQEYELDVIASDAAH---EARTVLTVRVNDENDNA-----PVFLAQQPPAYFAILPA  2546

Query  439   --EVPENSEVPAPILHLNVTEA-YQNMNLKFTLVPTAGSDNFKINTRNGTL  486
               E+ E+  V   +L +N T+A  +  N K   +     + F ++  NG +
Sbjct  2547  ISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVV  2597


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 95/333 (29%), Positives = 151/333 (45%), Gaps = 59/333 (18%)

Query  286   NAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDS  345
             +AP   +Y  ++   ++  + + KF Q          + A+V E +  GT V++V A DS
Sbjct  2298  DAPFLASYAELVIELEDENDNSPKFSQKQ--------FVATVSEGNNKGTFVAQVHAFDS  2349

Query  346   DFQGNGNGLLLFNIPHQTDGS--DAFGIDSK-EGLIRTIGKLDYETQSGYNVTIVASDMG  402
             D     N  L +   H  DG+  +AF I+    G++RT   LD E +  Y + I+A+D G
Sbjct  2350  D--AGSNARLRY---HIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG  2404

Query  403   NPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHL--NVTEAYQ  460
              P ++ TA + V +VDV +      +P F      + V E +E+ A I  +  N  + Y 
Sbjct  2405  VPQMTGTATIRVQIVDVNDN-----QPTFPPNNL-VTVSEATELGAVITSISANDVDTYP  2458

Query  461   NMNLKFTLVPTAGSDN---FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPV  517
              +  +     T   +N   F ++  +G L L + LD E +  YEL               
Sbjct  2459  ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYEL---------------  2503

Query  518   LLYPLPADRLADLAANEVKVI--VRVKDVNDNAPKFVVNG-------RPIVAAIPTSASY  568
                    D +A  AA+E + +  VRV D NDNAP F+           P ++ I  S S 
Sbjct  2504  -------DVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSV  2556

Query  569   GYHIVRLQATDAD-EGVNADIRYHILGRADGES  600
              + ++ + ATDAD EG N+ + Y I    +G S
Sbjct  2557  DFDLLTVNATDADSEGNNSKVIYIIEPAQEGFS  2589


 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 97/217 (45%), Gaps = 30/217 (14%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             + E+ PVG S+ R  A D D G    + YSI            P   SS   F +   +G
Sbjct  2871  LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGP---------APSDESSWKMFRVDSESG  2921

Query  136   EVSVARVLPPETEFR--MNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKE-  192
              V+ A V   E   R  M   A D GG   +V+VR+ ++  ++  P F +  Y F L   
Sbjct  2922  LVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAA  2981

Query  193   -GFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEI----------  241
                  GY++G+V ATD+D G +  + Y +     S+    FKV+RS G +          
Sbjct  2982  VALPQGYVVGQVTATDSDSGPDGRVVYQL-----SAPHSHFKVNRSSGAVLIKRKLKLDG  3036

Query  242   SASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEV  278
                GN+  + +D     +++   G+ +  +S+ VVE+
Sbjct  3037  DGDGNLYMDGRDIS--LVISASSGRHNSLSSMAVVEI  3071


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 137/337 (41%), Gaps = 53/337 (16%)

Query  167   VRIFVKDVNDHAPVFKKSW-YMFDLKEGFYSGYIIGKVEATDADFGK--NAEISYTIIQN  223
             V I + D ND+ P+F +S  Y  ++ E     Y I +++A DAD     N+E+ Y I   
Sbjct  2738  VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSG  2797

Query  224   ENSSTALPFKVSRSDGEISASGNIDREF-KDSYKFRIMARDGGKPHKKNSIVVVEVDILD  282
              +      F +    G +  +  +D +    SY+  I A D        S+    +++ D
Sbjct  2798  NDEHM---FTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHD  2854

Query  283   INDNAPTF--YNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKV  340
              NDN P F    Y H L                               EN P G+ V + 
Sbjct  2855  ENDNEPKFPLTEYVHFLA------------------------------ENEPVGSSVFRA  2884

Query  341   SANDSDFQGNGNGLLLFNI-PHQTDGSD--AFGIDSKEGLIRTIGKLDYETQSGYNVTIV  397
              A  SD      G L ++I P  +D S    F +DS+ GL+ +    DYE +  Y++ ++
Sbjct  2885  HA--SDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELL  2942

Query  398   ASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPIL--HLNV  455
             ASDMG    S         V V+ +  +   P F+ R Y   +P    +P   +   +  
Sbjct  2943  ASDMGGKKASVA-------VRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTA  2995

Query  456   TEAYQNMNLKFTLVPTAGSDNFKINTRNGTLYLAKSL  492
             T++    + +     +A   +FK+N  +G + + + L
Sbjct  2996  TDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKL  3032


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 118/540 (22%), Positives = 222/540 (41%), Gaps = 102/540 (19%)

Query  76    IPEDTPVGMSILRLLADDRDA-GSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTN  134
             I E   V   +L + A D D+ G+N+ + Y I              +P+ +  F +HP+N
Sbjct  2550  ISESLSVDFDLLTVNATDADSEGNNSKVIYII--------------EPAQEG-FSVHPSN  2594

Query  135   GEVSV--ARVLPPET---EFRMNFTAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYM  187
             G VSV  +R+ P  +   ++ +   A D G   L  +  +R+   D       F ++ Y 
Sbjct  2595  GVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYR  2654

Query  188   FDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNI  247
               + E    G ++ +        G++A      I   N  +A     S++   I     +
Sbjct  2655  AQISEAAPLGSVVLQ-------LGQDALDQSLAIIAGNEESAFELLQSKA---IVLVKPL  2704

Query  248   DREFKDSYKFR-IMARDGGKPHKKNSIVV----VEVDILDINDNAPTFYNYDHILQMYQN  302
             DRE  D YK R +++   G P   +        V + ILD NDN P F            
Sbjct  2705  DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF------------  2752

Query  303   SVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQ  362
                     D+SA        Y A + E +P    ++++ A D+D +   N  ++++I   
Sbjct  2753  --------DRSAK-------YEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI---  2794

Query  363   TDGSD--AFGIDSKEGLIRTIGKLDYETQS-GYNVTIVASDMGNP-SLSSTAILAVSVVD  418
             T G+D   F ID   G++    +LDY++ +  Y + I A D  +   L S     + + D
Sbjct  2795  TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHD  2854

Query  419   VQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNM--NLKFTLVPTAGSDN  476
               E   EP+ P+  + ++   + EN  V + +   + ++  +     L +++ P    ++
Sbjct  2855  --ENDNEPKFPLTEYVHF---LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDES  2909

Query  477   ----FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAA  532
                 F++++ +G +  A   D E++  Y++ +                 L +D     A+
Sbjct  2910  SWKMFRVDSESGLVTSAFVFDYEQRQRYDMEL-----------------LASDMGGKKAS  2952

Query  533   NEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHI  592
               V+V +  +D  +  P+F       V     +   GY + ++ ATD+D G +  + Y +
Sbjct  2953  VAVRVEIESRD--EFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL  3010


 Score = 51.2 bits (121),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 64/260 (25%), Positives = 112/260 (43%), Gaps = 46/260 (18%)

Query  168   RIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTI--IQNEN  225
             R+ + D ND+ P F  + Y+  L E    G  + +  A+D D G   +++Y+I    ++ 
Sbjct  2849  RLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDE  2908

Query  226   SSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDIND  285
             SS  + F+V    G ++++   D E +  Y   ++A D G    K + V V V+I   ++
Sbjct  2909  SSWKM-FRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG---GKKASVAVRVEIESRDE  2964

Query  286   NAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDS  345
               P F       + Y+                 ++P   A      P G +V +V+A DS
Sbjct  2965  FTPQFTE-----RTYR----------------FVLPAAVA-----LPQGYVVGQVTATDS  2998

Query  346   DFQGNGNGLLLFNIPHQTDGSDAFGIDSKEG--LIRTIGKLD-------YETQSGYNVTI  396
             D   +G  +   + PH       F ++   G  LI+   KLD       Y      ++ I
Sbjct  2999  DSGPDGRVVYQLSAPHS-----HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVI  3053

Query  397   VASDMGNPSLSSTAILAVSV  416
              AS   + SLSS A++ +++
Sbjct  3054  SASSGRHNSLSSMAVVEIAL  3073


>DS_DROME unnamed protein product
Length=3503

 Score = 190 bits (483),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 169/588 (29%), Positives = 267/588 (45%), Gaps = 82/588 (14%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             V + E   +   I+++ A D D G+NA I Y I  +  +  +T          +F I P 
Sbjct  990   VNVSESRSINAQIIQVNASDLDTGNNARITYRIV-DAGVDNVTNSISSSDVSQHFGIFPN  1048

Query  134   NGEVSVARVLPPETEFRMNFT--AIDGGGLSDNVSVRIFVK--DVNDHAPVFKKSWYMFD  189
             +G + +   L  ET  R   T  A D G  + +   R+ V+  D ND+ P F+KS Y F 
Sbjct  1049  SGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFR  1108

Query  190   LKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDR  249
             ++E    G ++G V A+D D G+NA I Y+++   +S     F+V    GEIS    +DR
Sbjct  1109  IEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS-----FQVHPVTGEISTREPLDR  1163

Query  250   EFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDK  309
             E ++ Y   + ARD G P  +++ V V + + D+NDNAP   +        Q  V     
Sbjct  1164  ELRELYDLVVEARDQGTP-VRSARVPVRIHVSDVNDNAPEIAD-------PQEDV-----  1210

Query  310   FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAF  369
                             SV E  P GT V +V A D D   N +          +DG   F
Sbjct  1211  ---------------VSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLF  1255

Query  370   GIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRP  429
              ID   G+IRT   LD+E +S Y + + ASD GNP   +  +L V V+D+ +      RP
Sbjct  1256  SIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLND-----NRP  1310

Query  430   MFSHRYYELEVPENS------------EVPAPILHLNVTEAYQNMNLKFTLVPTAG---S  474
              F+       V E++            E PA ++  +V E+++++ + +TL P       
Sbjct  1311  TFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIE  1370

Query  475   DNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANE  534
               F I+  +G L +A+ LDRE +S + L +R                L      +  ++ 
Sbjct  1371  AAFDIDRHSGNLVVARLLDREVQSEFRLEIRA---------------LDTTASNNPQSSA  1415

Query  535   VKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILG  594
             + V + V DVNDNAP++  +  PI   +  +   G  I    ATDAD G N D++Y ++ 
Sbjct  1416  ITVKIEVADVNDNAPEWPQD--PIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIR  1473

Query  595   RAD--GESRK-----FAIDALTGQVRSIVSFAKDAGRVFGFDVKATDR  635
                   ES++     F +D+LTG +        +A + +   V+A D+
Sbjct  1474  YFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ  1521


 Score = 147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 253/545 (46%), Gaps = 91/545 (17%)

Query  83   GMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNGEVSVARV  142
            G S+L++LA DRD G N+ + YS++ ET         P+  ++ +F I P  G ++    
Sbjct  467  GTSVLQVLAHDRDEGLNSALTYSLA-ET---------PETHAQ-WFQIDPQTGLITTRSH  515

Query  143  LPPETEF--RMNFTAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGY  198
            +  ETE   ++   A DGG   LS   +V + + DVND+ P+F +S+Y   + E    G 
Sbjct  516  IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGR  575

Query  199  IIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFKDSYKFR  258
             I KV A+D D G NA ++YTI   E       F+V  + GEI  +G +D E + SY+F 
Sbjct  576  CILKVSASDPDCGVNAMVNYTI--GEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFP  633

Query  259  IMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLL  318
            ++A D G     ++  ++++ + D+NDN P FY  +     Y+ S+  + K    A    
Sbjct  634  VLATDRG---GLSTTAMIKMQLTDVNDNRPVFYPRE-----YKVSLRESPKASSQA----  681

Query  319  LIPIYYASVLENSPTGTIVSKVSANDSDFQGNGN-GLLLFNIPHQTDGSDA--FGIDSKE  375
                          + T +  V A D D+   GN G + + I     G++A  F ID   
Sbjct  682  --------------SSTPIVAVVATDPDY---GNFGQVSYRI---VAGNEAGIFRIDRST  721

Query  376  GLIRTI--GKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSH  433
            G I  +    L   TQ  + + I A+D GN   ++ A++ +S++D  +     + P+F  
Sbjct  722  GEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQ-----RPPIFEK  776

Query  434  RYYELEVPENSEVPAPILHLNVTEAYQNMN----LKFTLVPTAGSDNFKINTRNGTLYLA  489
              Y   V E  ++P   +  +V  A  ++     +++++        F I T +G + +A
Sbjct  777  ARYNYYVKE--DIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIA  834

Query  490  KSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNAP  549
            K LD E KS   L +     +   G P +                 +V + V+DVNDNAP
Sbjct  835  KPLDHEAKSQVLLNI-----QATLGEPPVY-------------GHTQVNIEVEDVNDNAP  876

Query  550  KFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESRK--FAIDA  607
            +F      +  ++P SA  G  +    A D D G +  + Y ++     ES K  FAIDA
Sbjct  877  EF--EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLV----KESGKGLFAIDA  930

Query  608  LTGQV  612
             +G +
Sbjct  931  RSGHL  935


 Score = 147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 150/570 (26%), Positives = 249/570 (44%), Gaps = 77/570 (14%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             + ED P G  +  ++A   D    + + YSI S         G P      YF I   +G
Sbjct  783   VKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYS---------GDP----DGYFSIETNSG  829

Query  136   EVSVARVLPPE--TEFRMNFTAIDGG-GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKE  192
              + +A+ L  E  ++  +N  A  G   +  +  V I V+DVND+AP F+ S     + E
Sbjct  830   NIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPE  889

Query  193   GFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFK  252
                 G  +    A D D G + +++Y++++         F +    G +  S ++D E  
Sbjct  890   SAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGL---FAIDARSGHLILSQHLDYESS  946

Query  253   DSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQ  312
               +   + A DGG P    ++ ++ VD+ D+NDN P F   ++       SVNV++    
Sbjct  947   QRHTLIVTATDGGVPSLSTNLTIL-VDVQDVNDNPPVFEKDEY-------SVNVSESRSI  998

Query  313   SANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGID  372
             +A  + +     AS L+      I  ++   D+      N +        +D S  FGI 
Sbjct  999   NAQIIQV----NASDLDTGNNARITYRIV--DAGVDNVTNSI------SSSDVSQHFGIF  1046

Query  373   SKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFS  432
                G I     LD ET+  Y +T++A+D G P+  +   + V V+D  +       P F 
Sbjct  1047  PNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDAND-----NDPKFQ  1101

Query  433   HRYYELEVPENSE-------VPAPILHLNVTEAYQNMNLKFTLVPTAGSDNFKINTRNGT  485
                YE  + EN         V A  L L      +N  ++++L+P   S  F+++   G 
Sbjct  1102  KSKYEFRIEENLRRGSVVGVVTASDLDLG-----ENAAIRYSLLPINSS--FQVHPVTGE  1154

Query  486   LYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVN  545
             +   + LDRE + LY+L V      + +G PV              +  V V + V DVN
Sbjct  1155  ISTREPLDRELRELYDLVVEA----RDQGTPV-------------RSARVPVRIHVSDVN  1197

Query  546   DNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHIL-GRADGESRKFA  604
             DNAP+ + + +  V ++      G  +VR++A D D G NA I Y I+ GR       F+
Sbjct  1198  DNAPE-IADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFS  1256

Query  605   IDALTGQVRSIVSFAKDAGRVFGFDVKATD  634
             ID  +G +R+ V    +   ++   V A+D
Sbjct  1257  IDPTSGVIRTRVVLDHEERSIYRLGVAASD  1286


 Score = 142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 171/663 (26%), Positives = 283/663 (43%), Gaps = 113/663 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             + + E TPVG  I    A D D G+N  + Y +    Y P+  L   +  + S F +   
Sbjct  1439  LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIR--YFPQ--LNESQEQAMSLFRMDSL  1494

Query  134   NGEVSVARVLPPET--EFRMNFTAIDGGG-----LSDNVSVRIFVKDVNDHAPVF-----  181
              G +S+   L  E   E+ +   A+D        L  +V+VR+ + D NDHAP F     
Sbjct  1495  TGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNS  1554

Query  182   --KKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDG  239
                K+  +F + +    G ++  + A D D G N +++Y I           F+++   G
Sbjct  1555  SGGKTASLF-ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGR---FRINSQTG  1610

Query  240   EISASGNI-----DREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYD  294
              I    ++     D E    +   I A+D G+P  K S + + + +   ++N P F    
Sbjct  1611  IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRF----  1666

Query  295   HILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGL  354
                                     L  +Y A++LEN P+G+ V +V+A      G  N  
Sbjct  1667  ------------------------LQAVYRATILENVPSGSFVLQVTAK--SLHGAENAN  1700

Query  355   LLFNIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPS-LSSTAI--  411
             L + IP     +D F +D + G+I T G+ D E+Q+ Y + +   D    S LSS+A+  
Sbjct  1701  LSYEIPAGV-ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRK  1759

Query  412   --------------------LAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPIL  451
                                 + ++V DV +   E  RP      Y L VPENSE P  I 
Sbjct  1760  QRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPE-FRP---GSCYGLSVPENSE-PGVIH  1814

Query  452   HLNVTEAYQNMNLKFTLVPTAGS--DNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHH  509
              +  ++  +  N       T G+  + F I++ +G L  A+ LDRE+ S Y L+++    
Sbjct  1815  TVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELS-ARPLDREQHSRYTLQIQA---  1870

Query  510   KKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYG  569
                RG P                    + + V+D NDNAP+F ++      ++   A  G
Sbjct  1871  -SDRGQP------------KSRQGHCNITIFVEDQNDNAPRFKLSK--YTGSVQEDAPLG  1915

Query  570   YHIVRLQATDADEGVNADIRYHILGRADGESRKFAIDALTGQVRSIVSFAKDAGRVFGFD  629
               +V++ A DAD GVNA + Y +   A+    +FAID  +G + ++    ++    + F 
Sbjct  1916  TSVVQISAVDADLGVNARLVYSL---ANETQWQFAIDGQSGLITTVGKLDRELQASYNFM  1972

Query  630   VKATDRRGADDGRSAITNV-FNMFCCRTDLYLYAVDPLMNVVIDM-ETLQNVLRSKRADI  687
             V ATD  G  + RSA   V  N+     +  ++   P +  V  + +  Q +L+ +  D 
Sbjct  1973  VLATD-GGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDA  2031

Query  688   DRG  690
             D G
Sbjct  2032  DLG  2034


 Score = 142 bits (358),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 160/608 (26%), Positives = 272/608 (45%), Gaps = 107/608 (18%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             +++PE++  G+ I  ++A D D G NA + YSI+         LG       + F I  +
Sbjct  1802  LSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGN------LG-------NKFSIDSS  1847

Query  134   NGEVSVARVLPPE--TEFRMNFTAIDGG---GLSDNVSVRIFVKDVNDHAPVFKKSWYMF  188
             +GE+S AR L  E  + + +   A D G       + ++ IFV+D ND+AP FK S Y  
Sbjct  1848  SGELS-ARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTG  1906

Query  189   DLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNID  248
              ++E    G  + ++ A DAD G NA + Y++  NE   T   F +    G I+  G +D
Sbjct  1907  SVQEDAPLGTSVVQISAVDADLGVNARLVYSL-ANE---TQWQFAIDGQSGLITTVGKLD  1962

Query  249   REFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVND  308
             RE + SY F ++A DGG+   +++ V V++++LDINDN P F  Y +I Q+         
Sbjct  1963  RELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQV---------  2013

Query  309   KFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDA  368
                      L+ P            G  + KV A D+D   N   +   N    +  S  
Sbjct  2014  -------PALIQP------------GQTLLKVQALDADLGANAEIVYSLNA-ENSAVSAK  2053

Query  369   FGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQR  428
             F I+   G +     L  E+    ++ +VA D GNP  SS  ++ + + +  +  G P  
Sbjct  2054  FRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQ--GTPVL  2111

Query  429   PMFSHRYYELEVPENSEVPAPILHLNVTEA---YQNMNLKFTLVPTAGSDN--FKINTRN  483
               F +  Y + + ENS     +L +    +    Q +   F     AG+++    +++ +
Sbjct  2112  -RFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSF----GAGNEDGILSLDSLS  2166

Query  484   GTLYLAKS--LDREEKSLYEL----RVRVDHHKKGRGMPVLLYPLPADR-----------  526
             G + + K   LD +  S   +    R R  H+++         P  + R           
Sbjct  2167  GEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFA  2226

Query  527   LADLAANEVKV------------------IVRVKDVNDNAPKFVVNGRPIVAAIPTSASY  568
             L +   NE++V                  ++ ++D NDN+PKF  + +  VA +    + 
Sbjct  2227  LTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKF--SQKQFVATVSEGNNK  2284

Query  569   GYHIVRLQATDADEGVNADIRYHILGRADG-ESRKFAID-ALTGQVRSIVSFAKDAGRVF  626
             G  + ++ A D+D G NA +RYHI+   DG     F I+ A +G VR+ +   ++   ++
Sbjct  2285  GTFVAQVHAFDSDAGSNARLRYHIV---DGNHDNAFVIEPAFSGIVRTNIVLDREIRDIY  2341

Query  627   GFDVKATD  634
                + ATD
Sbjct  2342  KLKIIATD  2349


 Score = 134 bits (338),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 144/535 (27%), Positives = 228/535 (43%), Gaps = 91/535 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             V++ E+ PVG  IL++ A D D G NA + Y+I  E +              + F +   
Sbjct  565   VSVAENEPVGRCILKVSASDPDCGVNAMVNYTI-GEGF-----------KHLTEFEVRSA  612

Query  134   NGEVSVARVLPPE--TEFRMNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLK  191
             +GE+ +A  L  E  + +     A D GGLS    +++ + DVND+ PVF    Y   L+
Sbjct  613   SGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLR  672

Query  192   E-----GFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISA--S  244
             E        S   I  V ATD D+G   ++SY I+    +     F++ RS GEI     
Sbjct  673   ESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI---FRIDRSTGEIFVVRP  729

Query  245   GNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTF----YNYDHILQMY  300
               +    +  +   I A DGG   + N+  VV + I+D     P F    YNY       
Sbjct  730   DMLSVRTQPMHMLNISATDGGN-LRSNADAVVFLSIIDAMQRPPIFEKARYNY-------  781

Query  301   QNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIP  360
                                       V E+ P GT+V  V A   D        + ++I 
Sbjct  782   -------------------------YVKEDIPRGTVVGSVIAASGDVAHRSP--VRYSI-  813

Query  361   HQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQ  420
             +  D    F I++  G IR    LD+E +S   + I A+ +G P +     + + V DV 
Sbjct  814   YSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPVYGHTQVNIEVEDVN  872

Query  421   EQLGEPQRPMFSHRYYELEVPENSEVPAPIL--HLNVTEAYQNMNLKFTLVPTAGSDNFK  478
             +       P F      + VPE++E+ AP+   H +  ++  +  + ++LV  +G   F 
Sbjct  873   DNA-----PEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFA  927

Query  479   INTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVI  538
             I+ R+G L L++ LD E    + L V         G+P L             +  + ++
Sbjct  928   IDARSGHLILSQHLDYESSQRHTLIVTA----TDGGVPSL-------------STNLTIL  970

Query  539   VRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHIL  593
             V V+DVNDN P F  +   +   +  S S    I+++ A+D D G NA I Y I+
Sbjct  971   VDVQDVNDNPPVFEKDEYSV--NVSESRSINAQIIQVNASDLDTGNNARITYRIV  1023


 Score = 130 bits (326),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 151/546 (28%), Positives = 235/546 (43%), Gaps = 114/546 (21%)

Query  34    ISEPTVPGAGDANMTSEELVHHLSTTNFTNHDSILFMAPLV--TIPEDTPVGMSILRLLA  91
             + EP V G    N+  E++          N ++  F A +V  ++PE   +G  +    A
Sbjct  853   LGEPPVYGHTQVNIEVEDV----------NDNAPEFEASMVRISVPESAELGAPLYAAHA  902

Query  92    DDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNGEVSVARVLPPETEFRM  151
              D+D+GS+  + YS+  E             S K  F I   +G + +++ L  E+  R 
Sbjct  903   HDKDSGSSGQVTYSLVKE-------------SGKGLFAIDARSGHLILSQHLDYESSQRH  949

Query  152   NF--TAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATD  207
                 TA DGG   LS N+++ + V+DVND+ PVF+K  Y  ++ E       I +V A+D
Sbjct  950   TLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASD  1009

Query  208   ADFGKNAEISYTIIQ-------NENSSTALP--FKVSRSDGEISASGNIDREFKDSYKFR  258
              D G NA I+Y I+        N  SS+ +   F +  + G I     +DRE +D Y+  
Sbjct  1010  LDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLT  1069

Query  259   IMARDGGKP--HKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANN  316
             ++A D G P  H K  ++   V +LD NDN P                    KF +S   
Sbjct  1070  VLATDNGTPAAHAKTRVI---VRVLDANDNDP--------------------KFQKSK--  1104

Query  317   LLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGN---GLLLFNIPHQTDGSDAFGIDS  373
                   Y   + EN   G++V  V+A+D D   N      LL  N         +F +  
Sbjct  1105  ------YEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPIN--------SSFQVHP  1150

Query  374   KEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQE---QLGEPQRPM  430
               G I T   LD E +  Y++ + A D G P  S+   + + V DV +   ++ +PQ  +
Sbjct  1151  VTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDV  1210

Query  431   FSHRYYELEVPENSEVPAPILHLNVTEA--YQNMNLKFTLVPTAGSDN---FKINTRNGT  485
              S R    E P  +EV    + +   +    QN ++ +++V    SD    F I+  +G 
Sbjct  1211  VSVRE---EQPPGTEV----VRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGV  1263

Query  486   LYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVN  545
             +     LD EE+S+Y L V         G P    P    R+         + V V D+N
Sbjct  1264  IRTRVVLDHEERSIYRLGVAA----SDGGNP----PRETVRM---------LRVEVLDLN  1306

Query  546   DNAPKF  551
             DN P F
Sbjct  1307  DNRPTF  1312


 Score = 127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 208/495 (42%), Gaps = 78/495 (16%)

Query  135  GEVSVARVLPPETEFRMNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGF  194
            GE+     L  ET    +  AI   G   N+ V + VKD ND+AP F ++    +  E  
Sbjct  77   GEIRTKVKLDRETRASYSLVAIPLSG--RNIRVLVTVKDENDNAPTFPQTSMHIEFPENT  134

Query  195  YSGYIIGKVEATDADFGKNAEISYTIIQ-NENSSTALPFKVSRSDG----EISASGNIDR  249
                    + A D D        Y I+  N N +  L     R DG    ++  SG +DR
Sbjct  135  PREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRER-DGVLYLDLQISGFLDR  193

Query  250  EFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDK  309
            E    Y   I A DGG P  +   + V + I D+NDN P F                   
Sbjct  194  ETTPGYSLLIEALDGGTPPLRG-FMTVNITIQDVNDNQPIF-------------------  233

Query  310  FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNI-PHQTDGSDA  368
             +QS         Y+A+V EN+  GT V +V A+D+D   + NGL+ + I   Q+D    
Sbjct  234  -NQSR--------YFATVPENATVGTSVLQVYASDTD--ADENGLVEYAINRRQSDKEQM  282

Query  369  FGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQ------  422
            F ID + G I     LD+ET+  + + +VA D G   L +TA +++ V DV +       
Sbjct  283  FRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINV  342

Query  423  --LGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDNFKIN  480
              L +   P  S      E      V  P    +    Y N+N+        G  +F + 
Sbjct  343  IFLSDDASPKISESAQPGEFVARISVHDP----DSKTEYANVNVTL----NGGDGHFALT  394

Query  481  TRNGTLYLA---KSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKV  537
            TR+ ++YL      LDRE  S Y L V        +G P    PL A +          +
Sbjct  395  TRDNSIYLVIVHLPLDREIVSNYTLSVVA----TDKGTP----PLHASK---------SI  437

Query  538  IVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRAD  597
             +R+ DVNDN P+F        A +   A  G  ++++ A D DEG+N+ + Y +    +
Sbjct  438  FLRITDVNDNPPEF--EQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPE  495

Query  598  GESRKFAIDALTGQV  612
              ++ F ID  TG +
Sbjct  496  THAQWFQIDPQTGLI  510


 Score = 125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 149/561 (27%), Positives = 235/561 (42%), Gaps = 96/561 (17%)

Query  73   LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHP  132
              T+PE+  VG S+L++ A D DA  N  + Y+I+             +   +  F I P
Sbjct  239  FATVPENATVGTSVLQVYASDTDADENGLVEYAINRR-----------QSDKEQMFRIDP  287

Query  133  TNGEVSVARVLPPETE--FRMNFTAIDGGG--LSDNVSVRIFVKDVNDHAPVFKKSWYMF  188
              G + + + L  ET+    +   A D G   L     V I V DVND+ P     +   
Sbjct  288  RTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSD  347

Query  189  D----LKEGFYSGYIIGKVEATDADFGKN-AEISYTIIQNENSSTALPFKVSRSDGEIS-  242
            D    + E    G  + ++   D D     A ++ T+   +       F ++  D  I  
Sbjct  348  DASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGH-----FALTTRDNSIYL  402

Query  243  --ASGNIDREFKDSYKFRIMARDGGKP--HKKNSIVVVEVDILDINDNAPTFYNYDHILQ  298
                  +DRE   +Y   ++A D G P  H   SI    + I D+NDN P          
Sbjct  403  VIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIF---LRITDVNDNPP----------  449

Query  299  MYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFN  358
                      +F+Q         +Y+A+V+E +  GT V +V A+D D     N  L ++
Sbjct  450  ----------EFEQD--------LYHANVMEVADPGTSVLQVLAHDRD--EGLNSALTYS  489

Query  359  IPHQTDG-SDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVV  417
            +    +  +  F ID + GLI T   +D ET+    +T+VA D G P LSSTA + V++ 
Sbjct  490  LAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIH  549

Query  418  DVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN-  476
            DV +       P+F   +Y + V EN  V   IL ++ ++    +N         G  + 
Sbjct  550  DVND-----NEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHL  604

Query  477  --FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANE  534
              F++ + +G + +A  LD E +S YE  V                 L  DR        
Sbjct  605  TEFEVRSASGEICIAGELDFERRSSYEFPV-----------------LATDRGGLSTTAM  647

Query  535  VKVIVRVKDVNDNAPKFVVNGRPI-VAAIPTSASYGYH--IVRLQATDADEGVNADIRYH  591
            +K  +++ DVNDN P F      + +   P ++S      IV + ATD D G    + Y 
Sbjct  648  IK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYR  705

Query  592  ILGRADGESRKFAIDALTGQV  612
            I+  A  E+  F ID  TG++
Sbjct  706  IV--AGNEAGIFRIDRSTGEI  724


 Score = 119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 144/574 (25%), Positives = 240/574 (42%), Gaps = 65/574 (11%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             I + T +G  +  ++A D D+G N  + Y I+               + +  F I+   G
Sbjct  1564  ISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG-------------NGEGRFRINSQTG  1610

Query  136   EVSVARVLPPETE-------FRMNFTAIDGGG---LSDNVSVRIFVKDVNDHAPVFKKSW  185
              + + + LPP TE       F +   A D G       ++++ + V+  +++ P F ++ 
Sbjct  1611  IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAV  1670

Query  186   YMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASG  245
             Y   + E   SG  + +V A      +NA +SY I     +     F V    G I+  G
Sbjct  1671  YRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRG  1727

Query  246   NIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVN  305
               DRE + SY   +  RD  +    +S  V +    D   +     ++D +  +Y    +
Sbjct  1728  QFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFD-VATIYITVGD  1786

Query  306   VNDKFDQSANNLLLIP--IYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQT  363
             VND      N+    P   Y  SV ENS  G I + V+   SD     N  L+++I    
Sbjct  1787  VND------NSPEFRPGSCYGLSVPENSEPGVIHTVVA---SDLDEGPNADLIYSITGGN  1837

Query  364   DGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNP-SLSSTAILAVSVVDVQEQ  422
              G + F IDS  G + +   LD E  S Y + I ASD G P S      + + V D  + 
Sbjct  1838  LG-NKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDN  1895

Query  423   LGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTL-VPTAGSDNFKINT  481
                   P F    Y   V E++ +   ++ ++  +A   +N +    +       F I+ 
Sbjct  1896  A-----PRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDG  1950

Query  482   RNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRV  541
             ++G +     LDRE ++ Y   V       GR               ++ +  V V + V
Sbjct  1951  QSGLITTVGKLDRELQASYNFMVLAT--DGGR--------------YEVRSATVPVQINV  1994

Query  542   KDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESR  601
              D+NDN P F     P +  +P     G  ++++QA DAD G NA+I Y +       S 
Sbjct  1995  LDINDNRPIF--ERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSA  2052

Query  602   KFAIDALTGQVRSIVSFAKDAGRVFGFDVKATDR  635
             KF I+  TG + +  S A ++G++   +V A D+
Sbjct  2053  KFRINPSTGALSASQSLASESGKLLHLEVVARDK  2086


 Score = 105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 128/500 (26%), Positives = 210/500 (42%), Gaps = 101/500 (20%)

Query  1    LNSEAKLTIYVDDVNDNAPNFLQLVALQDQDIEISEPTVPGAGDANMTSEELVHHL-STT  59
            L + A ++I V DVNDN P    +    D   +ISE   PG   A ++    VH   S T
Sbjct  320  LETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARIS----VHDPDSKT  375

Query  60   NFTNHDSILFMAP--LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTL  117
             + N +  L            D  + + I+ L   DR+  SN T++   + +        
Sbjct  376  EYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPL-DREIVSNYTLSVVATDKGT------  428

Query  118  GPPKPSSKSYFFIHPTNGEVSVARVLPPETEFRMNFTAIDGGGLSDNVSVRIFVKDVNDH  177
             PP  +SKS F                                        + + DVND+
Sbjct  429  -PPLHASKSIF----------------------------------------LRITDVNDN  447

Query  178  APVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRS  237
             P F++  Y  ++ E    G  + +V A D D G N+ ++Y++ +   +  A  F++   
Sbjct  448  PPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETH-AQWFQIDPQ  506

Query  238  DGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHIL  297
             G I+   +ID E +   +  ++ARDGG P   +S   V V I D+NDN P         
Sbjct  507  TGLITTRSHIDCETEPVPQLTVVARDGGVP-PLSSTATVLVTIHDVNDNEPI--------  557

Query  298  QMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLF  357
                        FDQS         Y  SV EN P G  + KVSA+D D     N ++ +
Sbjct  558  ------------FDQS--------FYNVSVAENEPVGRCILKVSASDPDC--GVNAMVNY  595

Query  358  NIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVV  417
             I         F + S  G I   G+LD+E +S Y   ++A+D G   LS+TA++ + + 
Sbjct  596  TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRG--GLSTTAMIKMQLT  653

Query  418  DVQEQLGEPQRPMFSHRYYELEVPENSEVPA-----PILHLNVTEA-YQNM-NLKFTLVP  470
            DV +      RP+F  R Y++ + E+ +  +     PI+ +  T+  Y N   + + +V 
Sbjct  654  DVND-----NRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVA  708

Query  471  TAGSDNFKINTRNGTLYLAK  490
               +  F+I+   G +++ +
Sbjct  709  GNEAGIFRIDRSTGEIFVVR  728


 Score = 104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 138/556 (25%), Positives = 233/556 (42%), Gaps = 91/556 (16%)

Query  73    LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHP  132
             + T+ E    G  + ++ A D DAGSNA + Y I    +              + F I P
Sbjct  2275  VATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH-------------DNAFVIEP  2321

Query  133   T-NGEVSVARVLPPETE--FRMNFTAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYM  187
               +G V    VL  E    +++   A D G   ++   ++R+ + DVND+ P F  +  +
Sbjct  2322  AFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPN-NL  2380

Query  188   FDLKEGFYSGYIIGKVEATDAD------FGKNAEISYTIIQNENSSTALPFKVSRSDGEI  241
               + E    G +I  + A D D      +   AE +  I   EN S    F + R  G++
Sbjct  2381  VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDI---ENMSI---FALDRYSGKL  2434

Query  242   SASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQ  301
                  +D E +  Y+  ++A D    H+  +++ V V+  D NDNAP F           
Sbjct  2435  VLKRRLDYELQQEYELDVIASDAA--HEARTVLTVRVN--DENDNAPVFLA---------  2481

Query  302   NSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPH  361
                       Q      ++P   + + E+      +  V+A D+D +GN + ++    P 
Sbjct  2482  ---------QQPPAYFAILPAI-SEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPA  2531

Query  362   QTDGSDAFGIDSKEGLIRT-IGKLDYETQSG--YNVTIVASDMGNPSLSSTAILAVSVVD  418
             Q    + F +    G++   + +L     S   Y V I+A D G P+L S+ +L V   D
Sbjct  2532  Q----EGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQAND  2587

Query  419   VQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN--  476
                      R  F    Y  ++ E + + + +L L      Q++ +       AG++   
Sbjct  2588  -----NGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI------IAGNEESA  2636

Query  477   FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVK  536
             F++  ++  + L K LDRE   LY+LR+ + H              P    +  +++ + 
Sbjct  2637  FEL-LQSKAIVLVKPLDRERNDLYKLRLVLSHPHG-----------PPLISSLNSSSGIS  2684

Query  537   VIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADE--GVNADIRYHILG  594
             VI+ + D NDN P F  + +   A I   A   Y I +LQA DAD+    N+++ Y I  
Sbjct  2685  VIITILDANDNFPIFDRSAK-YEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITS  2743

Query  595   RADGESRKFAIDALTG  610
               D     F ID +TG
Sbjct  2744  GND--EHMFTIDLVTG  2757


 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 90/351 (26%), Positives = 151/351 (43%), Gaps = 52/351 (15%)

Query  148   EFRMNFTA--IDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEA  205
             E R+   A   D   L+    + I ++D ND++P F +  ++  + EG   G  + +V A
Sbjct  2234  EIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHA  2293

Query  206   TDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGG  265
              D+D G NA + Y I+   N   A   + + S G +  +  +DRE +D YK +I+A D G
Sbjct  2294  FDSDAGSNARLRYHIVDG-NHDNAFVIEPAFS-GIVRTNIVLDREIRDIYKLKIIATDEG  2351

Query  266   KPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYA  325
              P    +   + V I+D+NDN PTF                        NNL+       
Sbjct  2352  VPQMTGT-ATIRVQIVDVNDNQPTF----------------------PPNNLV-------  2381

Query  326   SVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGIDSKEGLIRTIGKLD  385
             +V E +  G +++ +SAND D        L        +    F +D   G +    +LD
Sbjct  2382  TVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLD  2441

Query  386   YETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHR----YYEL---  438
             YE Q  Y + ++ASD  +    +  +L V V D  +       P+F  +    Y+ +   
Sbjct  2442  YELQQEYELDVIASDAAH---EARTVLTVRVNDENDNA-----PVFLAQQPPAYFAILPA  2493

Query  439   --EVPENSEVPAPILHLNVTEA-YQNMNLKFTLVPTAGSDNFKINTRNGTL  486
               E+ E+  V   +L +N T+A  +  N K   +     + F ++  NG +
Sbjct  2494  ISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVV  2544


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 95/333 (29%), Positives = 151/333 (45%), Gaps = 59/333 (18%)

Query  286   NAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDS  345
             +AP   +Y  ++   ++  + + KF Q          + A+V E +  GT V++V A DS
Sbjct  2245  DAPFLASYAELVIELEDENDNSPKFSQKQ--------FVATVSEGNNKGTFVAQVHAFDS  2296

Query  346   DFQGNGNGLLLFNIPHQTDGS--DAFGIDSK-EGLIRTIGKLDYETQSGYNVTIVASDMG  402
             D     N  L +   H  DG+  +AF I+    G++RT   LD E +  Y + I+A+D G
Sbjct  2297  D--AGSNARLRY---HIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEG  2351

Query  403   NPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHL--NVTEAYQ  460
              P ++ TA + V +VDV +      +P F      + V E +E+ A I  +  N  + Y 
Sbjct  2352  VPQMTGTATIRVQIVDVNDN-----QPTFPPNNL-VTVSEATELGAVITSISANDVDTYP  2405

Query  461   NMNLKFTLVPTAGSDN---FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPV  517
              +  +     T   +N   F ++  +G L L + LD E +  YEL               
Sbjct  2406  ALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYEL---------------  2450

Query  518   LLYPLPADRLADLAANEVKVI--VRVKDVNDNAPKFVVNG-------RPIVAAIPTSASY  568
                    D +A  AA+E + +  VRV D NDNAP F+           P ++ I  S S 
Sbjct  2451  -------DVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSV  2503

Query  569   GYHIVRLQATDAD-EGVNADIRYHILGRADGES  600
              + ++ + ATDAD EG N+ + Y I    +G S
Sbjct  2504  DFDLLTVNATDADSEGNNSKVIYIIEPAQEGFS  2536


 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 97/217 (45%), Gaps = 30/217 (14%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             + E+ PVG S+ R  A D D G    + YSI            P   SS   F +   +G
Sbjct  2818  LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGP---------APSDESSWKMFRVDSESG  2868

Query  136   EVSVARVLPPETEFR--MNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKE-  192
              V+ A V   E   R  M   A D GG   +V+VR+ ++  ++  P F +  Y F L   
Sbjct  2869  LVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAA  2928

Query  193   -GFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEI----------  241
                  GY++G+V ATD+D G +  + Y +     S+    FKV+RS G +          
Sbjct  2929  VALPQGYVVGQVTATDSDSGPDGRVVYQL-----SAPHSHFKVNRSSGAVLIKRKLKLDG  2983

Query  242   SASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEV  278
                GN+  + +D     +++   G+ +  +S+ VVE+
Sbjct  2984  DGDGNLYMDGRDIS--LVISASSGRHNSLSSMAVVEI  3018


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 80/337 (24%), Positives = 134/337 (40%), Gaps = 53/337 (16%)

Query  167   VRIFVKDVNDHAPVFKKSW-YMFDLKEGFYSGYIIGKVEATDADFGK--NAEISYTIIQN  223
             V I + D ND+ P+F +S  Y  ++ E     Y I +++A DAD     N+E+ Y I   
Sbjct  2685  VIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSG  2744

Query  224   ENSSTALPFKVSRSDGEISASGNIDREF-KDSYKFRIMARDGGKPHKKNSIVVVEVDILD  282
              +      F +    G +  +  +D +    SY+  I A D        S+    +++ D
Sbjct  2745  NDEHM---FTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHD  2801

Query  283   INDNAPTF--YNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKV  340
              NDN P F    Y H L                               EN P G+ V + 
Sbjct  2802  ENDNEPKFPLTEYVHFLA------------------------------ENEPVGSSVFRA  2831

Query  341   SANDSDFQGNGNGLLLFNI---PHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIV  397
              A  SD      G L ++I   P        F +DS+ GL+ +    DYE +  Y++ ++
Sbjct  2832  HA--SDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELL  2889

Query  398   ASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPIL--HLNV  455
             ASDMG    S         V V+ +  +   P F+ R Y   +P    +P   +   +  
Sbjct  2890  ASDMGGKKASVA-------VRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTA  2942

Query  456   TEAYQNMNLKFTLVPTAGSDNFKINTRNGTLYLAKSL  492
             T++    + +     +A   +FK+N  +G + + + L
Sbjct  2943  TDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKL  2979


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 118/540 (22%), Positives = 222/540 (41%), Gaps = 102/540 (19%)

Query  76    IPEDTPVGMSILRLLADDRDA-GSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTN  134
             I E   V   +L + A D D+ G+N+ + Y I              +P+ +  F +HP+N
Sbjct  2497  ISESLSVDFDLLTVNATDADSEGNNSKVIYII--------------EPAQEG-FSVHPSN  2541

Query  135   GEVSV--ARVLPPET---EFRMNFTAIDGG--GLSDNVSVRIFVKDVNDHAPVFKKSWYM  187
             G VSV  +R+ P  +   ++ +   A D G   L  +  +R+   D       F ++ Y 
Sbjct  2542  GVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYR  2601

Query  188   FDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNI  247
               + E    G ++ +        G++A      I   N  +A     S++   I     +
Sbjct  2602  AQISEAAPLGSVVLQ-------LGQDALDQSLAIIAGNEESAFELLQSKA---IVLVKPL  2651

Query  248   DREFKDSYKFR-IMARDGGKPHKKNSIVV----VEVDILDINDNAPTFYNYDHILQMYQN  302
             DRE  D YK R +++   G P   +        V + ILD NDN P F            
Sbjct  2652  DRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF------------  2699

Query  303   SVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQ  362
                     D+SA        Y A + E +P    ++++ A D+D +   N  ++++I   
Sbjct  2700  --------DRSAK-------YEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDI---  2741

Query  363   TDGSD--AFGIDSKEGLIRTIGKLDYETQS-GYNVTIVASDMGNP-SLSSTAILAVSVVD  418
             T G+D   F ID   G++    +LDY++ +  Y + I A D  +   L S     + + D
Sbjct  2742  TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHD  2801

Query  419   VQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNM--NLKFTLVPTAGSDN  476
               E   EP+ P+  + ++   + EN  V + +   + ++  +     L +++ P    ++
Sbjct  2802  --ENDNEPKFPLTEYVHF---LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDES  2856

Query  477   ----FKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAA  532
                 F++++ +G +  A   D E++  Y++ +                 L +D     A+
Sbjct  2857  SWKMFRVDSESGLVTSAFVFDYEQRQRYDMEL-----------------LASDMGGKKAS  2899

Query  533   NEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHI  592
               V+V +  +D  +  P+F       V     +   GY + ++ ATD+D G +  + Y +
Sbjct  2900  VAVRVEIESRD--EFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL  2957


 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 64/260 (25%), Positives = 112/260 (43%), Gaps = 46/260 (18%)

Query  168   RIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTI--IQNEN  225
             R+ + D ND+ P F  + Y+  L E    G  + +  A+D D G   +++Y+I    ++ 
Sbjct  2796  RLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDE  2855

Query  226   SSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDIND  285
             SS  + F+V    G ++++   D E +  Y   ++A D G    K + V V V+I   ++
Sbjct  2856  SSWKM-FRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG---GKKASVAVRVEIESRDE  2911

Query  286   NAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDS  345
               P F       + Y+                 ++P   A      P G +V +V+A DS
Sbjct  2912  FTPQFTE-----RTYR----------------FVLPAAVA-----LPQGYVVGQVTATDS  2945

Query  346   DFQGNGNGLLLFNIPHQTDGSDAFGIDSKEG--LIRTIGKLD-------YETQSGYNVTI  396
             D   +G  +   + PH       F ++   G  LI+   KLD       Y      ++ I
Sbjct  2946  DSGPDGRVVYQLSAPHS-----HFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGRDISLVI  3000

Query  397   VASDMGNPSLSSTAILAVSV  416
              AS   + SLSS A++ +++
Sbjct  3001  SASSGRHNSLSSMAVVEIAL  3020


>FAT2_DROME unnamed protein product
Length=4699

 Score = 171 bits (434),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 162/553 (29%), Positives = 252/553 (46%), Gaps = 91/553 (16%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             ++I E   +G ++  + A DRD G N  + ++IS   Y              S F I P 
Sbjct  779   LSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDY-------------DSVFRIDPD  825

Query  134   NGEVSVARVLPPE--TEFRMNFTAIDGGGLSDNVS--VRIFVKDVNDHAPVFKKSWYMFD  189
              GE+ +   L  E   E+ +N T  D G  + + S  + I + DVND+ PV +K+   F 
Sbjct  826   RGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFR  885

Query  190   LKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDR  249
             L E    G ++  + ATDAD G NA+++Y +     S     F V+ + G +  +  +DR
Sbjct  886   LTESARIGTVVHCLHATDADSGINAQVTYAL-----SVECSDFTVNATTGCLRLNKPLDR  940

Query  250   EFKDSYKFRIMARDGGKP-HKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVND  308
             E +D+Y   I A+DGG P     ++V V VD  D+NDNAP F   ++I +          
Sbjct  941   EKQDNYALHITAKDGGSPVLSSEALVYVLVD--DVNDNAPVFGVQEYIFK----------  988

Query  309   KFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDA  368
                               V E+ P GT+++ + A D D   N    + F++  +T   + 
Sbjct  989   ------------------VREDLPRGTVLAVIEAVDEDIGPNAE--IQFSLKEETQDEEL  1028

Query  369   FGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQR  428
             F ID   G IRT G LDYE +  +N+ + A D G+PSL+S   + + ++DV E    P+ 
Sbjct  1029  FRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPE-  1087

Query  429   PMFSHRYYELEVPENSEVPAPILHLNVTEAYQ---NMNLKFTLVPTAGS--DNFKINTRN  483
               F    YE +V EN   P     +NVT       ++N K T   T G     F +N + 
Sbjct  1088  --FDDFVYEGKVKENK--PKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-  1142

Query  484   GTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKD  543
             G++     LD E K+ Y L +              + PL         +N V+V ++V++
Sbjct  1143  GSITSLSQLDAETKNFYWLTL--------CAQDCAIVPL---------SNCVEVYIQVEN  1185

Query  544   VNDNAPKFVVNGRPIVAAIPTSASY-GYHIVRLQATDADEGVNADIRYHIL-GRADGESR  601
              NDN P   +  +P+     T AS     I+ L+A D D      I Y+I+ G   G   
Sbjct  1186  ENDNIP---LTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVG---  1239

Query  602   KFAIDALTGQVRS  614
              F ID+ TG +++
Sbjct  1240  YFEIDSKTGVIKT  1252


 Score = 162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 154/568 (27%), Positives = 255/568 (45%), Gaps = 86/568 (15%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             + E   +G  +  L A D D+G NA + Y++S E                S F ++ T G
Sbjct  886   LTESARIGTVVHCLHATDADSGINAQVTYALSVEC---------------SDFTVNATTG  930

Query  136   EVSVARVLPPETE--FRMNFTAIDGGG--LSDNVSVRIFVKDVNDHAPVFKKSWYMFDLK  191
              + + + L  E +  + ++ TA DGG   LS    V + V DVND+APVF    Y+F ++
Sbjct  931   CLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVR  990

Query  192   EGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREF  251
             E    G ++  +EA D D G NAEI +++   E +     F++ +  G I   G +D E 
Sbjct  991   EDLPRGTVLAVIEAVDEDIGPNAEIQFSL--KEETQDEELFRIDKHTGAIRTQGYLDYEN  1048

Query  252   KDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDN--APTFYNYDHILQMYQNSVNVNDK  309
             K  +   + A DGG P   + + +V + I+D+N+N  AP F                 D 
Sbjct  1049  KQVHNLIVSAIDGGDPSLTSDMSIV-IMIIDVNENRFAPEF-----------------DD  1090

Query  310   FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAF  369
             F           +Y   V EN P GT V  V+A D D        L   I +   G D  
Sbjct  1091  F-----------VYEGKVKENKPKGTFVMNVTARDMDTVD-----LNSKITYSITGGDGL  1134

Query  370   GIDS--KEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQ  427
             GI +   +G I ++ +LD ET++ Y +T+ A D     LS+   + + V +  + +    
Sbjct  1135  GIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTD  1194

Query  428   RPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDNFKINTRNGTLY  487
             +P++     E  V EN E+    L     +      + + +V       F+I+++ G + 
Sbjct  1195  KPVYYVNVTEASV-ENVEIIT--LKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIK  1251

Query  488   LA-KSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVND  546
                + LDRE ++ + L V +  +    G PVL             ++  +++V V D+ND
Sbjct  1252  TTERKLDRENQAEHILEVAISDN----GSPVL-------------SSTSRIVVSVLDIND  1294

Query  547   NAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESRKFAID  606
             N+P+F  + R     +P+SA+    I ++ A D+D G N  I Y I  ++     KF ID
Sbjct  1295  NSPEF--DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI--KSGKGKNKFRID  1350

Query  607   ALTGQVRSIVSFAKDAGRVFGFDVKATD  634
             +  G +   ++   D+   F   +KA D
Sbjct  1351  SQRGHIH--IAKPLDSDNEFEIHIKAED  1376


 Score = 147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 147/513 (29%), Positives = 222/513 (43%), Gaps = 68/513 (13%)

Query  128   FFIHPTNGEVSVARVLPPET--EFRMNFTAIDGGGLSDNV--SVRIFVKDVNDHAPVFKK  183
             F I   +G + VA  L  ET  ++++     DG   +      + I V D+ND+ P+F  
Sbjct  3112  FSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSM  3171

Query  184   SWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISA  243
             + Y   + E      +I KV A D DFG N +I Y+++  EN      FK+S+S G I  
Sbjct  3172  AQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDY---FKISKSTGIIRL  3227

Query  244   SGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNS  303
               ++DRE    +   + A D G P K +SI  V V+ILDINDN P F        M Q  
Sbjct  3228  HKSLDRETISLFNLTVKAEDCGVP-KLHSIATVAVNILDINDNPPEF-------SMRQ--  3277

Query  304   VNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQT  363
                                Y   +LEN+  GT V KV A   D   N + +  F +    
Sbjct  3278  -------------------YSCKILENATHGTEVCKVYATSIDIGVNAD-IHYFIMSGNE  3317

Query  364   DGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQL  423
              G   F +DS  G +     LDYE    Y +TI A D G P LS+ A + +S++D+ +  
Sbjct  3318  QGK--FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDN-  3374

Query  424   GEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSD--NFKINT  481
                  P F    Y + V E+  V + IL +  T+   ++N   T     G +   F I+ 
Sbjct  3375  ----SPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDP  3430

Query  482   RNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRV  541
             +NGT+ +++ LDRE  S Y L ++                   D+      N V + + +
Sbjct  3431  KNGTISVSRPLDRETISHYTLEIQA-----------------CDQGDPQRCNSVPININI  3473

Query  542   KDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESR  601
              D NDNAP F  +   +V  +  +   GY  +  + +DADE  N    Y    R+  E  
Sbjct  3474  LDTNDNAPIFSSSNYSVV--LQENRLLGYVFLTFKISDADETPNT-TPYTFDIRSGNEGG  3530

Query  602   KFAIDALTGQVRSIVSFAKDAGRVFGFDVKATD  634
              F ++   G +R+   F  +    F   V+  D
Sbjct  3531  LFRLEQ-DGSLRTASRFNHNLQDEFVIQVRVFD  3562


 Score = 128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 132/471 (28%), Positives = 210/471 (45%), Gaps = 66/471 (14%)

Query  46    NMTSEELVHHLSTTNFTNHDSILF-MAPL-VTIPEDTPVGMSILRLLADDRDAGSNATIA  103
             + T E     + T N  N +  +F MA   V++PED  +   I ++ A D+D G N  I 
Sbjct  3146  DFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIK  3205

Query  104   YSISSETYIPKMTLGPPKPSSKSYFFIHPTNGEVSVARVLPPET--EFRMNFTAIDGG--  159
             YS+  E +               YF I  + G + + + L  ET   F +   A D G  
Sbjct  3206  YSLMGENH--------------DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVP  3251

Query  160   GLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYT  219
              L    +V + + D+ND+ P F    Y   + E    G  + KV AT  D G NA+I Y 
Sbjct  3252  KLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYF  3311

Query  220   IIQ-NENSSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEV  278
             I+  NE       FK+  + G++  +  +D E    Y   I A DGG P   N+   V +
Sbjct  3312  IMSGNEQGK----FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNN-AYVNI  3366

Query  279   DILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVS  338
              ILDINDN+PTF     +  +Y+  +NVN                     E+   G+ + 
Sbjct  3367  SILDINDNSPTF-----LQNLYR--INVN---------------------EDIFVGSKIL  3398

Query  339   KVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVA  398
              V A D D   + NGL+ +NI  + D    F ID K G I     LD ET S Y + I A
Sbjct  3399  DVKATDED--SDVNGLVTYNI-ERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQA  3455

Query  399   SDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEA  458
              D G+P   ++  + ++++D  +       P+FS   Y + + EN  +    L   +++A
Sbjct  3456  CDQGDPQRCNSVPININILDTND-----NAPIFSSSNYSVVLQENRLLGYVFLTFKISDA  3510

Query  459   YQNMNLK-FTLVPTAGSDN--FKINTRNGTLYLAKSLDREEKSLYELRVRV  506
              +  N   +T    +G++   F++  ++G+L  A   +   +  + ++VRV
Sbjct  3511  DETPNTTPYTFDIRSGNEGGLFRLE-QDGSLRTASRFNHNLQDEFVIQVRV  3560


 Score = 128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 134/507 (26%), Positives = 215/507 (42%), Gaps = 74/507 (15%)

Query  135   GEVSVARVLPPETEFRMNFTAI-DGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEG  193
             GE+ +A+ L  E     N + I   G  +   +V I VKD+ND+ P   K  Y     E 
Sbjct  3020  GELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNES  3079

Query  194   FYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFKD  253
                G  + +V+A D DF   +++ + +    +   A  F + +  G +  +  +DRE   
Sbjct  3080  ISIGTTLVEVKAIDFDF--QSKLRFYL----SGKGADDFSIGKESGILKVASALDRETTP  3133

Query  254   SYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQS  313
              YK     +DG K   +     + + + DINDN P F        M Q            
Sbjct  3134  KYKLVAHVQDG-KDFTQECFSEIIITVNDINDNMPIF-------SMAQ------------  3173

Query  314   ANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGS--DAFGI  371
                      Y  SV E++   T+++KV A D DF  N        I +   G   D F I
Sbjct  3174  ---------YRVSVPEDAQLNTLITKVHAMDKDFGVNRQ------IKYSLMGENHDYFKI  3218

Query  372   DSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMF  431
                 G+IR    LD ET S +N+T+ A D G P L S A +AV+++D+ +       P F
Sbjct  3219  SKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDIND-----NPPEF  3273

Query  432   SHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN--FKINTRNGTLYLA  489
             S R Y  ++ EN+     +  +  T     +N        +G++   FK+++  G L L 
Sbjct  3274  SMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLN  3333

Query  490   KSLDREEKSLYELRVR-VDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNA  548
              +LD E    Y L ++ +D      G P L             +N   V + + D+NDN+
Sbjct  3334  ATLDYEMSKFYFLTIQAIDG-----GTPPL-------------SNNAYVNISILDINDNS  3375

Query  549   PKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESRKFAIDAL  608
             P F+ N   I   +      G  I+ ++ATD D  VN  + Y+I  R D    +F+ID  
Sbjct  3376  PTFLQNLYRI--NVNEDIFVGSKILDVKATDEDSDVNGLVTYNI-ERGDNIG-QFSIDPK  3431

Query  609   TGQVRSIVSFAKDAGRVFGFDVKATDR  635
              G +       ++    +  +++A D+
Sbjct  3432  NGTISVSRPLDRETISHYTLEIQACDQ  3458


 Score = 124 bits (312),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 150/599 (25%), Positives = 253/599 (42%), Gaps = 88/599 (15%)

Query  73    LVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHP  132
             +++I E+   G  +++L A DRD+G N+ I+YSI++   +P              F I  
Sbjct  513   VISINENNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVP--------------FEIDH  558

Query  133   TNGEVSVARVLPPET---EFRMNFTAIDGG---GLSDNVSVRIFVKDVNDHAPVFKKSWY  186
              +G V    +L  ET    + +   A D G        + + I VKD+ND+ P F++   
Sbjct  559   FSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNC  618

Query  187   MFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQ-NENSSTALPFKVSRSDGEISASG  245
                + +    G  +    A D D G    ISY +   NE+      F +  + G +S S 
Sbjct  619   YGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGC----FNLDPTSGSLSISC  672

Query  246   NIDREFKDSYKFRIMARDGGKPHKKNSIVV-VEVDILDINDNAPTFYNYD----------  294
             ++ +    +   ++ A DG   H  + +++ V +   D+  ++   + +           
Sbjct  673   DLKKTTLTNRILKVSATDG--THFSDDLIINVHLMPEDLGGDSSILHGFGSFECRETGVA  730

Query  295   ----HILQMYQNSVNVNDKFDQSANNLLLIPIYYA---------------SVLENSPTGT  335
                   L + + + NV        ++L L P  Y                S+ E+   G 
Sbjct  731   RRLAETLSLAEKN-NVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGE  789

Query  336   IVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVT  395
              V+ + A D D   NG   L+F I    D    F ID   G ++ IG LD E Q+ Y + 
Sbjct  790   TVAWIEAKDRDLGYNGK--LVFAIS-DGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLN  846

Query  396   IVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNV  455
             I   D+GNP+ S++ +L ++++DV +      RP+         + E++ +   +  L+ 
Sbjct  847   ITVYDLGNPTKSTSKMLPITILDVND-----NRPVIQKTLATFRLTESARIGTVVHCLHA  901

Query  456   TEAYQNMNLKFTLVPTAGSDNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGM  515
             T+A   +N + T   +    +F +N   G L L K LDRE++  Y L +      K  G 
Sbjct  902   TDADSGINAQVTYALSVECSDFTVNATTGCLRLNKPLDREKQDNYALHITA----KDGGS  957

Query  516   PVLLYPLPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRL  575
             PVL             ++E  V V V DVNDNAP F V  +  +  +      G  +  +
Sbjct  958   PVL-------------SSEALVYVLVDDVNDNAPVFGV--QEYIFKVREDLPRGTVLAVI  1002

Query  576   QATDADEGVNADIRYHILGRADGESRKFAIDALTGQVRSIVSFAKDAGRVFGFDVKATD  634
             +A D D G NA+I++ +      E   F ID  TG +R+      +  +V    V A D
Sbjct  1003  EAVDEDIGPNAEIQFSLKEETQDEEL-FRIDKHTGAIRTQGYLDYENKQVHNLIVSAID  1060


 Score = 118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 135/526 (26%), Positives = 226/526 (43%), Gaps = 115/526 (22%)

Query  1     LNSEAKLTIYVDDVNDNAPNFLQLVALQDQDIEISEPTVPGAGDANMTSEELVHHLSTTN  60
             L+SEA + + VDDVNDNAP F     +Q+                               
Sbjct  960   LSSEALVYVLVDDVNDNAPVF----GVQEY------------------------------  985

Query  61    FTNHDSILFMAPLVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPP  120
                         +  + ED P G  +  + A D D G NA I +S+  ET          
Sbjct  986   ------------IFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEET----------  1023

Query  121   KPSSKSYFFIHPTNGEVSVARVLPPETEFRMNF--TAIDGG--GLSDNVSVRIFVKDVND  176
                 +  F I    G +     L  E +   N   +AIDGG   L+ ++S+ I + DVN+
Sbjct  1024  --QDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNE  1081

Query  177   H--APVFKKSWYMFDLKEGFYSGYIIGKVEATDAD-FGKNAEISYTIIQNENSSTALPFK  233
             +  AP F    Y   +KE    G  +  V A D D    N++I+Y+I   +     L   
Sbjct  1082  NRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGD----GLGIF  1137

Query  234   VSRSDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNY  293
                  G I++   +D E K+ Y   + A+D       N  V V + + + NDN P     
Sbjct  1138  AVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNC-VEVYIQVENENDNIP-----  1191

Query  294   DHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNG  353
                         + DK           P+YY +V E S     +  + A D D   +   
Sbjct  1192  ------------LTDK-----------PVYYVNVTEASVENVEIITLKAFDPDI--DPTQ  1226

Query  354   LLLFNIPHQTDGSDAFGIDSKEGLIRTIG-KLDYETQSGYNVTIVASDMGNPSLSSTAIL  412
              + +NI    +    F IDSK G+I+T   KLD E Q+ + + +  SD G+P LSST+ +
Sbjct  1227  TITYNIV-SGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRI  1285

Query  413   AVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNV--TEAYQNMNLKFTLVP  470
              VSV+D+ +       P F  R Y+++VP ++ V   I  ++   +++ +N  + +++  
Sbjct  1286  VVSVLDIND-----NSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKS  1340

Query  471   TAGSDNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMP  516
               G + F+I+++ G +++AK LD + +  +E+ ++ + +    G+P
Sbjct  1341  GKGKNKFRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDN----GIP  1380


 Score = 109 bits (273),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 120/460 (26%), Positives = 198/460 (43%), Gaps = 75/460 (16%)

Query  159   GGLSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISY  218
             G  S  + V+I V    D    F++  Y F   E       IG V        +N E  Y
Sbjct  2011  GIFSAILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDENVE--Y  2068

Query  219   TIIQNENSSTALPFKVSRSDGEISASGNI-DREFKDSYKFRIMAR----DGGKPHKKNSI  273
              I+    + T L F +  S G +  +G I DRE KD Y+  + A+    DG   + + ++
Sbjct  2069  RIL----NPTQL-FDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAV  2123

Query  274   VVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPT  333
               +++ +LD+NDN P F N                           +P YYA+V  + P 
Sbjct  2124  TSIDISVLDVNDNCPLFVN---------------------------MP-YYATVSIDDPK  2155

Query  334   GTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYN  393
             GTI+ +V A D D   NG          +    + F +D K G +     ++   ++ Y 
Sbjct  2156  GTIIMQVKAIDLDSAENGE----VRYELKKGNGELFKLDRKSGELSIKQHVEGHNRN-YE  2210

Query  394   VTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHL  453
             +T+ A D      SS A L V V+D          P+F  ++Y + V E+ E+ + +   
Sbjct  2211  LTVAAYDGAITPCSSEAPLQVKVID-------RSMPVFEKQFYTVSVKEDVEMYSALSVS  2263

Query  454   NVTEAYQNMNLKFTLVPTAGSDNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGR  513
                E+    +L +T+  ++ S +F+I+   G++++   LD E+ S +++ +R        
Sbjct  2264  IEAESPLGRSLIYTI--SSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRA-------  2314

Query  514   GMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIV  573
                        D L+ + A EV + V + DVND  P+  +        IP +AS+G  I+
Sbjct  2315  ----------TDSLSGVYA-EVVLSVSIMDVNDCYPE--IESDIYNLTIPENASFGTQIL  2361

Query  574   RLQATDADEGVNADIRYHILG-RADGESRKFAIDALTGQV  612
             ++ ATD D G NA + Y+I        S  F ID   G +
Sbjct  2362  KINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNL  2401


 Score = 108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 121/463 (26%), Positives = 201/463 (43%), Gaps = 69/463 (15%)

Query  175   NDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKV  234
             N ++P+F +S Y   + E    G+ I  V+A+D DFG  A + Y I+  E       F +
Sbjct  2545  NVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKI---FLI  2601

Query  235   SRSDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYD  294
              ++ G I++    DRE KD Y   +   DGG    K     ++V ++D+NDN P F    
Sbjct  2602  DQTTGVITSKVTFDREKKDEYVVLLKVSDGGG---KFGFASLKVIVVDVNDNVPYF----  2654

Query  295   HILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGL  354
              +L+ Y+  V+   + +Q+                       +  V A D D   NG+  
Sbjct  2655  -LLKEYKMVVSTTVEANQT-----------------------ILTVKAKDDDIVDNGS--  2688

Query  355   LLFNIPHQTDGS---DAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAI  411
             + F I  +++     D   I+ K G I    K +    + Y   + ASD G P   S   
Sbjct  2689  VHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVP  2748

Query  412   LAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPT  471
             +++ +++    +     P F      L++ E S  P  +L    T+ +   N  F     
Sbjct  2749  VSIEIIETDANI-----PTFEKSSVLLKIIE-STPPGTVL----TKLHMIGNYTFKFSIA  2798

Query  472   AGSDNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLA  531
             A  D+F I + +G L L ++LDRE++  + L V  +       +PV          AD  
Sbjct  2799  ADQDHFMI-SDSGELILQQTLDREQQESHNLIVVAE----TSTVPVFF------AYAD--  2845

Query  532   ANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYH  591
                  V++ V+D NDN PKF  +     A++  ++     +V++ ATDAD G N DIRY+
Sbjct  2846  -----VLIDVRDENDNYPKF--DNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYY  2898

Query  592   ILGRADGESRKFAIDALTGQVRSIVSFAKDAGRVFGFDVKATD  634
             +    +     F ID  +G +  + S  ++    + F V A D
Sbjct  2899  LESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAAD  2941


 Score = 106 bits (265),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 209/488 (43%), Gaps = 92/488 (19%)

Query  160   GLSDNV-----SVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNA  214
             G++ NV     S+ I V DVND+ P+F    Y   +      G II +V+A D D  +N 
Sbjct  2114  GMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENG  2173

Query  215   EISYTIIQNENSSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGG-KPHKKNSI  273
             E+ Y +           FK+ R  GE+S   +++   ++ Y+  + A DG   P    + 
Sbjct  2174  EVRYEL----KKGNGELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAITPCSSEAP  2228

Query  274   VVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPT  333
             + V+V    I+ + P F       Q Y  SV    K D    + L + I   S L  S  
Sbjct  2229  LQVKV----IDRSMPVFEK-----QFYTVSV----KEDVEMYSALSVSIEAESPLGRSLI  2275

Query  334   GTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYN  393
              TI S+                          S +F ID   G I  + +LDYE  S ++
Sbjct  2276  YTISSE--------------------------SQSFEIDYNTGSIFVVNELDYEKISSHD  2309

Query  394   VTIVASDMGNPSLS---STAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPI  450
             V+I A+D    SLS   +  +L+VS++DV +   E +  +     Y L +PEN+     I
Sbjct  2310  VSIRATD----SLSGVYAEVVLSVSIMDVNDCYPEIESDI-----YNLTIPENASFGTQI  2360

Query  451   LHLNVT--EAYQNMNLKFTLVPTAGSDN---FKINTRNGTLYLAKSLDREEKSLYELRVR  505
             L +N T  ++  N  L + +    G +N   F I+  +G LYL   LD E+   + + V 
Sbjct  2361  LKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVN  2420

Query  506   VDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRP-IVAAIPT  564
             V  H    G P L             ++   V + VKD+NDNAP FV    P     +  
Sbjct  2421  VKDH----GSPSL-------------SSRSNVFITVKDLNDNAPCFV---EPSYFTKVSV  2460

Query  565   SASYGYHIVRLQATDADEGVNADIRYHILGRADGESRKFAIDALTGQV--RSIVSFAKDA  622
             +A  G  +   +A D D      + Y I+     E + ++ID LTG +  +++++F   +
Sbjct  2461  AAVRGQFVALPKAYDKDISDTDSLEYKIV--YGNELQTYSIDKLTGVISLQNMLNFTDKS  2518

Query  623   GRVFGFDV  630
               V    V
Sbjct  2519  STVLNISV  2526


 Score = 105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 159/617 (26%), Positives = 240/617 (39%), Gaps = 116/617 (19%)

Query  74   VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
            V IPEDTP   SIL++ ADD D G N  I YS+  ++                YF IHPT
Sbjct  190  VVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDS---------------EYFAIHPT  234

Query  134  NGEVSVARVL--PPETEFRMNFTAIDGGGL-------SDNVSVRIFVKDVNDHAP-VFKK  183
             GE+++ + L     + F +   A D G         +    V I VK VN +AP +F K
Sbjct  235  TGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPEIFTK  294

Query  184  SWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISA  243
            +   F       +  I G V   D D G N  I    I + N       K + +  E   
Sbjct  295  T---FSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYI  351

Query  244  SGNIDREFKDS---YKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMY  300
              N           Y   ++A D G P ++ +   V + I   + N P F          
Sbjct  352  ELNQFAHLNQQHFIYNLTLLAEDLGTP-RRFAYKSVPIQIKPESKNIPIFTQ--------  402

Query  301  QNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIP  360
                                 IY  S+ E +P    V ++  +D D     N L+   I 
Sbjct  403  --------------------EIYEVSIPETAPINMPVIRLKVSDPDL--GKNALVYLEIV  440

Query  361  HQTDGSDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGN--PSLSSTAILAVSVVD  418
               +G D F I+   G++ T  +LD E +S Y +T+ A D  N      S+A + +SV D
Sbjct  441  GGNEG-DEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQD  499

Query  419  VQEQLGEPQRPMFSHRYYELEVPENSEVPAPILHLNVT--EAYQNMNLKFTLVPTAGSDN  476
            + +       P+F +    + + EN+   + ++ L     ++ +N  + ++ +    +  
Sbjct  500  MND-----NDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYS-IANLNAVP  553

Query  477  FKINTRNGTLYLAKSLDREE-KSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEV  535
            F+I+  +G +     LD E  K  YEL +R              + LP  R       E+
Sbjct  554  FEIDHFSGIVKTTSLLDFETMKRNYELIIRASD-----------WGLPYRR-----QTEI  597

Query  536  KVIVRVKDVNDNAPKFV-VNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHIL-  593
            K+ + VKD+NDN P+F  VN       +  SA  G  +    A D D G   DI  + L 
Sbjct  598  KLSIVVKDINDNRPQFERVN---CYGKVTKSAPMGTEVFVTSAIDFDAG---DIISYRLS  651

Query  594  -GRADGESRKFAIDALTGQVRSIVSFAKDAGRVFGFDVKATD-RRGADD-----------  640
             G  DG    F +D  +G +       K         V ATD    +DD           
Sbjct  652  DGNEDG---CFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPED  708

Query  641  --GRSAITNVFNMFCCR  655
              G S+I + F  F CR
Sbjct  709  LGGDSSILHGFGSFECR  725


 Score = 104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 120/448 (27%), Positives = 191/448 (43%), Gaps = 73/448 (16%)

Query  76    IPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPTNG  135
             I E+   G  + ++ A   D G NA I Y I S              + +  F +  T G
Sbjct  3282  ILENATHGTEVCKVYATSIDIGVNADIHYFIMS-------------GNEQGKFKMDSTTG  3328

Query  136   EVSVARVLPPETE--FRMNFTAIDGGG--LSDNVSVRIFVKDVNDHAPVFKKSWYMFDLK  191
             ++ +   L  E    + +   AIDGG   LS+N  V I + D+ND++P F ++ Y  ++ 
Sbjct  3329  DLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVN  3388

Query  192   EGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDREF  251
             E  + G  I  V+ATD D   N  ++Y I + +N      F +   +G IS S  +DRE 
Sbjct  3389  EDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ---FSIDPKNGTISVSRPLDRET  3445

Query  252   KDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFY--NYDHILQMYQNSVNVNDK  309
                Y   I A D G P + NS V + ++ILD NDNAP F   NY  +LQ           
Sbjct  3446  ISHYTLEIQACDQGDPQRCNS-VPININILDTNDNAPIFSSSNYSVVLQ-----------  3493

Query  310   FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAF  369
                                EN   G +      +D+D   N      F+I    +G   F
Sbjct  3494  -------------------ENRLLGYVFLTFKISDADETPNTTPYT-FDIRSGNEGG-LF  3532

Query  370   GIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRP  429
              ++ ++G +RT  + ++  Q  + + +   D G P L S A + V ++   E+   P  P
Sbjct  3533  RLE-QDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKII---EESQYP--P  3586

Query  430   MFSHRYYELEVPENSEVPAPILHLNVTEAYQNMNLKFTLVPTAGSDN-------FKINTR  482
             + +     +   E+    A I  ++ ++  +   L F+LV  +G D+       F I+  
Sbjct  3587  IVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLV--SGPDDMYQSSKLFNISNN  3644

Query  483   NGTLYLAKSLDREEKSLYELRVRVDHHK  510
              G +Y   +LD     LY+L V V   K
Sbjct  3645  TGKIYAISNLD---IGLYKLNVSVSDGK  3669


 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 142/580 (24%), Positives = 239/580 (41%), Gaps = 101/580 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             V I E+      I++L A DRD   +  + Y + +             PSS + F I   
Sbjct  1513  VNISENIEEESVIMQLHATDRD--EDKKLFYHLHATQ----------DPSSLALFRIDSI  1560

Query  134   NGEVSVARVLPPET---EFRMNFTAIDGG-GLSDNVSVRIFVKDVNDHAPVFKKSWYMFD  189
             +G V V + L  E       + F    G  G  +   + + V D NDH P F        
Sbjct  1561  SGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSK  1620

Query  190   LKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDR  249
             + E    G  + +V A D D G NAEI Y+II     S    F++  + G I+ +GN++ 
Sbjct  1621  VPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSV---FEIDPTFGIITLAGNLNI  1677

Query  250   EFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDK  309
                  Y  ++ A D G P   + I V                   HI+     +++ ND 
Sbjct  1678  NKIQEYMLQVKAVDLGNPPLSSQIPV-------------------HIIV----TMSENDP  1714

Query  310   FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAF  369
                  NN+ +       + EN P GT V++V+A  S         + FNI    + +++F
Sbjct  1715  PKFPTNNIAI------EIFENLPIGTFVTQVTARSS-------SSIFFNII-SGNINESF  1760

Query  370   GIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRP  429
              I+   G+I   G +DYE+   +N+T+  ++M   + SS   + + ++D  + +     P
Sbjct  1761  RINPSTGVIVINGNIDYESIKVFNLTVKGTNMA--AESSCQNIIIHILDANDNI-----P  1813

Query  430   MFSHRYYELEVPENSEVPAPILH----------LNVTEAYQNMN--LKFTLVPTAGSDNF  477
              F    Y   +PE++ + + +L           L V +A   +N  +++ +V     + F
Sbjct  1814  YFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFF  1873

Query  478   KINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKV  537
             KI++  G + L + LD E  + Y   V V       G P L            +     V
Sbjct  1874  KIDSTTGAIELLRQLDYETNAGYTFDVTV----SDMGKPKL-----------HSTTTAHV  1918

Query  538   IVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRAD  597
              +RV +VND  P F  N R +   +         + ++ A DAD   N  +R+ I+   D
Sbjct  1919  TIRVINVNDCPPVF--NERELNVTLFLPTFENVFVRQVSAKDAD---NDTLRFDIV---D  1970

Query  598   GESRK-FAIDALTGQV--RSIVSFAKDAGRVFGFDVKATD  634
             G + + F I+  TG +  R+      +  R +   V+A+D
Sbjct  1971  GNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD  2010


 Score = 94.0 bits (232),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 131/589 (22%), Positives = 242/589 (41%), Gaps = 99/589 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             V +P    V  SI ++ A D D+G N  I YSI S                K+ F I   
Sbjct  1306  VQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKS-------------GKGKNKFRIDSQ  1352

Query  134   NGEVSVARVLPPETEFRMNFTAIDGGGLSDNVSVR-----IFVKDVNDHAPVF--KKSWY  186
              G + +A+ L  + EF ++  A D G    + + R     + V   + +AP+   K S  
Sbjct  1353  RGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSEN  1412

Query  187   MFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGN  246
             + DL E    G+++ ++ A D D   N ++ Y I    + +T   F + + +G I  S  
Sbjct  1413  VVDLTENDKPGFLVTQILAVDDD---NDQLWYNISNGNDDNT---FYIGQDNGNILLSKY  1466

Query  247   IDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNV  306
             +D E + SY   I   DG      N +    V ++DINDN P F                
Sbjct  1467  LDYETQQSYNLTISVTDGTFTAFTNLL----VQVIDINDNPPQFAK--------------  1508

Query  307   NDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGS  366
                            +Y+ ++ EN    +++ ++ A D D     +  L +++    D S
Sbjct  1509  --------------DVYHVNISENIEEESVIMQLHATDRD----EDKKLFYHLHATQDPS  1550

Query  367   D--AFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLG  424
                 F IDS  G +    +LD+E  + + + +   D G P   + A + V+V D  +   
Sbjct  1551  SLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHND---  1607

Query  425   EPQRPMFSHRYYELEVPENSEVPAPILHLNVT--EAYQNMNLKFTLVPTAGSDNFKINTR  482
                 P F+ +  + +VPE++ + + +  +     ++  N  ++++++       F+I+  
Sbjct  1608  --HHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPT  1665

Query  483   NGTLYLAKSLDREEKSLYELRVR-VDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRV  541
              G + LA +L+  +   Y L+V+ VD      G P L   +P   +  ++ N+       
Sbjct  1666  FGIITLAGNLNINKIQEYMLQVKAVD-----LGNPPLSSQIPVHIIVTMSEND-------  1713

Query  542   KDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGESR  601
                    PKF  N   I   I  +   G  + ++ A  +     + I ++I+     ES 
Sbjct  1714  ------PPKFPTNN--IAIEIFENLPIGTFVTQVTARSS-----SSIFFNIISGNINES-  1759

Query  602   KFAIDALTGQVRSIVSFAKDAGRVFGFDVKATDRRGADDGRSAITNVFN  650
              F I+  TG +    +   ++ +VF   VK T+       ++ I ++ +
Sbjct  1760  -FRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILD  1807


 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 113/435 (26%), Positives = 186/435 (43%), Gaps = 78/435 (18%)

Query  165   VSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNE  224
             VS+ I   D N   P F+KS  +  + E    G ++ K+         N    ++I  ++
Sbjct  2749  VSIEIIETDAN--IPTFEKSSVLLKIIESTPPGTVLTKLHMI-----GNYTFKFSIAADQ  2801

Query  225   NSSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDIN  284
             +      F +S S GE+     +DRE ++S+   ++A     P    +   V +D+ D N
Sbjct  2802  DH-----FMISDS-GELILQQTLDREQQESHNLIVVAETSTVP-VFFAYADVLIDVRDEN  2854

Query  285   DNAPTFYNYDHILQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSAND  344
             DN P                    KFD +         Y ASV ENS     + KVSA D
Sbjct  2855  DNYP--------------------KFDNT--------FYSASVAENSEKVISLVKVSATD  2886

Query  345   SDFQGNGNGLLLFNIPHQTDG-SDAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGN  403
             +D   NG+  + + +   T+   + F ID   G I  +  LD E QS YN  ++A+D G+
Sbjct  2887  ADTGPNGD--IRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGH  2944

Query  404   PSLSSTAILAVSVVDVQEQLGEPQRPMFSHRYYELEVPENSEVPAPIL--HLNVTEAYQN  461
             P   +   + + +VD  +       P+F      L V EN+ +P  +L   L +    + 
Sbjct  2945  PKHDAKVPVTIKIVDYND-----NAPVFKLPIEGLSVFENA-LPGTVLINLLLIDPDIEK  2998

Query  462   MNLKFTLVPTAGSDNFKINTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYP  521
               + F +V       F+I  ++G L++AK LDRE+   Y L +                 
Sbjct  2999  QEMDFFIVSGDKQAQFQIG-KSGELFIAKPLDREQLMFYNLSI-----------------  3040

Query  522   LPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDAD  581
             +  D      AN   V + VKD+NDN P + +  R  ++    S S G  +V ++A D D
Sbjct  3041  IATDGKFTAKAN---VEIDVKDINDNTP-YCLKPRYHIST-NESISIGTTLVEVKAIDFD  3095

Query  582   EGVNADIRYHILGRA  596
                 + +R+++ G+ 
Sbjct  3096  --FQSKLRFYLSGKG  3108


 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 130/579 (22%), Positives = 231/579 (40%), Gaps = 99/579 (17%)

Query  70    MAPLVTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFF  129
             M    T+  D P G  I+++ A D D+  N  + Y +              K  +   F 
Sbjct  2143  MPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYEL--------------KKGNGELFK  2188

Query  130   IHPTNGEVSVAR-VLPPETEFRMNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMF  188
             +   +GE+S+ + V      + +   A DG     +    + VK ++   PVF+K +Y  
Sbjct  2189  LDRKSGELSIKQHVEGHNRNYELTVAAYDGAITPCSSEAPLQVKVIDRSMPVFEKQFYTV  2248

Query  189   DLKEG--FYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGN  246
              +KE    YS   +  +EA ++  G++  + YTI     SS +  F++  + G I     
Sbjct  2249  SVKEDVEMYSALSVS-IEA-ESPLGRS--LIYTI-----SSESQSFEIDYNTGSIFVVNE  2299

Query  247   IDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNV  306
             +D E   S+   I A D          VV+ V I+D+ND  P   +              
Sbjct  2300  LDYEKISSHDVSIRATDSLSGVYAE--VVLSVSIMDVNDCYPEIES--------------  2343

Query  307   NDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGS  366
                            IY  ++ EN+  GT + K++A D+D   N          +  + S
Sbjct  2344  --------------DIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNS  2389

Query  367   DAFGIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEP  426
             + F ID  +G +     LDYE    +++ +   D G+PSLSS + + ++V D+ +     
Sbjct  2390  ELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLND-----  2444

Query  427   QRPMFSHRYYELEVPENSEVPAPILHLNVTEAY-----QNMNLKFTLVPTAGSDNFKINT  481
               P F    Y  +V   S        + + +AY        +L++ +V       + I+ 
Sbjct  2445  NAPCFVEPSYFTKV---SVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDK  2501

Query  482   RNGTLYLAKSLDREEKSLYELRVRVDH--HKKGRGMPVLLYPLPADRLADLAANEVKVIV  539
               G + L   L+  +KS   L + V    H     + + L P                  
Sbjct  2502  LTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYARLKISLLP------------------  2543

Query  540   RVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDADEGVNADIRYHILGRADGE  599
                   +N    + +     A +P +  +G++I+ ++A+D D G  A++ Y I+     E
Sbjct  2544  ------ENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSE---E  2594

Query  600   SRK-FAIDALTGQVRSIVSFAKDAGRVFGFDVKATDRRG  637
              +K F ID  TG + S V+F ++    +   +K +D  G
Sbjct  2595  MKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGG  2633


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 127/569 (22%), Positives = 202/569 (36%), Gaps = 95/569 (17%)

Query  74    VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPPKPSSKSYFFIHPT  133
             +TIPE+   G  IL++ A D D+G+NA ++Y I S              ++   F+I  T
Sbjct  2348  LTIPENASFGTQILKINATDNDSGANAKLSYYIESIN----------GQNNSELFYIDVT  2397

Query  134   NGEVSVARVLPPET----EFRMNFTAIDGGGLSDNVSVRIFVKDVNDHAPVFKKSWYMFD  189
             +G + +   L  E        +N        LS   +V I VKD+ND+AP F +  Y   
Sbjct  2398  DGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTK  2457

Query  190   LKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSRSDGEISASGNIDR  249
             +      G  +   +A D D      + Y I+      T   + + +  G IS    ++ 
Sbjct  2458  VSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQT---YSIDKLTGVISLQNMLNF  2514

Query  250   EFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHILQMYQNSVNVNDK  309
               K S    I   DG       +   +++ +L  N  +P                     
Sbjct  2515  TDKSSTVLNISVSDG----VHTAYARLKISLLPENVYSPL--------------------  2550

Query  310   FDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLLFNIPHQTDGSDAF  369
             FDQS         Y A V EN   G  +  V A+D DF    N  L + I  + +    F
Sbjct  2551  FDQST--------YEAQVPENLLHGHNIITVKASDGDFGTYAN--LYYEIVSE-EMKKIF  2599

Query  370   GIDSKEGLIRTIGKLDYETQSGYNVTIVASDMGNPSLSSTAILAVSVVDVQEQLGEPQRP  429
              ID   G+I +    D E +  Y V +  SD G            + + V         P
Sbjct  2600  LIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGGK-------FGFASLKVIVVDVNDNVP  2652

Query  430   MFSHRYYELEVPENSEVPAPILHLNVT--EAYQNMNLKFTLVP----TAGSDNFKINTRN  483
              F  + Y++ V    E    IL +     +   N ++ F +V      A  D  +IN + 
Sbjct  2653  YFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKT  2712

Query  484   GTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLYPLPADRLADLAANEVKVIVRVKD  543
             G +      +    + Y+  VR       RG P                +EV V + + +
Sbjct  2713  GDIVFKSKAESYGVNSYQFFVRA----SDRGEPQF-------------HSEVPVSIEIIE  2755

Query  544   VNDNAPKF--------VVNGRPIVAAIPTSASYGYHIVRLQ-ATDADEGVNAD----IRY  590
              + N P F        ++   P    +      G +  +   A D D  + +D    I  
Sbjct  2756  TDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGNYTFKFSIAADQDHFMISDSGELILQ  2815

Query  591   HILGRADGESRKFAIDALTGQVRSIVSFA  619
               L R   ES    + A T  V    ++A
Sbjct  2816  QTLDREQQESHNLIVVAETSTVPVFFAYA  2844


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 131/329 (40%), Gaps = 51/329 (16%)

Query  63    NHDSILFMAPL--VTIPEDTPVGMSILRLLADDRDAGSNATIAYSISSETYIPKMTLGPP  120
             N +S  F+  L  + + ED  VG  IL + A D D+  N  + Y+I     I +      
Sbjct  3372  NDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ------  3425

Query  121   KPSSKSYFFIHPTNGEVSVARVLPPET--EFRMNFTAIDGGG--LSDNVSVRIFVKDVND  176
                    F I P NG +SV+R L  ET   + +   A D G     ++V + I + D ND
Sbjct  3426  -------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTND  3478

Query  177   HAPVFKKSWYMFDLKEGFYSGYIIGKVEATDADFGKNAEISYTIIQNENSSTALPFKVSR  236
             +AP+F  S Y   L+E    GY+    + +DAD   N    YT      +   L F++ +
Sbjct  3479  NAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNT-TPYTFDIRSGNEGGL-FRLEQ  3536

Query  237   SDGEISASGNIDREFKDSYKFRIMARDGGKPHKKNSIVVVEVDILDINDNAPTFYNYDHI  296
              DG +  +   +   +D +  ++   D G P   +   VV V I++ +   P       I
Sbjct  3537  -DGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVV-VKIIEESQYPP-------I  3587

Query  297   LQMYQNSVNVNDKFDQSANNLLLIPIYYASVLENSPTGTIVSKVSANDSDFQGNGNGLLL  356
             +   + ++N                       E+  +G  + KV A+D D     N  L+
Sbjct  3588  VTPLEVTIN---------------------SFEDDFSGAFIGKVHASDQDKYDELNFSLV  3626

Query  357   FNIPHQTDGSDAFGIDSKEGLIRTIGKLD  385
                      S  F I +  G I  I  LD
Sbjct  3627  SGPDDMYQSSKLFNISNNTGKIYAISNLD  3655


 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 92/235 (39%), Gaps = 43/235 (18%)

Query  419  VQEQLGEPQRPMFSHRYYELEVPENS---EVPAPILHLNVTEAYQNMN--LKFTLVPTAG  473
            ++ QL +  R  FSH  Y + +PENS        +LH  +      +N  +K+ ++    
Sbjct  52   LENQLQDLYR--FSHSVYNVTIPENSLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDK  109

Query  474  SDNFK-------------INTRNGTLYLAKSLDREEKSLYELRVRVDHHKKGRGMPVLLY  520
               FK             I TR   +     L+RE+   Y +RV+   H           
Sbjct  110  EKLFKAEEKLVGDFAFLAIRTRTNNVV----LNREKTEEYVIRVKAHVHLH---------  156

Query  521  PLPADRLADLAANEVKVIVRVKDVNDNAPKFVVNGRPIVAAIPTSASYGYHIVRLQATDA  580
                DR       E  + ++V D ND +P F      +V  IP        I+++ A DA
Sbjct  157  ----DRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVV--IPEDTPKYQSILKVTADDA  210

Query  581  DEGVNADIRYHILGRADGESRKFAIDALTGQVRSIVSFAKDAGRVFGFDVKATDR  635
            D G+N +I Y +L     +S  FAI   TG++  +          F   V A DR
Sbjct  211  DLGINGEIYYSLL----MDSEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDR  261


 Score = 34.3 bits (77),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 67/140 (48%), Gaps = 11/140 (8%)

Query  146   ETEFRMNFTAIDGGG--LSDNVSVRIFVKDVNDHAPVFKKSWYMFDLKEGFYSGYIIGKV  203
             + EF +     D G   L  +  V + + + + + P+        +  E  +SG  IGKV
Sbjct  3551  QDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKV  3610

Query  204   EATDADFGKNAEISYTIIQ--NENSSTALPFKVSRSDGEISASGNIDREFKDSYKFRIMA  261
              A+D D  K  E++++++   ++   ++  F +S + G+I A  N+D      YK  +  
Sbjct  3611  HASDQD--KYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGL---YKLNVSV  3665

Query  262   RDGGKPHKKNSIVVVEVDIL  281
              D GK H   SIV + V+++
Sbjct  3666  SD-GKFHVF-SIVKINVELV  3683



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold550-size791213-augustus-gene-3.3-mRNA-1

Length=312
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q583M4_TRYB2  unnamed protein product                                 166     1e-47
IFT46_CAEEL  unnamed protein product                                  144     3e-39
Q9VJ72_DROME  unnamed protein product                                 119     2e-30


>Q583M4_TRYB2 unnamed protein product
Length=435

 Score = 166 bits (419),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/193 (44%), Positives = 120/193 (62%), Gaps = 6/193 (3%)

Query  118  YDPSEFDHLQVSA--EIKDLFRNITLYTPQNTELDYKLRPFIPDFIPAVGDIDAFLKVQC  175
            Y P E+  +  +A  E+++LF+ I  Y PQ  EL  KLRPFIPD++P++GD+D F K+  
Sbjct  218  YKPQEYAMVNANASREVQELFKRILDYQPQTPELPAKLRPFIPDYVPSIGDLDPFCKIPR  277

Query  176  PDGQNNQVGLRVLDEPCAKQSEPAVLHLQLRAVAKQS-SAKAVVVKVVENAEKNPKAINK  234
            PDG+ + +G+ VLDEP   QS PAV+ L+LRA    S    A  V   E+A   P+ I++
Sbjct  278  PDGKPDGLGIYVLDEPSVAQSNPAVVLLELRATNIHSVGGLAEAVDSFEDAANRPEVIDR  337

Query  235  WIKDIGDLHRSKPPPTVHYTKPLPDVDSLLQEWPSEFEQKLR-EVGLPTPDLDCDLATYI  293
            WI D+  +H  KP PT++Y KP+P++D LLQ WP EFE+ L  +V  P P +D DL  Y+
Sbjct  338  WINDVKKVHYKKPLPTINYQKPMPEIDLLLQVWPQEFEEFLNSDVQFPPPQIDLDLDQYV  397

Query  294  DIVCGACSLSRPV  306
              +C  C L  P 
Sbjct  398  RALC--CILDIPT  408


>IFT46_CAEEL unnamed protein product
Length=471

 Score = 144 bits (362),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 2/166 (1%)

Query  139  ITLYTPQNTELDYKLRPFIPDFIPAVGDIDAFLKVQCPDGQNNQVGLRVLDEPCAKQSEP  198
            I  Y  Q  EL  +LRPF  ++IPA+GD+D F+KV  PD  ++ VGL  +DEP + QS+ 
Sbjct  258  IDAYKTQEVELRPQLRPFTIEYIPAMGDVDLFIKVPRPDEIDDNVGLTQIDEPPSNQSDA  317

Query  199  AVLHLQLRAVAKQSSA--KAVVVKVVENAEKNPKAINKWIKDIGDLHRSKPPPTVHYTKP  256
             ++ +Q+R   K ++     V VK++E A++NP  I KWI DI + H+SKP  TVHY   
Sbjct  318  TIVDMQIRNATKDAAILDDDVPVKLLERADENPDEIKKWISDIKEFHKSKPAQTVHYRTQ  377

Query  257  LPDVDSLLQEWPSEFEQKLREVGLPTPDLDCDLATYIDIVCGACSL  302
            LPDV++L+QEWP + E+ L+   +P+ +LD  L  Y++I      +
Sbjct  378  LPDVETLMQEWPQKLEEVLKTTKIPSAELDVSLEKYVEICLNIVDI  423


>Q9VJ72_DROME unnamed protein product
Length=416

 Score = 119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 135/266 (51%), Gaps = 34/266 (13%)

Query  62   KQAGTSNSLMAGSQRSVSRM-SPSLRIPNQKNSDQSENSEEEDDDDLDVQVATLEGTYDP  120
            ++A     + +G  R  +++    L +P + ++  +  S+ +DD    +           
Sbjct  139  EEAAMGGRMGSGGARGGAKLPHQKLTLPMRGSASGAGRSKRQDDQSFIMSA---------  189

Query  121  SEFDHLQVSAEIKDLFRNITLYTPQNTELDYKLRPFIPDFIPAVGDIDAFLKVQCP----  176
             +++ L V  E+K+LF  I  YTPQ  +  + L+PFIP+F+PAVGD+DA LKVQ P    
Sbjct  190  DKWEDLSVPGELKELFPYIVKYTPQTIDTPFHLQPFIPEFVPAVGDVDALLKVQAPPLLQ  249

Query  177  -------DGQNNQVGLRVLDEPCAKQSEPAVLHLQLRAVAKQSSAK----AVVVKVVENA  225
                   +    ++GL +LDEP   QSEP++L+++LR+V   S  +    A    +V  A
Sbjct  250  PQRQKDLNDHLEKLGLWLLDEPSGAQSEPSLLNMKLRSVLSGSMGRNPRHASSASLVPTA  309

Query  226  EKNPKAINKWIKDIGDLHRSKPPPTVHYTKPLPDVDSLLQEWPSEFEQKLREVGLPTPDL  285
             ++ K I KWI ++  +H ++   +++  +P  D+D+LL++WP  F  +     L     
Sbjct  310  -RSGKDIEKWITEVEQVHMTQ---SMYDVQPRKDIDALLEDWPRSFGDEQTINALDQAYR  365

Query  286  DC-----DLATYIDIVCGACSLSRPV  306
             C      +A Y+ ++C    +  P+
Sbjct  366  SCLQQNISVAEYVGVLCERFGVEGPL  391



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold1749-size454670-augustus-gene-3.10-mRNA-1

Length=163
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q582N8_TRYB2  unnamed protein product                                 80.5    2e-18
PKS17_DICDI  unnamed protein product                                  71.6    7e-15
PKS16_DICDI  unnamed protein product                                  71.2    7e-15


>Q582N8_TRYB2 unnamed protein product
Length=339

 Score = 80.5 bits (197),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 78/155 (50%), Gaps = 0/155 (0%)

Query  1    LNFQDLMVRQGAIDSPPKTPFILGFECAGEIEEVGEGVEEFKVGDHVVALPEYRAWSELV  60
            +N  D+  R+G    PP    +LG E +G +  VG  V+ F  GD V+AL     +++LV
Sbjct  43   VNRADISQRRGHYPPPPGVSELLGLEVSGVVLRVGSNVKRFGEGDRVMALLAGGGYADLV  102

Query  61   AVPARYVYRLPAEMSFLDAAALTMNYLVAYILLFELSGLSSGKSVLVHSAGGGVGQAVAQ  120
                  V ++P E SF++AAA+   +L A+ LL     L  G+ VLVH+   GVG ++ Q
Sbjct  103  VAHEGSVMKIPDEYSFVEAAAIPEGFLTAWQLLRRHGSLKKGQCVLVHAGASGVGTSLMQ  162

Query  121  LCRTVSDVVVYGVASKSKHEALQSTIDHLLERGSD  155
            L        V    S+ K +  +   D +++R  D
Sbjct  163  LAGKYFGAKVVATCSEGKVDFCKKFADIVVDRSPD  197


>PKS17_DICDI unnamed protein product
Length=2604

 Score = 71.6 bits (174),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 57/174 (33%), Positives = 81/174 (47%), Gaps = 27/174 (16%)

Query  10    QGAIDSPPKTPFILGFECAGEIEEVG-EGVEEFKVGDHVVALPEYRAWSELVAVPARYVY  68
             +G I SPP      G ECAG I  V   GV  FKVGD VV    +   S +     + V 
Sbjct  1902  KGDIYSPP-----FGLECAGYITRVAPSGVTRFKVGDQVVGFASHSLSSHVTTHQNKIVL  1956

Query  69    RLPAEMSFLDAAALTMNYLVAYILLFELSGLSSGK-SVLVHSAGGGVGQAVAQLCR----  123
             + P  +SF +AAA+ + Y  +Y  +F +    + K S+LVHSA GGVG A   L +    
Sbjct  1957  K-PENISFNEAAAVCVVYATSYYSIFHIGAFIADKESILVHSATGGVGLASLNLLKWKRN  2015

Query  124   ---------TVSDVVVYG-VASKSKHEALQSTIDHLL-----ERGSDYGSEVRK  162
                        +D  +Y  V SK K + LQ     L+      R ++Y  E+++
Sbjct  2016  QLKKHGNSEISNDASIYATVGSKEKIDYLQEKYGDLITAIYNSRDTEYCDEIKQ  2069


>PKS16_DICDI unnamed protein product
Length=2603

 Score = 71.2 bits (173),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 57/174 (33%), Positives = 81/174 (47%), Gaps = 27/174 (16%)

Query  10    QGAIDSPPKTPFILGFECAGEIEEVG-EGVEEFKVGDHVVALPEYRAWSELVAVPARYVY  68
             +G I SPP      G ECAG I  V   GV  FKVGD VV    +   S  +    + V 
Sbjct  1901  KGDIYSPP-----FGLECAGYITRVAPSGVTRFKVGDQVVGFASHSLSSLAITHQDKIVL  1955

Query  69    RLPAEMSFLDAAALTMNYLVAYILLFELSGLSSGK-SVLVHSAGGGVGQAVAQLCR----  123
             + P  +SF +AAA+ + Y  +Y  +F +    + K S+LVHSA GGVG A   L +    
Sbjct  1956  K-PENISFNEAAAVCVVYATSYYSIFHIGAFMADKESILVHSATGGVGLATLNLLKWKRN  2014

Query  124   ---------TVSDVVVYG-VASKSKHEALQSTIDHLL-----ERGSDYGSEVRK  162
                        +D  +Y  V SK K + LQ     L+      R ++Y  E+++
Sbjct  2015  QLKKHGNSEISNDASIYATVGSKEKVDYLQEKYGDLITAIYNSRDTEYCDEIKQ  2068



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold8084-size81320-augustus-gene-0.1-mRNA-1

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I3U2_PLAF7  unnamed protein product                                 40.0    0.003
Q8IHN4_PLAF7  unnamed protein product                                 30.4    2.8  


>Q8I3U2_PLAF7 unnamed protein product
Length=1610

 Score = 40.0 bits (92),  Expect = 0.003, Method: Composition-based stats.
 Identities = 19/70 (27%), Positives = 42/70 (60%), Gaps = 0/70 (0%)

Query  140  EDAPVEYVPVEDVPVEDAPVEDAVVEDAVVEDVRLEDAPVENVPVENVPVEDALVEDVSV  199
            +D  V+++ V+D+ V+D  V+D  V+D  V+++ ++D  ++++ V+N+     L +  S 
Sbjct  868  KDINVQHINVQDMDVQDMDVQDINVQDMDVQNINVQDINIQDMDVQNINNSITLNKSTSC  927

Query  200  EDEPVEDARG  209
            + +   DA G
Sbjct  928  QTDESRDAPG  937


 Score = 39.3 bits (90),  Expect = 0.004, Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 38/55 (69%), Gaps = 0/55 (0%)

Query  144  VEYVPVEDVPVEDAPVEDAVVEDAVVEDVRLEDAPVENVPVENVPVEDALVEDVS  198
            V+++  +D+ V+   V+D  V+D  V+D+ ++D  V+N+ V+++ ++D  V++++
Sbjct  862  VQFIEEKDINVQHINVQDMDVQDMDVQDINVQDMDVQNINVQDINIQDMDVQNIN  916


 Score = 34.3 bits (77),  Expect = 0.16, Method: Composition-based stats.
 Identities = 12/47 (26%), Positives = 33/47 (70%), Gaps = 0/47 (0%)

Query  115  EDVPVENVPVEDAPIEDALLEDVLMEDAPVEYVPVEDVPVEDAPVED  161
            +D+ V+++ V+D  ++D  ++D+ ++D  V+ + V+D+ ++D  V++
Sbjct  868  KDINVQHINVQDMDVQDMDVQDINVQDMDVQNINVQDINIQDMDVQN  914


 Score = 32.7 bits (73),  Expect = 0.59, Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 32/48 (67%), Gaps = 0/48 (0%)

Query  135  EDVLMEDAPVEYVPVEDVPVEDAPVEDAVVEDAVVEDVRLEDAPVENV  182
            +D+ ++   V+ + V+D+ V+D  V+D  V++  V+D+ ++D  V+N+
Sbjct  868  KDINVQHINVQDMDVQDMDVQDINVQDMDVQNINVQDINIQDMDVQNI  915


 Score = 32.0 bits (71),  Expect = 1.1, Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 59/113 (52%), Gaps = 13/113 (12%)

Query  159  VEDAVVEDAVVEDVRLEDAPVENVPVENVPVEDALVEDVSVEDEPVEDARGRRPCGRRNM  218
            VE  +  D +V   + +    +++ V+ +  +D  V+ ++V+D  V+D          ++
Sbjct  837  VEAKIKNDEMVMQEQKDTKEEKHMDVQFIEEKDINVQHINVQDMDVQDM---------DV  887

Query  219  EDALVEDALVEDVPLEDPHVEDFRVQYVPVEDILEEDASEASSVQSSDEGEAP  271
            +D  V+D  V+++ ++D +++D  VQ +     L    ++++S Q+ +  +AP
Sbjct  888  QDINVQDMDVQNINVQDINIQDMDVQNINNSITL----NKSTSCQTDESRDAP  936


 Score = 29.6 bits (65),  Expect = 5.6, Method: Composition-based stats.
 Identities = 16/76 (21%), Positives = 43/76 (57%), Gaps = 0/76 (0%)

Query  77   KFQEEYDYLGEYEDVAFEFNEDVVHAPVEDALVDNFPVEDVPVENVPVEDAPIEDALLED  136
            K + +   + E +D   E + DV     +D  V +  V+D+ V+++ V+D  ++D  +++
Sbjct  840  KIKNDEMVMQEQKDTKEEKHMDVQFIEEKDINVQHINVQDMDVQDMDVQDINVQDMDVQN  899

Query  137  VLMEDAPVEYVPVEDV  152
            + ++D  ++ + V+++
Sbjct  900  INVQDINIQDMDVQNI  915


>Q8IHN4_PLAF7 unnamed protein product
Length=6093

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 25/47 (53%), Gaps = 0/47 (0%)

Query  205   EDARGRRPCGRRNMEDALVEDALVEDVPLEDPHVEDFRVQYVPVEDI  251
             E  +G+ P    ++ED   ED + E  PLE+  +E+   +Y+   DI
Sbjct  1791  ESFKGQGPTDNVSVEDVNSEDIINEHTPLEETKIEELPTEYITTADI  1837



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold2079-size403250-augustus-gene-2.0-mRNA-1

Length=243
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKC9_DROME  unnamed protein product                                 91.7    4e-21
Q2PJ91_CAEEL  unnamed protein product                                 88.2    7e-20
Q23514_CAEEL  unnamed protein product                                 87.8    9e-20


>Q9VKC9_DROME unnamed protein product
Length=496

 Score = 91.7 bits (226),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 98/187 (52%), Gaps = 10/187 (5%)

Query  6    DFDWDAKTRGFLLSVFYYGYVLTNIAGGVLAVKYGGANVYGYGVLLTSLTTMLSPV-VTR  64
            DF+W  + +G +LS FY GY++T+I GG+LA K+GG    G G+L T++ TML+P+ + +
Sbjct  77   DFEWSEELQGLILSSFYIGYIVTHIPGGLLAEKFGGKWTLGLGILSTAVFTMLTPLAINK  136

Query  65   IHLYALIALRISEGIFEGILDPGVEILLSRWIPLHERSSIFALVESGYAWGHAATITASS  124
                 LI  R+  G+ EG   P + +LL+ W+P +ER  + ALV  G   G   TI  + 
Sbjct  137  GDSDWLIVTRVLMGLGEGTTFPALSVLLAAWVPANERGKLGALVLGG---GQVGTIMGNL  193

Query  125  AIGFHC---GWEAIFYCAGMTQIGIALYVLKFDYKNSGYLSSLPFIIKLLLMYLISPFAD  181
              G      GWE +FY  G   +G+  + + F +      +S PFI      YL+     
Sbjct  194  LSGVFIDAYGWEFVFYFFG--GLGVVWFAI-FMFLCYSDPTSHPFIKPSEREYLVKEIGT  250

Query  182  ILHMRNL  188
            I    +L
Sbjct  251  ISRNEDL  257


 Score = 30.8 bits (68),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 12/43 (28%), Positives = 24/43 (56%), Gaps = 0/43 (0%)

Query  184  HMRNLLTITATAEEWHTVFYIQIGICLLGSFAYGVLGSGQLQP  226
            ++  ++T  A+  EW  VF++  G+    +  Y +  SG++QP
Sbjct  422  YLVGVMTPNASLLEWRLVFWVAFGVLCFTAVIYCIWASGEVQP  464


>Q2PJ91_CAEEL unnamed protein product
Length=474

 Score = 88.2 bits (217),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 1/136 (1%)

Query  6    DFD-WDAKTRGFLLSVFYYGYVLTNIAGGVLAVKYGGANVYGYGVLLTSLTTMLSPVVTR  64
            DF+ W   T+G +LS F+YGY+++ + GG LA  +G   ++  G   T++ T+L+P   R
Sbjct  79   DFENWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFAR  138

Query  65   IHLYALIALRISEGIFEGILDPGVEILLSRWIPLHERSSIFALVESGYAWGHAATITASS  124
            +    L+  R  EG+ EG+  P + ++ SRW P  E++ +     SG  +G    +  S+
Sbjct  139  MGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSA  198

Query  125  AIGFHCGWEAIFYCAG  140
             +G H GW  IF+  G
Sbjct  199  YLGEHFGWPMIFWFFG  214


 Score = 32.0 bits (71),  Expect = 0.48, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (49%), Gaps = 0/39 (0%)

Query  194  TAEEWHTVFYIQIGICLLGSFAYGVLGSGQLQPWAVEKN  232
            T  EW+ + YI I   LLG+  +       LQPWA E  
Sbjct  429  TIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAEHT  467


>Q23514_CAEEL unnamed protein product
Length=479

 Score = 87.8 bits (216),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 75/136 (55%), Gaps = 1/136 (1%)

Query  6    DFD-WDAKTRGFLLSVFYYGYVLTNIAGGVLAVKYGGANVYGYGVLLTSLTTMLSPVVTR  64
            DF+ W   T+G +LS F+YGY+++ + GG LA  +G   ++  G   T++ T+L+P   R
Sbjct  84   DFENWTPMTQGVVLSSFFYGYIVSQLPGGYLAYTHGAKTIFFAGTFGTAVFTLLTPPFAR  143

Query  65   IHLYALIALRISEGIFEGILDPGVEILLSRWIPLHERSSIFALVESGYAWGHAATITASS  124
            +    L+  R  EG+ EG+  P + ++ SRW P  E++ +     SG  +G    +  S+
Sbjct  144  MGYGMLVFARFMEGLLEGVTYPAMHVIWSRWAPPMEQTKLATFAFSGSYFGTVVAMPLSA  203

Query  125  AIGFHCGWEAIFYCAG  140
             +G H GW  IF+  G
Sbjct  204  YLGEHFGWPMIFWFFG  219


 Score = 32.0 bits (71),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (49%), Gaps = 0/39 (0%)

Query  192  TATAEEWHTVFYIQIGICLLGSFAYGVLGSGQLQPWAVE  230
              T  EW+ + YI I   LLG+  +       LQPWA E
Sbjct  432  NGTIGEWNVIMYIIISAYLLGAAIFWKFADATLQPWAAE  470



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold1260-size535680-augustus-gene-4.3-mRNA-1

Length=367
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VSM8_DROME  unnamed protein product                                 494     1e-175
Q95TT8_DROME  unnamed protein product                                 493     3e-175
Q9VFX6_DROME  unnamed protein product                                 90.1    2e-19 


>Q9VSM8_DROME unnamed protein product
Length=403

 Score = 494 bits (1272),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 241/370 (65%), Positives = 284/370 (77%), Gaps = 11/370 (3%)

Query  3    GIPDEQGRRALCWKLLLNYLPPTRGTWSETLARKRELYKQFIEEMIVMPGESQE------  56
            G+PD Q  RAL WKLLL YL P R +W+ TLA+KR LYKQFIEE+++ PG S        
Sbjct  34   GVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSNRASVDG  93

Query  57   DDGSLID---VTMADHPLNLNPDSQWQTFFKDNEVLLQIDKDVRRLCPDISFFQQATDFP  113
             DG  +D   V + DHPL+  P+S W TFF DNE LLQIDKDVRRLCPDISFFQQ TD+P
Sbjct  94   GDGDKVDSGGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYP  153

Query  114  CQQVVHSSG--VKRLHVRVQHNVLKSANVERKGLGVTKITLSVKKATEDYAPMSEGLEAH  171
            C+ VVHS G   +RLH RV   VL SANVERKGLG+TKI L  K++ E+YA M EG EAH
Sbjct  154  CEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAH  213

Query  172  WEVVERILFLYAKLNPGQGYVQGMNEIIGPIYYSFACDLDAEWREYAEADCFFCFTNLMG  231
            WEVV+RILF+YAKLNPGQGYVQGMNEI+GPIYY  A D D  +R +AEADCFFCFT LM 
Sbjct  214  WEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMS  273

Query  232  EIRDFFIKSLDEAECGINGMMSKLGEQLKSKDYPVWVRLQELELYPQYYSFRWLTLLLSQ  291
            EIRDFFIK+LD+AE GI  MM++L   LKSKD  ++  L+  EL+PQYYSFRWLTLLLSQ
Sbjct  274  EIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQ  333

Query  292  EFPLPDVLRIWDSLFADENRFEFLIFICCAMIILLRDMLLCGDFPTNVKLLQNFPSTDIQ  351
            EFPLPDVLRIWDS+FADE RF+FLI ICC+MI++ R+ +L  DF +NVKLLQN+P  DI 
Sbjct  334  EFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILENDFASNVKLLQNYPPIDIN  393

Query  352  IVLSKAAELA  361
            +V++ A  LA
Sbjct  394  VVIAHAGSLA  403


>Q95TT8_DROME unnamed protein product
Length=403

 Score = 493 bits (1269),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/370 (65%), Positives = 284/370 (77%), Gaps = 11/370 (3%)

Query  3    GIPDEQGRRALCWKLLLNYLPPTRGTWSETLARKRELYKQFIEEMIVMPGESQE------  56
            G+PD Q  RAL WKLLL YL P R +W+ TLA+KR LYKQFIEE+++ PG S        
Sbjct  34   GVPDVQSFRALSWKLLLGYLGPRRSSWTTTLAQKRALYKQFIEELVLPPGHSSNRASVDG  93

Query  57   DDGSLID---VTMADHPLNLNPDSQWQTFFKDNEVLLQIDKDVRRLCPDISFFQQATDFP  113
             DG  +D   V + DHPL+  P+S W TFF DNE LLQIDKDVRRLCPDISFFQQ TD+P
Sbjct  94   GDGDKVDSGGVGLQDHPLSEGPESAWNTFFNDNEFLLQIDKDVRRLCPDISFFQQPTDYP  153

Query  114  CQQVVHSSG--VKRLHVRVQHNVLKSANVERKGLGVTKITLSVKKATEDYAPMSEGLEAH  171
            C+ VVHS G   +RLH RV   VL SANVERKGLG+TKI L  K++ E+YA M EG EAH
Sbjct  154  CEIVVHSKGEHGRRLHERVVPAVLSSANVERKGLGMTKINLITKRSVENYAAMEEGQEAH  213

Query  172  WEVVERILFLYAKLNPGQGYVQGMNEIIGPIYYSFACDLDAEWREYAEADCFFCFTNLMG  231
            WEVV+RILF+YAKLNPGQGYVQGMNEI+GPIYY  A D D  +R +AEADCFFCFT LM 
Sbjct  214  WEVVQRILFIYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADCFFCFTALMS  273

Query  232  EIRDFFIKSLDEAECGINGMMSKLGEQLKSKDYPVWVRLQELELYPQYYSFRWLTLLLSQ  291
            EIRDFFIK+LD+AE GI  MM++L   LKSKD  ++  L+  EL+PQYYSFRWLTLLLSQ
Sbjct  274  EIRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQYYSFRWLTLLLSQ  333

Query  292  EFPLPDVLRIWDSLFADENRFEFLIFICCAMIILLRDMLLCGDFPTNVKLLQNFPSTDIQ  351
            EFPLPDVLRIWDS+FADE RF+FLI ICC+MI++ ++ +L  DF +NVKLLQN+P  DI 
Sbjct  334  EFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQKEAILENDFASNVKLLQNYPPIDIN  393

Query  352  IVLSKAAELA  361
            +V++ A  LA
Sbjct  394  VVIAHAGSLA  403


>Q9VFX6_DROME unnamed protein product
Length=654

 Score = 90.1 bits (222),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 108/221 (49%), Gaps = 41/221 (19%)

Query  178  ILFLYAKLNPGQGYVQGMNEIIGPIYYSFACD-------------------LDAEWREYA  218
            ILF YA+ +P   Y QGM+EI+ PI +    D                   LD     Y 
Sbjct  176  ILFYYAREHPYMCYRQGMHEILAPIIFVVYSDHQSLLHFSELAKTDINPTLLDVLDPAYL  235

Query  219  EADCFFCFTNLMGEIRDFF------------IKSLDEA--------ECGINGMMSKLGEQ  258
            EAD +  F+ LM  +  ++            I+   E+        E  + G ++ + ++
Sbjct  236  EADTYSLFSRLMASVESYYRVSNLVSTPGGHIEQRAESPGDNETSTEAEVIGQLNFIRDK  295

Query  259  LKSK-DYPVWVRLQELELYPQYYSFRWLTLLLSQEFPLPDVLRIWDSLFADENRFEFLIF  317
            + +K D  +   LQ++E+    +  RWL LL  +EF L D+L +WD++FAD +RF+   +
Sbjct  296  ILAKQDQHLHHYLQKMEIPLHIFGIRWLRLLFGREFMLLDLLLLWDAIFADSDRFDLPNY  355

Query  318  ICCAMIILLRDMLLCGDFPTNVKLLQNFPST-DIQIVLSKA  357
            I  AM++ +RD LL  D+ T++  L  +P+  D+ +VL  A
Sbjct  356  ILVAMLVHIRDKLLLSDYTTSLTYLMRYPNNVDVHLVLRHA  396


 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 46/98 (47%), Gaps = 8/98 (8%)

Query  11   RALCWKLLLNYLPPTRGTWSETLARKRELYKQFIEEMIVMPGESQEDDGSLIDVTMADHP  70
            R++ W LLL  L     +W+    ++R  Y +F  + +  P +        + V   D P
Sbjct  77   RSVHWALLLRVLTSEHRSWTSQRLQQRVRYDKFRADYVRNPHQ--------LAVDCNDDP  128

Query  71   LNLNPDSQWQTFFKDNEVLLQIDKDVRRLCPDISFFQQ  108
            L+ +  S W  +F D ++   I +DV R  P + FF++
Sbjct  129  LSQSTQSVWNQYFSDQDLFAVIRQDVVRTFPGVDFFRK  166



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold2347-size359201-augustus-gene-2.6-mRNA-1

Length=715
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NAAT1_DROME  unnamed protein product                                  660     0.0  
Q9VSV2_DROME  unnamed protein product                                 597     0.0  
Q86P29_DROME  unnamed protein product                                 597     0.0  


>NAAT1_DROME unnamed protein product
Length=641

 Score = 660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/643 (52%), Positives = 440/643 (68%), Gaps = 40/643 (6%)

Query  91   QPEAKDTRNGVTAPSKNPSNGSTAEEEDAPERQQWANGVEFLMSCIAMSVGLGNIWRFPF  150
            QP    +       +   S   T  E+   ER  W NG+EFLMSCI++SVGLGN+WRFPF
Sbjct  7    QPSNGSSNGSGNGATNAASTEKTDAEKPTAERTNWGNGLEFLMSCISVSVGLGNVWRFPF  66

Query  151  TAYENGGGAFLIPYIIVLFIIGKPMYYMEMAMGQFSSYGPIKVWNLSPLFKGIGYGQMFA  210
            TAYENGGGAFLIPYIIVLF+IGKPMYY+EM MGQF+S G +K+W++ P F G+GYGQ F 
Sbjct  67   TAYENGGGAFLIPYIIVLFLIGKPMYYLEMIMGQFTSQGTVKIWSVVPGFVGVGYGQAFG  126

Query  211  TACTLTYYCSLMALTAFYFVMSFSAELPWAHCRPEWGPNCFDSVKSENYTYNF-------  263
            T C ++YY SL+ALT +Y  +SF +ELPW++CR EW  NC +S + + Y  N        
Sbjct  127  TICIISYYSSLLALTLYYLFVSFQSELPWSYCRDEW-TNCVNS-RPQEYVDNLLTGVSLA  184

Query  264  ---------------SANLQSSSELYFTKHVLQEQDTIHYGLGAPDWRLTLCLLFSWLSV  308
                           +  LQSSSELYF   V++E+  I  G+G PDW+LTL L  +W+ +
Sbjct  185  NESARNLSGIVANDETEKLQSSSELYFLNVVIKEKLDISDGVGDPDWKLTLALFVAWVVI  244

Query  309  FVVVIRGVKSSGKAAYFLALFPYVIMVTLLIKGCTLEGAGQGILFFITPQWEQLLNPSVW  368
            F+V++RGVKSSGKAAYFLALFPYV++  LLI+  TLEGA  GILFF+ PQW +LLNP+VW
Sbjct  245  FLVIMRGVKSSGKAAYFLALFPYVVLFVLLIRAVTLEGARDGILFFLEPQWGELLNPTVW  304

Query  369  YAAVTQAFFSLNVGFGSLIMYSSYNNFKENIHRDALIVTTLDTFTSLIAGCTIFAILGNL  428
              AV Q FFSL VG G +IM++SYN F   I+RDA+IVTTLDT TSL+ G TIFAILGNL
Sbjct  305  KEAVVQCFFSLAVGSGPIIMFASYNRFDHGIYRDAMIVTTLDTLTSLLGGITIFAILGNL  364

Query  429  AHEMGVDDIRTVVRGGTGLAFISYPDAIAKFPGVPQLFAVLFFLMLFVLGVGSAVALASS  488
            AH + +++IR VVR GTGLAFISYPDAI+KF  VPQLF+VLFF MLFVLG+GS VAL S+
Sbjct  365  AHNLQIENIRDVVRSGTGLAFISYPDAISKFQAVPQLFSVLFFFMLFVLGIGSIVALQST  424

Query  489  VITIVSDQFPHFRHSLVVTAVCCGGFLVGLVYITPGGQFILNLVDFYAVTFVVFVLAVLE  548
            ++TI+ DQF  +++  V       GFL+GLVY+TPGGQ+IL LVDFY  T+VVF+LA+ E
Sbjct  425  IVTIICDQFKGWKYWKVALTTSVCGFLMGLVYVTPGGQWILTLVDFYGGTYVVFILAIFE  484

Query  549  MIGVHWVYGLNNFCHDLEFMQGHAVGIYWRLCWGLITPVILFVVLVYFILTMKPLTYTND  608
            + G+ WVYGL NFC D+EFM    V +YWR+CW   TPV++ ++ +Y ++T++P+ Y+  
Sbjct  485  LAGIVWVYGLQNFCDDIEFMCNRRVSLYWRVCWSFFTPVMMIIIFIYSMVTIEPIKYSEL  544

Query  609  YIYPDSAYAAGWVLLGFGAIQFPLWAIFRLIKKRHLGFPQAA---------RVTELWCPK  659
            Y +P++A  AGW+L   GA QFPLW ++ +   RH   PQ           + ++ W P 
Sbjct  545  Y-FPEAANIAGWLLFAIGAAQFPLWGLWYI--SRH---PQGTYWKSLKASLKPSDRWGPA  598

Query  660  VPSQRREWLLFKADKKMESDSIAEVETRLQKLSRKFLGFVTSQ  702
             P  RREW++FK ++K    +  +  ++L    RK   F  S 
Sbjct  599  NPEIRREWVIFK-NQKAAQRATQKDTSKLGFFWRKVANFCGSN  640


>Q9VSV2_DROME unnamed protein product
Length=629

 Score = 597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/601 (49%), Positives = 398/601 (66%), Gaps = 16/601 (3%)

Query  89   LRQPEAKDTRNGVTAPSKNPSNGSTAE-EEDAPERQQWANGVEFLMSCIAMSVGLGNIWR  147
            L       +   +  PS  P    ++E   D   R  W + +EFLMSCIA+SVGLGN+WR
Sbjct  17   LETSRCAGSGEALLKPSLLPMALESSELSPDRKARDNWGSSLEFLMSCIALSVGLGNVWR  76

Query  148  FPFTAYENGGGAFLIPYIIVLFIIGKPMYYMEMAMGQFSSYGPIKVWNLSPLFKGIGYGQ  207
            FPFTA ENGGGAFLIPY++VLF++GKP+YYMEM +GQFSS G ++V++ +PL +G+GY Q
Sbjct  77   FPFTALENGGGAFLIPYLVVLFVVGKPIYYMEMLLGQFSSRGIVQVFDFAPLMRGVGYAQ  136

Query  208  MFATACTLTYYCSLMALTAFYFVMSFSAELPWAHCRPEWGPNCFDSVKSENYTYNFSANL  267
            + A     TYY S+MALT  YF  SF++ELPW+ CR EWG  C  +   +      S N 
Sbjct  137  LLALGVLATYYASVMALTLRYFFDSFASELPWSFCREEWGDGCVSASGGQPLQGQLSRNF  196

Query  268  QSSSELYFTKHVLQEQDTIHYGLGAPDWRLTLCLLFSWLSVFVVVIRGVKSSGKAAYFLA  327
             SS++LY  + VL E D++  G+G P   L L L  SWL+V +++IRGVKSSGKAAY LA
Sbjct  197  SSSTQLYLQRIVLNETDSLEEGIGYPSGSLALMLGISWLTVTLIIIRGVKSSGKAAYVLA  256

Query  328  LFPYVIMVTLLIKGCTLEGAGQGILFFITPQWEQLLNPSVWYAAVTQAFFSLNVGFGSLI  387
            LFPYV+M  LL++  TL GA  G+++F+TPQWE+LL P VWY AVTQ FFSL V FG +I
Sbjct  257  LFPYVVMFILLVRALTLPGAYDGVMYFLTPQWEKLLEPQVWYNAVTQVFFSLAVCFGVII  316

Query  388  MYSSYNNFKENIHRDALIVTTLDTFTSLIAGCTIFAILGNLAHEMGVDDIRTVVRGGTGL  447
            MYSSYN F  N++RDA IVTTLDTFTSL++G  IF ILGNLAHE G  DI +VV+ G GL
Sbjct  317  MYSSYNRFGHNVYRDANIVTTLDTFTSLLSGVIIFGILGNLAHESGTKDIASVVKAGPGL  376

Query  448  AFISYPDAIAKFPGVPQLFAVLFFLMLFVLGVGSAVALASSVITIVSDQFPHFRHSLVVT  507
            AFISYPDAIAKF   PQ+F++LFF MLF+LGVGS V + S ++T++ DQF + +  ++V 
Sbjct  377  AFISYPDAIAKFKMFPQVFSLLFFAMLFMLGVGSNVGMVSCIMTVLKDQFVNVKLWIIVV  436

Query  508  AVCCGGFLVGLVYITPGGQFILNLVDFYAVTFVVFVLAVLEMIGVHWVYGLNNFCHDLEF  567
            ++   GFLVGL+YITPGGQ I+ L+DF+ VTFV  V A+ E+I V W+YG    C D E+
Sbjct  437  SLSVIGFLVGLIYITPGGQHIITLMDFHGVTFVSLVSAIFELIAVGWIYGTKRLCQDAEY  496

Query  568  MQGHAVGIYWRLCWGLITPVILFVVLVYFILTMKPLTYTNDYIYPDSAYAAGWVLLGFGA  627
            M       Y+R+CW ++TP+++ V+LVY +LTM+PL+Y N   +P      GW + G   
Sbjct  497  MLNIKTSNYYRICWSIVTPLVMLVILVYSLLTMRPLSY-NGQEFPLVYRVVGWCVSGCII  555

Query  628  IQFPLWAIFRLIKKRHLGFPQAARVTEL---------WCPKVPSQRREWLLFKADKKMES  678
             Q   WA +   K+     P+ +  + +         W P  P +  ++ +F  +K  E+
Sbjct  556  GQLFYWAGYANFKQ-----PKGSLKSRINNSIKPHSDWGPSDPKKLMDYQMFLRNKDEEN  610

Query  679  D  679
             
Sbjct  611  S  611


>Q86P29_DROME unnamed protein product
Length=629

 Score = 597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/601 (49%), Positives = 398/601 (66%), Gaps = 16/601 (3%)

Query  89   LRQPEAKDTRNGVTAPSKNPSNGSTAE-EEDAPERQQWANGVEFLMSCIAMSVGLGNIWR  147
            L       +   +  PS  P    ++E   D   R  W + +EFLMSCIA+SVGLGN+WR
Sbjct  17   LETSRCAGSGEALLKPSLLPMALESSELSPDRKARDNWGSSLEFLMSCIALSVGLGNVWR  76

Query  148  FPFTAYENGGGAFLIPYIIVLFIIGKPMYYMEMAMGQFSSYGPIKVWNLSPLFKGIGYGQ  207
            FPFTA ENGGGAFLIPY++VLF++GKP+YYMEM +GQFSS G ++V++ +PL +G+GY Q
Sbjct  77   FPFTALENGGGAFLIPYLVVLFVVGKPIYYMEMLLGQFSSRGIVQVFDFAPLMRGVGYAQ  136

Query  208  MFATACTLTYYCSLMALTAFYFVMSFSAELPWAHCRPEWGPNCFDSVKSENYTYNFSANL  267
            + A     TYY S+MALT  YF  SF++ELPW+ CR EWG  C  +   +      S N 
Sbjct  137  LLALGVLATYYASVMALTLRYFFDSFASELPWSFCREEWGDGCVSASGGQPLQGQLSRNF  196

Query  268  QSSSELYFTKHVLQEQDTIHYGLGAPDWRLTLCLLFSWLSVFVVVIRGVKSSGKAAYFLA  327
             SS++LY  + VL E D++  G+G P   L L L  SWL+V +++IRGVKSSGKAAY LA
Sbjct  197  SSSTQLYLQRIVLNETDSLEKGIGYPSGSLALMLGISWLTVTLIIIRGVKSSGKAAYVLA  256

Query  328  LFPYVIMVTLLIKGCTLEGAGQGILFFITPQWEQLLNPSVWYAAVTQAFFSLNVGFGSLI  387
            LFPYV+M  LL++  TL GA  G+++F+TPQWE+LL P VWY AVTQ FFSL V FG +I
Sbjct  257  LFPYVVMFILLVRALTLPGAYDGVMYFLTPQWEKLLEPQVWYNAVTQVFFSLAVCFGVII  316

Query  388  MYSSYNNFKENIHRDALIVTTLDTFTSLIAGCTIFAILGNLAHEMGVDDIRTVVRGGTGL  447
            MYSSYN F  N++RDA IVTTLDTFTSL++G  IF ILGNLAHE G  DI +VV+ G GL
Sbjct  317  MYSSYNRFGHNVYRDANIVTTLDTFTSLLSGVIIFGILGNLAHESGTKDIASVVKAGPGL  376

Query  448  AFISYPDAIAKFPGVPQLFAVLFFLMLFVLGVGSAVALASSVITIVSDQFPHFRHSLVVT  507
            AFISYPDAIAKF   PQ+F++LFF MLF+LGVGS V + S ++T++ DQF + +  ++V 
Sbjct  377  AFISYPDAIAKFKMFPQVFSLLFFAMLFMLGVGSNVGMVSCIMTVLKDQFVNVKLWIIVV  436

Query  508  AVCCGGFLVGLVYITPGGQFILNLVDFYAVTFVVFVLAVLEMIGVHWVYGLNNFCHDLEF  567
            ++   GFLVGL+YITPGGQ I+ L+DF+ VTFV  V A+ E+I V W+YG    C D E+
Sbjct  437  SLSVIGFLVGLIYITPGGQHIITLMDFHGVTFVSLVSAIFELIAVGWIYGTKRLCQDAEY  496

Query  568  MQGHAVGIYWRLCWGLITPVILFVVLVYFILTMKPLTYTNDYIYPDSAYAAGWVLLGFGA  627
            M       Y+R+CW ++TP+++ V+LVY +LTM+PL+Y N   +P      GW + G   
Sbjct  497  MLNIKTSNYYRICWSIVTPLVMLVILVYSLLTMRPLSY-NGQEFPLVYRVVGWCVSGCII  555

Query  628  IQFPLWAIFRLIKKRHLGFPQAARVTEL---------WCPKVPSQRREWLLFKADKKMES  678
             Q   WA +   K+     P+ +  + +         W P  P +  ++ +F  +K  E+
Sbjct  556  GQLFYWAGYANFKQ-----PKGSLKSRINNSIKPHSDWGPSDPKKLMDYQMFLRNKDEEN  610

Query  679  D  679
             
Sbjct  611  S  611



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold2464-size351418-augustus-gene-2.5-mRNA-1

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SC5A7_CAEEL  unnamed protein product                                  466     4e-158
G3MU40_CAEEL  unnamed protein product                                 34.3    0.40  
G5ECM1_CAEEL  unnamed protein product                                 33.9    0.46  


>SC5A7_CAEEL unnamed protein product
Length=576

 Score = 466 bits (1198),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 254/553 (46%), Positives = 346/553 (63%), Gaps = 33/553 (6%)

Query  70   GVVAILLFYGAVLAVGIWAGTKQKNQGQ---------EEVMLAGRSLGMFVGVLTLIGEA  120
            G+VAI+ FY  +L VGIWAG K K+  +         EEVMLAGR++G  VG+ T+   A
Sbjct  6    GIVAIVFFYVLILVVGIWAGRKSKSSKELESEAGAATEEVMLAGRNIGTLVGIFTM--TA  63

Query  121  TWVGGGFINGTAEAMFTNGLAWCQMPLGYSLSLFFGVVLFVKKMRAANYITMLDPFQNMY  180
            TWVGG +INGTAEA++  GL  CQ P+GY++SL  G +LF KKMR   YITMLDPFQ+ Y
Sbjct  64   TWVGGAYINGTAEALYNGGLLGCQAPVGYAISLVMGGLLFAKKMREEGYITMLDPFQHKY  123

Query  181  GSKIGSLMFFPGLMADVFWVGAILNALGSSLMVILDLNMTISVIVSAIFAGAYTMAGGLY  240
            G +IG LM+ P L+ + FW  AIL+ALG++L VIL ++M  SV +SA  A  YT  GG Y
Sbjct  124  GQRIGGLMYVPALLGETFWTAAILSALGATLSVILGIDMNASVTLSACIAVFYTFTGGYY  183

Query  241  SVSYTDVIQLFLIVIGLLLATPFAYTNPLVSHTAMAAHDWMGHVET-RSIGKWIDDFLLL  299
            +V+YTDV+QLF I +GL +  P A  +      +  A DW+G +   +    WID  LLL
Sbjct  184  AVAYTDVVQLFCIFVGLWVCVPAAMVHDGAKDISRNAGDWIGEIGGFKETSLWIDCMLLL  243

Query  300  IFGGIPWQAYVQRILSIKSTRIAQMMSFGAVIGCFTMAIPAAVTGVIGKGADW---EHVP  356
            +FGGIPWQ Y QR+LS K+   AQ +SF A +GC  MAIP A+ G I +  DW   ++ P
Sbjct  244  VFGGIPWQVYFQRVLSSKTAHGAQTLSFVAGVGCILMAIPPALIGAIARNTDWRMTDYSP  303

Query  357  GFEANVTEA----QASIILPLVLRYLTPQWVACFGLGAISAAAMSSADACILSSSSMFSR  412
                   E+    + ++++PLV +YLTP+WVA  GLGA+SAA MSSAD+ +LS++SMF+ 
Sbjct  304  WNNGTKVESIPPDKRNMVVPLVFQYLTPRWVAFIGLGAVSAAVMSSADSSVLSAASMFAH  363

Query  413  NIYKVAVRTGASDVEVLWVLRFSIVAVTSLATVIALTVDSIYYLSFLCSDLVYVILFPQL  472
            NI+K+ +R  AS+ EV+ V+R +I+ V  +AT++ALT+ SIY L +LC+DLVYVILFPQL
Sbjct  364  NIWKLTIRPHASEKEVIIVMRIAIICVGIMATIMALTIQSIYGLWYLCADLVYVILFPQL  423

Query  473  FLVVHWASGVNSYGCVSAYAVGLTMRLLCGEPGLGIPVVLELPLYDAESNTQMFPLRTLC  532
              VV+     N+YG ++ YAVGL +RL+ GEP + +P     P+Y      Q FP RT  
Sbjct  424  LCVVYMPRS-NTYGSLAGYAVGLVLRLIGGEPLVSLPAFFHYPMY--TDGVQYFPFRTTA  480

Query  533  MLSSMITHVTVSTLARLCFERGWLPPRCDVLGAFADXXXXXXXXXGKLAVPHTPLADNMP  592
            MLSSM T   VS  +   F+ G L P  DV+G   +           + + H PL  ++ 
Sbjct  481  MLSSMATIYIVSIQSEKLFKSGRLSPEWDVMGCVVN-----------IPIDHVPLPSDVS  529

Query  593  PEGKSGKFGFQNP  605
                S     + P
Sbjct  530  FAVSSETLNMKAP  542


>G3MU40_CAEEL unnamed protein product
Length=1520

 Score = 34.3 bits (77),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (47%), Gaps = 2/96 (2%)

Query  358   FEANVTEAQASIILPLVLRYLTPQWVACFG-LGAISAAAMSSADACILSSSSMFSRNIYK  416
             +E    ++    I PL  +  +   V  F  +G      MS+   C L+ SS+F R  ++
Sbjct  1321  YEKQKRDSSRGNIDPLTEKKRSDMMVKFFQFMGCRKFRKMSTLSFCPLNFSSIFMRGEWR  1380

Query  417   VAVRTG-ASDVEVLWVLRFSIVAVTSLATVIALTVD  451
             +   +   +   +L+ LRF  + V+S  T+ A T+D
Sbjct  1381  IFHESALKTYYNILFNLRFEELPVSSDPTITAETMD  1416


>G5ECM1_CAEEL unnamed protein product
Length=1601

 Score = 33.9 bits (76),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 45/96 (47%), Gaps = 2/96 (2%)

Query  358   FEANVTEAQASIILPLVLRYLTPQWVACFG-LGAISAAAMSSADACILSSSSMFSRNIYK  416
             +E    ++    I PL  +  +   V  F  +G      MS+   C L+ SS+F R  ++
Sbjct  1402  YEKQKRDSSRGNIDPLTEKKRSDMMVKFFQFMGCRKFRKMSTLSFCPLNFSSIFMRGEWR  1461

Query  417   VAVRTG-ASDVEVLWVLRFSIVAVTSLATVIALTVD  451
             +   +   +   +L+ LRF  + V+S  T+ A T+D
Sbjct  1462  IFHESALKTYYNILFNLRFEELPVSSDPTITAETMD  1497



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


Query= maker-scaffold2750-size610360-augustus-gene-2.4-mRNA-1

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24559_DROME  unnamed protein product                                 104     2e-25
Q9VL50_DROME  unnamed protein product                                 103     2e-25
X2J9A4_DROME  unnamed protein product                                 103     3e-25


>Q24559_DROME unnamed protein product
Length=402

 Score = 104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 92/134 (69%), Gaps = 17/134 (13%)

Query  1    MADKKKGKKRREEVSEE----LEKPAKEEYTIAKWMKKNVPTKKTKFLNHNVEYFTGAKA  56
            M++KK+ ++R++E +E     ++KP+K+E  +AKW+KKNV TKKTKFL+H VEYFT +KA
Sbjct  1    MSEKKRARRRKDEYTEPGAQKVDKPSKDEKNVAKWLKKNVKTKKTKFLSHIVEYFTSSKA  60

Query  57   VDAFMASPWATEKEGVEPYFTTRLDVVRYLDKMLRHKFFHRAKKVPVSEQELKAKLKKKE  116
            +DA M S +    EG  P FTTR  V+ +LD ML HKFFHRAKKVPV+ +E++ K     
Sbjct  61   IDALMKSKFT---EGSNPLFTTREQVIEFLDVMLEHKFFHRAKKVPVTLEEIRGK-----  112

Query  117  KDKKSDGGDKRNKK  130
                  GGDK+  K
Sbjct  113  -----SGGDKKADK  121


>Q9VL50_DROME unnamed protein product
Length=415

 Score = 103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 91/126 (72%), Gaps = 10/126 (8%)

Query  1    MADKKKGKKRREEVSEE----LEKPAKEEYTIAKWMKKNVPTKKTKFLNHNVEYFTGAKA  56
            M++KK+ ++R++E +E     ++KP+K+E  +AKW+KKNV TKKTKFL+H VEYFT +KA
Sbjct  1    MSEKKRARRRKDEYTEPGAQKVDKPSKDEKNVAKWLKKNVKTKKTKFLSHIVEYFTSSKA  60

Query  57   VDAFMASPWATEKEGVEPYFTTRLDVVRYLDKMLRHKFFHRAKKVPVSEQELKAKLKKKE  116
            +DA + S +    EG  P FTTR  V+ +LD ML HKFFHRAKKVPV+ +E++    K  
Sbjct  61   IDALLKSKFT---EGSNPLFTTREQVIEFLDVMLEHKFFHRAKKVPVTLEEIRG---KSG  114

Query  117  KDKKSD  122
             DKK+D
Sbjct  115  GDKKAD  120


>X2J9A4_DROME unnamed protein product
Length=385

 Score = 103 bits (256),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 92/134 (69%), Gaps = 17/134 (13%)

Query  1    MADKKKGKKRREEVSEE----LEKPAKEEYTIAKWMKKNVPTKKTKFLNHNVEYFTGAKA  56
            M++KK+ ++R++E +E     ++KP+K+E  +AKW+KKNV TKKTKFL+H VEYFT +KA
Sbjct  1    MSEKKRARRRKDEYTEPGAQKVDKPSKDEKNVAKWLKKNVKTKKTKFLSHIVEYFTSSKA  60

Query  57   VDAFMASPWATEKEGVEPYFTTRLDVVRYLDKMLRHKFFHRAKKVPVSEQELKAKLKKKE  116
            +DA + S +    EG  P FTTR  V+ +LD ML HKFFHRAKKVPV+ +E++ K     
Sbjct  61   IDALLKSKFT---EGSNPLFTTREQVIEFLDVMLEHKFFHRAKKVPVTLEEIRGK-----  112

Query  117  KDKKSDGGDKRNKK  130
                  GGDK+  K
Sbjct  113  -----SGGDKKADK  121



Lambda      K        H
   0.322    0.137    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3515528214


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold13965-size18010-augustus-gene-0.1-mRNA-1

Length=276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86P77_DROME  unnamed protein product                                 323     9e-102
Q9VDE9_DROME  unnamed protein product                                 323     1e-101
MGP2_DICDI  unnamed protein product                                   105     2e-25 


>Q86P77_DROME unnamed protein product
Length=1309

 Score = 323 bits (827),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 183/232 (79%), Gaps = 6/232 (3%)

Query  47    ESLRRGWELLAVCLAFFPPSPKFQPYLDGYMNRHMDPSFD--FPEVGKWPIHVQISHYAT  104
             +SL RGWEL+A+CL++ PPSP FQP L  Y+NRH DPSF   F EV KWPIHVQISHYAT
Sbjct  1015  DSLIRGWELMAICLSYVPPSPTFQPTLLNYVNRHRDPSFATCFMEVSKWPIHVQISHYAT  1074

Query  105   VSCKRLERIGHTGKKSPRKPTVDEIDQARLQIFRPSMFGNTLEEVMALQKERFPHKKLPW  164
             V C+RL+RIG +G++  +KPTVDE++QAR QI R SMFGNTL EVM LQKE+FP +KLPW
Sbjct  1075  VCCRRLDRIGSSGRRMAKKPTVDEVEQARQQILRNSMFGNTLSEVMDLQKEKFPFRKLPW  1134

Query  165   VQSTLSEEVLRLQGAQTEGIFRVSADVDEVNTLKSKIDHWELP---ADTTDAHAPASLLK  221
             +Q+TLSE VL L G QTEGIFRVSADVDEV  +K+++D W++P       DAH PASLLK
Sbjct  1135  IQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMKNRLDRWDVPDYKNTLVDAHTPASLLK  1194

Query  222   LWYRELYEPLIPDEMYMECVNHHGEPETAIAIVNSLPELNKLVLCYLIRFLQ  273
             LWYRELY+PLIPD  Y +CVN   +P+ A  IVN LPE+N+LVL YLI FLQ
Sbjct  1195  LWYRELYDPLIPDAYYEDCVNTE-DPDKAKEIVNKLPEINQLVLTYLIHFLQ  1245


 Score = 60.5 bits (145),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)

Query  10   ESDIEKYAQDNLNIHKKGIFRKKFSVRDMLSWS  42
            E DIEK+A DNLN+H KGIFRKK SVRDMLSW+
Sbjct  904  ECDIEKFAADNLNLHSKGIFRKKASVRDMLSWT  936


>Q9VDE9_DROME unnamed protein product
Length=1330

 Score = 323 bits (827),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 183/232 (79%), Gaps = 6/232 (3%)

Query  47    ESLRRGWELLAVCLAFFPPSPKFQPYLDGYMNRHMDPSFD--FPEVGKWPIHVQISHYAT  104
             +SL RGWEL+A+CL++ PPSP FQP L  Y+NRH DPSF   F EV KWPIHVQISHYAT
Sbjct  1036  DSLIRGWELMAICLSYVPPSPTFQPTLLNYVNRHRDPSFATCFMEVSKWPIHVQISHYAT  1095

Query  105   VSCKRLERIGHTGKKSPRKPTVDEIDQARLQIFRPSMFGNTLEEVMALQKERFPHKKLPW  164
             V C+RL+RIG +G++  +KPTVDE++QAR QI R SMFGNTL EVM LQKE+FP +KLPW
Sbjct  1096  VCCRRLDRIGSSGRRMAKKPTVDEVEQARQQILRNSMFGNTLSEVMDLQKEKFPFRKLPW  1155

Query  165   VQSTLSEEVLRLQGAQTEGIFRVSADVDEVNTLKSKIDHWELP---ADTTDAHAPASLLK  221
             +Q+TLSE VL L G QTEGIFRVSADVDEV  +K+++D W++P       DAH PASLLK
Sbjct  1156  IQTTLSEHVLLLNGKQTEGIFRVSADVDEVGCMKNRLDRWDVPDYKNTLVDAHTPASLLK  1215

Query  222   LWYRELYEPLIPDEMYMECVNHHGEPETAIAIVNSLPELNKLVLCYLIRFLQ  273
             LWYRELY+PLIPD  Y +CVN   +P+ A  IVN LPE+N+LVL YLI FLQ
Sbjct  1216  LWYRELYDPLIPDAYYEDCVNTE-DPDKAKEIVNKLPEINQLVLTYLIHFLQ  1266


 Score = 60.5 bits (145),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)

Query  10   ESDIEKYAQDNLNIHKKGIFRKKFSVRDMLSWS  42
            E DIEK+A DNLN+H KGIFRKK SVRDMLSW+
Sbjct  925  ECDIEKFAADNLNLHSKGIFRKKASVRDMLSWT  957


>MGP2_DICDI unnamed protein product
Length=877

 Score = 105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 88/162 (54%), Gaps = 18/162 (11%)

Query  113  IGHTGKKSPRKPTVDEIDQARLQIFRPSMFGNTLEEVMALQKERFPHKKLPWVQSTLSEE  172
            IG T K  P  PT                F  +L+E+M  QK+  P  ++P+V   LS  
Sbjct  357  IGGTKKDEPILPTAS--------------FKVSLDELMNRQKDNHPTLEVPYVLQVLSTR  402

Query  173  VLRLQGAQTEGIFRVSADVDEVNTLKSKIDHWELP-ADTTDAHAPASLLKLWYRELYEPL  231
            + +++G  TEGIFRV   +  +   + +ID  +   ++  D   PA+LLK W R++   L
Sbjct  403  IAQMKGHVTEGIFRVPGIISTIKETRLRIDKADFNLSNIDDVRTPAALLKQWLRDIPTAL  462

Query  232  IPDEMYMECVNHHGEPETAIAIVNSLPELNKLVLCYLIRFLQ  273
            IPD +Y +C++    P  AIAIV ++P +N+ VLCYLI FLQ
Sbjct  463  IPDSLYQQCID---TPTNAIAIVKTIPIINQRVLCYLINFLQ  501



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold989-size604863-augustus-gene-1.7-mRNA-1

Length=431
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JRC3_DROME  unnamed protein product                                 375     8e-127
Q95U55_DROME  unnamed protein product                                 209     3e-65 
Q9Y0Z8_DROME  unnamed protein product                                 31.2    2.0   


>Q7JRC3_DROME unnamed protein product
Length=474

 Score = 375 bits (963),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 192/402 (48%), Positives = 263/402 (65%), Gaps = 16/402 (4%)

Query  36   MGLLSKLVAAGIAILLAYMYLVLTEV---PPLPRLE-TKWWG-RGQPQ------KVDESI  84
            MG+  K++   +AI    +Y  +T++    P P+L+  +WWG   QP+      K +  +
Sbjct  1    MGVTVKILVLILAIAGGLVYRNVTQLWADLPAPKLDPQEWWGDEAQPKDYEAYLKNNSEV  60

Query  85   RPFKINVPQKVLDDLKERLKRAPEFTQPLEGIGFEYGFNSKYLKEVIQYWHDKY--DWRK  142
               +++ P K + DLKERL R    T PLEG+ FEYGFN+ YLKEV++YW D Y   WR+
Sbjct  61   IGNRLSYPDKTIADLKERLNRTLRLTPPLEGVAFEYGFNTNYLKEVVEYWRDDYLPRWRE  120

Query  143  REAFLNSLPQFKTRVDGLDLHFIHVKP-KNVPATTRVLPLLLLHGWPGSIREFYDVIPLL  201
            RE FL     F T + GL  HF+H+    +     +  P+LLLHGWPGS+REFYD I LL
Sbjct  121  REVFLWQFNHFTTDIQGLRTHFLHLMVYDDNKVGKKHYPVLLLHGWPGSVREFYDFIHLL  180

Query  202  --TTPRTGTDFVFEVILPSLPGYGFSEGAAKSGMGAAHIGVVMRNLMKKLGFDKFYVQGG  259
              T       ++F V++PSLPGYG+S+G ++ G+G A + V+MRNLM +LG++KF++QGG
Sbjct  181  HQTNLDNNNKYIFNVVVPSLPGYGWSQGTSRKGLGPAQVAVMMRNLMLRLGYNKFFIQGG  240

Query  260  DWGSIIATYMATLFKDSVLGIHLNVCLANTPLSNFKWFMGSLWPTLIVKEQYVKRMYPIG  319
            DWGSII + +ATL+ ++VLG H N+C   +P S  K  +   WP+L V   +    +P  
Sbjct  241  DWGSIIGSNIATLYPENVLGYHSNMCNNLSPKSLAKGLVAEFWPSLFVPSGFEDFFFPKS  300

Query  320  SVLANLMNEFGYFHIQSTKPDTVGTAPRDSPAGLAAYILEKFSVWTNPEWKSRPDGGLTV  379
            + +  LM E GYFHIQ+TKPDT+G A  D+P GLAAYILEKFS WTNP ++S PDGGLT 
Sbjct  301  NEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYILEKFSTWTNPSYRSLPDGGLTK  360

Query  380  KYKLDDLLDNIMIYWVTGSITTSMRLYAETWNKEHMALDLDR  421
            +YK+D LLDN+MIY++T SITTS RLYAE + +    L LDR
Sbjct  361  RYKMDALLDNLMIYYLTNSITTSQRLYAEQYAQAQRDLHLDR  402


>Q95U55_DROME unnamed protein product
Length=253

 Score = 209 bits (533),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 130/181 (72%), Gaps = 0/181 (0%)

Query  241  VMRNLMKKLGFDKFYVQGGDWGSIIATYMATLFKDSVLGIHLNVCLANTPLSNFKWFMGS  300
            +MRNLM +LG++KF++QGGDWGSII + +ATL+ ++VLG H N+C   +P S  K  +  
Sbjct  1    MMRNLMLRLGYNKFFIQGGDWGSIIGSNIATLYPENVLGYHSNMCNNLSPKSLAKGLVAE  60

Query  301  LWPTLIVKEQYVKRMYPIGSVLANLMNEFGYFHIQSTKPDTVGTAPRDSPAGLAAYILEK  360
             WP+L V   +    +P  + +  LM E GYFHIQ+TKPDT+G A  D+P GLAAYILEK
Sbjct  61   FWPSLFVPSGFEDFFFPKSNEMRYLMEESGYFHIQATKPDTIGAALTDNPVGLAAYILEK  120

Query  361  FSVWTNPEWKSRPDGGLTVKYKLDDLLDNIMIYWVTGSITTSMRLYAETWNKEHMALDLD  420
            FS WTNP ++S PDG LT +YK+D LLDN+MIY++T SITTS RLYAE + +    L LD
Sbjct  121  FSTWTNPSYRSLPDGRLTKRYKMDALLDNLMIYYLTNSITTSQRLYAEQYAQAQRDLHLD  180

Query  421  R  421
            R
Sbjct  181  R  181


>Q9Y0Z8_DROME unnamed protein product
Length=869

 Score = 31.2 bits (69),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 17/34 (50%), Gaps = 0/34 (0%)

Query  346  PRDSPAGLAAYILEKFSVWTNPEWKSRPDGGLTV  379
            P D P+  A   L+K     NPE K+ PD G + 
Sbjct  45   PHDKPSQTAVSFLQKHHTPKNPESKANPDDGASC  78



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= augustus-scaffold383-size1216599-processed-gene-11.3-mRNA-1

Length=278
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDY8_DROME  unnamed protein product                                 422     1e-150
Q8T3L2_DROME  unnamed protein product                                 419     2e-149
A0A0B4KGG5_DROME  unnamed protein product                             402     7e-143


>Q9VDY8_DROME unnamed protein product
Length=272

 Score = 422 bits (1084),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 198/272 (73%), Positives = 233/272 (86%), Gaps = 1/272 (0%)

Query  7    MIIKEFRVTLPLTVEEYQVAQLYSVAEASKNETGGGDGIEVLKNEPFTGYPLLGGEYDKG  66
            M IKEFRVTLPLTVEEYQVAQL+SVAEASK  TGGG+GIEVLKNEPF  +PLLGG+Y+ G
Sbjct  1    MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSG  60

Query  67   QYTHKIYHLTNKVPSFIRILAPKGSLEIHEEAWNAYPYCKTVISNPMYMGDKFVIIIETM  126
            QYT+KIYHL +KVP++IR+LAPKGSLEIHEEAWNAYPYC+T+I+NP +M D F III+T+
Sbjct  61   QYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPKFMKDAFKIIIDTL  120

Query  127  HIADRGDSENIHRLPPEKLKMRQVVPIDIANDYVSRADYKLEEDPKKFHSEKTGRGPLEG  186
            H+ D GDSEN+H L P+KLK+R++V IDIAND V  ADYK +EDP  + S+KTGRGPL G
Sbjct  121  HVGDAGDSENVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVG  180

Query  187  K-WKESVEPVMTCYKLVTVEFKWFMLQNRVENFIQQTEQRLFTTFHRQVFCWMDRWHGYT  245
              WK+ V PVMTCYKLVT EFKWF LQ RVENFIQ++E+RLFT FHRQVFC  DRW+G T
Sbjct  181  SDWKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLT  240

Query  246  MEDIRAIEEKTKRELDEQRKRGEVRGMRAETD  277
            MEDIRAIE++TK ELD+ R+ GEVRGMRA+ D
Sbjct  241  MEDIRAIEDQTKEELDKARQVGEVRGMRADAD  272


>Q8T3L2_DROME unnamed protein product
Length=272

 Score = 419 bits (1076),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 198/272 (73%), Positives = 232/272 (85%), Gaps = 1/272 (0%)

Query  7    MIIKEFRVTLPLTVEEYQVAQLYSVAEASKNETGGGDGIEVLKNEPFTGYPLLGGEYDKG  66
            M IKEFRVTLPLTVEEYQVAQL+SVAEASK  TGGG+GIEVLKNEPF  +PLLGG+Y+ G
Sbjct  1    MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSG  60

Query  67   QYTHKIYHLTNKVPSFIRILAPKGSLEIHEEAWNAYPYCKTVISNPMYMGDKFVIIIETM  126
            QYT+KIYHL +KVP++IR+LAPKGSLEIHEEAWNAYPYC+T+I+NP +M D F III+T+
Sbjct  61   QYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPKFMKDAFKIIIDTL  120

Query  127  HIADRGDSENIHRLPPEKLKMRQVVPIDIANDYVSRADYKLEEDPKKFHSEKTGRGPLEG  186
            H+ D GDSEN+H L P+KLK+R+VV IDIAND V  ADYK +EDP  + S+KTGRGPL G
Sbjct  121  HVGDAGDSENVHELTPDKLKVREVVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLVG  180

Query  187  K-WKESVEPVMTCYKLVTVEFKWFMLQNRVENFIQQTEQRLFTTFHRQVFCWMDRWHGYT  245
              WK+ V PVMTCYKLVT EFKWF LQ RVENFIQ++E+RLFT FHRQVFC  DRW+G T
Sbjct  181  SDWKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGLT  240

Query  246  MEDIRAIEEKTKRELDEQRKRGEVRGMRAETD  277
            MEDIRAIE++TK ELD+ R+ GEV GMRA+ D
Sbjct  241  MEDIRAIEDQTKEELDKARQVGEVWGMRADAD  272


>A0A0B4KGG5_DROME unnamed protein product
Length=273

 Score = 402 bits (1033),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 194/273 (71%), Positives = 227/273 (83%), Gaps = 2/273 (1%)

Query  7    MIIKEFRVTLPLTVEEYQVAQLYSVAEASKNETGGGDGIEVLKNEPFTGYPLLGGEYDKG  66
            M IKEFRVTLPLTVEEYQVAQL+SVAEASK  TGGG+GIEVLKNEPF  +PLLGG+Y+ G
Sbjct  1    MQIKEFRVTLPLTVEEYQVAQLFSVAEASKENTGGGEGIEVLKNEPFEDFPLLGGKYNSG  60

Query  67   QYTHKIYHLTNKVPSFIRILAPKGSLEIHEEAWNAYPYCKTVISNPMYMGDKFVIIIETM  126
            QYT+KIYHL +KVP++IR+LAPKGSLEIHEEAWNAYPYC+T+I+NP YM   F I I + 
Sbjct  61   QYTYKIYHLQSKVPAYIRLLAPKGSLEIHEEAWNAYPYCRTIITNPGYMDKNFKIDIYSQ  120

Query  127  HI-ADRGDSENIHRLPPEKLKMRQVVPIDIANDYVSRADYKLEEDPKKFHSEKTGRGPLE  185
            HI  D G  +N+H L P+KLK+R++V IDIAND V  ADYK +EDP  + S+KTGRGPL 
Sbjct  121  HIENDLGTVDNVHELTPDKLKVREIVHIDIANDPVLPADYKPDEDPTTYQSKKTGRGPLV  180

Query  186  GK-WKESVEPVMTCYKLVTVEFKWFMLQNRVENFIQQTEQRLFTTFHRQVFCWMDRWHGY  244
            G  WK+ V PVMTCYKLVT EFKWF LQ RVENFIQ++E+RLFT FHRQVFC  DRW+G 
Sbjct  181  GSDWKKHVNPVMTCYKLVTCEFKWFGLQTRVENFIQKSERRLFTNFHRQVFCSTDRWYGL  240

Query  245  TMEDIRAIEEKTKRELDEQRKRGEVRGMRAETD  277
            TMEDIRAIE++TK ELD+ R+ GEVRGMRA+ D
Sbjct  241  TMEDIRAIEDQTKEELDKARQVGEVRGMRADAD  273



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold622-size737393-augustus-gene-1.1-mRNA-1

Length=982
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q2XY08_DROME  unnamed protein product                                 416     1e-130
Q494K2_DROME  unnamed protein product                                 416     3e-130
Q95R77_DROME  unnamed protein product                                 259     4e-76 


>Q2XY08_DROME unnamed protein product
Length=878

 Score = 416 bits (1069),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 268/757 (35%), Positives = 402/757 (53%), Gaps = 96/757 (13%)

Query  1    LTCGNDGDIRVYLGLEDDDPTSHCVGENALALAQKVCVCVLMLTVQGSKLYVGTDDNTLR  60
            +TCG DGDIR +  + DDDP S C+GE  + +A             G++L   TD NT+ 
Sbjct  22   ITCGTDGDIRHWTCISDDDPRSSCLGEFVMCIAHT-----------GTRLLASTDRNTIH  70

Query  61   CYTFPQMERDGVLHRFSKPVTHISVSPDGNTVVAASESSEIYVRDMMTEKFK-MLSGHSG  119
             YTFP+M+ DG+L RF+ P T + VS  G    A SE + I V    T   + +L GH+G
Sbjct  71   AYTFPEMDSDGILMRFTAPATCLKVS--GGYTAAGSEDTTIKVLKGDTAGNETVLEGHTG  128

Query  120  PILCVAIDPKVEFLVSSSGDGRVCVWELDSATEVQSWQCVSACGSFFEARSLCRVSWQPG  179
            PIL + +  + + LVS +GDG++ VW  +   E+++   +    SF  A       ++P 
Sbjct  129  PILALDLFAERKLLVSVAGDGQLKVWNFEEGKELKTIGGLPKVNSFESASLYGTPHFEPQ  188

Query  180  GGQLLAVPHENQVLLYKRGSWQRWHALSHPTLEKDVSICSFSPCGKYLAASSVVGDIVVW  239
             G+LLA   +N++++    +W+    L   ++  + S C FSP G+ LAA +  G++ ++
Sbjct  189  SGELLAYAVDNEIVVLNTANWEVAFKLRDDSVSSNYSCCQFSPNGERLAAGTTKGEVSIF  248

Query  240  NVTRKSCVG--ITKHDKKRQICGLAWNPDGRGEVAFCDFSGQLGTVA-----------GC  286
            +V ++  V   I   D     C LAWN  G  EVAFCD +GQLGTV            G 
Sbjct  249  DVKKRKAVTVEIPPSDCNAITC-LAWNLSGEVEVAFCDATGQLGTVFLGDAVDTGNGDGL  307

Query  287  IEEESQV-----NHVAGECED-------------------------DDDDAHSEKLSVS-  315
            +++++++        AG+  D                         D DDA ++ L  S 
Sbjct  308  VDDQAELLGDDYEFEAGDDVDTAADDGDGVSLEQLKRKVMNFADPVDHDDASNQSLDSSS  367

Query  316  --------------ELQPPFQPSATPLHLQHRFMVWNSVGVVRCSSAP--EEVIDVEFHD  359
                          + Q  FQPSATP  L+HR+M WN VG+V     P  +  IDVEFHD
Sbjct  368  RTVPAPVAPQIKLFKQQTAFQPSATPADLEHRYMAWNDVGIVTAHVEPSGDSSIDVEFHD  427

Query  360  TATHHALHIRNLQHYHIASLTEHALVLASECESDCPSKVMCILLDCWDGSREWSVELPAG  419
             + HHALHI N   +++AS++  AL LAS  ES   SK++ I L    G++EWS+ LP  
Sbjct  428  ASIHHALHISNYNQHNLASVSSGALALASN-ES---SKLVVIALAAA-GNKEWSLSLPDC  482

Query  420  EGALCVASGSNWVAVATDTRLLRLWTLSGAQREVVVLPGPVLCLAQHAHSLLLTCHLAPG  479
            E A  V +    VAVAT +  LR++T+ G QREV+ +PGPV+ +A H HSL++  H +  
Sbjct  483  ESAEAVVATRFLVAVATSSSFLRIFTVMGTQREVLTIPGPVVAIAGHEHSLMVVYHSSAP  542

Query  480  VCGDQNVGYAQMCMARGRLS---SWQPLPLTPRATLYWLGYSDEGSPCLHDSSGSVRLL-  535
                Q++  A M +    LS    + P+PLTP   L W GYSD GSP + D+ G ++L  
Sbjct  543  SQTQQHL--AAMLVNINGLSLRQEYLPVPLTPGRQLTWFGYSDTGSPSIADNMGLLQLYR  600

Query  536  GSRGYWLPVLHTASLLSALFQAKGKSDHYFVLGVSATCQNVRAVLCKGSRYPPTAPRSPV  595
             S   W P+  T      + Q+   S ++FV+ VS   Q V+AVLC+G+ YP T PR  +
Sbjct  601  RSSNAWFPICDT------MKQSTSVSHNFFVVAVSEKRQIVQAVLCRGTSYPMTNPRPML  654

Query  596  VELPLQVGLADVTTDRGQLEELFWRSTIATPAAPAEETLRAAKEASIKLFAMACRAGQQA  655
             EL +Q+ L DV  ++ +LE+   RS++       +   +  KE +IKLFA+AC +  + 
Sbjct  655  QELRMQIPLCDVEVEKSELEDALLRSSLMQ----MDGAEKMQKETAIKLFALACSSECET  710

Query  656  RAVDLCTLMADEQVVQLAFKYASKLGKTQLANRIAQL  692
            RA +L   +A   ++QLA KYA+K G+  L++R+ +L
Sbjct  711  RARELIESIACTDLLQLAVKYATKRGRIHLSDRLCEL  747


>Q494K2_DROME unnamed protein product
Length=895

 Score = 416 bits (1068),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 267/757 (35%), Positives = 402/757 (53%), Gaps = 96/757 (13%)

Query  1    LTCGNDGDIRVYLGLEDDDPTSHCVGENALALAQKVCVCVLMLTVQGSKLYVGTDDNTLR  60
            +TCG DGDIR +  + DDDP S C+GE  + +A             G++L   TD NT+ 
Sbjct  29   ITCGTDGDIRHWTCISDDDPRSSCLGEFVMCIAHT-----------GTRLLASTDRNTIH  77

Query  61   CYTFPQMERDGVLHRFSKPVTHISVSPDGNTVVAASESSEIYVRDMMTEKFK-MLSGHSG  119
             YTFP+M+ DG+L RF+ P T + VS  G    A SE + I V    T   + +L GH+G
Sbjct  78   AYTFPEMDSDGILMRFTAPATCLKVS--GGYTAAGSEDTTIKVLKGDTAGNETVLEGHTG  135

Query  120  PILCVAIDPKVEFLVSSSGDGRVCVWELDSATEVQSWQCVSACGSFFEARSLCRVSWQPG  179
            PIL + +  + + LVS +GDG++ VW  +   E+++   +    SF  A       ++P 
Sbjct  136  PILALDLFAERKLLVSVAGDGQLKVWNFEEGKELKTIGGLPKVNSFESASLYGTPHFEPQ  195

Query  180  GGQLLAVPHENQVLLYKRGSWQRWHALSHPTLEKDVSICSFSPCGKYLAASSVVGDIVVW  239
             G+LLA   +N++++    +W+    L   ++  + S C FSP G+ LAA +  G++ ++
Sbjct  196  SGELLAYAVDNEIVVLNTANWEVAFKLRDDSVSSNYSCCQFSPNGERLAAGTTKGEVSIF  255

Query  240  NVTRKSCVG--ITKHDKKRQICGLAWNPDGRGEVAFCDFSGQLGTVA-----------GC  286
            +V ++  V   I   D     C LAWN  G  EVAFCD +GQLGTV            G 
Sbjct  256  DVKKRKAVTVEIPPSDCNAITC-LAWNLSGEVEVAFCDATGQLGTVFLGDAVDTGNGDGL  314

Query  287  IEEESQV-----NHVAGECED-------------------------DDDDAHSEKLSVS-  315
            +++++++        AG+  D                         D DDA ++ L  S 
Sbjct  315  VDDQAELLGDDYEFEAGDDVDTAADDGDGVSLEQLKRKVMNFADPVDHDDASNQSLDSSS  374

Query  316  --------------ELQPPFQPSATPLHLQHRFMVWNSVGVVRCSSAP--EEVIDVEFHD  359
                          + Q  FQPSATP  L+HR+M WN VG+V     P  +  IDVEFHD
Sbjct  375  RTVPAPVAPQIKLFKQQTAFQPSATPADLEHRYMAWNDVGIVTAHVEPSGDSSIDVEFHD  434

Query  360  TATHHALHIRNLQHYHIASLTEHALVLASECESDCPSKVMCILLDCWDGSREWSVELPAG  419
             + HHALHI N   +++AS++  AL LAS  ES   SK++ I L    G++EWS+ LP  
Sbjct  435  ASIHHALHISNYNQHNLASVSSGALALASN-ES---SKLVVIALAAA-GNKEWSLSLPDC  489

Query  420  EGALCVASGSNWVAVATDTRLLRLWTLSGAQREVVVLPGPVLCLAQHAHSLLLTCHLAPG  479
            E A  V +    VAVAT +  LR++T+ G QREV+ +PGP++ +A H HSL++  H +  
Sbjct  490  ESAEAVVATRFLVAVATSSSFLRIFTVMGTQREVLTIPGPMVAIAGHEHSLMVVYHSSAP  549

Query  480  VCGDQNVGYAQMCMARGRLS---SWQPLPLTPRATLYWLGYSDEGSPCLHDSSGSVRLL-  535
                Q++  A M +    LS    + P+PLTP   L W GYSD GSP + D+ G ++L  
Sbjct  550  SQTQQHL--AAMLVNINGLSLRQEYLPVPLTPGRQLTWFGYSDTGSPSIADNMGLLQLYR  607

Query  536  GSRGYWLPVLHTASLLSALFQAKGKSDHYFVLGVSATCQNVRAVLCKGSRYPPTAPRSPV  595
             S   W P+  T      + Q+   S ++FV+ VS   Q V+AVLC+G+ YP T PR  +
Sbjct  608  RSSNAWFPICDT------MKQSTSVSHNFFVVAVSEKRQIVQAVLCRGTSYPMTNPRPML  661

Query  596  VELPLQVGLADVTTDRGQLEELFWRSTIATPAAPAEETLRAAKEASIKLFAMACRAGQQA  655
             EL +Q+ L DV  ++ +LE+   RS++       +   +  KE +IKLFA+AC +  + 
Sbjct  662  QELRMQIPLCDVEVEKSELEDALLRSSLMQ----MDGAEKMQKETAIKLFALACSSECET  717

Query  656  RAVDLCTLMADEQVVQLAFKYASKLGKTQLANRIAQL  692
            RA +L   +A   ++QLA KYA+K G+  L++R+ +L
Sbjct  718  RARELIESIACTDLLQLAVKYATKRGRIHLSDRLCEL  754


>Q95R77_DROME unnamed protein product
Length=542

 Score = 259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 154/381 (40%), Positives = 225/381 (59%), Gaps = 23/381 (6%)

Query  318  QPPFQPSATPLHLQHRFMVWNSVGVVRCSSAP--EEVIDVEFHDTATHHALHIRNLQHYH  375
            Q  FQPSATP  L+HR+M WN VG+V     P  +  IDVEFHD + HHALHI N   ++
Sbjct  38   QTAFQPSATPADLEHRYMAWNDVGIVTAHVEPSGDSSIDVEFHDASIHHALHISNYNQHN  97

Query  376  IASLTEHALVLASECESDCPSKVMCILLDCWDGSREWSVELPAGEGALCVASGSNWVAVA  435
            +AS++  AL LAS  ES   SK++ I L    G++EWS+ LP  E A  V +    VAVA
Sbjct  98   LASVSSGALALASN-ES---SKLVVIALAAA-GNKEWSLSLPDCESAEAVVATRFLVAVA  152

Query  436  TDTRLLRLWTLSGAQREVVVLPGPVLCLAQHAHSLLLTCHLAPGVCGDQNVGYAQMCMAR  495
            T +  LR++T+ G QREV+ +PGP++ +A H HSL++  H +      Q++  A M +  
Sbjct  153  TSSSFLRIFTVMGTQREVLTIPGPMVAIAGHEHSLMVVYHSSAPSQTQQHL--AAMLVNI  210

Query  496  GRLS---SWQPLPLTPRATLYWLGYSDEGSPCLHDSSGSVRLL-GSRGYWLPVLHTASLL  551
              LS    + P+PLTP   L W GYSD GSP + D+ G ++L   S   W P+  T    
Sbjct  211  NGLSLRQEYLPVPLTPGRQLTWFGYSDTGSPSIADNMGLLQLYRRSSNAWFPICDT----  266

Query  552  SALFQAKGKSDHYFVLGVSATCQNVRAVLCKGSRYPPTAPRSPVVELPLQVGLADVTTDR  611
              + Q+   S ++FV+ VS   Q V+AVLC+G+ YP T PR  + EL +Q+ L DV  ++
Sbjct  267  --MKQSTSVSHNFFVVAVSEKRQIVQAVLCRGTSYPMTNPRPMLQELRMQIPLCDVEVEK  324

Query  612  GQLEELFWRSTIATPAAPAEETLRAAKEASIKLFAMACRAGQQARAVDLCTLMADEQVVQ  671
             +LE+   RS++       +   +  KE +IKLFA+AC +  + RA +L   +A   ++Q
Sbjct  325  SELEDALLRSSLMQ----MDGAEKMQKETAIKLFALACSSECETRARELIESIACTDLLQ  380

Query  672  LAFKYASKLGKTQLANRIAQL  692
            LA KYA+K G+  L++R+ +L
Sbjct  381  LAVKYATKRGRIHLSDRLCEL  401



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold426-size975134-augustus-gene-8.2-mRNA-1

Length=227
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU53_DROME  unnamed protein product                                 60.1    2e-10
Q0E8F0_DROME  unnamed protein product                                 59.7    3e-10
A0A0S0WP14_DROME  unnamed protein product                             59.7    3e-10


>Q9VU53_DROME unnamed protein product
Length=540

 Score = 60.1 bits (144),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 94/220 (43%), Gaps = 28/220 (13%)

Query  3    VDSG-FPWLPYLTTLQLSYMGKLERIGAGGLSRLTALEELHCNHNPRLREIDGAALSRRE  61
            + SG F  L  L  L+L+   +L R+ +G  S  T LE L+ + N +L E+   AL    
Sbjct  303  ISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGG--  360

Query  62   GADSRPVWPLLTKLWLNDNLLGYLSSHLVDRWDKLEIIDIQMNPWICDCENQWVVSTLVK  121
                    P L+ + L  N L  L   LV  W  L+ +D+  NP+ CDC   W+   LV 
Sbjct  361  -------LPHLSTVVLKANQLSSLDEGLVP-WADLQTLDLSENPFECDCRLLWLRHLLVS  412

Query  122  VVESKNPDLLEGIMCGAPEEMKGRRVVDLEARHYNMRCLDADGAHPERDGVMLIGVLVGA  181
               S        ++C  P  ++     DL   H     L    AH       +IG+LV A
Sbjct  413  RNASGQ---YAPVICAYPTALR-----DLPLAHLAEPLLGC--AHGAASKQAIIGILVVA  462

Query  182  LVATPVTLAAVLLW--RKAQQML-----LGCRSHQYSRAY  214
              A   TLA VL     + ++ML     LG +  +Y + +
Sbjct  463  CAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTF  502


>Q0E8F0_DROME unnamed protein product
Length=780

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 94/220 (43%), Gaps = 28/220 (13%)

Query  3    VDSG-FPWLPYLTTLQLSYMGKLERIGAGGLSRLTALEELHCNHNPRLREIDGAALSRRE  61
            + SG F  L  L  L+L+   +L R+ +G  S  T LE L+ + N +L E+   AL    
Sbjct  303  ISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGG--  360

Query  62   GADSRPVWPLLTKLWLNDNLLGYLSSHLVDRWDKLEIIDIQMNPWICDCENQWVVSTLVK  121
                    P L+ + L  N L  L   LV  W  L+ +D+  NP+ CDC   W+   LV 
Sbjct  361  -------LPHLSTVVLKANQLSSLDEGLVP-WADLQTLDLSENPFECDCRLLWLRHLLVS  412

Query  122  VVESKNPDLLEGIMCGAPEEMKGRRVVDLEARHYNMRCLDADGAHPERDGVMLIGVLVGA  181
               S        ++C  P  ++     DL   H     L    AH       +IG+LV A
Sbjct  413  RNASGQ---YAPVICAYPTALR-----DLPLAHLAEPLLGC--AHGAASKQAIIGILVVA  462

Query  182  LVATPVTLAAVLLW--RKAQQML-----LGCRSHQYSRAY  214
              A   TLA VL     + ++ML     LG +  +Y + +
Sbjct  463  CAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTF  502


>A0A0S0WP14_DROME unnamed protein product
Length=811

 Score = 59.7 bits (143),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 94/220 (43%), Gaps = 28/220 (13%)

Query  3    VDSG-FPWLPYLTTLQLSYMGKLERIGAGGLSRLTALEELHCNHNPRLREIDGAALSRRE  61
            + SG F  L  L  L+L+   +L R+ +G  S  T LE L+ + N +L E+   AL    
Sbjct  303  ISSGAFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGG--  360

Query  62   GADSRPVWPLLTKLWLNDNLLGYLSSHLVDRWDKLEIIDIQMNPWICDCENQWVVSTLVK  121
                    P L+ + L  N L  L   LV  W  L+ +D+  NP+ CDC   W+   LV 
Sbjct  361  -------LPHLSTVVLKANQLSSLDEGLVP-WADLQTLDLSENPFECDCRLLWLRHLLVS  412

Query  122  VVESKNPDLLEGIMCGAPEEMKGRRVVDLEARHYNMRCLDADGAHPERDGVMLIGVLVGA  181
               S        ++C  P  ++     DL   H     L    AH       +IG+LV A
Sbjct  413  RNASGQ---YAPVICAYPTALR-----DLPLAHLAEPLLGC--AHGAASKQAIIGILVVA  462

Query  182  LVATPVTLAAVLLW--RKAQQML-----LGCRSHQYSRAY  214
              A   TLA VL     + ++ML     LG +  +Y + +
Sbjct  463  CAALITTLALVLYTCRHRIREMLKGHSALGRKEREYQKTF  502



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold266-size1047221-augustus-gene-3.1-mRNA-1

Length=504
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57ZQ6_TRYB2  unnamed protein product                                 30.0    5.4  


>Q57ZQ6_TRYB2 unnamed protein product
Length=887

 Score = 30.0 bits (66),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 29/92 (32%), Positives = 36/92 (39%), Gaps = 16/92 (17%)

Query  107  RKDGVATRGRKGDP--SREGAMGSEEGDRRKYRGEKGPRSGTGQRVGRRRGTRVSVSAGR  164
            R +  +T  R+GDP   R  A GS  G       E+GP S  G  V      ++ + AGR
Sbjct  374  RAENSSTANRRGDPWTGRHNAHGSRAGKGGDEENERGPGSSAGGFVTACEQLKMDLKAGR  433

Query  165  -------------EPPTRGPGSLTPTSHRAPV  183
                          P  R PG  TP   R PV
Sbjct  434  GVPPQFSMERRKPAPGVRYPG-FTPPFQRQPV  464



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold415-size1042365-augustus-gene-3.2-mRNA-1

Length=704
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRBID_DROME  unnamed protein product                                  614     0.0  
NU153_DROME  unnamed protein product                                  55.5    2e-07
Q9W215_DROME  unnamed protein product                                 34.7    0.097


>TRBID_DROME unnamed protein product
Length=778

 Score = 614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/720 (48%), Positives = 435/720 (60%), Gaps = 126/720 (18%)

Query  13   KWVCDYCTFANWPSSAKCTMCRGARPL--QDIYQLRDEPSPEQ-----------------  53
            KW C+ CT+ N+PSS KCTMC+ ++PL  +DI++L    SP Q                 
Sbjct  10   KWKCETCTYENYPSSLKCTMCQASKPLLNEDIFRL----SPAQESCTVAEEAAAVEVAVM  65

Query  54   APFGGGLALASGP---SESGGGGGRGKWECRECTYQNWPRALKCLQCCGQR---------  101
            +P       +  P   +         KW C+ CTY NWPR+L+C+QCC +R         
Sbjct  66   SPTPSSTCYSLQPQSQARQSNVADSEKWPCKVCTYLNWPRSLRCVQCCTKRGGEAIERGK  125

Query  102  -----PASAANLHEHLQPLRIEHTSECSAAS------GGGALRVSTSP-TADKKELKEAE  149
                  A      E LQ LRI  + E  A           + R+S S    D   L    
Sbjct  126  KDMDNEADGDRAGEALQALRISGSEENLANKPVQLIGATASHRLSLSRGIDDATHLNNLA  185

Query  150  NDLRGRAR---------------------------------QQSQQQLVKWLCVVCTYEN  176
            N    +++                                 QQ Q  + KW C  CTYEN
Sbjct  186  NASHNQSQSQHRQPVLQQQMQLQLQPQQQRESSSSAAVPPQQQKQCYVSKWACNSCTYEN  245

Query  177  WPKATKCVMCCKARSPAGSIVSSPEREPFPTGQDDVPHEERSL--------------VTF  222
            WP++ KC MC K R          ERE     Q+D+ H   SL              V  
Sbjct  246  WPRSIKCSMCGKTR----------ERE-ISGSQNDL-HASSSLNSQEENQQQLQQPNVDT  293

Query  223  PYVGNRTTVRRERNQTSSESANNWD--YERRRKQVRRKIRKTDWAWLNACLGVVEGDPNP  280
              V N    +      SSE+ NN D   ER+ ++ R+  R+ DW WLNACLGVVE + + 
Sbjct  294  VSVNNSFNKKHIYQLGSSETINNCDTLQERQERRQRQIRRQVDWQWLNACLGVVENNYSA  353

Query  281  VEAYLTSGGEPTRQLTPSEVALLSRPSAFDTGYTLVHLAIRFQREDLLATLLSQIEGSGS  340
            VEAYL+ GG P R LT +E+A L+R SAFD G+TL+HLAIRF RE++L  LL QI GSG 
Sbjct  354  VEAYLSCGGNPARSLTSTEIAALNRNSAFDVGHTLIHLAIRFHREEMLPMLLDQISGSGP  413

Query  341  GVKRVPSYVAPDLAADIRRHVAATMRIRKGSFPCHFVTEITTFALPAAGTLPAVAEVEDL  400
            G+KRVPSYVAPDLAADIRRH A T+R+RK   PCH+V +  TFALPA        E+E+L
Sbjct  414  GIKRVPSYVAPDLAADIRRHFANTLRLRKSGLPCHYVQKHATFALPA--------EIEEL  465

Query  401  PGTVQEQLFEELLDKDAQQQLESEPSVINWSLEVTVRLGSRLFALWNRSSGDCLLDSAMQ  460
            P  +QEQL++ELLD+DAQ+QLE+ P  +NWSLE+T RL SR+F LWNRS+GDCLLDSAMQ
Sbjct  466  PIPIQEQLYDELLDRDAQKQLETPPPALNWSLEITARLSSRMFVLWNRSAGDCLLDSAMQ  525

Query  461  ATWGVFDRDNTLRRALADSLHQGGHLTVWCRFYPRWKEYEASQARVLEFSLDEGQWEEDW  520
            ATWGVFDRDN LRRALAD+LHQ GH+     F+ RWKEYE  QA +L F+L++ Q+EEDW
Sbjct  526  ATWGVFDRDNILRRALADTLHQCGHV-----FFTRWKEYEMLQASMLHFTLEDSQFEEDW  580

Query  521  AGLLSLASQPGSSLDQLHVFVLAHILRRPIIVYGVKYVKSFRGEAIGYARFEGVYLPLLW  580
            + LLSLA QPGSSL+QLH+F LAHILRRPIIVYGVKYVKSFRGE IGYARFEGVYLPL W
Sbjct  581  STLLSLAGQPGSSLEQLHIFALAHILRRPIIVYGVKYVKSFRGEDIGYARFEGVYLPLFW  640

Query  581  EPSFCVRTPLALGYTRGHFSALVAMEPYSRLEGVGVGAGSDLQ-VTFLPLMDRDRKLLPV  639
            + +FC ++P+ALGYTRGHFSALV MEP++R++    G   D++ VT+LPLMD + KLLP+
Sbjct  641  DQNFCTKSPIALGYTRGHFSALVPMEPFTRID----GRRDDVEDVTYLPLMDCELKLLPI  696


 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  11   TSKWVCDYCTFANWPSSAKCTMCRGAR  37
             SKW C+ CT+ NWP S KC+MC   R
Sbjct  233  VSKWACNSCTYENWPRSIKCSMCGKTR  259


>NU153_DROME unnamed protein product
Length=1883

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 80/229 (35%), Gaps = 40/229 (17%)

Query  9     PSTSKWVCDYCTFANWPSSAKCTMCRGARPLQDIYQLRDEPSPEQAPFGGGLALASGPSE  68
             PS+ +W CD C   N P   KC  C  A+P+          +P QAP     A     S 
Sbjct  902   PSSKEWECDTCMVRNKPEINKCVACETAKPVASA-------APVQAPLPPSTAAIDTQSF  954

Query  69    SGGGGGRGK----WECRECTYQNWPRALKCLQCCGQRPASAANLHEHLQPLRIEHTSE--  122
              G G    K    WEC  C   N   A KC+ C   R   A  ++ +  PL     S   
Sbjct  955   VGFGDRFKKSTTAWECDACMLSNKAEASKCIACETPRKTVAPKVN-NFSPLITNAKSNEW  1013

Query  123   ------------------CSAASGGGALRVSTSPTADKKELKEAENDLRGRARQQSQQQL  164
                               C +A  G  + +  +            +    R ++ +    
Sbjct  1014  ECSVCLVRNKVEVSKCVACESAKPGATMALPATSNIAVATPSIITDGFGDRFKKSA----  1069

Query  165   VKWLCVVCTYENWPKATKCVMCCKARSPAGSIVSSPEREPFPTGQDDVP  213
               W C  C   N  +A+KC+ C   R  +  I +S     +P+  +++P
Sbjct  1070  TAWECDACMLSNKAEASKCIACETPRKSSTPIANS----SYPSINNNLP  1114


 Score = 35.0 bits (79),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 26/98 (27%), Positives = 36/98 (37%), Gaps = 10/98 (10%)

Query  10    STSKWVCDYCTFANWPSSAKCTMCRGARPLQDIYQLRDEPS-PEQAPFGGGLALASGPSE  68
             S + W CD C  +N   ++KC  C   R           PS     P G G  ++     
Sbjct  1068  SATAWECDACMLSNKAEASKCIACETPRKSSTPIANSSYPSINNNLPAGSGFDISFTRKA  1127

Query  69    SGGGGGRGKWECRECTYQNWPRALKCLQCCGQRPASAA  106
             +        WEC+ C   N     +C+ C  Q P S A
Sbjct  1128  N-------MWECQTCLVMNKSSDEECIAC--QTPNSQA  1156


>Q9W215_DROME unnamed protein product
Length=150

 Score = 34.7 bits (78),  Expect = 0.097, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (64%), Gaps = 3/33 (9%)

Query  157  RQQSQQQLVK---WLCVVCTYENWPKATKCVMC  186
            RQ+ Q ++++   W C VCTY N  +A KC MC
Sbjct  10   RQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMC  42


 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%)

Query  78  WECRECTYQNWPRALKCLQC  97
           W+C  CTY+N   A KC  C
Sbjct  23  WDCSVCTYRNSAEAFKCRMC  42



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold55939-size10466-augustus-gene-0.0-mRNA-1

Length=144
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFR0_DROME  unnamed protein product                                 34.3    0.019
B7Z058_DROME  unnamed protein product                                 32.0    0.16 
M9PFL1_DROME  unnamed protein product                                 31.6    0.20 


>M9PFR0_DROME unnamed protein product
Length=301

 Score = 34.3 bits (77),  Expect = 0.019, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 46/104 (44%), Gaps = 7/104 (7%)

Query  22   ESTLGMVVERQSNKKGKRQFEMCTSG---AKMKDCLKRLKNNKSILRDESVLFMCGTNDV  78
             ++ GM  E          F+ C S    A+M+D LK  K +  I+++  ++    T+D+
Sbjct  179  HASTGMTSEALGVSVAPSFFQSCVSDGKTARMEDVLK-FKVSTKIMQN--IIDKFATHDI  235

Query  79   LNGTRFEHLIRDARTVLRILKERRCRVAVMPLPPIGRLQPQSQA  122
                 +E+  R    +L++  E  C     P PP G+L  Q  A
Sbjct  236  FGRDNYEYYARVTGRILKVQDEWICSFQYPP-PPRGKLAQQKYA  278


>B7Z058_DROME unnamed protein product
Length=906

 Score = 32.0 bits (71),  Expect = 0.16, Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 46/103 (45%), Gaps = 7/103 (7%)

Query  23   STLGMVVERQSNKKGKRQFEMCTSG---AKMKDCLKRLKNNKSILRDESVLFMCGTNDVL  79
            ++ GM  E          F+ C S    A+M+D LK  K +  I+  ++++    T+D+ 
Sbjct  180  ASTGMTSEALGVSVAPSFFQSCVSDGKTARMEDVLK-FKVSTKIM--QNIIDKFATHDIF  236

Query  80   NGTRFEHLIRDARTVLRILKERRCRVAVMPLPPIGRLQPQSQA  122
                +E+  R    +L++  E  C     P PP G+L  Q  A
Sbjct  237  GRDNYEYYARVTGRILKVQDEWICSFQYPP-PPRGKLAQQKYA  278


>M9PFL1_DROME unnamed protein product
Length=454

 Score = 31.6 bits (70),  Expect = 0.20, Method: Composition-based stats.
 Identities = 27/103 (26%), Positives = 46/103 (45%), Gaps = 7/103 (7%)

Query  23   STLGMVVERQSNKKGKRQFEMCTSG---AKMKDCLKRLKNNKSILRDESVLFMCGTNDVL  79
            ++ GM  E          F+ C S    A+M+D LK  K +  I+  ++++    T+D+ 
Sbjct  180  ASTGMTSEALGVSVAPSFFQSCVSDGKTARMEDVLK-FKVSTKIM--QNIIDKFATHDIF  236

Query  80   NGTRFEHLIRDARTVLRILKERRCRVAVMPLPPIGRLQPQSQA  122
                +E+  R    +L++  E  C     P PP G+L  Q  A
Sbjct  237  GRDNYEYYARVTGRILKVQDEWICSFQYPP-PPRGKLAQQKYA  278



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold469-size850856-augustus-gene-7.12-mRNA-1

Length=128
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCYDB_DROME  unnamed protein product                                  111     2e-29
GCY8E_DROME  unnamed protein product                                  103     2e-26
GCYDA_DROME  unnamed protein product                                  102     4e-26


>GCYDB_DROME unnamed protein product
Length=669

 Score = 111 bits (278),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 78/122 (64%), Gaps = 15/122 (12%)

Query  1    MAVSGAPDCTLDHARNVADVTLCLVRQVEMLKLPSEIKIQIRIGIHSGPVVAGVVGLKVP  60
            MAVSGAPD    HA +  D+ L ++++V+   LP    + IR+GI+SGPVVAGVVG+KVP
Sbjct  548  MAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPG---VAIRVGINSGPVVAGVVGMKVP  604

Query  61   RYCLFGDTVNTAARMQTTSQVQSALRCSPVTRPGKVQISNATRQLLSDDRYIFECRGLVK  120
            RYCLFGDTVNTA+RM+++S             P  +Q+SN T   +    Y  E RG VK
Sbjct  605  RYCLFGDTVNTASRMESSSD------------PWMIQLSNYTALKVQKVGYKVEARGFVK  652

Query  121  VK  122
            VK
Sbjct  653  VK  654


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 103 bits (256),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 79/123 (64%), Gaps = 14/123 (11%)

Query  1    MAVSGAPDCTLDHARNVADVTLCLVRQVEMLKLPSEIK-IQIRIGIHSGPVVAGVVGLKV  59
            M V+GAPD   +HA  V D+ L +V  +  LK PS  + ++IR+G+HSG VVAG+VGLK+
Sbjct  473  MVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKM  532

Query  60   PRYCLFGDTVNTAARMQTTSQVQSALRCSPVTRPGKVQISNATRQLLSDDRYIFECRGLV  119
            PRYCLFGDTVNTA+RM++TS               KV IS +T+ L+  +  I E RG +
Sbjct  533  PRYCLFGDTVNTASRMESTSIAM------------KVHISESTKVLIGPNYKIIE-RGEI  579

Query  120  KVK  122
             VK
Sbjct  580  DVK  582


>GCYDA_DROME unnamed protein product
Length=667

 Score = 102 bits (253),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 58/122 (48%), Positives = 73/122 (60%), Gaps = 15/122 (12%)

Query  1    MAVSGAPDCTLDHARNVADVTLCLVRQVEMLKLPSEIKIQIRIGIHSGPVVAGVVGLKVP  60
            MAVSGAPD    HA +  D+ L   R ++  K      + IR+GI+SGPVVAGVVG KVP
Sbjct  545  MAVSGAPDVNPLHAEHACDLAL---RVMKKFKAHDMGDVAIRVGINSGPVVAGVVGQKVP  601

Query  61   RYCLFGDTVNTAARMQTTSQVQSALRCSPVTRPGKVQISNATRQLLSDDRYIFECRGLVK  120
            RYCLFGDTVNTA+RM+++S             P K+Q+S  T   +    Y  E RG V+
Sbjct  602  RYCLFGDTVNTASRMESSSD------------PWKIQLSKYTGDKVRQVGYKVESRGTVQ  649

Query  121  VK  122
            VK
Sbjct  650  VK  651



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold735-size695327-augustus-gene-3.2-mRNA-1

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WAT_DROME  unnamed protein product                                    134     2e-36
D2SNU9_HELVI  unnamed protein product                                 127     3e-34
O46038_DROME  unnamed protein product                                 119     5e-31


>WAT_DROME unnamed protein product
Length=517

 Score = 134 bits (338),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 114/234 (49%), Gaps = 58/234 (25%)

Query  3    ARQNTEIQDFYNDCGVFVTGGTGSLGKLTIEKILRSCPGVRRVYVLIRSKKGLSVDERKK  62
             +  + +Q FY D GVF+TGGTG  GK+ IEK+LR    V ++Y+LIR+KKG     R +
Sbjct  26   VKDESPMQMFYKDKGVFLTGGTGFFGKIIIEKLLRVTE-VGQIYLLIRTKKGKDAFARIE  84

Query  63   ALLDNVVFERMKREQPDSVDKIEIVSGDCSVPRLGLSDSDYHDLTQHVNIVLHLAANVRF  122
             L ++ VF +MK+  P    +I I+SGDCS+P LG+S  +   + ++VNIVLH AA VRF
Sbjct  85   DLFNDPVFAKMKQVNPKYRCQITIISGDCSLPGLGISADERETIMENVNIVLHSAATVRF  144

Query  123  DENLKAAVTINTKGT------------------------------------------QEA  140
            DE LK A+ IN  GT                                          + A
Sbjct  145  DEKLKMAIAINVHGTKEIIKLAKEIVNLKALVHVSTAFAHCNMRHIQERFYSGTMSGENA  204

Query  141  IKL---------------IIGSCPNAYIFSKAMLENAILMEAQGIPASVVRPSM  179
             KL               II   PN Y F+K + EN +   AQ +P ++ RP +
Sbjct  205  FKLSECLDEHTLNTLTPTIIKGYPNTYTFTKVLAENVVQQSAQNLPVTIFRPGI  258


>D2SNU9_HELVI unnamed protein product
Length=453

 Score = 127 bits (320),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 113/225 (50%), Gaps = 54/225 (24%)

Query  9    IQDFYNDCGVFVTGGTGSLGKLTIEKILRSCPGVRRVYVLIRSKKGLSVDERKKALLDNV  68
            + +FY    VF+TGGTG LGK+ IEK+L SCP +  +Y+LIR KKGLSV ER K  LD+ 
Sbjct  13   VAEFYAGKSVFITGGTGFLGKVFIEKLLYSCPDIVNIYMLIREKKGLSVSERIKQFLDDP  72

Query  69   VFERMKREQPDSVDKIEIVSGDCSVPRLGLSDSDYHDLTQHVNIVLHLAANVRFDENLKA  128
            +F R+K ++P  ++KI ++ GD + P LG++ ++   L + V++++H AA V+F+E L  
Sbjct  73   LFTRLKDKRPADLEKIVLIPGDITAPDLGITAANEKMLIEKVSVIIHSAATVKFNEPLPT  132

Query  129  AVTINTKGT---------------------------QEAIKLIIGSCP------------  149
            A  IN +GT                           +E +  I+   P            
Sbjct  133  AWKINVEGTRMMLALSRRMKRIEVFIHISTAYTNTNREVVDEILYPAPADIDQVYQYVKE  192

Query  150  ---------------NAYIFSKAMLENAILMEAQGIPASVVRPSM  179
                           N Y F+KA+ E+ +      +P  +VRPS+
Sbjct  193  GISEEDTEKILNGRPNTYTFTKALTEHLVAENQAYVPTIIVRPSV  237


>O46038_DROME unnamed protein product
Length=475

 Score = 119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 89/136 (65%), Gaps = 2/136 (1%)

Query  8    EIQDFYNDCGVFVTGGTGSLGKLTIEKILRSCPGVRRVYVLIRSKKGLSVDERKKALLDN  67
            E+++F+ D  +FVTGG+G +GK  +EK+LRSC  VRR+YVL+R +K L+ ++R   L   
Sbjct  8    EMEEFFEDSEIFVTGGSGVVGKALVEKLLRSC-NVRRIYVLLRPRKQLTAEQRLVRLRQA  66

Query  68   VVFERMKREQPDSVDKIEIVSGDCSVPRLGLSDSDYHDLTQHVNIVLHLAANVRFDENLK  127
             VF  +  ++P+ +DKI  V GD S+P LG+ D       + V++V H AA VRFDE L+
Sbjct  67   TVFHVLAVQKPEELDKIVAVPGDVSLPGLGI-DPSMMQRMKGVSLVYHCAATVRFDEPLR  125

Query  128  AAVTINTKGTQEAIKL  143
             AV +N  GT EA+K 
Sbjct  126  EAVRLNVGGTLEALKF  141



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold3030-size297379-augustus-gene-1.6-mRNA-1

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q584S0_TRYB2  unnamed protein product                                 32.0    2.0  
Q383P3_TRYB2  unnamed protein product                                 31.6    2.5  
Q584S6_TRYB2  unnamed protein product                                 31.2    2.9  


>Q584S0_TRYB2 unnamed protein product
Length=345

 Score = 32.0 bits (71),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 21/82 (26%), Positives = 39/82 (48%), Gaps = 13/82 (16%)

Query  635  PPVEEVKRDRRALKEISCEMLCWDMDLLSELAKEELKVKPIPAVK-------KDVDDSCV  687
            P  + +  +R   KE +  M+ WD D + E+A+  +   P    K       +D++ + +
Sbjct  214  PYTDIIVANRHEAKEFA-NMMKWDTDCVEEIARRAVSEVPYTGTKGRVVVFTRDIESTVL  272

Query  688  PICWSDTRAVKETMPAPKLDRD  709
                  T+   ET+P P+LD+D
Sbjct  273  A-----TKDGVETVPVPQLDQD  289


>Q383P3_TRYB2 unnamed protein product
Length=461

 Score = 31.6 bits (70),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (54%), Gaps = 0/54 (0%)

Query  597  AIRVPPTMRVPPIKIAPAMKKSPVADKKAAKTRAPAKQPPVEEVKRDRRALKEI  650
            A RVPPT  + PI++   M+ S +A +   K+     +  VE  K   +AL+++
Sbjct  405  ASRVPPTTSLSPIEVQERMRASDLAKQYGVKSITNYAERDVENFKEQMKALRKL  458


>Q584S6_TRYB2 unnamed protein product
Length=345

 Score = 31.2 bits (69),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 21/82 (26%), Positives = 39/82 (48%), Gaps = 13/82 (16%)

Query  635  PPVEEVKRDRRALKEISCEMLCWDMDLLSELAKEELKVKPIPAVK-------KDVDDSCV  687
            P  + +  +R   KE +  M+ WD D + E+A+  +   P    K       +D++ + +
Sbjct  214  PYTDIIVANRHEAKEFA-NMMKWDTDCVEEIARRAVSEVPYTGTKGRVVVFTRDIEPTVI  272

Query  688  PICWSDTRAVKETMPAPKLDRD  709
                  T+   ET+P P+LD+D
Sbjct  273  A-----TKDGVETVPVPQLDQD  289



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold410-size896665-augustus-gene-7.6-mRNA-1

Length=166
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TFDP_DROME  unnamed protein product                                   72.4    2e-15
TFDP1_CAEEL  unnamed protein product                                  62.4    8e-12
O01768_CAEEL  unnamed protein product                                 29.3    2.1  


>TFDP_DROME unnamed protein product
Length=445

 Score = 72.4 bits (176),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)

Query  108  KRRKSDKVGKGLRHFSMKVCEKVRKKGTTSYNEVADELVAE  148
            ++RK DK GKGLRHFSMKVCEKV +KG T+YNEVAD+LV+E
Sbjct  159  RKRKPDKAGKGLRHFSMKVCEKVEEKGKTTYNEVADDLVSE  199


>TFDP1_CAEEL unnamed protein product
Length=598

 Score = 62.4 bits (150),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)

Query  118  GLRHFSMKVCEKVRKKGTTSYNEVADELVAEFTNPALI  155
            GLRHFS KVCEKV++KG T+YNEVADELVA++    LI
Sbjct  72   GLRHFSTKVCEKVKEKGLTNYNEVADELVADYFQNNLI  109


>O01768_CAEEL unnamed protein product
Length=4858

 Score = 29.3 bits (64),  Expect = 2.1, Method: Composition-based stats.
 Identities = 10/33 (30%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  9     LRTLSLQGSKTTQRSPQMVIPIQSTTPMKVATI  41
             +R L ++G+K  QR   M++P+ S+    ++T+
Sbjct  1904  IRRLGMKGTKAIQRGSVMLVPLHSSIKFFLSTV  1936



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold1097-size574752-augustus-gene-1.2-mRNA-1

Length=421
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VGR_SOLIN  unnamed protein product                                    65.9    3e-11
FBLN1_CAEEL  unnamed protein product                                  61.2    7e-10
A8JTM7_DROME  unnamed protein product                                 57.8    1e-08


>VGR_SOLIN unnamed protein product
Length=1782

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 9/90 (10%)

Query  98   CSLNLCEQRCAVYLQRVICTCYPGYQFNPENQKNGVTPLCEDVDECASSGGGHDCEQQCL  157
            CS   C+  C    +  +CTC PGY+   +N+       C D+DEC + G    C+Q C+
Sbjct  209  CSSAGCQSNCHQTPKGSVCTCKPGYKLQKDNRT------CNDIDECQAYG---ICDQDCM  259

Query  158  NTAGSFRCECRDGFQLRPDNKTCEPSASSA  187
            N  GS+ C C+  + L  D +TC+  A  A
Sbjct  260  NVPGSYACTCQREYYLENDKRTCKARAGEA  289


 Score = 50.1 bits (118),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 15/109 (14%)

Query  74    CVRQRCCQNYTYIGGRCVPKDVDPCSLN-LCEQRCAVYLQRVICTCYPGYQFNPENQKNG  132
             C   R C + +   G+C       C++N  C+  C       +C C  GY+   +     
Sbjct  1243  CDGNRDCPDGSDETGKCQTA----CTVNNFCKGMCYKTPAGAVCGCQSGYRLAVDMIS--  1296

Query  133   VTPLCEDVDECASSGGGHDCEQQCLNTAGSFRCECRDGFQLRPDNKTCE  181
                 CED++EC        C Q C NT GS+ C C+D F +R D  +C+
Sbjct  1297  ----CEDINECELD----ICSQMCRNTIGSYECFCKDEFIIRNDKTSCK  1337


 Score = 29.3 bits (64),  Expect = 8.7, Method: Composition-based stats.
 Identities = 15/40 (38%), Positives = 21/40 (53%), Gaps = 3/40 (8%)

Query  142  ECASSGGGHDCEQQCL-NTAGSFRCECRDGFQLRPDNKTC  180
            +C  + G  +C   CL +   SF C C  G +L  DN+TC
Sbjct  889  DCQKNNG--NCSHVCLPSLITSFICACPPGMELSNDNRTC  926


>FBLN1_CAEEL unnamed protein product
Length=728

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 52/106 (49%), Gaps = 10/106 (9%)

Query  79   CCQNYTYIGGRCVPKDVDPCSLNLC-EQRCAVYLQRVICTCYPGYQFNPENQKNGVTPLC  137
            C   Y   G     +DV+ C   +C    C        C C PGY+FN   ++      C
Sbjct  375  CAHGYEVNGATGFCEDVNECQQGVCGSMECINLPGTYKCKCGPGYEFNDAKKR------C  428

Query  138  EDVDECASSGGGHDCE--QQCLNTAGSFRCECRDGFQLRPDNKTCE  181
            EDVDEC    G H C+   +C+NT GSF C+C+ GFQL  D + CE
Sbjct  429  EDVDECIKFAG-HVCDLSAECINTIGSFECKCKPGFQLASDGRRCE  473


 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 71/140 (51%), Gaps = 17/140 (12%)

Query  87   GGRCVPKDVDPCSLNL--CEQRCAVYLQRVICTCYPGYQFNPENQKNGVTPLCEDVDECA  144
            G RC  +DV+ C+  +  CEQ+C        C C  G+   P+  K      CED+DEC+
Sbjct  469  GRRC--EDVNECTTGIAACEQKCVNIPGSYQCICDRGFALGPDGTK------CEDIDECS  520

Query  145  S-SGGGHD-CEQQCLNTAGSFRCECRDGFQLRPDNKTC---EPSASSAVAGDTGAQAAAR  199
              +G G+D C   C+NT GS+ C+C  G++++PD +TC   +  A    AG         
Sbjct  521  IWAGSGNDLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSDKVCVNTL  580

Query  200  G--RCYANCDTVSRLHDKVN  217
            G  +C++     + +HD +N
Sbjct  581  GSFKCHSIDCPTNYIHDSLN  600


 Score = 52.8 bits (125),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 54/106 (51%), Gaps = 13/106 (12%)

Query  93   KDVDPC---SLNLCE--QRCAVYLQRVICTCYPGYQFNPENQKNGVTPLCEDVDECASSG  147
            +DVD C   + ++C+    C   +    C C PG+Q   + ++      CEDV+EC +  
Sbjct  429  EDVDECIKFAGHVCDLSAECINTIGSFECKCKPGFQLASDGRR------CEDVNECTT--  480

Query  148  GGHDCEQQCLNTAGSFRCECRDGFQLRPDNKTCEPSASSAVAGDTG  193
            G   CEQ+C+N  GS++C C  GF L PD   CE     ++   +G
Sbjct  481  GIAACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSG  526


 Score = 36.6 bits (83),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 34/59 (58%), Gaps = 13/59 (22%)

Query  130  KNGVTPLCEDVDECASSGGGHDCE--QQCLNTAGSFRCE-----CRDGFQLRPDNKTCE  181
            KNG   +C D+DEC +   GH+C   ++C+NT GSFRC+     C  G+++      CE
Sbjct  337  KNG---MCNDIDECVT---GHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCE  389


 Score = 31.6 bits (70),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 26/49 (53%), Gaps = 7/49 (14%)

Query  137  CEDVDECASSGGGHDC--EQQCLNTAGSFRCE---CRDGFQLRPDNKTC  180
            C DVDEC  + G HDC    QC NT GS+RC+   C DG    P    C
Sbjct  279  CVDVDEC--NLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGEC  325


 Score = 29.6 bits (65),  Expect = 5.9, Method: Compositional matrix adjust.
 Identities = 18/41 (44%), Positives = 19/41 (46%), Gaps = 5/41 (12%)

Query  141  DECASSGGGHDCEQQCLNTAG-SFRCECRDGFQLRPDNKTC  180
            D CASS     CE  C +  G    C CR GF L PD   C
Sbjct  157  DRCASS----HCEHLCHDRGGEKVECSCRSGFDLAPDGMAC  193


>A8JTM7_DROME unnamed protein product
Length=4769

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 38/72 (53%), Gaps = 8/72 (11%)

Query  103   CEQRCAVYLQR-VICTCYPGYQFNPENQKNGVTPLCEDVDECASSGGGHDCEQQCLNTAG  161
             C+Q C        ICTCYPGY    +N+K      C DVDEC +    H C  QC N  G
Sbjct  4131  CQQHCHNLTDGGYICTCYPGYIIAADNKKK-----CSDVDECLTRQ--HTCSHQCHNLNG  4183

Query  162   SFRCECRDGFQL  173
             ++ C CR+GF L
Sbjct  4184  TYSCSCREGFHL  4195


 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 46/92 (50%), Gaps = 9/92 (10%)

Query  95   VDPCSLNLCEQRCAVYLQRVICTCYPGYQFNPENQKNGVTPLCEDVDECASSGGGHDCEQ  154
            +  C    CE +C   L   +C C PG    P+N+       C D+DECA  G    C+Q
Sbjct  414  IASCPALSCEFKCGPSLTGGVCYCKPGQSLAPDNRT------CVDLDECAEWG---HCDQ  464

Query  155  QCLNTAGSFRCECRDGFQLRPDNKTCEPSASS  186
             C NT GS+ C+C  G+ L  D+K   P A++
Sbjct  465  LCTNTLGSYTCQCAQGYTLINDSKCIAPDANN  496


 Score = 49.3 bits (116),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 48/98 (49%), Gaps = 16/98 (16%)

Query  98    CSLNLCEQR---CAVYLQRV----ICTCYPGYQFNPENQKNGVTPLCEDVDECASSGGGH  150
             C L  CE +   C+ + Q+     +C C PG +      ++G T  C D +EC   G   
Sbjct  1473  CDLAECEHQAGQCSSFCQKTPNGALCVCPPGSEIG----EDGYT--CIDSNECDPPGL--  1524

Query  151   DCEQQCLNTAGSFRCECRDGFQLRPDNKTCEPSASSAV  188
              C QQC NT GS+ C C DG+ L P+  TC+    +A 
Sbjct  1525  -CSQQCTNTKGSYFCSCTDGYVLEPNKHTCKAVNHTAA  1561


 Score = 33.5 bits (75),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 15/42 (36%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query  139   DVDECASSGGGHDCEQQCLNTAGSFRCECRDGFQLRPDNKTC  180
             +VDECA       C  +C++T   + C+C +G++L  D K C
Sbjct  3247  NVDECAKVEINQ-CGHKCVDTLTGYYCDCNEGYKLLADGKAC  3287


 Score = 32.0 bits (71),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (49%), Gaps = 9/47 (19%)

Query  143  CASSGGGHDCEQQCLNTAGS-------FRCECRDGFQLRPDNKTCEP  182
            C ++ GG  C   C+ TA         FRC C  G+QL  D K C+P
Sbjct  763  CGNNNGG--CNHMCIVTAVKGAPTGLGFRCACSTGYQLETDLKLCKP  807



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold5670-size150794-augustus-gene-0.5-mRNA-1

Length=475
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGH2_DROME  unnamed protein product                                 348     3e-116
LAP4_DROME  unnamed protein product                                   54.7    1e-07 
ATK_DROME  unnamed protein product                                    53.9    2e-07 


>Q9VGH2_DROME unnamed protein product
Length=425

 Score = 348 bits (893),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 190/409 (46%), Positives = 255/409 (62%), Gaps = 19/409 (5%)

Query  79   SAEDCGPGFGNKCLCGVEDYQDRVHQYIVNCSNTGFTDTSVLQHLPSQVQVLIFTGNSIP  138
            ++  CGP F   C CG E Y+  + QY+VNC+N G  +TSVL+ +P QV+VLIFTGN I 
Sbjct  23   NSSSCGPNFPAACSCGQEMYESEM-QYVVNCTNAGLVNTSVLEFMPEQVEVLIFTGNRIT  81

Query  139  ELPWNVFGHLNNLSELRVVDMSNNGIEDIKGKAYHRVANVERLVLNNNNLLISE-SDEAH  197
            ELPWNVFG +NN  +LR+VDMS+N I +I+GK+YH V  VERL+LN+NNL IS   DE +
Sbjct  82   ELPWNVFGSINNYKQLRIVDMSSNHIREIRGKSYHHVPRVERLILNHNNLSISRYEDEVN  141

Query  198  YHHPRVFSNFVNLMELHLTNAFADNVTGDLAKDLHDIFVNSNLTKVIKLHLEQNEISVFK  257
            +HHPRVFSNF+NL  LHLT+AF DN +  L++DLHDIFVNS L K+ KLHLEQNEI+ FK
Sbjct  142  HHHPRVFSNFINLQSLHLTDAFEDNSSPQLSEDLHDIFVNSQLVKLQKLHLEQNEITHFK  201

Query  258  DPDIFCDLPSLMDLHLGDNLLPGLNFNLMCLEHLRFLDLEGNRISKLDEVELSTFDSF--  315
            D ++FCDLPSL DLHLGDN L  LNF + CL +LRFLDLE N+ S +   +L   +    
Sbjct  202  DRNVFCDLPSLRDLHLGDNDLRDLNFEVRCLNNLRFLDLERNKFSFVKPTDLRVLNELEE  261

Query  316  -PARNQSLVIDVRDNPFLCDCDVERLYTWLQTTRVQVRNLCDCDVERLYTWLQTTRVQVR  374
             P R  +L++D   NPF CDC       W+ TTRV VRN      + L  +  T  V   
Sbjct  262  RPNRTANLIVDFNLNPFGCDCRTAPFRAWITTTRVTVRN-----KDSLMCFHSTGHVDAE  316

Query  375  NKDSLRCNRGLSESDRGEALANVRQLQCAPRIDSLSSAG-------SHYVSNVILGLMFT  427
                L+ + G        A   +   +  P      ++        S + + +I  L+  
Sbjct  317  PAHLLQMDMGQCADAIAAAATILNTAEDEPHYGDPEASHLQPQAHISGHTATLIFLLIVL  376

Query  428  TILLLGVVVAYMY--RTELKKFAQPIKDSVSRKIQYTSIGKPEDQEMEV  474
            T++LLG++VA +Y  R +LK    P+ D+V++K+QYTSI   +  E+ V
Sbjct  377  TMILLGLLVALVYVSRDKLKYMITPVFDNVAKKVQYTSIKDEDCPEVHV  425


>LAP4_DROME unnamed protein product
Length=1851

 Score = 54.7 bits (130),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 87/205 (42%), Gaps = 38/205 (19%)

Query  120  LQHLPSQVQVLIFTGNSIPELPWNVFGHLNNLSELRVVDMSNNGIEDIKGKAYHRVANVE  179
            ++HL S +QV  F+ N IP+LP   F  L NL+ L + DMS   +       +  +  +E
Sbjct  102  IKHLQS-LQVADFSSNPIPKLPSG-FSQLKNLTVLGLNDMSLTTLP----ADFGSLTQLE  155

Query  180  RLVLNNNNLLISESDEAHYHHPRVFSNFVNLMELHLTNAFADNVTGDLAK------DLHD  233
             L L  N L          H P   S    L  L L     DN   DL         LH+
Sbjct  156  SLELRENLL---------KHLPETISQLTKLKRLDL----GDNEIEDLPPYLGYLPGLHE  202

Query  234  IFVNSN-----------LTKVIKLHLEQNEISVFKDPDIFCDLPSLMDLHLGDNLLPGLN  282
            ++++ N           LTK+  L + +N +     P+    L SL DL L  NLL  L 
Sbjct  203  LWLDHNQLQRLPPELGLLTKLTYLDVSENRLEEL--PNEISGLVSLTDLDLAQNLLEALP  260

Query  283  FNLMCLEHLRFLDLEGNRISKLDEV  307
              +  L  L  L L+ NR+ +L++ 
Sbjct  261  DGIAKLSRLTILKLDQNRLQRLNDT  285


>ATK_DROME unnamed protein product
Length=1535

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 93/193 (48%), Gaps = 28/193 (15%)

Query  120  LQHLPSQVQVLIFT-----GNSIPELPWNVFGHLNNLSELRVVDMSNNGIEDIKGKAYHR  174
            L+HLP    +L  T       ++ ELP ++F HL  L  + +   S  G+  ++   +  
Sbjct  149  LKHLPDFSGLLSLTYLSVQTGALQELPSHLFRHLPKLQHIHITGGS--GLTRLEAGLFDG  206

Query  175  VANVERLVLNNNNLLISESDEAHYHHPRVFSNFVNLMELHLT-NAFAD-NVTGDLAKDLH  232
            + +++ L L++N L        ++ H R  S   NL+ L L+ N  +D  + G + KDL 
Sbjct  207  LISLKNLDLSHNGL--------NWIHLRALSRLPNLVSLKLSHNQISDVGMVGRIVKDLE  258

Query  233  DIFVNSNLTKVIKLHLEQNEISVFKDPDIFCDLPSLMDLHLGDNLLPGLNFN-LMCLEHL  291
             +          KL L+ N I+V +D   F DLP+L +LHL DN +  L +   +    L
Sbjct  259  HL---------KKLRLDNNLITVIEDGS-FVDLPNLSELHLNDNRITELQYGAFLRTPQL  308

Query  292  RFLDLEGNRISKL  304
            + + L+ N I ++
Sbjct  309  KTIYLQNNLIRRI  321


 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 101/259 (39%), Gaps = 68/259 (26%)

Query  148  LNNLSELRVVDMSNNGIEDIKGKAYHRVANVERLVLNNNNLLISESDEAHYHHPRVFSNF  207
            L NL+ LR +D+S N I  I+        NV  + L+NN  LI E  +        F N 
Sbjct  688  LGNLNNLRDIDLSYNQISRIQSDVIGGWRNVVEIRLSNN--LIVELQQG------TFRNL  739

Query  208  VNLMELHLTNAFADNVTGDLAKDLHDI---------------FVNSNLTKVIKLHLEQNE  252
              L  L L++    NV     K L ++                V   L  ++  H + N+
Sbjct  740  PKLQYLDLSSNEIRNVEPGALKGLDELQEFVLADNKLVELKDHVFEELPSLLASHFQYNK  799

Query  253  ISVFKDPDIFCDLPSLMDLHLGDNLLPGL-NFNLMCLEHLRFLDLEGNRIS---------  302
            +  +  P+ F +  SL+ L+L +N    + N  L  + +L  LDL  N +          
Sbjct  800  LR-YISPESFHNANSLVFLNLSNNHFRNMENIGLRSMRNLEVLDLSTNGVKLVSTMPLKA  858

Query  303  -------KLD-----EVELSTFDSFP------ARNQSL----------------VIDVRD  328
                   K+D      ++ S F++ P       RN  L                ++DV  
Sbjct  859  LNWLVELKMDNNQICRIQGSPFETMPRLRVLSMRNNQLRSIKERTFRNVRGNIAILDVDG  918

Query  329  NPFLCDCDVERLYTWLQTT  347
            NP  C+C+++ L  WLQ T
Sbjct  919  NPIDCNCEMQWLSVWLQET  937


 Score = 38.9 bits (89),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 86/183 (47%), Gaps = 22/183 (12%)

Query  122  HLPSQVQVLIFTGNSIPELPWNVFGHLNNLSELRVVDMSNNGIEDIKGKAYHRVANVERL  181
             LP+ +++L  + N I +LP + F       ELRV+ ++ N +  +K  ++  +  +E L
Sbjct  547  QLPN-LRMLDLSQNRIEQLPRHGF---QGAMELRVLSLAQNELRQLKDTSFIGIQRLELL  602

Query  182  VLNNNNLLISESDEAHYHHPRVFSNFVNLMELHLTNAFADNVTGDLAKDLHDIFVNSNLT  241
             L  N L   E+DE      R       L  L+L +   + +T        D F ++N +
Sbjct  603  HLQENQL--GEADE------RALLPLAELRNLNLQSNKLEAIT--------DNFFSNN-S  645

Query  242  KVIKLHLEQNEISVFKDPDIFCDLPSLMDLHLGDNLLPGLNFNLMCLEHLRFLDLEGNRI  301
            ++ +L L +N I     P  F    SL  L L  N L  ++  L  L +LR +DL  N+I
Sbjct  646  RLEQLDLSRNLIRSIS-PTAFDTQRSLEYLDLSGNALLDISVGLGNLNNLRDIDLSYNQI  704

Query  302  SKL  304
            S++
Sbjct  705  SRI  707


 Score = 35.8 bits (81),  Expect = 0.085, Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 69/160 (43%), Gaps = 23/160 (14%)

Query  148  LNNLSELRVVDMSNNGIEDIKGKAYHRVANVERLVLNNNNLLISESDEAHYHHPRVFSNF  207
            L+ L  LR +DMS N + ++   A      +E+L LN+N+L + E D             
Sbjct  354  LDALPRLRYLDMSGNLLSELPYGALRGHGTLEQLHLNHNHLRLIERD--------ALMAM  405

Query  208  VNLMELHLTNAFADNVTGDLAKDLHDIFVNSNLTKVIKLHLEQNEISVFKDPDIFCDLPS  267
              L EL + N         L+ DL   F   NL  +  L L QN+ +   D  +   LPS
Sbjct  406  PALRELRMRN-------NSLSSDLPLPFW--NLPGLKGLDLAQNQFARV-DSQLLAGLPS  455

Query  268  LMDLHLGDNLLPGLNFNLMCLEH---LRFLDLEGNRISKL  304
            L  L L +N L  L  N     H   L  L++  N ++K+
Sbjct  456  LRRLDLSENGLIELAPN--SFRHNPLLETLNISSNELTKI  493



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold4449-size204091-augustus-gene-1.3-mRNA-1

Length=864
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TBA1_DROME  unnamed protein product                                   845     0.0  
TBA3_DROME  unnamed protein product                                   842     0.0  
TBA2_DROME  unnamed protein product                                   835     0.0  


>TBA1_DROME unnamed protein product
Length=450

 Score = 845 bits (2184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/430 (97%), Positives = 422/430 (98%), Gaps = 0/430 (0%)

Query  423  GQAGVQIGNACWELYCLEHGILPDGQMPSDKSSSKVDDSFSTFFCETGAGKHVPRAVFVD  482
            GQAGVQIGNACWELYCLEHGI PDGQMPSDK+    DDSF+TFF ETGAGKHVPRAVFVD
Sbjct  10   GQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVD  69

Query  483  LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDIVMDRIRKLSDQC  542
            LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVD+V+DRIRKL+DQC
Sbjct  70   LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQC  129

Query  543  TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSIL  602
            TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSIL
Sbjct  130  TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSIL  189

Query  603  TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN  662
            TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN
Sbjct  190  TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN  249

Query  663  VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRH  722
            VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSV+EITNACFEPANQMVKCDPRH
Sbjct  250  VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRH  309

Query  723  GKYMACCMLYRGDVVPKDVNAAIAVIKTKRTIQFVDWCPTGFKVGINYQPPTAVPGGDLA  782
            GKYMACCMLYRGDVVPKDVNAAIA IKTKRTIQFVDWCPTGFKVGINYQPPT VPGGDLA
Sbjct  310  GKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLA  369

Query  783  KVQRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  842
            KVQRAVCMLSNTTAIAEAWARLDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  843  KDYEEVGMDS  852
            KDYEEVGMDS
Sbjct  430  KDYEEVGMDS  439


>TBA3_DROME unnamed protein product
Length=450

 Score = 842 bits (2175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/430 (96%), Positives = 421/430 (98%), Gaps = 0/430 (0%)

Query  423  GQAGVQIGNACWELYCLEHGILPDGQMPSDKSSSKVDDSFSTFFCETGAGKHVPRAVFVD  482
            GQAGVQIGNACWELYCLEHGI PDGQMPSDK+    DDSF+TFF ETGAGKHVPRAVFVD
Sbjct  10   GQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDDSFNTFFSETGAGKHVPRAVFVD  69

Query  483  LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDIVMDRIRKLSDQC  542
            LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVD+V+DRIRKL+DQC
Sbjct  70   LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQC  129

Query  543  TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSIL  602
            TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFA+YPAPQVSTAVVEPYNSIL
Sbjct  130  TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSIL  189

Query  603  TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN  662
            TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN
Sbjct  190  TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN  249

Query  663  VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRH  722
            VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSV+EITNACFEPANQMVK DPRH
Sbjct  250  VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRH  309

Query  723  GKYMACCMLYRGDVVPKDVNAAIAVIKTKRTIQFVDWCPTGFKVGINYQPPTAVPGGDLA  782
            GKYMACCMLYRGDVVPKDVNAAIA IKTKRTIQFVDWCPTGFKVGINYQPPT VPGGDLA
Sbjct  310  GKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLA  369

Query  783  KVQRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  842
            KVQRAVCMLSNTTAIAEAWARLDHKFDLMY+KRAFVHWYVGEGMEEGEFSEAREDLAALE
Sbjct  370  KVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALE  429

Query  843  KDYEEVGMDS  852
            KDYEEVGMDS
Sbjct  430  KDYEEVGMDS  439


>TBA2_DROME unnamed protein product
Length=449

 Score = 835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/441 (93%), Positives = 423/441 (96%), Gaps = 1/441 (0%)

Query  423  GQAGVQIGNACWELYCLEHGILPDGQMPSDKSSSKVDDSFSTFFCETGAGKHVPRAVFVD  482
            GQAGVQIGNACWELYCLEHGI PDG MPSDK+    DDSFSTFF ETGAGKHVPRAVFVD
Sbjct  10   GQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDDSFSTFFSETGAGKHVPRAVFVD  69

Query  483  LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDIVMDRIRKLSDQC  542
            LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVD+V+DRIRKL+DQC
Sbjct  70   LEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQC  129

Query  543  TGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSIL  602
            TGLQGFL+FHSFGGGTGSGFTSLLMERLSVDYGKKSKLEF+IYPAPQVSTAVVEPYNSIL
Sbjct  130  TGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSIL  189

Query  603  TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALN  662
            TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTY NLNRLIGQIVSSITASLRFDGALN
Sbjct  190  TTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALN  249

Query  663  VDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRH  722
            VDLTEFQTNLVPYPRIHFPL TYAPVIS EKAYHEQL+V+EITNACFEPANQMVKCDPR 
Sbjct  250  VDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRR  309

Query  723  GKYMACCMLYRGDVVPKDVNAAIAVIKTKRTIQFVDWCPTGFKVGINYQPPTAVPGGDLA  782
            GKYMACCMLYRGDVVPKDVNAAIA IKTKR+IQFVDWCPTGFKVGINYQPPT VPGGDLA
Sbjct  310  GKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLA  369

Query  783  KVQRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALE  842
            KVQRAVCMLSNTTAIAEAWARLDHKFDLMY+KRAFVHWYVGEGMEEGEF+EAREDLAALE
Sbjct  370  KVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALE  429

Query  843  KDYEEVGMDSTEGEGEGAEEY  863
            KDYEEVG+DST   GE  EEY
Sbjct  430  KDYEEVGIDSTTELGED-EEY  449



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= augustus-scaffold3786-size239860-processed-gene-1.1-mRNA-1

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K7W5_DROME  unnamed protein product                                 167     1e-45
Q389W0_TRYB2  unnamed protein product                                 46.6    2e-05
Q9VYQ9_DROME  unnamed protein product                                 46.2    4e-05


>Q7K7W5_DROME unnamed protein product
Length=628

 Score = 167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 137/408 (34%), Positives = 188/408 (46%), Gaps = 57/408 (14%)

Query  3    KFLPKSGDSVLVTGAGDSRIRVHDIK-LEETTLVCNCHTGRVKRLATAPNVPYMFWSAAE  61
            KFLPK+ +S++ T A D  I V+DI    ET   C CH  R KRLATA + P++FWSA E
Sbjct  117  KFLPKTNNSIVATCAADKFIYVYDINDPNETLFSCICHFSRAKRLATAQDSPHVFWSAGE  176

Query  62   DGLIMQFDLRTPHSCSRE--VNNVLVNLLSHMGRYAEAKCLAINPCRPELLAVGANDPYV  119
            DG I+Q D+R PH C  E  +   L+NL   +    EAKCLAINP R E LAVG NDP+ 
Sbjct  177  DGCILQLDIREPHRCRPEEGIGVRLLNLHDQLEN-TEAKCLAINPRRTEYLAVGTNDPFA  235

Query  120  RVYDRRMIKATT-------VEDY------KKKYRNLAS-----TYVTFSPDGNDLLVNLG  161
            RVYDRR + +T        V  Y      K   RN+       TY+TF+ +G +LLVN+G
Sbjct  236  RVYDRRKLPSTNGNGLSACVAYYAPGQIVKNISRNIVHEPRGITYLTFNGNGTELLVNIG  295

Query  162  GEQIYLFDIN-----------------------------SRRKPTRFEIQAQEIGGVKAS  192
             E +Y FD+N                             SR  PT  E+  +E      +
Sbjct  296  CEHVYRFDLNHAEPPVFYDLPAFTSTLVHEEEPVKMPHRSRSLPTEIEVYKKEGNDFLEN  355

Query  193  FK-VHAVESSIFAYAEHCEGSNGYSNGFRNGTNVSASSTPISEKKSKREKVSLANNIELL  251
             K V A+++   A A++ +G   Y N               +  +   E + L  +    
Sbjct  356  GKLVDAIDAYSAALAKYPQGEVLYLNRATALMRRGWFGDIYAALRDCHEALRLDPSYVKA  415

Query  252  KLK-ANEAFEQQLYTDAVTMYNRAISLCPNAAVLYDVEVVDMDGPSSSEEGSSGGGE--Q  308
              + A    E     DA       I   P+ A  + V +++ D   +  +  S      Q
Sbjct  416  HFRLARALLELHRPQDADQCLQALIQRFPDFANNHGVLMLNKDIKENRRQSKSPEAPELQ  475

Query  309  PKQTARSWT-LPSEQEEAWCRA-ACDYEVRFCGHCNTTTDIKEANFFG  354
            P +    +  L  +  E   R+ A DY  R+ GHCN TTDIKEAN+ G
Sbjct  476  PVEVDDGFRYLRLKNAEYDLRSTARDYMQRYVGHCNVTTDIKEANYLG  523


>Q389W0_TRYB2 unnamed protein product
Length=444

 Score = 46.6 bits (109),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/185 (24%), Positives = 77/185 (42%), Gaps = 21/185 (11%)

Query  10   DSVLVTGAGDSRIRVHDIKLEETTLVCNCHTGRVKRLATAPNVPYMFWSAAEDGLIMQFD  69
            +S   TG GD  ++V D+      L    H   V+ L+ +   PYMF + ++D  +  +D
Sbjct  153  NSWFATGGGDGVVKVWDLTTGALKLNLTGHKEGVRALSLSTLSPYMF-TGSDDHSVKCWD  211

Query  70   LRTPHSCSREVNNVLVNLLSHMGRYAEAKCLAINPCRPELLAVGANDPYVRVYDRRMIKA  129
            L        E N ++ +   H G      C++ +P   +++  G  D  VRV+D R    
Sbjct  212  L--------ERNEIIRDFHGHKG---SVHCVSTHPSL-DIVLSGGRDKTVRVWDVRTRSC  259

Query  130  TTVEDYKKKYRNLASTYVTFSPDGNDLLVNLGGE--QIYLFDINSRRKPTRFEIQAQEIG  187
              +          + + ++ +    D     GG    +YL+DI S R  TR     + + 
Sbjct  260  VHL------LLGHSDSVMSLAVQQEDPQAISGGSDGMVYLWDIASGRAFTRLTRHKKPVR  313

Query  188  GVKAS  192
            G+  S
Sbjct  314  GLALS  318


>Q9VYQ9_DROME unnamed protein product
Length=482

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 13/117 (11%)

Query  9    GDSVLVTGAGDSRIRVHDIKLEETTLVCNCHTGRVKRLATAPNVPYMFWSAAEDGLIMQF  68
            G+    TGAGD  I++ D+   +  L    H   V+ +A +   PY+F S  ED  +  +
Sbjct  183  GNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYLF-SCGEDRQVKCW  241

Query  69   DLRTPHSCSREVNNVLVNLLSHMGRYAEAKCLAINPCRPELLAVGANDPYVRVYDRR  125
            DL        E N V+ +   H+   +    LA++P   ++LA    D   R++D R
Sbjct  242  DL--------EYNKVIRHYHGHL---SAVYSLALHPT-IDVLATSGRDSTARIWDMR  286



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold345-size957666-augustus-gene-7.2-mRNA-1

Length=454
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5ECK4_CAEEL  unnamed protein product                                 49.3    6e-06
G5EFW3_CAEEL  unnamed protein product                                 41.6    0.001
G5EG97_CAEEL  unnamed protein product                                 41.6    0.001


>G5ECK4_CAEEL unnamed protein product
Length=1523

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 0/42 (0%)

Query  405   NMLAVSRGQVVKVLHKEDYNGNPEWWFVEKKLKKTGYVPANY  446
             N + V  G+V+ VL + D +GNPEW  +++   K GYVPA Y
Sbjct  1478  NQVEVKEGEVIGVLQRTDDDGNPEWLLIKRDSGKVGYVPAAY  1519


 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 45/196 (23%), Positives = 88/196 (45%), Gaps = 21/196 (11%)

Query  5    RDEQYDEQENLFCTLDKMVRSFLKNAETFVASLQETFF-IKCLIVENIAAMYDEDMTS-E  62
            RD  +D    L C LD   R  ++     V   ++ F   + L+ + +     + ++S E
Sbjct  698  RDTDFDR---LVCELDSAERRLVRFNYMMVIYRKKMFHETRVLMHKKVVEPRKKHLSSSE  754

Query  63   VD----KYSRIVKNISSQFLNEFKRAVDSRVLSPLTLLLKCFEGPWKLVQKRYDKLLDYE  118
            +D     ++  +K  +S+         + R+   +   L+    P +L++KR DKL+DYE
Sbjct  755  IDLQLQPFNHAIKTWASE--------ANVRIRDEIVKALRSI--PKRLIKKRNDKLMDYE  804

Query  119  AYYSRMDKSKDRQGTINIMKNTFTALNNQLLEELPVLIMLSCEVFAECVKAFVLARKLFM  178
            A  ++ +K   ++    I K+ + ALN Q+ ++LP +      V A  ++      K  M
Sbjct  805  ASRTK-EKGLGKRDFAEIQKD-YEALNTQVKQQLPKVTEYLTTVLATSMRTVSEQDKALM  862

Query  179  GKITKQYLSLLSEISE  194
              + K +    S+ +E
Sbjct  863  ETLRKLFNDAKSKAAE  878


>G5EFW3_CAEEL unnamed protein product
Length=4166

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  405  NMLAVSRGQVVKVLHKEDYNGNPEWWFVEKKLKKTGYVPANY  446
            N + VS+G+V+ +L K      PEWW   K+    GYVPANY
Sbjct  940  NGMRVSKGEVLALLEK----STPEWWRALKRDGTEGYVPANY  977


>G5EG97_CAEEL unnamed protein product
Length=3980

 Score = 41.6 bits (96),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (60%), Gaps = 4/42 (10%)

Query  405  NMLAVSRGQVVKVLHKEDYNGNPEWWFVEKKLKKTGYVPANY  446
            N + VS+G+V+ +L K      PEWW   K+    GYVPANY
Sbjct  754  NGMRVSKGEVLALLEK----STPEWWRALKRDGTEGYVPANY  791



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold6038-size230919-augustus-gene-1.8-mRNA-1

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALLC_DICDI  unnamed protein product                                   212     1e-65
VILD_DICDI  unnamed protein product                                   29.6    5.8  
PDXK_DICDI  unnamed protein product                                   28.9    6.6  


>ALLC_DICDI unnamed protein product
Length=369

 Score = 212 bits (540),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/357 (37%), Positives = 177/357 (50%), Gaps = 74/357 (21%)

Query  1    LLKAEEPVWREGEFTECGKWMDGWETRRKRVSGHDWAIIKLGYPGQIKGVYVDTAYFTGN  60
            L+K   PVW   ++ + GKWMDGWET+R     HDW IIKLG PG I G  +DTAYFTGN
Sbjct  45   LIKHSAPVWDAEKYVDTGKWMDGWETKRHN-PDHDWCIIKLGIPGVIYGFEIDTAYFTGN  103

Query  61   YVPRFSLQAANLASEVLYNIDMLVVFHWSLEESLLPPRVSRMGTAATPDMMKQVERLQSE  120
            Y P  S++A    S+  +N         +L+ES                           
Sbjct  104  YPPHASIEALCDDSDPNFN---------TLKES--------------------------N  128

Query  121  KWQEVVAMTALKCGLADSRRHYLHAKHGADVWTHVRLNLYPDGGIARLRLYGEVKLNWDA  180
             W+ ++     K  L  S + Y   K     +TH++  +YPDGG+ARLR YG V  +W  
Sbjct  129  NWEVILN----KSDLGSSCKKYFECK-VEKRFTHIKFRIYPDGGVARLRAYGRVVKDWTL  183

Query  181  VDCTQASAKCFGSTLVDLMSMEKGGACIHYSNAHYGHPRNVIRPGRGRDMGDGWETARRL  240
            V             LVDL ++E GG     S+  YG+  N+I PGR  +MGDGWET RR 
Sbjct  184  V---------IPGELVDLAAIENGGLVTQVSDHFYGNKNNIIMPGRSVNMGDGWETKRR-  233

Query  241  DRPCILQEDENGILQVPGNEWAVFKLAHLGTIETIEVDTLHFKGNYPDSVWIDG----SL  296
                          + PGN+W   KLA  G ++ IEVDT  FKGN+P S  ID     S 
Sbjct  234  --------------RGPGNDWLTVKLAKEGIVKRIEVDTNWFKGNFPTSCSIDAIHSSSA  279

Query  297  GD-----DFSWKTLLSKKKLSPHKLHKYTSKDFLHEGPLTHVRVTIAPDGGISRLRL  348
             D     D+ W  +L    L  H+ H + ++   ++ P TH+R+ I PDGG+SRLR+
Sbjct  280  PDETHLQDYEWTNILPNSPLCGHRRHFFQNELVNNDKPFTHIRLNIFPDGGVSRLRI  336


 Score = 72.0 bits (175),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 83/188 (44%), Gaps = 39/188 (21%)

Query  187  SAKCFGSTLVDLMSMEKGGACIHYSNAHYGHPRNVIRPG-------RGRDMG---DGWET  236
            +A C+ S   +L+S + GG  +  ++  +    N+I+         +  D G   DGWET
Sbjct  11   NAPCYVSECAELLSDKVGGVVLGCTDQWFAECVNLIKHSAPVWDAEKYVDTGKWMDGWET  70

Query  237  ARRLDRPCILQEDENGILQVPGNEWAVFKLAHLGTIETIEVDTLHFKGNYPDSVWIDG--  294
             R                  P ++W + KL   G I   E+DT +F GNYP    I+   
Sbjct  71   KR----------------HNPDHDWCIIKLGIPGVIYGFEIDTAYFTGNYPPHASIEALC  114

Query  295  --------SLGDDFSWKTLLSKKKLSPHKLHKYTSKDFLHEGPLTHVRVTIAPDGGISRL  346
                    +L +  +W+ +L+K  L       +  K    E   TH++  I PDGG++RL
Sbjct  115  DDSDPNFNTLKESNNWEVILNKSDLGSSCKKYFECK---VEKRFTHIKFRIYPDGGVARL  171

Query  347  RLWGRAVK  354
            R +GR VK
Sbjct  172  RAYGRVVK  179


>VILD_DICDI unnamed protein product
Length=1704

 Score = 29.6 bits (65),  Expect = 5.8, Method: Compositional matrix adjust.
 Identities = 10/19 (53%), Positives = 13/19 (68%), Gaps = 0/19 (0%)

Query  12   GEFTECGKWMDGWETRRKR  30
             EF +C +W+DG E  RKR
Sbjct  952  AEFDDCTRWIDGLEAARKR  970


>PDXK_DICDI unnamed protein product
Length=302

 Score = 28.9 bits (63),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 21/39 (54%), Gaps = 1/39 (3%)

Query  258  GNEWAVFKLAHLGTIETIEVDTLHFKGNYPDSVWIDGSL  296
            GN+ AVF L HLG IE   ++++H   N     W   SL
Sbjct  18   GNKCAVFALQHLG-IEVDPINSVHLSNNTAYPTWKGESL  55



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold3297-size274863-augustus-gene-1.5-mRNA-1

Length=201
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCJ4_DROME  unnamed protein product                                 95.5    7e-23
Q8IMY3_DROME  unnamed protein product                                 89.7    9e-21
Y7071_DICDI  unnamed protein product                                  31.6    0.54 


>Q9VCJ4_DROME unnamed protein product
Length=561

 Score = 95.5 bits (236),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 61/87 (70%), Gaps = 2/87 (2%)

Query  114  GWVDWNMALDLEGGPNWANNTNDSPIIVNAPA-DEFYKQPMFYAIAHFSKFVPPGSVHVG  172
            GW+DWN+ LD  GGPN+ +NT D+P+IVN    +EFYKQPMFYAI HFSK+VP GSV + 
Sbjct  443  GWIDWNICLDEIGGPNYVDNTVDAPVIVNTTTFEEFYKQPMFYAIGHFSKWVPEGSVRID  502

Query  173  LELEKDGGSENVAFLTPDNITVVIMQN  199
              +  +   ++VAFL PDN    ++ N
Sbjct  503  -AVPSNVNLDSVAFLRPDNKITAVLFN  528


 Score = 45.1 bits (105),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 49/104 (47%), Gaps = 3/104 (3%)

Query  24   AEKLIRFLDLYAAEGLDFWGLTPQNEPSHGYTDG---DWNSMGWHTQQMLDYLVANLCPT  80
            A+  +R+L L    G+  W ++  NEP +G        + S+GW  Q    +L   L PT
Sbjct  273  ADYHLRWLRLMKDNGIPIWAISTGNEPLNGIIFMYFVKFMSLGWTPQTQAIWLNDYLGPT  332

Query  81   LKTSGYSGLKLMINDDQRNNVDEWMEVTNNWVTGWVDWNMALDL  124
            ++ S +  + L  NDDQR +   W ++ N      +D+   L L
Sbjct  333  IRNSEFKDITLFGNDDQRYSFPHWFKMMNRTRPNSIDYLDGLSL  376


>Q8IMY3_DROME unnamed protein product
Length=566

 Score = 89.7 bits (221),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 6/99 (6%)

Query  106  EVTNNWVTGWVDWNMALDLEGGPNWANNTNDSPIIVNAPA-DEFYKQPMFYAIAHFSKFV  164
            ++T+N+  GW+DWN+ LD +GGPN+  N  D+PIIVNA +  E YKQP+FYAI HFSKF+
Sbjct  436  DLTHNF-NGWLDWNLVLDEQGGPNYVKNFVDAPIIVNATSRSEIYKQPIFYAIGHFSKFL  494

Query  165  PPGSVHVGLELEKDGGS----ENVAFLTPDNITVVIMQN  199
            PP SV +   +E           V F  PD    +I+ N
Sbjct  495  PPDSVRIETRIENQSNPFTQLSVVGFQRPDGSVALIIYN  533


 Score = 45.4 bits (106),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (4%)

Query  28   IRFLDLYAAEGLDFWGLTPQNEPSHG---YTDGDWNSMGWHTQQMLDYLVANLCPTLKTS  84
            ++FL+L  ++ +  W ++  NEP +G   +    + SMGW   Q   +L  NL PT++ S
Sbjct  277  LKFLELMRSKNMPIWAISTGNEPLNGVIGFFFVHFMSMGWTPWQQAIWLNDNLGPTIRNS  336

Query  85   GYSGLKLMINDDQRNNVDEWME  106
              S + +  NDDQR     W  
Sbjct  337  AESKVLIFGNDDQRYTYPTWFR  358


>Y7071_DICDI unnamed protein product
Length=2454

 Score = 31.6 bits (70),  Expect = 0.54, Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 27/68 (40%), Gaps = 7/68 (10%)

Query  40    DFWGLTPQNEPSHGYTDGDWNSMGWHTQQMLDYLVANL------CPTLKTSGYSGLKLMI  93
             DFW   P N+P+      DW     +TQ +  Y   N        P + T  Y+  K   
Sbjct  1877  DFWN-QPTNDPNFAVCLADWGEAKVYTQDVEGYTTRNRGTEFIKSPEMLTIAYASQKTRE  1935

Query  94    NDDQRNNV  101
             N D+R  V
Sbjct  1936  NFDRRKKV  1943



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold4231-size215699-augustus-gene-1.3-mRNA-1

Length=500
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TCPD_CAEEL  unnamed protein product                                   32.3    0.88 
CHS2_CAEEL  unnamed protein product                                   32.7    0.98 
Q582D6_TRYB2  unnamed protein product                                 30.0    5.4  


>TCPD_CAEEL unnamed protein product
Length=540

 Score = 32.3 bits (72),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 21/73 (29%), Positives = 34/73 (47%), Gaps = 3/73 (4%)

Query  74   NPTDTDYEDQYYGFEYEARAKGYSEHRQYLLEVPFYRLKANVTNITEWPLFVYVDITNAP  133
            +P  TD E+Q    +Y    +   E RQYLLE+   ++KA   N+      +  D  N  
Sbjct  254  SPPKTDMENQVIITDYAQMDRALKEERQYLLEI-CKQIKAAGCNVLLIQKSILRDAVNE-  311

Query  134  FLTVHWAAAPRWL  146
             L +H+ A  + +
Sbjct  312  -LALHFLAKMKIM  323


>CHS2_CAEEL unnamed protein product
Length=1668

 Score = 32.7 bits (73),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 32/160 (20%), Positives = 65/160 (41%), Gaps = 13/160 (8%)

Query  144   RWLGGVQYDVLGYNVTLHHNTSVDGSDESLSLGFVRVDQELELSYNVGPTSGTYRFGVQI  203
             RW+    ++++     L    +V   +ES+S+ ++     + +S  +GP  GT    +  
Sbjct  1010  RWIPSTIFNIMDL---LKDYRNVVRVNESISIWYIIYQLVMLISSILGP--GTIFVMI--  1062

Query  204   NHPACGSTGCRLSFSPTINIKVVKPLPIVLIVYVPTHKTHVQVV--KELAAYLRSFCEVE  261
                  G+     S    I++ +V    +V IV   T K   Q++  + + A         
Sbjct  1063  ----IGAISISFSIDTLISLVIVSIPVVVFIVVCLTAKPEHQLICAQTIGAIFAMLMTAV  1118

Query  262   ALLHDLDMPKENIQEPHTWYNKAYERANLVMVVTSPLQHT  301
              +   L + K+ +  PH+ +  A   + L   +  PL+ T
Sbjct  1119  VVGTSLQLQKDGLLSPHSMFTVAVATSFLTAAILHPLEFT  1158


>Q582D6_TRYB2 unnamed protein product
Length=2237

 Score = 30.0 bits (66),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 58/160 (36%), Gaps = 44/160 (28%)

Query  72    WANPTDTDYEDQYYGFEYEARAKG-YSEHRQYLLEVPFYRLKANVTNITEWPLFVYVDIT  130
             W        ED       E RA+  Y+  R+    VP + ++A V  +T   L+V VDIT
Sbjct  1081  WEEVRSWSLEDLVEKLSDERRAEAAYACIRR----VPHFIVEAAVRPLTRRMLYVDVDIT  1136

Query  131   NAPFLTVHWAAAPRWLGGVQYDVLGYNVTLHHNTSVDGSDESLSLGFVRVDQELELSYNV  190
                         P ++         ++ T+H  TS                   EL   V
Sbjct  1137  ------------PDFM---------FDETVHTGTSG------------------ELVITV  1157

Query  191   GPTSGTYRFGVQINHPACGSTGCRLSFSPTINIKVVKPLP  230
               T+G      +IN  A    GC    SPTI + VV P P
Sbjct  1158  EHTNGRILHCERINLRAAALRGCETVSSPTIVVPVVDPKP  1197



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold2458-size351189-augustus-gene-1.1-mRNA-1

Length=101
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR9A_DROME  unnamed protein product                                   48.1    1e-07
OR2A_DROME  unnamed protein product                                   40.4    6e-05
OR2_ANOGA  unnamed protein product                                    36.6    0.001


>OR9A_DROME unnamed protein product
Length=392

 Score = 48.1 bits (113),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (43%), Gaps = 35/127 (28%)

Query  1    LHQEALRITDNICSAFRTLFFLYYALSSMIICLLLYQL----------------------  38
            LHQ+ L+I D+I   +R L FL + LS++ IC + +Q+                      
Sbjct  251  LHQKGLQIADHIADKYRPLIFLQFFLSALQICFIGFQVADLFPNPQSLYFIAFVGSLLIA  310

Query  39   ------------NSSSEAAEAVAATQWYNYSSEDKSTLVIIMCRAQRPVYLWAGRFAVMS  86
                        ++S +    +  T W ++S   K  L+I   RAQRP  +  G F   S
Sbjct  311  LFIYSKCGENIKSASLDFGNGLYETNWTDFSPPTKRALLIAAMRAQRPCQM-KGYFFEAS  369

Query  87   LETYAAV  93
            + T++ +
Sbjct  370  MATFSTI  376


>OR2A_DROME unnamed protein product
Length=397

 Score = 40.4 bits (93),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 39/85 (46%), Gaps = 1/85 (1%)

Query  10   DNICSAFRTLFFLYYALSSMIICLLLYQLNSSSEA-AEAVAATQWYNYSSEDKSTLVIIM  68
            D+       +FF    L   +IC    ++ + SEA  +A     W     + K  L+  +
Sbjct  298  DHTAMIISIVFFSAVTLEVFVICYFGDRMRTQSEALCDAFYDCNWIEQLPKFKRELLFTL  357

Query  69   CRAQRPVYLWAGRFAVMSLETYAAV  93
             R QRP  ++AG +  +SLET+  V
Sbjct  358  ARTQRPSLIYAGNYIALSLETFEQV  382


>OR2_ANOGA unnamed protein product
Length=378

 Score = 36.6 bits (83),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (51%), Gaps = 0/59 (0%)

Query  38   LNSSSEAAEAVAATQWYNYSSEDKSTLVIIMCRAQRPVYLWAGRFAVMSLETYAAVSNL  96
            L  S    +A+    W ++    +  L++I+ RAQRP+ +  G    M+LE +  + N+
Sbjct  307  LEQSLGIGDAIYNGAWPDFEEPIRKRLILIIARAQRPMVIKVGNVYPMTLEMFQKLLNV  365



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold3875-size234203-augustus-gene-1.3-mRNA-1

Length=447
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O96616_DROME  unnamed protein product                                 184     5e-54
Q9VX20_DROME  unnamed protein product                                 184     9e-54
UNC4_CAEEL  unnamed protein product                                   105     1e-25


>O96616_DROME unnamed protein product
Length=349

 Score = 184 bits (467),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 113/177 (64%), Gaps = 37/177 (21%)

Query  98   EGAQSD----DFLRNSKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALAMRLDLKES  153
            EGA S+    D   +SK+RR RTNFNSWQL ELER F  SHYPD+FMREALA +LDL E 
Sbjct  108  EGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEG  167

Query  154  RVAVWFQYRKAKWNDDVCMRFIRDRVAGLTVVLWLQVWFQNRRAKWRKKEHTKKGPGRPA  213
            R+AVW                                 FQNRRAKWRK+EHTKKGPGRPA
Sbjct  168  RIAVW---------------------------------FQNRRAKWRKQEHTKKGPGRPA  194

Query  214  HNAHPQTCSGEPIPEEELRRKERNRREKKLLKALERQQRKLAAKGIAVDVATLRREW  270
            HNAHPQ+CSG+PIP  ELR +E  +R K++ KA++RQ +KL  KG+ VD A L  E+
Sbjct  195  HNAHPQSCSGDPIPLSELRARELAQRSKRMKKAIDRQAKKLQDKGLEVDYARLEAEY  251


>Q9VX20_DROME unnamed protein product
Length=382

 Score = 184 bits (467),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 113/177 (64%), Gaps = 37/177 (21%)

Query  98   EGAQSD----DFLRNSKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALAMRLDLKES  153
            EGA S+    D   +SK+RR RTNFNSWQL ELER F  SHYPD+FMREALA +LDL E 
Sbjct  141  EGADSNLGQNDCTESSKKRRGRTNFNSWQLRELERVFQGSHYPDIFMREALATKLDLMEG  200

Query  154  RVAVWFQYRKAKWNDDVCMRFIRDRVAGLTVVLWLQVWFQNRRAKWRKKEHTKKGPGRPA  213
            R+AVW                                 FQNRRAKWRK+EHTKKGPGRPA
Sbjct  201  RIAVW---------------------------------FQNRRAKWRKQEHTKKGPGRPA  227

Query  214  HNAHPQTCSGEPIPEEELRRKERNRREKKLLKALERQQRKLAAKGIAVDVATLRREW  270
            HNAHPQ+CSG+PIP  ELR +E  +R K++ KA++RQ +KL  KG+ VD A L  E+
Sbjct  228  HNAHPQSCSGDPIPLSELRARELAQRSKRMKKAIDRQAKKLQDKGLEVDYARLEAEY  284


>UNC4_CAEEL unnamed protein product
Length=252

 Score = 105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/58 (83%), Positives = 52/58 (90%), Gaps = 0/58 (0%)

Query  109  SKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALAMRLDLKESRVAVWFQYRKAKW  166
            +KRRR+RTNF+ WQLEELE AF ASHYPDVFMREALAMRLDL ESRV VWFQ R+AKW
Sbjct  86   AKRRRTRTNFSGWQLEELESAFEASHYPDVFMREALAMRLDLLESRVQVWFQNRRAKW  143



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold1322-size522458-augustus-gene-3.3-mRNA-1

Length=122
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580N6_TRYB2  unnamed protein product                                 98.6    5e-25
Q21555_CAEEL  unnamed protein product                                 65.5    2e-13
D6XD01_TRYB2  unnamed protein product                                 31.6    0.14 


>Q580N6_TRYB2 unnamed protein product
Length=856

 Score = 98.6 bits (244),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 56/77 (73%), Gaps = 0/77 (0%)

Query  3    QVLLLGMGADEQLGGYMRHRTVLRRSGWPGLMAELQLDLSRISARNLGRDDRITADHGRQ  62
            +VLLLGMGADE LGGY RHR    R G  GL+ EL  D SR+  RNLGRDDR+ +D GR+
Sbjct  688  RVLLLGMGADETLGGYTRHRRAFERRGIRGLVGELDHDFSRLWERNLGRDDRVVSDSGRE  747

Query  63   ARYPYLDEDVISFLAAL  79
             RYPYLDE V++ L A+
Sbjct  748  GRYPYLDEGVLAVLGAV  764


>Q21555_CAEEL unnamed protein product
Length=475

 Score = 65.5 bits (158),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 1/76 (1%)

Query  6    LLGMGADEQLGGYMRHRTVLRRSGWPGLMAE-LQLDLSRISARNLGRDDRITADHGRQAR  64
            LLG GADE L GY RHRT   +   P  +AE  + +L R+ +RN GRD R+ A  G+   
Sbjct  331  LLGSGADELLAGYARHRTRFEKEQIPENVAEECENELRRLGSRNGGRDARVAAQLGKTIL  390

Query  65   YPYLDEDVISFLAALP  80
             P L++ V+++L ALP
Sbjct  391  SPLLEDTVVTWLNALP  406


>D6XD01_TRYB2 unnamed protein product
Length=447

 Score = 31.6 bits (70),  Expect = 0.14, Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 19/28 (68%), Gaps = 1/28 (4%)

Query  64   RYP-YLDEDVISFLAALPPWQRCLDACT  90
            RYP Y++ D++S LA+L P  RC   CT
Sbjct  246  RYPGYMNNDLMSMLASLIPTPRCHFVCT  273



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold708-size707887-augustus-gene-4.5-mRNA-1

Length=405
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q382T6_TRYB2  unnamed protein product                                 33.5    0.33 
G5EFE0_CAEEL  unnamed protein product                                 30.8    2.7  
EXC6_CAEEL  unnamed protein product                                   29.3    8.1  


>Q382T6_TRYB2 unnamed protein product
Length=568

 Score = 33.5 bits (75),  Expect = 0.33, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 29/56 (52%), Gaps = 5/56 (9%)

Query  306  ANSRKYEAVNPLESGRLAEGPVEAKLEKMRTAMGSRPEQQE-----VLIQTSTGFF  356
            AN ++ EA+N L   +L  G VEA    +  A+  +P Q E      LI  S+GFF
Sbjct  479  ANPQRAEALNNLAVLQLRAGNVEAAYSDITMALAVQPLQLESLYNAALIAYSSGFF  534


>G5EFE0_CAEEL unnamed protein product
Length=740

 Score = 30.8 bits (68),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (56%), Gaps = 7/54 (13%)

Query  192  DAAPSPPQ-----PPPLPPRQVLQAEWLEKELHKIDREKQRLERERGKFLEREA  240
            D AP+ PQ     P   PP + +  + LE    ++  E++RLE E+ K +ERE+
Sbjct  491  DTAPNTPQSMQRTPKSRPPHRNMSVDNLE--FDRLTLERERLEFEKAKIMERES  542


>EXC6_CAEEL unnamed protein product
Length=843

 Score = 29.3 bits (64),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (53%), Gaps = 5/36 (14%)

Query  290  GPPVPRQRAAGLLDCR-----ANSRKYEAVNPLESG  320
            GP  PR+RAAG+LD R        RK   V  LES 
Sbjct  537  GPESPRKRAAGILDMRQKLGNVRIRKLRDVTTLESS  572



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold4072-size225311-augustus-gene-0.2-mRNA-1

Length=207


***** No hits found *****



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold798-size682270-augustus-gene-1.12-mRNA-1

Length=187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LCP1_DROME  unnamed protein product                                   63.9    3e-13
Q9VTC8_DROME  unnamed protein product                                 62.4    9e-13
LCP2_DROME  unnamed protein product                                   58.5    3e-11


>LCP1_DROME unnamed protein product
Length=130

 Score = 63.9 bits (154),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 14/132 (11%)

Query  50   MMKLVVLFCVLAAALAAPQAPLLKLNPKEPI--PIVAQSSVQNEDGSFQNSYESADGTKV  107
            M K V++  VL  A+A P  P   L   E +   +++QS     DG F +S  +++G + 
Sbjct  1    MFKFVMICAVLGLAVANPPVPH-SLGRSEDVHADVLSQSDDVRADG-FDSSLHTSNGIEQ  58

Query  108  DAAGVQKAVGPKAEAGTAIQGAYSFYI-DNVLYTLTYVADENGFQPQANFLPTPPPIPEK  166
             A+G         +A   I G + +   +     + YVA+ENG+QP   ++PTPPPIPE 
Sbjct  59   AASG---------DAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEA  109

Query  167  ILEALAYNAAHP  178
            I  A+A+  +HP
Sbjct  110  IARAVAWLESHP  121


>Q9VTC8_DROME unnamed protein product
Length=122

 Score = 62.4 bits (150),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 10/88 (11%)

Query  92   DGSFQNSYESADGTKVDAAGVQKAVGPKAEAGTAIQGAYSFYI-DNVLYTLTYVADENGF  150
            DGS+   Y +++G     +GV          G    G+ S+   D     L Y ADENG+
Sbjct  36   DGSYSWEYGTSNGIDAQESGV---------GGVQAAGSVSYAAPDGTPIQLEYTADENGY  86

Query  151  QPQANFLPTPPPIPEKILEALAYNAAHP  178
            +P    LPTPPPIP+ IL+ALAY  AHP
Sbjct  87   RPTGAHLPTPPPIPDYILKALAYIEAHP  114


>LCP2_DROME unnamed protein product
Length=126

 Score = 58.5 bits (140),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 68/130 (52%), Gaps = 14/130 (11%)

Query  50   MMKLVVLFCVLAAALAAPQAPLLKLNPKEPIPIVAQSSVQNEDGSFQNSYESADGTKVDA  109
            M K V++  V+  A A   AP+ + +      ++++S     DG F +S  +++G +  A
Sbjct  1    MFKFVMILAVVGVATAL--APVSRSDDVH-ADVLSRSDDVRADG-FDSSLHTSNGIEQAA  56

Query  110  AGVQKAVGPKAEAGTAIQGAYSFYI-DNVLYTLTYVADENGFQPQANFLPTPPPIPEKIL  168
            +G         +A   I G + +   +     + YVA+ENG+QP   ++PTPPPIPE I 
Sbjct  57   SG---------DAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPPPIPEAIA  107

Query  169  EALAYNAAHP  178
             A+A+  +HP
Sbjct  108  RAVAWLESHP  117



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


Query= maker-scaffold114-size1392915-augustus-gene-8.1-mRNA-1

Length=354
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SYH4_DROME  unnamed protein product                                 107     1e-27
Q9VHG3_DROME  unnamed protein product                                 107     5e-27
RBP2A_PLAF7  unnamed protein product                                  61.6    5e-10


>Q8SYH4_DROME unnamed protein product
Length=178

 Score = 107 bits (266),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)

Query  250  DYKKSACDRERTRMRDMNRAFDLLREKLPVCKPPGKKLSKIESLRLAIRYIRHLQALL  307
            DY+++ACDRERTRMRDMNRAFDLLR KLP+ KP GKK SKIESLR+AI YI HLQA+L
Sbjct  89   DYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAML  146


>Q9VHG3_DROME unnamed protein product
Length=268

 Score = 107 bits (268),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)

Query  250  DYKKSACDRERTRMRDMNRAFDLLREKLPVCKPPGKKLSKIESLRLAIRYIRHLQALL  307
            DY+++ACDRERTRMRDMNRAFDLLR KLP+ KP GKK SKIESLR+AI YI HLQA+L
Sbjct  179  DYRRTACDRERTRMRDMNRAFDLLRSKLPISKPNGKKYSKIESLRIAINYINHLQAML  236


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 40/157 (25%), Positives = 92/157 (59%), Gaps = 14/157 (9%)

Query  29    ERQQMEGLQRERQQMEGQQREGLQREGQQMERQQMREGQQMEGQQMERQQMERQHMVGQQ  88
             +RQ+ E LQ+E ++++ Q++E L+RE Q    +Q+++ ++++ Q+ ER Q E        
Sbjct  2740  KRQEQERLQKE-EELKRQEQERLEREKQ----EQLQKEEELKRQEQERLQKE--------  2786

Query  89    REGQQMEGQQREGQQMEGQQMEGQQMEGQQREGQQMEGQQMEGQQMEGQQMEGQQREGQQ  148
              E  + + Q+R  ++ E ++ E +++E +++E  Q E +    +Q   Q+ E  +R+ Q+
Sbjct  2787  -EALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQE  2845

Query  149   REGLQMEGQQRETQQMEGQQMEGQQRERQQMEGLQRE  185
             R   + E +++E +++E +++E  +RE+     L+ +
Sbjct  2846  RLQKEEELKRQEQERLERKKIELAEREQHIKSKLESD  2882


 Score = 57.0 bits (136),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 38/172 (22%), Positives = 97/172 (56%), Gaps = 15/172 (9%)

Query  31    QQMEGLQRERQQMEGQQREGLQREG------------QQMERQQMREGQQMEGQQMERQQ  78
             Q+ E L+RE+Q+   ++ E  ++E             ++ E++++++ ++++ Q+ ER +
Sbjct  2703  QEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLE  2762

Query  79    MERQHMVGQQREGQQMEG---QQREGQQMEGQQMEGQQMEGQQREGQQMEGQQMEGQQME  135
              E+Q  + ++ E ++ E    Q+ E  + + Q+   ++ E +++E +++E ++ E  Q E
Sbjct  2763  REKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQLQKE  2822

Query  136   GQQMEGQQREGQQREGLQMEGQQRETQQMEGQQMEGQQRERQQMEGLQRERQ  187
              +    +Q   Q+ E L+ + Q+R  ++ E ++ E ++ ER+++E  +RE+ 
Sbjct  2823  EELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAEREQH  2874


 Score = 55.5 bits (132),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 38/161 (24%), Positives = 91/161 (57%), Gaps = 0/161 (0%)

Query  46    QQREGLQREGQQMERQQMREGQQMEGQQMERQQMERQHMVGQQREGQQMEGQQREGQQME  105
             Q++E L+RE Q+  +++    ++ + +Q ++Q+ E      Q+R  ++ E +++E +++E
Sbjct  2703  QEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQEQERLE  2762

Query  106   GQQMEGQQMEGQQREGQQMEGQQMEGQQMEGQQMEGQQREGQQREGLQMEGQQRETQQME  165
              ++ E  Q E + +  +Q   Q+ E  + + Q+   ++ E +++E  ++E +++E  Q E
Sbjct  2763  REKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQLQKE  2822

Query  166   GQQMEGQQRERQQMEGLQRERQQREGQQMERQQMEGETADR  206
              +    +Q   Q+ E L+R+ Q+R  ++ E ++ E E  +R
Sbjct  2823  EELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLER  2863


 Score = 54.7 bits (130),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 39/152 (26%), Positives = 89/152 (59%), Gaps = 13/152 (9%)

Query  10    GLQREGQQMERKQMEGLQR------ERQQMEGLQRERQQMEGQQREGLQREGQQMERQQM  63
              L+R+ Q+  +K+ E L+R      ER++ E LQ+E ++++ Q++E LQ+E     ++Q 
Sbjct  2738  ALKRQEQERLQKEEE-LKRQEQERLEREKQEQLQKE-EELKRQEQERLQKEEALKRQEQE  2795

Query  64    REGQQMEGQQMERQQMERQHMVGQQREGQQMEGQQREGQQMEGQQMEGQQMEGQQREGQQ  123
             R  ++ E ++ E++++ER     +++E  Q E + +  +Q   Q+ E  + + Q+R  ++
Sbjct  2796  RLQKEEELKRQEQERLER-----EKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKE  2850

Query  124   MEGQQMEGQQMEGQQMEGQQREGQQREGLQME  155
              E ++ E +++E +++E  +RE   +  L+ +
Sbjct  2851  EELKRQEQERLERKKIELAEREQHIKSKLESD  2882


 Score = 47.0 bits (110),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 63/100 (63%), Gaps = 12/100 (12%)

Query  2     QMEGLQREGLQREGQQMERKQMEGLQRE----RQQMEGLQRERQ-------QMEGQQREG  50
             +++  ++E LQ+E + ++R++ E LQ+E    RQ+ E L+RE+Q       +++ Q++E 
Sbjct  2774  ELKRQEQERLQKE-EALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQER  2832

Query  51    LQREGQQMERQQMREGQQMEGQQMERQQMERQHMVGQQRE  90
             LQ+E     ++Q R  ++ E ++ E++++ER+ +   +RE
Sbjct  2833  LQKEEALKRQEQERLQKEEELKRQEQERLERKKIELAERE  2872



Lambda      K        H
   0.320    0.135    0.414 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2561588750


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold5832-size145800-augustus-gene-0.9-mRNA-1

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SZM4_DROME  unnamed protein product                                 45.4    1e-04
Q9VPY4_DROME  unnamed protein product                                 45.4    1e-04
TFP11_DROME  unnamed protein product                                  38.9    0.011


>Q8SZM4_DROME unnamed protein product
Length=1004

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 34/64 (53%), Gaps = 5/64 (8%)

Query  470  RMPPTTAAHPVQAAEVGPIPETNVGNQMLRSMGWEPGTGLGASGNGMQEPVAAVVRPKFQ  529
            R   +T+A P       PI  +NVG+++L+ MGW  G GLG    G  + + A  R  + 
Sbjct  920  RQKQSTSATPAM-----PISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNYV  974

Query  530  GLGH  533
            GLG+
Sbjct  975  GLGN  978


>Q9VPY4_DROME unnamed protein product
Length=1004

 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 34/64 (53%), Gaps = 5/64 (8%)

Query  470  RMPPTTAAHPVQAAEVGPIPETNVGNQMLRSMGWEPGTGLGASGNGMQEPVAAVVRPKFQ  529
            R   +T+A P       PI  +NVG+++L+ MGW  G GLG    G  + + A  R  + 
Sbjct  920  RQKQSTSATPAM-----PISSSNVGSRLLQKMGWSEGQGLGRKNQGRTQIIEADGRSNYV  974

Query  530  GLGH  533
            GLG+
Sbjct  975  GLGN  978


>TFP11_DROME unnamed protein product
Length=839

 Score = 38.9 bits (89),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (49%), Gaps = 5/72 (7%)

Query  469  RRMPPTTAAHPVQAA---EVGPIPETN--VGNQMLRSMGWEPGTGLGASGNGMQEPVAAV  523
            R+ P TT  H    A    VG   +    +G ++L  MG+EPG GLG    G+  PV A 
Sbjct  141  RKQPSTTFQHRSHIASERNVGAWEQHTRGIGAKLLLQMGYEPGKGLGKDLQGISHPVQAH  200

Query  524  VRPKFQGLGHHG  535
            VR     +G +G
Sbjct  201  VRKGRGAIGAYG  212



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold2796-size318026-augustus-gene-1.1-mRNA-1

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T6I0_DROME  unnamed protein product                                 905     0.0  
Q8IGN0_DROME  unnamed protein product                                 905     0.0  
Q8T8W3_DROME  unnamed protein product                                 900     0.0  


>Q8T6I0_DROME unnamed protein product
Length=534

 Score = 905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/534 (81%), Positives = 488/534 (91%), Gaps = 3/534 (1%)

Query  1    MFSWINKNENKKAPELYENVVEGLKTIYRTKLLPLEQHYQFHDFHSPQLDDPDFDAKPMI  60
            MFS++ + +N +  E+ ENV+  LK IYR+KLLPLE+HYQFHDFHSP+L+DPDFDAKPMI
Sbjct  1    MFSFLKREKNTQ--EVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMI  58

Query  61   LLVGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDRFIAVMYEEKEGVIPGNALVVDPKRQ  120
            LLVGQYSTGKTTFIRYLLE+DFPGIRIGPEPTTDRFIAVMY++KEGVIPGNALVVDPK+Q
Sbjct  59   LLVGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVIPGNALVVDPKKQ  118

Query  121  FRPLTKFGNAFLNRFQCSTVNTPVLKGISIVDTPGILSGEKQRVDRGYDFTGVLEWFAER  180
            FRPL+K+GNAFLNRFQCS+V +PVL  ISIVDTPGILSGEKQR+DRGYDFTGVLEWFAER
Sbjct  119  FRPLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAER  178

Query  181  VDRIILLFDAHKLDISDEFRRSIEALRGHDDKIRIVLNKADMVDHQQLMRVYGALMWSLG  240
            VDRIILLFDAHKLDISDEFRRSIEAL+GHDDKIRI+LNKADM+DHQQLMRVYGALMWSLG
Sbjct  179  VDRIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLG  238

Query  241  KVLQTPEVARVYIGSFWDQPLRYDVNRRLFEDEEQDLFKDLQSLPRNAALRKLNDLIKRA  300
            KVLQTPEVARVYIGSFWDQPLR+D NRRLFEDEEQDLF+DLQSLPRNAALRKLNDLIKRA
Sbjct  239  KVLQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRA  298

Query  301  RLAKVHAYIISALRKDMPSVFGKDGKKKELIKNLGQIYDQIQREHQISPGDFPDIKKMQE  360
            RLAKVHA+II+ LRKDMPSVFGKD KKK+LIKNLGQ+YD+IQREH ISPGDFPDIKKMQE
Sbjct  299  RLAKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQE  358

Query  361  LLVHHDFTKFHPLKPRLLEIVDKMLAEDIAHLMAMIPHEEITTTTEPRIKGGAFEGVTDT  420
            +L H DFTKFH LKP LL+IVD MLA+DIA LM MIP EE+T   +P +KGGAFEGV D 
Sbjct  359  VLQHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEEMTMVADPIVKGGAFEGVIDD  418

Query  421  -ISPFGYKRGEGIDAGSGEPEWIVNKERYKYDAMFDTLGPVDGKVTGAAAKSEMVKSKLP  479
             +SPFGY +GEGIDAG GE EWI NK++ + D +F+ LGPVDGK++GA AK E++KSKLP
Sbjct  419  HVSPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLP  478

Query  480  NSVLGKIWKLSDVDKDGLLDADEFALAMHLISIKIDGHDLPSELPDHLVPPSKR  533
            NSVL KIWKLSDVD DG LD+DEFALA+HLI++K++G +LP+ LP+HLVPPSKR
Sbjct  479  NSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR  532


>Q8IGN0_DROME unnamed protein product
Length=534

 Score = 905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/534 (81%), Positives = 488/534 (91%), Gaps = 3/534 (1%)

Query  1    MFSWINKNENKKAPELYENVVEGLKTIYRTKLLPLEQHYQFHDFHSPQLDDPDFDAKPMI  60
            MFS++ + +N +  E+ ENV+  LK IYR+KLLPLE+HYQFHDFHSP+L+DPDFDAKPMI
Sbjct  1    MFSFLKREKNTQ--EVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMI  58

Query  61   LLVGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDRFIAVMYEEKEGVIPGNALVVDPKRQ  120
            LLVGQYSTGKTTFIRYLLE+DFPGIRIGPEPTTDRFIAVMY++KEGV+PGNALVVDPK+Q
Sbjct  59   LLVGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVVPGNALVVDPKKQ  118

Query  121  FRPLTKFGNAFLNRFQCSTVNTPVLKGISIVDTPGILSGEKQRVDRGYDFTGVLEWFAER  180
            FRPL+K+GNAFLNRFQCS+V +PVL  ISIVDTPGILSGEKQR+DRGYDFTGVLEWFAER
Sbjct  119  FRPLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAER  178

Query  181  VDRIILLFDAHKLDISDEFRRSIEALRGHDDKIRIVLNKADMVDHQQLMRVYGALMWSLG  240
            VDRIILLFDAHKLDISDEFRRSIEAL+GHDDKIRI+LNKADM+DHQQLMRVYGALMWSLG
Sbjct  179  VDRIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLG  238

Query  241  KVLQTPEVARVYIGSFWDQPLRYDVNRRLFEDEEQDLFKDLQSLPRNAALRKLNDLIKRA  300
            KVLQTPEVARVYIGSFWDQPLR+D NRRLFEDEEQDLF+DLQSLPRNAALRKLNDLIKRA
Sbjct  239  KVLQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRA  298

Query  301  RLAKVHAYIISALRKDMPSVFGKDGKKKELIKNLGQIYDQIQREHQISPGDFPDIKKMQE  360
            RLAKVHA+II+ LRKDMPSVFGKD KKK+LIKNLGQ+YD+IQREH ISPGDFPDIKKMQE
Sbjct  299  RLAKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQE  358

Query  361  LLVHHDFTKFHPLKPRLLEIVDKMLAEDIAHLMAMIPHEEITTTTEPRIKGGAFEGVTDT  420
            +L H DFTKFH LKP LL+IVD MLA+DIA LM MIP EE+T   +P +KGGAFEGV D 
Sbjct  359  VLQHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEEMTMVADPMVKGGAFEGVIDD  418

Query  421  -ISPFGYKRGEGIDAGSGEPEWIVNKERYKYDAMFDTLGPVDGKVTGAAAKSEMVKSKLP  479
             +SPFGY +GEGIDAG GE EWI NK++ + D +F+ LGPVDGK++GA AK E++KSKLP
Sbjct  419  HVSPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLP  478

Query  480  NSVLGKIWKLSDVDKDGLLDADEFALAMHLISIKIDGHDLPSELPDHLVPPSKR  533
            NSVL KIWKLSDVD DG LD+DEFALA+HLI++K++G +LP+ LP+HLVPPSKR
Sbjct  479  NSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR  532


>Q8T8W3_DROME unnamed protein product
Length=540

 Score = 900 bits (2325),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/532 (81%), Positives = 486/532 (91%), Gaps = 3/532 (1%)

Query  3    SWINKNENKKAPELYENVVEGLKTIYRTKLLPLEQHYQFHDFHSPQLDDPDFDAKPMILL  62
            S++ + +N +  E+ ENV+  LK IYR+KLLPLE+HYQFHDFHSP+L+DPDFDAKPMILL
Sbjct  9    SFLKREKNTQ--EVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMILL  66

Query  63   VGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDRFIAVMYEEKEGVIPGNALVVDPKRQFR  122
            VGQYSTGKTTFIRYLLE+DFPGIRIGPEPTTDRFIAVMY++KEGVIPGNALVVDPK+QFR
Sbjct  67   VGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVIPGNALVVDPKKQFR  126

Query  123  PLTKFGNAFLNRFQCSTVNTPVLKGISIVDTPGILSGEKQRVDRGYDFTGVLEWFAERVD  182
            PL+K+GNAFLNRFQCS+V +PVL  ISIVDTPGILSGEKQR+DRGYDFTGVLEWFAERVD
Sbjct  127  PLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVD  186

Query  183  RIILLFDAHKLDISDEFRRSIEALRGHDDKIRIVLNKADMVDHQQLMRVYGALMWSLGKV  242
            RIILLFDAHKLDISDEFRRSIEAL+GHDDKIRI+LNKADM+DHQQLMRVYGALMWSLGKV
Sbjct  187  RIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLGKV  246

Query  243  LQTPEVARVYIGSFWDQPLRYDVNRRLFEDEEQDLFKDLQSLPRNAALRKLNDLIKRARL  302
            LQTPEVARVYIGSFWDQPLR+D NRRLFEDEEQDLF+DLQSLPRNAALRKLNDLIKRARL
Sbjct  247  LQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRARL  306

Query  303  AKVHAYIISALRKDMPSVFGKDGKKKELIKNLGQIYDQIQREHQISPGDFPDIKKMQELL  362
            AKVHA+II+ LRKDMPSVFGKD KKK+LIKNLGQ+YD+IQREH ISPGDFPDIKKMQE+L
Sbjct  307  AKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQEVL  366

Query  363  VHHDFTKFHPLKPRLLEIVDKMLAEDIAHLMAMIPHEEITTTTEPRIKGGAFEGVTDT-I  421
             H DFTKFH LKP LL+IVD MLA+DIA LM MIP EE+T   +P +KGGAFEGV D  +
Sbjct  367  QHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEEMTMVADPIVKGGAFEGVIDDHV  426

Query  422  SPFGYKRGEGIDAGSGEPEWIVNKERYKYDAMFDTLGPVDGKVTGAAAKSEMVKSKLPNS  481
            SPFGY +GEGIDAG GE EWI NK++ + D +F+ LGPVDGK++GA AK E++KSKLPNS
Sbjct  427  SPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLPNS  486

Query  482  VLGKIWKLSDVDKDGLLDADEFALAMHLISIKIDGHDLPSELPDHLVPPSKR  533
            VL KIWKLSDVD DG LD+DEFALA+HLI++K++G +LP+ LP+HLVPPSKR
Sbjct  487  VLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR  538



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold415-size1042365-augustus-gene-6.4-mRNA-1

Length=371
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q86PE8_DROME  unnamed protein product                                 184     1e-54
Q9VL01_DROME  unnamed protein product                                 184     2e-54
Q95RS6_DROME  unnamed protein product                                 173     6e-50


>Q86PE8_DROME unnamed protein product
Length=406

 Score = 184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 173/365 (47%), Gaps = 45/365 (12%)

Query  32   DSDGSVVTRTGSGGGLTKCACRPLASCPP-----TSQGHTDGTHLIDVRIVSNFSTSKQC  86
            DS GS  ++ G        +C     C P         +T G  +ID+R+     T  +C
Sbjct  51   DSSGSTGSQNGGSSSTQYQSCGDQKECVPRWLCANDTINTSGDGIIDIRL----GTDAEC  106

Query  87   PPGSAFCC------------VDEQQACGCGTRKPQCLPGVRLEPG---QACFAKYPWVGM  131
                  CC                   GCG + P  + G ++      +A F ++PW+  
Sbjct  107  KNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGV-GFKITGAVNQEAEFGEFPWMLA  165

Query  132  VLDDS---NKYVGGAVLVGPKHLLTAAHKVAPYVSRFDIRNLWATSKRLKVRLGEWNTRS  188
            +L +    N Y  G  L+ P  +LTAAH V          N   +S  + VR GEW+T++
Sbjct  166  ILREEGNLNLYECGGALIAPNVVLTAAHCV---------HNKQPSS--IVVRAGEWDTQT  214

Query  189  TAEPYPFVEVNVVGLVIHPHFNPTDLNNDIAVITLKDPVPAGQFPHISAACLPEPRRDFT  248
              E     +  V  ++ H  FN   L ND+AV+ L+ P    +  +I   CLP     F 
Sbjct  215  QTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQE--NIQTVCLPNVGDKFD  272

Query  249  NQRCWVAGWGKNAFGPQGSYQNTQRETAVPILSGAACEQQLRSTRLGQSYKLNRTSFLCA  308
              RC+  GWGKN FG  G YQ   ++  +P++    CE  LR TRLG+ + L+  SF+CA
Sbjct  273  FDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH-DSFICA  331

Query  309  GGEPGQDACTGDGGSPLVCESGG---LFTLAGLVSWGIGCAERGIPGVYVNVPSYKEWVS  365
            GGE  +D C GDGGSPLVC   G    F  AG+V+WGIGC E  IPGVY +V   + W+ 
Sbjct  332  GGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID  391

Query  366  KQIHV  370
             ++ +
Sbjct  392  AKLKI  396


>Q9VL01_DROME unnamed protein product
Length=406

 Score = 184 bits (468),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 172/365 (47%), Gaps = 45/365 (12%)

Query  32   DSDGSVVTRTGSGGGLTKCACRPLASCPP-----TSQGHTDGTHLIDVRIVSNFSTSKQC  86
            DS GS  +  G        +C     C P         +T G  +ID+R+     T  +C
Sbjct  51   DSSGSTGSENGGSSSTQYQSCGDQKECVPRWLCANDTINTSGDGIIDIRL----GTDAEC  106

Query  87   PPGSAFCC------------VDEQQACGCGTRKPQCLPGVRLEPG---QACFAKYPWVGM  131
                  CC                   GCG + P  + G ++      +A F ++PW+  
Sbjct  107  KNYLDLCCDLPNKRKDPIFEFKPDHPEGCGYQNPNGV-GFKITGAVNQEAEFGEFPWMLA  165

Query  132  VLDDS---NKYVGGAVLVGPKHLLTAAHKVAPYVSRFDIRNLWATSKRLKVRLGEWNTRS  188
            +L +    N Y  G  L+ P  +LTAAH V          N   +S  + VR GEW+T++
Sbjct  166  ILREEGNLNLYECGGALIAPNVVLTAAHCV---------HNKQPSS--IVVRAGEWDTQT  214

Query  189  TAEPYPFVEVNVVGLVIHPHFNPTDLNNDIAVITLKDPVPAGQFPHISAACLPEPRRDFT  248
              E     +  V  ++ H  FN   L ND+AV+ L+ P    +  +I   CLP     F 
Sbjct  215  QTEIRRHEDRYVKEIIYHEQFNKGSLYNDVAVMLLESPFTLQE--NIQTVCLPNVGDKFD  272

Query  249  NQRCWVAGWGKNAFGPQGSYQNTQRETAVPILSGAACEQQLRSTRLGQSYKLNRTSFLCA  308
              RC+  GWGKN FG  G YQ   ++  +P++    CE  LR TRLG+ + L+  SF+CA
Sbjct  273  FDRCYATGWGKNKFGKDGEYQVILKKVDMPVVPEQQCETNLRETRLGRHFILH-DSFICA  331

Query  309  GGEPGQDACTGDGGSPLVCESGG---LFTLAGLVSWGIGCAERGIPGVYVNVPSYKEWVS  365
            GGE  +D C GDGGSPLVC   G    F  AG+V+WGIGC E  IPGVY +V   + W+ 
Sbjct  332  GGEKDKDTCKGDGGSPLVCPIAGQKNRFKSAGIVAWGIGCGEVNIPGVYASVAKLRPWID  391

Query  366  KQIHV  370
             ++ +
Sbjct  392  AKLKI  396


>Q95RS6_DROME unnamed protein product
Length=421

 Score = 173 bits (438),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 113/358 (32%), Positives = 170/358 (47%), Gaps = 49/358 (14%)

Query  41   TGSGGGLTKCACRPLASCPPTSQGHT-----DGTHLIDVRIVSNFSTSKQCPPGSAFCC-  94
            T + G    C C P   C P+++  T     DG  +ID+R   +      CP     CC 
Sbjct  71   TSTSGKTATCNCVPYYKCDPSTKSFTEDGSFDGFGVIDIRFNDD---DPICPASVDVCCD  127

Query  95   -------------VDEQ--QACGCGTRKPQCLPGVR--LEPGQACFAKYPWVGMVLDDSN  137
                         +D++  Q  GCG R    L      +   +A F ++PW   +L   N
Sbjct  128  ANRTLNKTLNPTPLDQRPNQPRGCGVRNTGGLDFTLSGVSQNEAGFGEFPWTVALLHSGN  187

Query  138  -KYVGGAVLVGPKHLLTAAHKVAPYVSRFDIRNLWATSKRLKVRLGEWNTRSTAEPYPFV  196
              Y     L+  + +LTAAH V               +    VR GEW+T++  E  P+ 
Sbjct  188  LSYFCAGSLIHKQVVLTAAHCVESL-----------RTGSFTVRAGEWDTQTMKERLPYQ  236

Query  197  EVNVVGLVIHPHFNPTDLNNDIAVITLKDPVPAGQFPHISAACLPEPRRDFTN--QRCWV  254
            E +V  +++HP +N   +  D A++ L  PV      HI+  CLP+ + D       C+ 
Sbjct  237  ERSVQTVILHPDYNRRSIAYDFALVILSQPVTLDD--HINVICLPQ-QDDIPQPGNTCFS  293

Query  255  AGWGKNAFGPQGSYQNTQRETAVPILSGAACEQQLRSTRLGQSYKLNRTSFLCAGGEPGQ  314
             GWGK+AFG  G Y +  +   +PI+   +C+ +LR TRLG  + L+R SF+CAGG+ G 
Sbjct  294  TGWGKDAFGSLGKYSSLMKRVPLPIVEFNSCQTRLRGTRLGPKFALDR-SFICAGGQRGI  352

Query  315  DACTGDGGSPLVCESGGL----FTLAGLVSWGIGCAERGIPGVYVNVPSYKEWVSKQI  368
            D C GDGG+PL C  G      +   G+V+WGIGC +  +P  Y NV   + W+ +Q+
Sbjct  353  DTCQGDGGAPLACPRGSTRESRYQQTGIVAWGIGCNDE-VPAAYANVALVRGWIDQQM  409



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold1069-size578407-augustus-gene-3.5-mRNA-1

Length=294
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SY36_DROME  unnamed protein product                                 220     5e-65
Q8IRG8_DROME  unnamed protein product                                 220     7e-65
Q8IRG9_DROME  unnamed protein product                                 220     8e-65


>Q8SY36_DROME unnamed protein product
Length=1177

 Score = 220 bits (561),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 165/284 (58%), Gaps = 36/284 (13%)

Query  1     LYKHSHLETDINNKSDRIEWGHARYQTLYKPNRAYELVVQWVASSGTIVADLIMGWARKA  60
             +Y+ SHLE D+N KSDR+EWGH ++ T+ +P  A+E+VV+WV SSG IVADLI GW RKA
Sbjct  902   VYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKA  961

Query  61    QTCGLQVIPIPADPLALPFTHKSDPLRGPIFIPLDTECLMDSRSYLFEMFTEESWEQRLF  120
                   ++ +PADP+A PFT KSDPLRGPIFIPL T  L +  + LF+ F EES   R+ 
Sbjct  962   NQFNF-LVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA-LFDEFPEESRSDRML  1019

Query  121   CLQEAILERFGFLRCVVENSGPSPVTHMGMHHEQYVHLTGVMFVLIPSCLCRREQRSGSS  180
               QEAIL +FGFL CV+E      V        QYVH TG MF LI  C           
Sbjct  1020  FFQEAILGKFGFLPCVLEKK--YSVGKDLPKEYQYVHCTGNMFALI-RC-----------  1065

Query  181   GSRPGLASRQLGIQGARRYPVHSDALSSPHEEYITRHVSGKNKGDYSTERRMGFLWSWNH  240
                               Y V S  L    E  +TR V G +  + +  +++GFLW+WNH
Sbjct  1066  --------------ATNNYQVESPILK---EANVTRCVYG-HTNNTNVPKKVGFLWAWNH  1107

Query  241   ML-SRRWRSSTTPATGD-EGFQAKVLGNFRHFCANDDNRLRHFW  282
             M+ +++W++ T   + D E FQ K+L +FR FC+N D RL  FW
Sbjct  1108  MIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW  1151


>Q8IRG8_DROME unnamed protein product
Length=1472

 Score = 220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 165/284 (58%), Gaps = 36/284 (13%)

Query  1     LYKHSHLETDINNKSDRIEWGHARYQTLYKPNRAYELVVQWVASSGTIVADLIMGWARKA  60
             +Y+ SHLE D+N KSDR+EWGH ++ T+ +P  A+E+VV+WV SSG IVADLI GW RKA
Sbjct  1197  VYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKA  1256

Query  61    QTCGLQVIPIPADPLALPFTHKSDPLRGPIFIPLDTECLMDSRSYLFEMFTEESWEQRLF  120
                   ++ +PADP+A PFT KSDPLRGPIFIPL T  L +  + LF+ F EES   R+ 
Sbjct  1257  NQFNF-LVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA-LFDEFPEESRSDRML  1314

Query  121   CLQEAILERFGFLRCVVENSGPSPVTHMGMHHEQYVHLTGVMFVLIPSCLCRREQRSGSS  180
               QEAIL +FGFL CV+E      V        QYVH TG MF LI  C           
Sbjct  1315  FFQEAILGKFGFLPCVLEKK--YSVGKDLPKEYQYVHCTGNMFALI-RC-----------  1360

Query  181   GSRPGLASRQLGIQGARRYPVHSDALSSPHEEYITRHVSGKNKGDYSTERRMGFLWSWNH  240
                               Y V S  L    E  +TR V G +  + +  +++GFLW+WNH
Sbjct  1361  --------------ATNNYQVESPILK---EANVTRCVYG-HTNNTNVPKKVGFLWAWNH  1402

Query  241   ML-SRRWRSSTTPATGD-EGFQAKVLGNFRHFCANDDNRLRHFW  282
             M+ +++W++ T   + D E FQ K+L +FR FC+N D RL  FW
Sbjct  1403  MIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW  1446


>Q8IRG9_DROME unnamed protein product
Length=1471

 Score = 220 bits (561),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 126/284 (44%), Positives = 165/284 (58%), Gaps = 36/284 (13%)

Query  1     LYKHSHLETDINNKSDRIEWGHARYQTLYKPNRAYELVVQWVASSGTIVADLIMGWARKA  60
             +Y+ SHLE D+N KSDR+EWGH ++ T+ +P  A+E+VV+WV SSG IVADLI GW RKA
Sbjct  1196  VYRQSHLEIDVNQKSDRMEWGHVKHHTVLQPRFAFEIVVEWVTSSGPIVADLIGGWMRKA  1255

Query  61    QTCGLQVIPIPADPLALPFTHKSDPLRGPIFIPLDTECLMDSRSYLFEMFTEESWEQRLF  120
                   ++ +PADP+A PFT KSDPLRGPIFIPL T  L +  + LF+ F EES   R+ 
Sbjct  1256  NQFNF-LVSVPADPMAEPFTKKSDPLRGPIFIPLCTTFLPNGAA-LFDEFPEESRSDRML  1313

Query  121   CLQEAILERFGFLRCVVENSGPSPVTHMGMHHEQYVHLTGVMFVLIPSCLCRREQRSGSS  180
               QEAIL +FGFL CV+E      V        QYVH TG MF LI  C           
Sbjct  1314  FFQEAILGKFGFLPCVLEKK--YSVGKDLPKEYQYVHCTGNMFALI-RC-----------  1359

Query  181   GSRPGLASRQLGIQGARRYPVHSDALSSPHEEYITRHVSGKNKGDYSTERRMGFLWSWNH  240
                               Y V S  L    E  +TR V G +  + +  +++GFLW+WNH
Sbjct  1360  --------------ATNNYQVESPILK---EANVTRCVYG-HTNNTNVPKKVGFLWAWNH  1401

Query  241   ML-SRRWRSSTTPATGD-EGFQAKVLGNFRHFCANDDNRLRHFW  282
             M+ +++W++ T   + D E FQ K+L +FR FC+N D RL  FW
Sbjct  1402  MIPNKKWKAQTINNSADGELFQLKMLKDFREFCSNSDQRLSTFW  1445



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold1686-size463981-augustus-gene-3.12-mRNA-1

Length=205
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRN6_DROME  unnamed protein product                                 76.6    3e-16
SEP1_CAEEL  unnamed protein product                                   68.9    2e-13
Q38BR4_TRYB2  unnamed protein product                                 28.1    5.2  


>Q9VRN6_DROME unnamed protein product
Length=634

 Score = 76.6 bits (187),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (49%), Gaps = 3/141 (2%)

Query  4    LKRLPWENISVLKGHPVTRMHSLHFLHAMYKVYEQRIAGGVLEGVDPDKGHYIVNPDKNL  63
            L  L WE +  ++    +R+ SLH L  +++ ++  I  G     +  +G  ++NPD +L
Sbjct  369  LDHLHWEQLVTVQ--EFSRVKSLHCLWRLFQNHKSNIKHGYY-TTNIKRGMCVINPDADL  425

Query  64   PNMEERIKLAATSRFPAWQGTFGIKPTPEQFGHALQDSDIFVYCGHGSGTQFLGSRQIQK  123
             N   R++         WQ  F   P  E        +D FVY GHGSG Q++  R I +
Sbjct  426  VNSGRRLRSFFEYWLSQWQHLFETVPNEEVMVKQALQADCFVYAGHGSGLQYVNGRIICR  485

Query  124  LQVNAVALLFGCNSTGLTSFG  144
             +V +V  LFGC+ST +   G
Sbjct  486  ARVRSVVFLFGCDSTRMLGTG  506


>SEP1_CAEEL unnamed protein product
Length=1262

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 104/229 (45%), Gaps = 38/229 (17%)

Query  4     LKRLPWENISVLKGHP-VTRMHSLHFLHAMYKVYEQRIAGGVLEGVDPDKGHYIVNPDKN  62
             L +  WE + +   +P V R  S+H   +  +  + +     L+ +D    +YI++PD N
Sbjct  911   LSQFCWERLPIFDEYPYVGRQVSIHSTFSQLEAMKSQEKQIPLQ-IDVQNAYYILDPDNN  969

Query  63    LPNMEERIKLAATSRFPAWQGTFGIKPTPEQFGHALQDSDIFVYCGHGSGTQFLGSRQIQ  122
             L   ++R+ +   ++F  W+GT G  P   +   AL   D F + GHGSG+  +    ++
Sbjct  970   LGETQKRM-VEYINKF-NWEGTVGSAPKSNEISAALSQRDAFFFIGHGSGSSVMPRSVLK  1027

Query  123   KLQVNAVALLFGCNSTGLT----SFGAR--VETWSTAQC-----------------YMMS  159
             +   NA++LL GC S         F  +  +  ++ A+C                 +++ 
Sbjct  1028  QSTCNAISLLMGCGSVRTIPQALGFDGKTAILDYAMAKCPLIVGCLWTVTDGEIDRFLIR  1087

Query  160   CSPDWQQEPK----------LLEALNCGRAITKL-FMTYASVVAIGLPV  197
                D  ++ K          L EA++  R+  +L ++T A+VV  GLPV
Sbjct  1088  MIDDCFEDSKSLTGIDKLRQLSEAMHEARSKARLKYLTGAAVVMYGLPV  1136


>Q38BR4_TRYB2 unnamed protein product
Length=349

 Score = 28.1 bits (61),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (55%), Gaps = 3/62 (5%)

Query  11   NISVLKGHPVTRMHSLHFLHAMYKVYEQRIAGGVLEGVDPDKGHYIVNPDKNLPNMEERI  70
            NI +L  + V R H L  +    +V E+ +  GV+ GV  D+G +++  +++   + E +
Sbjct  272  NILIL--NDVARTHGLS-VEVTVQVIEKLLEDGVISGVFDDRGKFVMLSEEHYKQIAEFV  328

Query  71   KL  72
            KL
Sbjct  329  KL  330



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold6484-size121480-augustus-gene-0.4-mRNA-1

Length=326
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQK1_DROME  unnamed protein product                                 254     6e-80
Q95SC8_DROME  unnamed protein product                                 231     4e-71
PICC1_CAEEL  unnamed protein product                                  111     3e-27


>Q9VQK1_DROME unnamed protein product
Length=607

 Score = 254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 152/300 (51%), Positives = 178/300 (59%), Gaps = 64/300 (21%)

Query  75   EANQRLGDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVSAYQSKLRELD  134
            E NQRL DDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEV+AYQ+KLR+LD
Sbjct  305  EQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLD  364

Query  135  NKQQELIKDNMELKELCLYLDEERSQ---NAVCPACGSGLRPGPRDDGDGSSSSTNADEP  191
            +KQQELI DN+ELKELCLYLDEER+    NA+C  CG+  R   RDDGDGSSSSTNADE 
Sbjct  365  DKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATRNALRDDGDGSSSSTNADE-  423

Query  192  SLPAQFNHRRTESRERLLEESIQRQRTGFNDQMMMYVRSLEQRVKQLEEEKLALQQKLGQ  251
                     R  + +R L + ++   T  NDQ + YVRSLE+R++QLEEE+      L Q
Sbjct  424  ----TITALRNYAEQRQLPQDLRHAHT-LNDQTLQYVRSLERRIQQLEEERTTPTAHLQQ  478

Query  252  TVSGDVNGSWESESPTGARP----------------------------------------  271
              +     +      + A P                                        
Sbjct  479  PTTPTPQATPTPTVTSAATPAKSAASPHQQQQQQQQHQQQQQDIVAAAAAAAAAIQLPEP  538

Query  272  -----EAVVQALQVLEVREKLERGVRDSSSTAGPGLEPDLDMAAAGLDDGEKALVREMCN  326
                 EAVV+ALQVLEVRE+LER      + AG  L+         +DDGEKALVREMCN
Sbjct  539  IAGRPEAVVRALQVLEVREQLERD--RLGNLAGSALD--------QMDDGEKALVREMCN  588


>Q95SC8_DROME unnamed protein product
Length=607

 Score = 231 bits (590),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 134/171 (78%), Gaps = 9/171 (5%)

Query  75   EANQRLGDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVSAYQSKLRELD  134
            E NQRL DDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEV+AYQ+KLR+LD
Sbjct  303  EQNQRLLDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVAAYQNKLRQLD  362

Query  135  NKQQELIKDNMELKELCLYLDEERSQ---NAVCPACGSGLRPGPRDDGDGSSSSTNADEP  191
            +KQQELI DN+ELKELCLYLDEER+    NA+C  CG+  R   RDDGDGSSSSTNADE 
Sbjct  363  DKQQELITDNLELKELCLYLDEERAHVAANALCAGCGAATRNALRDDGDGSSSSTNADE-  421

Query  192  SLPAQFNHRRTESRERLLEESIQRQRTGFNDQMMMYVRSLEQRVKQLEEEK  242
                     R  + +R L + ++   T  NDQ + YVRSLE+R++QLEEE+
Sbjct  422  ----TITALRNYAEQRQLPQDLRHAHT-LNDQTLQYVRSLERRIQQLEEER  467


 Score = 59.7 bits (143),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 40/61 (66%), Gaps = 10/61 (16%)

Query  266  PTGARPEAVVQALQVLEVREKLERGVRDSSSTAGPGLEPDLDMAAAGLDDGEKALVREMC  325
            P   RPEAVV+ALQVLEVRE+LER      + AG  L+         +DDGEKALVREMC
Sbjct  538  PIAGRPEAVVRALQVLEVREQLERD--RLGNLAGSALD--------QMDDGEKALVREMC  587

Query  326  N  326
            N
Sbjct  588  N  588


>PICC1_CAEEL unnamed protein product
Length=535

 Score = 111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 97/183 (53%), Gaps = 18/183 (10%)

Query  75   EANQRLGDDNQELRDLCCFLDDDRQKGRKLAREWQRFGRYTASVMRQEVSAYQSKLRELD  134
            E N++L   N+ELRDL CFLDDDRQK RKLAREWQ+FGRYT+S+M+QEV +Y  K+  ++
Sbjct  156  EDNRKLAISNKELRDLSCFLDDDRQKTRKLAREWQKFGRYTSSLMKQEVDSYHQKMVSIE  215

Query  135  NKQQELIKDNMELKELCLYLDEERSQNAVCPACGSGLRPGPRDDGDGSSSSTNADEPSLP  194
             K     ++  EL++LC+YLDE+R       A          D G GSS  +   E    
Sbjct  216  EKLCTKEREVDELRQLCMYLDEQRQSLMSNAAANVDCDNESEDLGCGSSEQSGGSEGHND  275

Query  195  AQFNHRRTESRERLLEESIQR------------------QRTGFNDQMMMYVRSLEQRVK  236
             + +H   +   +  E +++R                         +++ Y++SLE R+K
Sbjct  276  EEKHHEFNKCFNKHKESTLRRIMATSMCSEPSEEEERREVSKRERSRLLGYIQSLENRIK  335

Query  237  QLE  239
             LE
Sbjct  336  HLE  338


 Score = 31.6 bits (70),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 50/115 (43%), Gaps = 12/115 (10%)

Query  49   LAASKNGKAYPDG-LKAEAAKRYPQSVEANQRLGDDN----QELRDLCCFLDDDRQKGRK  103
            +  SKN  A P   L  +    Y   V  NQ     +    + +R  C  LDD+ QK  +
Sbjct  72   VVVSKNSIATPSSSLTPQGTPSYAVPVSRNQMQYSASKLQYEHMRHRCKMLDDENQKLMR  131

Query  104  LAREWQRFGRYTASVMRQEVSAYQSKLRELDNKQQELIKDNMELKELCLYLDEER  158
            +  +         +   + V  + +++R L    ++L   N EL++L  +LD++R
Sbjct  132  MQSD-------VVNDANRRVQMHVNEIRMLKEDNRKLAISNKELRDLSCFLDDDR  179



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold173-size1403081-augustus-gene-10.2-mRNA-1

Length=667
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMY3_DROME  unnamed protein product                                 258     1e-77
Q9VCJ4_DROME  unnamed protein product                                 249     2e-74
B5TRE1_CAEEL  unnamed protein product                                 31.6    3.0  


>Q8IMY3_DROME unnamed protein product
Length=566

 Score = 258 bits (660),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/531 (31%), Positives = 256/531 (48%), Gaps = 49/531 (9%)

Query  182  VCVCNATYCDTVVPTTAAHLAAGGVRHYSSTKAGKRLELS---ITRFYP-----------  227
            VCVCN+TYCD + P     ++   V   SS+K G R + +   +++  P           
Sbjct  39   VCVCNSTYCDYLEPPQLTDISQIVV--ISSSKDGLRFKKTTGDLSKKKPITIDDKQFTDE  96

Query  228  --------TPRERVLKRKPVVRAAFMLNQG-----------QRYQQILGFGGAATDAATI  268
                      +ER   +   +  +  +N             Q +Q +  FGGA T   + 
Sbjct  97   NFKADAIVVDQERAWLQLANIPQSLFINASIKTYRIFVKREQSFQNVSIFGGAFTGTVSY  156

Query  269  NTYSLSARVAEKLMRSYFGKEGIGYTLVRVPVGSSDFSAHYYGYTDDHPEDLTLHNFN-L  327
                L   + + + RSYF   GI Y  +R+ +G SDF    + Y +    D  L NF  L
Sbjct  157  LLKELPVELQDHVYRSYFHPVGIAYNTIRMSIGGSDFDMEPWAYNELPLHDPKLSNFTEL  216

Query  328  STEDFQYKIPFIKRAKQLSPY-PVRLISTPWSAPDWMKAIDPETNVNWLRKDLFKVYADL  386
               D Q K+  +KR K +     ++++   WSAP WMK+ +  T    L+ + ++ +A  
Sbjct  217  DPRDLQ-KVEQLKRLKIIGKVDSLKIMGAAWSAPTWMKSNNRWTGFGQLKSEYYQTWALY  275

Query  387  YVRFLDGYAAQGLDFWGLTPQNEPSEGIATG---KFNKMGWTTEDMVTFLTRDFCPLLKE  443
            +++FL+   ++ +  W ++  NEP  G+       F  MGWT      +L  +  P ++ 
Sbjct  276  HLKFLELMRSKNMPIWAISTGNEPLNGVIGFFFVHFMSMGWTPWQQAIWLNDNLGPTIRN  335

Query  444  RGHGGVKVMINDDQRRDVAEWLKTY--SNEELYECAAGMAVHWYKDQETPAAILSEAHRL  501
                 V +  NDDQR     W +    S         G+AVHWY D+     ++ +AH  
Sbjct  336  SAESKVLIFGNDDQRYTYPTWFRKMRSSRNNSLNYLDGLAVHWYWDELIGPQLIDQAHTD  395

Query  502  YPHKFLLYTEACFEHEKMDP-AVTLGNWEKGELYMADIIEVISNWVTGWMDWNLALDMDG  560
             P+K LL TE+C   +        LG+W++GE YM    + +++   GW+DWNL LD  G
Sbjct  396  MPNKLLLNTESCIGDKPWQTHGPELGSWQRGESYMRAYTQDLTHNFNGWLDWNLVLDEQG  455

Query  561  GPNWADNTVDSPIVVNAEA-DEFYKQPMFYAIAHFSKFVPPGSVRVDLELKSGGG----V  615
            GPN+  N VD+PI+VNA +  E YKQP+FYAI HFSKF+PP SVR++  +++       +
Sbjct  456  GPNYVKNFVDAPIIVNATSRSEIYKQPIFYAIGHFSKFLPPDSVRIETRIENQSNPFTQL  515

Query  616  DGVAFLTPAKVTVVVLQNRQDTYSFASITDPIRGTVFLRLPENSMHTILYR  666
              V F  P     +++ N Q+     ++ D  RG + LRLP  S HT+LY+
Sbjct  516  SVVGFQRPDGSVALIIYNGQNLPVDVTLDDSQRGAIQLRLPPRSWHTVLYK  566


>Q9VCJ4_DROME unnamed protein product
Length=561

 Score = 249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 163/523 (31%), Positives = 258/523 (49%), Gaps = 41/523 (8%)

Query  182  VCVCNATYCDTV---VPTTAAHL-----AAGGVRH-YSSTKAGKRLELSITRFYPTPRE-  231
            VCVC A YCD +   V T          +  G+R   +S K GK  + ++  +    +E 
Sbjct  40   VCVCTADYCDYLENPVLTDENEWFLISSSKQGLRFSTTSDKFGKEEKFTVQDYVEPTQET  99

Query  232  ---RVLKR--KPVVRAAFM---------------LNQGQRYQQILGFGGAATDAATINTY  271
                +L R    VV +AF                L++ + +Q+++GFGG+ T A      
Sbjct  100  ANATILSRLLDKVVDSAFTLESRESSITRTVTLRLDRSKTHQKMVGFGGSYTGAVEYLVE  159

Query  272  SLS-ARVAEKLMRSYFGKEGIGYTLVRVPVGSSDFSAHYYGYTDDHPEDLTLHNFNLSTE  330
            +   + +A+ L +S++ ++G+G+ L+RV +G  DF    + Y ++  +        L+  
Sbjct  160  NFKHSELADHLYKSFYAEDGLGFNLMRVSIGGCDFDLEPWSYAEEEGDTELSDMDELNAH  219

Query  331  DFQYKIPFIKRAKQLSPYPVRLIS-TPWSAPDWMKAIDPETNVNWLRKDLFKVYADLYVR  389
            D   ++  IKR  ++S     L+    WS+P WMK  +  T    L++  ++ +AD ++R
Sbjct  220  DVT-RVAQIKRLIEVSGVKNLLVKGAAWSSPPWMKTNNRWTGFGRLKRAYYQTWADYHLR  278

Query  390  FLDGYAAQGLDFWGLTPQNEPSEGIATG---KFNKMGWTTEDMVTFLTRDFCPLLKERGH  446
            +L      G+  W ++  NEP  GI      KF  +GWT +    +L     P ++    
Sbjct  279  WLRLMKDNGIPIWAISTGNEPLNGIIFMYFVKFMSLGWTPQTQAIWLNDYLGPTIRNSEF  338

Query  447  GGVKVMINDDQRRDVAEWLKTYSNE--ELYECAAGMAVHWYKDQETPAAILSEAHRLYPH  504
              + +  NDDQR     W K  +       +   G+++HWY D+    + + +     P 
Sbjct  339  KDITLFGNDDQRYSFPHWFKMMNRTRPNSIDYLDGLSLHWYWDEIFGNSFIEQTKEYAPD  398

Query  505  KFLLYTEACFEHEKMDPAV-TLGNWEKGELYMADIIEVISNWVTGWMDWNLALDMDGGPN  563
            K L+ +E+C   +    A   LG+WE+ E Y  D +  I     GW+DWN+ LD  GGPN
Sbjct  399  KILIVSESCIGDKPWQAAAPLLGSWERAEKYARDYLLNIKLGFHGWIDWNICLDEIGGPN  458

Query  564  WADNTVDSPIVVNAEA-DEFYKQPMFYAIAHFSKFVPPGSVRVDLELKSGGGVDGVAFLT  622
            + DNTVD+P++VN    +EFYKQPMFYAI HFSK+VP GSVR+D  + S   +D VAFL 
Sbjct  459  YVDNTVDAPVIVNTTTFEEFYKQPMFYAIGHFSKWVPEGSVRID-AVPSNVNLDSVAFLR  517

Query  623  PAKVTVVVLQNRQDTYSFASITDPIRGTVFLRLPENSMHTILY  665
            P      VL N        ++ D IRG   + +P  S+HT+LY
Sbjct  518  PDNKITAVLFNSGRADLDITLVDSIRGQFVVNVPAKSIHTLLY  560


>B5TRE1_CAEEL unnamed protein product
Length=925

 Score = 31.6 bits (70),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 28/54 (52%), Gaps = 3/54 (6%)

Query  252  YQQILGFGGAATDAATINTYSLSARVAEKLMRSYFGKEGIGYT-LVRVPVGSSD  304
            YQ++L +G   +D A I  Y     +  KLM   FG E  GYT  V+  +G+ D
Sbjct  703  YQRLLKYGVQPSDIAIITPYKGQTSLVTKLMEE-FGAE-TGYTDFVQTTIGTVD  754



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold15-size2120621-augustus-gene-1.2-mRNA-1

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KUC2_DROME  unnamed protein product                                 127     4e-37
PDXK_DICDI  unnamed protein product                                   92.4    9e-24
D6XI07_TRYB2  unnamed protein product                                 75.9    1e-17


>Q7KUC2_DROME unnamed protein product
Length=304

 Score = 127 bits (318),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 0/101 (0%)

Query  1    MQTAERDLATVCDPVMGDNGRMYVSEELLPIYRDTILPLADIIVPNQFEVELLTGRKVTS  60
            ++ A   L  VCDPVMGDNG++YV +ELLP+YRD I+PLADII PNQFEVELLT ++V S
Sbjct  107  LRQANPGLVYVCDPVMGDNGQLYVPKELLPVYRDEIIPLADIITPNQFEVELLTEKEVRS  166

Query  61   VAEAWEAVQLFHDKGIKTVVLTSTGLGTDGHLLALASSTLG  101
             A  WEA++ FH +GIKTVV++S+ LG  G L A  S   G
Sbjct  167  EAAVWEAMEWFHQRGIKTVVISSSDLGQPGVLRAFLSQQNG  207


>PDXK_DICDI unnamed protein product
Length=302

 Score = 92.4 bits (228),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 66/100 (66%), Gaps = 0/100 (0%)

Query  1    MQTAERDLATVCDPVMGDNGRMYVSEELLPIYRDTILPLADIIVPNQFEVELLTGRKVTS  60
            +++   +L  VCDPV+GDN  +YV E+L+ +Y++ ++P AD I PNQ EVE LTG K+ +
Sbjct  100  LKSENPNLIYVCDPVLGDNNELYVPEDLVEVYKNEVIPNADYIFPNQTEVEFLTGIKIKN  159

Query  61   VAEAWEAVQLFHDKGIKTVVLTSTGLGTDGHLLALASSTL  100
              +A +A+  FH  G+K VV+TS    T+ + + +  ST+
Sbjct  160  DQDALKAIDQFHKMGVKNVVITSLFFDTNPNDIIVIGSTI  199


>D6XI07_TRYB2 unnamed protein product
Length=300

 Score = 75.9 bits (185),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 1/82 (1%)

Query  2    QTAERDLATVCDPVMGDNGRMYVSEELLPIYRDTILPLADIIVPNQFEVELLTGRKVTSV  61
            +  ++ L  +CDPVMGD+G MY  +E+L  YR+ ++PLADI+ PN FE  LL+G  V  +
Sbjct  106  EKEDKKLTFICDPVMGDDGIMYCKKEVLDAYRE-LVPLADIVTPNYFEASLLSGVTVNDL  164

Query  62   AEAWEAVQLFHDKGIKTVVLTS  83
            + A  A   FH+ G+  V++ S
Sbjct  165  SSAILAADWFHNCGVAHVIIKS  186



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold9215-size55068-augustus-gene-0.3-mRNA-1

Length=174
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8WFH5_CAEEL  unnamed protein product                                 35.8    0.016
CED1_CAEEL  unnamed protein product                                   33.1    0.11 
H2L041_CAEEL  unnamed protein product                                 32.3    0.21 


>A8WFH5_CAEEL unnamed protein product
Length=2444

 Score = 35.8 bits (81),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 27/76 (36%), Positives = 37/76 (49%), Gaps = 11/76 (14%)

Query  86    CGNNNTC---ECAPGYGYYIATNTCSIT----ISGVVAHGGNCRLARQCKSGMICPEQTC  138
             CGNN  C   +C    GYY    TC+      +  VV   GNC+  RQC +  +C +  C
Sbjct  1625  CGNNQVCIQDQCLCRNGYYAQPETCTGDRCNCVQHVVPDMGNCQ--RQCGNNQVCIQDQC  1682

Query  139   ECRTGLQYDRTSLTCI  154
             +CR G  Y   + TC+
Sbjct  1683  QCRNG--YYAQTETCV  1696


 Score = 32.0 bits (71),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 50/118 (42%), Gaps = 9/118 (8%)

Query  27   ESCVNTVNCESPLLCVSYVCNCDVNQTISSDRNICLSGVKHGDPCHETAQCLLELADSYC  86
            E C   V C    +C + VC C  N  I     +    V  G+ C+   QC   L +S C
Sbjct  647  EPCSEKVACSPFSVCENNVCKCVNNMMIRDKMCVQRRKVNIGNSCNNEDQC---LGNSTC  703

Query  87   GNNNTCECAPGYGYYIATNTCSITISG---VVAHGGNCRLARQCKSGMICPEQTCECR  141
             +NN C+C  G G+  + + C +  +G    +  G  C     C    +C +  C+C+
Sbjct  704  MDNN-CQC--GIGFVASMDVCVLRKTGKPNFLTPGYLCNPEDICTGQSVCIKGVCQCQ  758


 Score = 30.8 bits (68),  Expect = 0.72, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (43%), Gaps = 9/80 (11%)

Query  61   CLSGVKHGDPCHETAQCLLELADSYCGNNNTCECAPGYGYYIATNTCSITISGVVAHGGN  120
            C+  V  G PC   AQC      S+C  + TC+C PG+  Y+    C    S       +
Sbjct  298  CVKQVSIGQPCVANAQCNF---GSFC-QSGTCQCPPGF--YVQDEQCQAIES---EPNES  348

Query  121  CRLARQCKSGMICPEQTCEC  140
            C+   +C  G +C    C C
Sbjct  349  CQNNEKCTKGSVCYNGKCSC  368


 Score = 29.3 bits (64),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (47%), Gaps = 3/62 (5%)

Query  48   CDVNQTISSDRNICLSGVKHGDPCHETAQCLLELADSYCGNNNTCECAPGYGYYIATNTC  107
            C   QT   +  +C++  + G+PC  + QC      +YC     CEC   YG   ++N C
Sbjct  85   CPAGQTYIREAGVCMTVQQPGEPCQYSQQCSALEPGAYCLKMR-CECV--YGMKKSSNGC  141

Query  108  SI  109
            + 
Sbjct  142  TF  143


 Score = 27.3 bits (59),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 38/96 (40%), Gaps = 18/96 (19%)

Query  68   GDPCHETAQCLLELADSYCGNNNTCECAPGYGYYIATNTCSIT------ISGVVAH----  117
            G  C    QC     D+ C    TC C P      A  TC  +       SGV       
Sbjct  170  GKGCSHNLQCSGAYPDATCFMQ-TCTCPPNLPV-AADGTCGRSCPNNQVYSGVTGECLPE  227

Query  118  ---GGNCRLARQCKS---GMICPEQTCECRTGLQYD  147
               G +C  + QC++   G++C + TC C  GL +D
Sbjct  228  KQPGQDCIYSSQCQASFGGLVCDKNTCRCPNGLVFD  263


>CED1_CAEEL unnamed protein product
Length=1111

 Score = 33.1 bits (74),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 32/64 (50%), Gaps = 7/64 (11%)

Query  92   CECAPGYGYYIATNTCSITISGVVAHGGNCRLARQCKSGMIC-PE-QTCECRTGLQYDRT  149
            CEC PGYG     ++CS+   G+      C  +  C++G  C PE  TC C +G Q +R 
Sbjct  136  CECDPGYGGKYCASSCSVGTWGL-----GCSKSCDCENGANCDPELGTCICTSGFQGERC  190

Query  150  SLTC  153
               C
Sbjct  191  EKPC  194


>H2L041_CAEEL unnamed protein product
Length=1316

 Score = 32.3 bits (72),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 50/118 (42%), Gaps = 9/118 (8%)

Query  27   ESCVNTVNCESPLLCVSYVCNCDVNQTISSDRNICLSGVKHGDPCHETAQCLLELADSYC  86
            E C   V C    +C + VC C  N  I     +    V  G+ C+   QC   L +S C
Sbjct  647  EPCSEKVACSPFSVCENNVCKCVNNMMIRDKMCVQRRKVNIGNSCNNEDQC---LGNSTC  703

Query  87   GNNNTCECAPGYGYYIATNTCSITISG---VVAHGGNCRLARQCKSGMICPEQTCECR  141
             +NN C+C  G G+  + + C +  +G    +  G  C     C    +C +  C+C+
Sbjct  704  MDNN-CQC--GIGFVASMDVCVLRKTGKPNFLTPGYLCNPEDICTGQSVCIKGVCQCQ  758


 Score = 30.8 bits (68),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 34/80 (43%), Gaps = 9/80 (11%)

Query  61   CLSGVKHGDPCHETAQCLLELADSYCGNNNTCECAPGYGYYIATNTCSITISGVVAHGGN  120
            C+  V  G PC   AQC      S+C  + TC+C PG+  Y+    C    S       +
Sbjct  298  CVKQVSIGQPCVANAQCNF---GSFC-QSGTCQCPPGF--YVQDEQCQAIES---EPNES  348

Query  121  CRLARQCKSGMICPEQTCEC  140
            C+   +C  G +C    C C
Sbjct  349  CQNNEKCTKGSVCYNGKCSC  368


 Score = 29.3 bits (64),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 29/62 (47%), Gaps = 3/62 (5%)

Query  48   CDVNQTISSDRNICLSGVKHGDPCHETAQCLLELADSYCGNNNTCECAPGYGYYIATNTC  107
            C   QT   +  +C++  + G+PC  + QC      +YC     CEC   YG   ++N C
Sbjct  85   CPAGQTYIREAGVCMTVQQPGEPCQYSQQCSALEPGAYCLKMR-CECV--YGMKKSSNGC  141

Query  108  SI  109
            + 
Sbjct  142  TF  143


 Score = 28.9 bits (63),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 53/137 (39%), Gaps = 16/137 (12%)

Query  29   CVNTVNCESPLLC-VSYVCNCDVNQTISSDRNICLSGVKHGDPCHETAQCLLELADSYCG  87
            C +  +C   L+C  S  C+C   + + S    C S V+ G  C    +C    A     
Sbjct  780  CSSRDDCGEGLMCGASGKCSCP--EGLFSVNGKCRSYVQLGQTCTSDDRCAERNAQC---  834

Query  88   NNNTCECAPGY-------GYYIATNTCSITISGVVAHGGNCRLARQCKSGMICPEQTCEC  140
              N C C  GY          I T     T+S V +    C  + QC SG  C +  C C
Sbjct  835  QENYCTCRTGYTNINGQCAANIVTPAEPETLSQVKST--KCLASNQCPSGAQCVKGECRC  892

Query  141  RTGLQYDRTSLTCIPIV  157
            + GL   R    C+PI 
Sbjct  893  KPGLGITRYGF-CVPIT  908


 Score = 27.3 bits (59),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 38/96 (40%), Gaps = 18/96 (19%)

Query  68   GDPCHETAQCLLELADSYCGNNNTCECAPGYGYYIATNTCSIT------ISGVVAH----  117
            G  C    QC     D+ C    TC C P      A  TC  +       SGV       
Sbjct  170  GKGCSHNLQCSGAYPDATC-FMQTCTCPPNLPV-AADGTCGRSCPNNQVYSGVTGECLPE  227

Query  118  ---GGNCRLARQCKS---GMICPEQTCECRTGLQYD  147
               G +C  + QC++   G++C + TC C  GL +D
Sbjct  228  KQPGQDCIYSSQCQASFGGLVCDKNTCRCPNGLVFD  263



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold316-size983291-augustus-gene-2.3-mRNA-1

Length=96
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RL31_DROME  unnamed protein product                                   115     1e-34
Q8I463_PLAF7  unnamed protein product                                 73.2    5e-18
Q57ZA6_TRYB2  unnamed protein product                                 27.7    1.8  


>RL31_DROME unnamed protein product
Length=124

 Score = 115 bits (288),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 63/75 (84%), Gaps = 0/75 (0%)

Query  1   MAKPKFEKKNKSAINEVVTREYTINLHKRLHRVGFKKRAPRAIKEIRKFALKRMGTPDVR  60
           M K K EK NKSAINEVVTRE TI+L KR+H +GFKKRAPRAIKEIRKFA + MGT DVR
Sbjct  1   MTKTKGEKINKSAINEVVTRECTIHLAKRVHNIGFKKRAPRAIKEIRKFAEREMGTTDVR  60

Query  61  IDIRLNKQVWSKGVR  75
           ID RLNK +WSKG+R
Sbjct  61  IDTRLNKHIWSKGIR  75


>Q8I463_PLAF7 unnamed protein product
Length=120

 Score = 73.2 bits (178),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)

Query  18  VTREYTINLHKRLHRVGFKKRAPRAIKEIRKFALKRMGTPDVRIDIRLNKQVWSKGVR  75
           VT+  TINL K  H+V +K++APRAIKEIR  A K M T DVR+D++LNK +WSKGVR
Sbjct  16  VTKFITINLSKLTHKVCYKRKAPRAIKEIRSIAGKLMHTKDVRLDVKLNKFIWSKGVR  73


>Q57ZA6_TRYB2 unnamed protein product
Length=1572

 Score = 27.7 bits (60),  Expect = 1.8, Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 3/51 (6%)

Query  2     AKPKFEKKNKSAINEVVTREYTINLHKRLHRVGFKKRAPRAIKEIRKFALK  52
             A P  EK   +A+ E   R Y+  L ++ H  G  +R    + ++R  ALK
Sbjct  981   ASPPPEKHRPAAVPE---RSYSQQLEQKCHEEGQPRRTKIPLSDVRSAALK  1028



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold3941-size236702-augustus-gene-1.12-mRNA-1

Length=138
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VP27_DROME  unnamed protein product                                 110     5e-29
M9PIG4_DROME  unnamed protein product                                 110     5e-29
GR28B_DROME  unnamed protein product                                  30.0    0.59 


>Q9VP27_DROME unnamed protein product
Length=1103

 Score = 110 bits (276),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 90/170 (53%), Gaps = 34/170 (20%)

Query  2     QINTMCKQDEEDDGSGEVEECLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQA  61
             +I  +CK + + D  G++ ECLK AF   + +N  C+MEV  LI +AKADIHVDP+L  A
Sbjct  934   EIQELCKANVDSDEHGQLAECLKTAFLQKQIINRQCQMEVATLIAEAKADIHVDPILETA  993

Query  62    CGVDVSKFCSDIPQGAGR-----RKLTVADPQSVQ-----------ELYTQV--------  97
             C VD+ ++CS +  G GR     R L    P S++           E++           
Sbjct  994   CTVDLLRYCSKVAAGNGRKLNCLRTLLKDTPNSLEADCREKLQRRIEMFRNADDTLALPP  1053

Query  98    ----------AHSSARKYFLVVSLTIVGLIFMIGLFCGRVTKRTLLMKNK  137
                         S ARK+FLV+ ++  GL+F+ G+F GR TKR + +KNK
Sbjct  1054  EDVQQLVQQVVASPARKFFLVILMSATGLVFLTGIFLGRATKRAMGLKNK  1103


 Score = 34.7 bits (78),  Expect = 0.016, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (52%), Gaps = 1/62 (2%)

Query  16   SGEVEECLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFCSDIPQ  75
            S ++ +CLK  + +    +  C + VV  + +   D   +P L  ACG ++ ++CS+I  
Sbjct  819  SSKLLDCLKT-YKDDTQFDQRCHLVVVNRMIEQNTDFRFNPSLQSACGKNIDRYCSNIVA  877

Query  76   GA  77
             A
Sbjct  878  SA  879


 Score = 33.5 bits (75),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 31/68 (46%), Gaps = 5/68 (7%)

Query  17   GEVEECLKNAFYNHRP---MNPGCRMEVVGLIE--DAKADIHVDPLLHQACGVDVSKFCS  71
            GE+  CL       RP   +   C+  +  LI+  DA  D  VDP+L +AC   V   C 
Sbjct  375  GEIIHCLLEHVKARRPQRRVTAQCQRGLETLIKASDAGEDWRVDPVLRRACKPVVDVVCR  434

Query  72   DIPQGAGR  79
            D+  G  R
Sbjct  435  DVQGGEAR  442


 Score = 32.0 bits (71),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query  17   GEVEECLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFCSDI  73
            G   ECL+    N   + P C+  VV   E+  A + ++P++   CG  + + CS I
Sbjct  576  GSEMECLQK---NMDQLQPECKTVVVKYTEEEAAHVELNPVIMNVCGEAMQQHCSAI  629


 Score = 28.9 bits (63),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 0/51 (0%)

Query  22   CLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFCSD  72
            CL++   N   + P C  E+         D  + P L   C  D+ KFC D
Sbjct  310  CLESVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPELLNDCADDIPKFCPD  360


 Score = 28.5 bits (62),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 30/69 (43%), Gaps = 7/69 (10%)

Query  17   GEVEECLKNAFYN-----HRPMNPG-CRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFC  70
             EV  CL     N      R   P  CR +V   +   +  I +DP L  AC  ++ +FC
Sbjct  698  NEVVACLSEVMRNDTIKAQRHQIPKECRHQVKAQLYQQRESIQLDPKLANACKRELEQFC  757

Query  71   SDIPQGAGR  79
             +  +G G+
Sbjct  758  EE-EKGPGQ  765


>M9PIG4_DROME unnamed protein product
Length=1107

 Score = 110 bits (276),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 90/170 (53%), Gaps = 34/170 (20%)

Query  2     QINTMCKQDEEDDGSGEVEECLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQA  61
             +I  +CK + + D  G++ ECLK AF   + +N  C+MEV  LI +AKADIHVDP+L  A
Sbjct  938   EIQELCKANVDSDEHGQLAECLKTAFLQKQIINRQCQMEVATLIAEAKADIHVDPILETA  997

Query  62    CGVDVSKFCSDIPQGAGR-----RKLTVADPQSVQ-----------ELYTQV--------  97
             C VD+ ++CS +  G GR     R L    P S++           E++           
Sbjct  998   CTVDLLRYCSKVAAGNGRKLNCLRTLLKDTPNSLEADCREKLQRRIEMFRNADDTLALPP  1057

Query  98    ----------AHSSARKYFLVVSLTIVGLIFMIGLFCGRVTKRTLLMKNK  137
                         S ARK+FLV+ ++  GL+F+ G+F GR TKR + +KNK
Sbjct  1058  EDVQQLVQQVVASPARKFFLVILMSATGLVFLTGIFLGRATKRAMGLKNK  1107


 Score = 34.7 bits (78),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (52%), Gaps = 1/62 (2%)

Query  16   SGEVEECLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFCSDIPQ  75
            S ++ +CLK  + +    +  C + VV  + +   D   +P L  ACG ++ ++CS+I  
Sbjct  823  SSKLLDCLKT-YKDDTQFDQRCHLVVVNRMIEQNTDFRFNPSLQSACGKNIDRYCSNIVA  881

Query  76   GA  77
             A
Sbjct  882  SA  883


 Score = 33.5 bits (75),  Expect = 0.048, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 31/68 (46%), Gaps = 5/68 (7%)

Query  17   GEVEECLKNAFYNHRP---MNPGCRMEVVGLIE--DAKADIHVDPLLHQACGVDVSKFCS  71
            GE+  CL       RP   +   C+  +  LI+  DA  D  VDP+L +AC   V   C 
Sbjct  375  GEIIHCLLEHVKARRPQRRVTAQCQRGLETLIKASDAGEDWRVDPVLRRACKPVVDVVCR  434

Query  72   DIPQGAGR  79
            D+  G  R
Sbjct  435  DVQGGEAR  442


 Score = 32.0 bits (71),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query  17   GEVEECLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFCSDI  73
            G   ECL+    N   + P C+  VV   E+  A + ++P++   CG  + + CS I
Sbjct  576  GSEMECLQK---NMDQLQPECKTVVVKYTEEEAAHVELNPVIMNVCGEAMQQHCSAI  629


 Score = 28.9 bits (63),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 21/51 (41%), Gaps = 0/51 (0%)

Query  22   CLKNAFYNHRPMNPGCRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFCSD  72
            CL++   N   + P C  E+         D  + P L   C  D+ KFC D
Sbjct  310  CLESVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPELLNDCADDIPKFCPD  360


 Score = 28.5 bits (62),  Expect = 2.5, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 30/69 (43%), Gaps = 7/69 (10%)

Query  17   GEVEECLKNAFYN-----HRPMNPG-CRMEVVGLIEDAKADIHVDPLLHQACGVDVSKFC  70
             EV  CL     N      R   P  CR +V   +   +  I +DP L  AC  ++ +FC
Sbjct  698  NEVVACLSEVMRNDTIKAQRHQIPKECRHQVKAQLYQQRESIQLDPKLANACKRELEQFC  757

Query  71   SDIPQGAGR  79
             +  +G G+
Sbjct  758  EE-EKGPGQ  765


>GR28B_DROME unnamed protein product
Length=470

 Score = 30.0 bits (66),  Expect = 0.59, Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 6/62 (10%)

Query  82   LTVADPQSVQELYTQVAH------SSARKYFLVVSLTIVGLIFMIGLFCGRVTKRTLLMK  135
            +   DP  + +   ++ H      ++A KYF    LTI+ + F+I +F       TLL K
Sbjct  276  IVTKDPAEIIQESMEIHHLICEAAATANKYFTYQLLTIISIAFLIIVFDAYYVLETLLGK  335

Query  136  NK  137
            +K
Sbjct  336  SK  337



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold10920-size32279-augustus-gene-0.1-mRNA-1

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ECO_DROME  unnamed protein product                                    99.0    1e-23
BCN92_DROME  unnamed protein product                                  68.6    4e-15
Q4GZ53_TRYB2  unnamed protein product                                 63.2    1e-11


>ECO_DROME unnamed protein product
Length=1052

 Score = 99.0 bits (245),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 52/141 (37%), Positives = 79/141 (56%), Gaps = 3/141 (2%)

Query  8     PKSWWKRVSDVVEVVDKDLGYADGGSGLNIQGCKVYLYVESKSVIGCLVAQPITMAHRLQ  67
             P +   R+ D++ VVDK+LGY+   S +  +    ++ V  + ++G  + QP++ AHR  
Sbjct  913   PTARLDRLRDLIGVVDKELGYS---SYIVPKIFVAFIAVRKQQIVGFCLVQPLSQAHRFI  969

Query  68    VTDGLDTCSHESYPVRCGVSRLWVVISHRRRGIATKLVDCMRANFMYGYILSIEEFAFSV  127
               DG D  S ESYP  CGVSR+WV    RR GIA+KL+  ++ + + G  ++ E  AFS 
Sbjct  970   QVDGTDYFSEESYPASCGVSRIWVSPLQRRSGIASKLLRVVQCHTVLGQEIARECIAFST  1029

Query  128   PTVSGKEFGTNYAKKKNFLVY  148
             PT  G+     +    NFL Y
Sbjct  1030  PTDDGRALARQFTGLDNFLTY  1050


>BCN92_DROME unnamed protein product
Length=92

 Score = 68.6 bits (166),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 45/59 (76%), Gaps = 0/59 (0%)

Query  148  YMMYALRKIYDSFKGNKYLKDPVELEKAFEAARKNLEMIKKQVVIGNLYSTEKLIIENK  206
            + MYA RKI D+F+ N+  +D  E+++     ++NLE+I++QV+IG+LYS +KL+IENK
Sbjct  26   FRMYAARKIRDTFRANRSTRDFAEIDRQMAEGQQNLELIRRQVIIGHLYSADKLVIENK  84


>Q4GZ53_TRYB2 unnamed protein product
Length=295

 Score = 63.2 bits (152),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 61/130 (47%), Gaps = 28/130 (22%)

Query  47   ESKSVIGCLVAQPITMAHRLQ------------------VTDGLDTCSHE-------SYP  81
            E   ++G  VA+ ++  HR+                   V +GL  C  E       +  
Sbjct  166  EGCKIVGLCVARELSAPHRMHCESNWSHEKSEASGVGAAVQEGLGDCWEEDATRVGGTNN  225

Query  82   VR---CGVSRLWVVISHRRRGIATKLVDCMRANFMYGYILSIEEFAFSVPTVSGKEFGTN  138
            VR   CGV  +WV   +RR G+A  LVD  R +  YG+ + +E  AFS PT  GK F  +
Sbjct  226  VRKAFCGVQLVWVADCYRRHGVAKVLVDTARRHISYGFEVPVERVAFSEPTSLGKLFAKS  285

Query  139  YAKKKNFLVY  148
            Y+ + +FL++
Sbjct  286  YSGRPDFLIF  295



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold5293-size165890-augustus-gene-0.5-mRNA-1

Length=376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PIF6_TRYB2  unnamed protein product                                   50.4    2e-06
PIF5_TRYB2  unnamed protein product                                   47.0    2e-05
Q4QH47_LEIMA  unnamed protein product                                 29.3    7.3  


>PIF6_TRYB2 unnamed protein product
Length=796

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 65/135 (48%), Gaps = 3/135 (2%)

Query  222  LTLAVGCCIMLIRNLDTKHGLCNGTRLLVVNMSNYAVDAK---IITGSYKGDRAYIPRIK  278
            L L +G  ++L+ +L     L NG + +VV+ +          +   +  G+   +PR+ 
Sbjct  526  LELRIGAQVVLLASLPDAPHLSNGDQGVVVSFAEQTRGPALPVVCFATSGGEEVLVPRVS  585

Query  279  LLSTPADFPFSFSHRQFLVRLAFVMTINKSQGQTFDRIGIYLPHTVFSHGQLYVALSRAK  338
            +     +     +  Q  ++L++ +T++++QG T   + + L    F  GQ YVALSR +
Sbjct  586  MEVLGPEGRVIATRTQIPLQLSWAITVHRAQGMTLPLVSVRLNKCFFDCGQAYVALSRVR  645

Query  339  SLDSVSVLAKPSSGI  353
            S + + + A   S I
Sbjct  646  SREDLMLTAFDPSAI  660


>PIF5_TRYB2 unnamed protein product
Length=928

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 1/53 (2%)

Query  294  QFLVRLAFVMTINKSQGQTFDRIGIYLPHTVFSHGQLYVALSRAKSLDSVSVL  346
            Q  +R A+ MT++K+QG T   + + + H  FS GQ YVALSR+  LD++ +L
Sbjct  824  QLPLRQAWAMTVHKAQGLTISHVEVAI-HRFFSPGQAYVALSRSTRLDNIRLL  875


>Q4QH47_LEIMA unnamed protein product
Length=994

 Score = 29.3 bits (64),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 36/68 (53%), Gaps = 1/68 (1%)

Query  288  FSFSHRQFLVRLAFVMTINKSQGQTF-DRIGIYLPHTVFSHGQLYVALSRAKSLDSVSVL  346
            +S S     + LA+  T++K QG T   R+ + L         LYVA+SR ++ + +S+ 
Sbjct  664  YSLSSVALPLSLAYAFTVHKVQGLTLVGRVHLELSRMWPCEHLLYVAMSRVRNPEQLSMS  723

Query  347  AKPSSGIV  354
            +  +S +V
Sbjct  724  SFTASMVV  731



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold3577-size252935-augustus-gene-0.3-mRNA-1

Length=197
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D6XL11_TRYB2  unnamed protein product                                 32.7    0.15 
Q86PT1_9TRYP  unnamed protein product                                 32.7    0.15 
E9ADC3_LEIMA  unnamed protein product                                 30.0    1.4  


>D6XL11_TRYB2 unnamed protein product
Length=338

 Score = 32.7 bits (73),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 3/65 (5%)

Query  75   QYEACVGTVYENTLNSTECLITATNRGYTLTLTNIWVNDYTGSDYMYT-EPG--SNWTLI  131
            QY   VG V    + S +  I  +N+    + +N+W+ D+    Y  T EPG  S   L+
Sbjct  7    QYTGVVGAVRTIVVFSQQHHILESNQKARSSPSNVWIEDWEAESYGLTPEPGAVSTQLLL  66

Query  132  NYPMD  136
            + P++
Sbjct  67   DKPLE  71


>Q86PT1_9TRYP unnamed protein product
Length=338

 Score = 32.7 bits (73),  Expect = 0.15, Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 3/65 (5%)

Query  75   QYEACVGTVYENTLNSTECLITATNRGYTLTLTNIWVNDYTGSDYMYT-EPG--SNWTLI  131
            QY   VG V    + S +  I  +N+    + +N+W+ D+    Y  T EPG  S   L+
Sbjct  7    QYTGVVGAVRTIVVFSQQHHILESNQKARSSPSNVWIEDWEAESYGLTPEPGAVSTQLLL  66

Query  132  NYPMD  136
            + P++
Sbjct  67   DKPLE  71


>E9ADC3_LEIMA unnamed protein product
Length=642

 Score = 30.0 bits (66),  Expect = 1.4, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 19/31 (61%), Gaps = 0/31 (0%)

Query  19   LVDFDFQNTSYLLWVSNASISDYPGLSLDGD  49
            ++DFD+   S+LL+      ++YPGL  D D
Sbjct  488  VIDFDYTKRSFLLYDVANHFNEYPGLDCDYD  518



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold8556-size69593-augustus-gene-0.2-mRNA-1

Length=272
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KI42_DROME  unnamed protein product                                 42.0    3e-04
Q9VDH5_DROME  unnamed protein product                                 37.0    0.014
Q0KIF2_DROME  unnamed protein product                                 35.4    0.053


>Q0KI42_DROME unnamed protein product
Length=897

 Score = 42.0 bits (97),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/211 (22%), Positives = 89/211 (42%), Gaps = 26/211 (12%)

Query  73   LVFSIYSATLMSRLAV---QTRTHSYEAFADLVNSTPYVVGLLRGDSSIEMT--KPQLQK  127
            +V S Y+A L + L +   Q+  +S +  AD  +   Y         +  MT  + + +K
Sbjct  635  IVVSSYTANLAAFLTIEKPQSLINSVDDLADNKDGVVYGAKKTGSTRNFFMTSAEERYKK  694

Query  128  LNLH-----RYELEDNLEYINERICEGNYIFVTDGPNFR-KEQTSCSADIASVAVVSSSL  181
            +N       +Y  EDN+E +N      +Y F+ +  +     +  C+      A+     
Sbjct  695  MNKFMSENPQYLTEDNMEGVNRVKTNTHYAFLMESTSIEYNTKRECNLKKIGDALDEKGY  754

Query  182  SFAVRKNSPYLGAINYQLMKMLEIGDVARLRKKWISAEST--------APQET-------  226
              A+RK+ P+ G  N  L+++ E G + +++ KW +   T        AP  T       
Sbjct  755  GIAMRKDWPHRGKFNNALLELQEQGVLEKMKNKWWNEVGTGICATKEDAPDATPLDMNNL  814

Query  227  ESITMMHIVPCVVSLTLGIATSAVCLLAERH  257
            E +  + +V    +L  GI +  + ++ + H
Sbjct  815  EGVFFVLLVGSCCALLYGIISWVLFVMKKAH  845


>Q9VDH5_DROME unnamed protein product
Length=853

 Score = 37.0 bits (84),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 46/180 (26%), Positives = 73/180 (41%), Gaps = 28/180 (16%)

Query  49   VAGTQWFRRSSGCVVLMVTELAGFLVFSIYSATLMSRLAVQTRTHSYEAFADLVNSTPYV  108
            VAG  WF       ++M+         S Y+A L + L V+      E+  DL   T   
Sbjct  619  VAGIWWF-----FTLIMI---------SSYTANLAAFLTVERMDSPIESAEDLAKQTRIK  664

Query  109  VGLLRG--------DSSIEMTKPQLQKLNLHRYEL--EDNLEYINERICEG--NYIFVTD  156
             G L+G        DS I   +     +   R  +    N E + ER+ +G  +Y F+ +
Sbjct  665  YGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGV-ERVAKGKGSYAFLME  723

Query  157  GPNFRK-EQTSCSADIASVAVVSSSLSFAVRKNSPYLGAINYQLMKMLEIGDVARLRKKW  215
              +     + +C        + + S   A   NSPY  AIN  ++K+ E G +  L+ KW
Sbjct  724  STSIEYVTERNCELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKW  783


>Q0KIF2_DROME unnamed protein product
Length=899

 Score = 35.4 bits (80),  Expect = 0.053, Method: Compositional matrix adjust.
 Identities = 46/205 (22%), Positives = 82/205 (40%), Gaps = 26/205 (13%)

Query  73   LVFSIYSATLMSRLAVQTRTHSYEAFADLVNSTPYVVGLLRG--------DSSIEMTKPQ  124
            ++ + Y+A L + L  +   +  E   DL + T    G L          DS IE  K  
Sbjct  617  IIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKI  676

Query  125  LQKLNLHRYE-----LEDNLEYINERICEGNYIFVTDGPNFRK-EQTSCSADIASVAVVS  178
             + ++  +        ED ++    R+ +GNY F+ +        Q  C+       + +
Sbjct  677  WRSMDNKKPSAFTTTYEDGIK----RVNQGNYAFLMESTMLDYIVQRDCNLTQIGGLLDT  732

Query  179  SSLSFAVRKNSPYLGAINYQLMKMLEIGDVARLRKKW-------ISAESTAPQ-ETESIT  230
                 A  K SP+   I+  ++++ E GD+  L  KW        + ++T+ Q +  S+ 
Sbjct  733  KGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLG  792

Query  231  MMHIVPCVVSLTLGIATSAVCLLAE  255
            +  I    V L  GI  +AV    E
Sbjct  793  LESIGGVFVVLIAGIIVAAVVAFFE  817



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold5701-size152153-augustus-gene-0.7-mRNA-1

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CATA_DROME  unnamed protein product                                   492     1e-173
CATA1_CAEEL  unnamed protein product                                  460     3e-161
CATA2_CAEEL  unnamed protein product                                  460     3e-161


>CATA_DROME unnamed protein product
Length=506

 Score = 492 bits (1267),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 230/331 (69%), Positives = 270/331 (82%), Gaps = 4/331 (1%)

Query  7    VIRTSAGRRLSSAVATMTVGPKGPVVLQDTNFLDIMQHFDRERIPERVVHAKGAGAFGCF  66
             I T  G  +    A+ TVGP+GP++LQD NFLD M HFDRERIPERVVHAKGAGAFG F
Sbjct  24   AITTGNGAPIGIKDASQTVGPRGPILLQDVNFLDEMSHFDRERIPERVVHAKGAGAFGYF  83

Query  67   EVTHDIRQYCKAAMFSEIGKKTPIAVRFSRVAGNLGSADTVRSVDEDPRGFAVKFYTEEG  126
            EVTHDI QYC A +F ++ K+TP+AVRFS V G  GSADT R    DPRGFAVKFYTE+G
Sbjct  84   EVTHDITQYCAAKIFDKVKKRTPLAVRFSTVGGESGSADTAR----DPRGFAVKFYTEDG  139

Query  127  NWDLVGNNTPIFFIRDPILFPTFIHSQKRNPVTNTQDVNMVWDFASLRPETTHQMMITFS  186
             WDLVGNNTP+FFIRDPILFP+FIH+QKRNP T+ +D +M WDF +LRPE+ HQ+ I FS
Sbjct  140  VWDLVGNNTPVFFIRDPILFPSFIHTQKRNPQTHLKDPDMFWDFLTLRPESAHQVCILFS  199

Query  187  DRGIPDGHRHMHGYGSHTFKLVNEKNEPVYCKFHYKTDQGIKNLSPEDAEKIAGTDPDYA  246
            DRG PDG+ HM+GYGSHTFKL+N K EP+Y KFH+KTDQGIKNL  + A+++A TDPDY+
Sbjct  200  DRGTPDGYCHMNGYGSHTFKLINAKGEPIYAKFHFKTDQGIKNLDVKTADQLASTDPDYS  259

Query  247  IRDLYNAIAEKKFPSWTFYIQVMTLEQAEKFRWNIFDVTKVWPHKEYPLIPVGKIVLNQN  306
            IRDLYN I   KFPSWT YIQVMT EQA+KF++N FDVTKVW  KEYPLIPVGK+VL++N
Sbjct  260  IRDLYNRIKTCKFPSWTMYIQVMTYEQAKKFKYNPFDVTKVWSQKEYPLIPVGKMVLDRN  319

Query  307  PSNYFADVEQIAFSPSNFVPGIEASLDKMLQ  337
            P NYFA+VEQIAFSP++ VPG+E S DKML 
Sbjct  320  PKNYFAEVEQIAFSPAHLVPGVEPSPDKMLH  350


>CATA1_CAEEL unnamed protein product
Length=500

 Score = 460 bits (1184),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 265/334 (79%), Gaps = 4/334 (1%)

Query  4    KSDVIRTSAGRRLSSAVATMTVGPKGPVVLQDTNFLDIMQHFDRERIPERVVHAKGAGAF  63
            K  VI TS G  + S  A +T G +GP+++QD  ++D M HFDRERIPERVVHAKGAGA 
Sbjct  19   KPQVITTSNGAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAH  78

Query  64   GCFEVTHDIRQYCKAAMFSEIGKKTPIAVRFSRVAGNLGSADTVRSVDEDPRGFAVKFYT  123
            G FEVTHDI +YCKA +F+++GK+TP+ +RFS V G  GSADT R    DPRGFA+KFYT
Sbjct  79   GYFEVTHDISKYCKADIFNKVGKQTPLLIRFSTVGGESGSADTAR----DPRGFAIKFYT  134

Query  124  EEGNWDLVGNNTPIFFIRDPILFPTFIHSQKRNPVTNTQDVNMVWDFASLRPETTHQMMI  183
            EEGNWDLVGNNTPIFFIRDPI FP FIH+QKRNP T+ +D NM++DF   RPE  HQ+M 
Sbjct  135  EEGNWDLVGNNTPIFFIRDPIHFPNFIHTQKRNPQTHLKDPNMIFDFWLHRPEALHQVMF  194

Query  184  TFSDRGIPDGHRHMHGYGSHTFKLVNEKNEPVYCKFHYKTDQGIKNLSPEDAEKIAGTDP  243
             FSDRG+PDG+RHM+GYGSHTFK+VN+  + +Y KFH+K  QG+KNL+ E A ++A +DP
Sbjct  195  LFSDRGLPDGYRHMNGYGSHTFKMVNKDGKAIYVKFHFKPTQGVKNLTVEKAGQLASSDP  254

Query  244  DYAIRDLYNAIAEKKFPSWTFYIQVMTLEQAEKFRWNIFDVTKVWPHKEYPLIPVGKIVL  303
            DY+IRDL+NAI +  FP W  +IQVMT EQAEK+ +N FDVTKVWPH +YPLI VGK+VL
Sbjct  255  DYSIRDLFNAIEKGDFPVWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVL  314

Query  304  NQNPSNYFADVEQIAFSPSNFVPGIEASLDKMLQ  337
            N+NP NYFA+VEQ AF P++ VPGIE S DKMLQ
Sbjct  315  NRNPRNYFAEVEQSAFCPAHIVPGIEFSPDKMLQ  348


>CATA2_CAEEL unnamed protein product
Length=497

 Score = 460 bits (1183),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 219/334 (66%), Positives = 263/334 (79%), Gaps = 4/334 (1%)

Query  4    KSDVIRTSAGRRLSSAVATMTVGPKGPVVLQDTNFLDIMQHFDRERIPERVVHAKGAGAF  63
            K  VI TS G  + S  A +T G +GP+++QD  ++D M HFDRERIPERVVHAKGAGA 
Sbjct  19   KPQVITTSNGAPIYSKTAVLTAGRRGPMLMQDVVYMDEMAHFDRERIPERVVHAKGAGAH  78

Query  64   GCFEVTHDIRQYCKAAMFSEIGKKTPIAVRFSRVAGNLGSADTVRSVDEDPRGFAVKFYT  123
            G FEVTHDI +YCKA MF+++GK+TP+ VRFS VAG  GSADTVR    DPRGF++KFYT
Sbjct  79   GYFEVTHDITKYCKADMFNKVGKQTPLLVRFSTVAGESGSADTVR----DPRGFSLKFYT  134

Query  124  EEGNWDLVGNNTPIFFIRDPILFPTFIHSQKRNPVTNTQDVNMVWDFASLRPETTHQMMI  183
            EEGNWDLVGNNTPIFFIRD I FP FIH+ KRNP T+ +D N ++DF   RPE+ HQ+M 
Sbjct  135  EEGNWDLVGNNTPIFFIRDAIHFPNFIHALKRNPQTHMRDPNALFDFWMNRPESIHQVMF  194

Query  184  TFSDRGIPDGHRHMHGYGSHTFKLVNEKNEPVYCKFHYKTDQGIKNLSPEDAEKIAGTDP  243
             +SDRGIPDG R M+GYG+HTFK+VN++  P+YCKFH+K  QG KNL P DA K+A +DP
Sbjct  195  LYSDRGIPDGFRFMNGYGAHTFKMVNKEGNPIYCKFHFKPAQGSKNLDPTDAGKLASSDP  254

Query  244  DYAIRDLYNAIAEKKFPSWTFYIQVMTLEQAEKFRWNIFDVTKVWPHKEYPLIPVGKIVL  303
            DYAIRDL+NAI  + FP W  +IQVMT EQAEK+ +N FDVTKVWPH +YPLI VGK+VL
Sbjct  255  DYAIRDLFNAIESRNFPEWKMFIQVMTFEQAEKWEFNPFDVTKVWPHGDYPLIEVGKMVL  314

Query  304  NQNPSNYFADVEQIAFSPSNFVPGIEASLDKMLQ  337
            N+N  NYFA+VEQ AF P++ VPGIE S DKMLQ
Sbjct  315  NRNVKNYFAEVEQAAFCPAHIVPGIEFSPDKMLQ  348



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold5409-size180593-augustus-gene-0.1-mRNA-1

Length=678
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95TG0_DROME  unnamed protein product                                 380     2e-117
Q0E9J6_DROME  unnamed protein product                                 381     3e-115
A1Z6X2_DROME  unnamed protein product                                 381     3e-115


>Q95TG0_DROME unnamed protein product
Length=1212

 Score = 380 bits (975),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 220/611 (36%), Positives = 326/611 (53%), Gaps = 55/611 (9%)

Query  37   EPPLASYSHGDILGYQVTYREKSGGTQQVRTVRGHSWLE-----VTLSTLRQFTPYEITV  91
            +PP  +  +G+ILGY V Y+  +  +  V         E     + L  LR +T Y + +
Sbjct  227  KPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVI  286

Query  92   CAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTALTSQSVRVRWEPPAPEHCNGIIQGY  151
             AFN +G+GP S      T EG P   P D  CT LTSQ++RV W  P  E  NG+I+ Y
Sbjct  287  QAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTY  346

Query  152  KVFYRHANPKKGVQASVEVKKTTNLETNLHGLSKYTNYSLRVLAFTSAGEGIRSAPIHCM  211
            KV Y  ++ +   +     KKT + +T LHGL KYTNY+++VLA T+ G+G+RS PIHC 
Sbjct  347  KVVYAPSD-EWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQ  405

Query  212  TEEDVPGPPEMVKALAMTSDSILVAWTRPVEPNGNIIKYYIYIRSMANGNQDLQKDIVFG  271
            TE DVP  P  VKAL M + +ILV+W  P +PNG I +Y +Y  S A G +   K     
Sbjct  406  TEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVY--SKAEGAETETK-----  458

Query  272  DRDLMFEARQLKEFQRYEFWDLQKDIVFGDRDLMFEARQLKEFQRYEFWVTAATNIGEGP  331
                    +++  +Q                 + FEA +L++ + YEFWVTA+T IGEG 
Sbjct  459  -------TQKVPHYQ-----------------MSFEATELEKNKPYEFWVTASTTIGEGQ  494

Query  332  SSPRVSQSPISRVPARITSFSRHVLARAGQSEVLPCRAVGLPAPSRTWRSSKGGAVSS--  389
             S  +   P  +VPA+I SF     A   +   +PC AVG P P  TW+  KG   S+  
Sbjct  495  QSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITWKI-KGVEFSAND  553

Query  390  RHRLLPDHSLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTVQVAPGAPVISVAGATSQS  449
            R R+LPD SL +  +   DAG+Y+C AEN   +D +T+ L V   P +P ++++  T+ +
Sbjct  554  RMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDA  613

Query  450  LTLVWRVPDTGGSPITGNFGFIKAYTKAQGYTLNYRRNTEEWKKVSFDSDQKLYILDGIK  509
            LT+  +  +   +P+              GYTL+Y+    EW+      D + + ++G+ 
Sbjct  614  LTVKLKPHEGDTAPL-------------HGYTLHYKPEFGEWETSEVSVDSQKHNIEGLL  660

Query  510  CGSTYQLSLAATNSVGTGKSSSVISASTKGGAPRVPAMEDLLVVNSTSATLYLETWPDGG  569
            CGS YQ+     N++G G++S +++  TKG  P++P     + V+S S +L+ + W DGG
Sbjct  661  CGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDGG  720

Query  570  CPVQRFSVACRSRGQTHWTEVEGARGGPRHEELVIADLSPATWYAVRVVAHNDAGSNQHE  629
            CP+  F V  + R Q  W ++  +         V+ DL PATWY +R+ AHN AG    E
Sbjct  721  CPMSHFVVESKKRDQIEWNQI--SNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAE  778

Query  630  YVFATRSLRGG  640
            Y FAT ++ GG
Sbjct  779  YDFATLTVTGG  789


 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 137/346 (40%), Gaps = 47/346 (14%)

Query  68   VRGHSWLEVTLSTLRQFTPYEITVCAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTAL  127
            V GH+  E  +  L   T Y I + A N +G+  SS  + + T E  P   PQ+++   +
Sbjct  159  VPGHT-TEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  217

Query  128  TSQSVRVRWEPPAPEHCNGIIQGYKVFYRHANPK-----KGVQASVEVKKTTNLETNLHG  182
               ++RV W+PP     NG I GY V Y+ +N       + +    E  K  NLE  L  
Sbjct  218  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE--LQN  275

Query  183  LSKYTNYSLRVLAFTSAGEGIRSAPIHCMTEEDVPG-PPEMVKALAMTSDSILVAW-TRP  240
            L  YT YS+ + AF   G G  S      T E  P  PP       +TS +I V W + P
Sbjct  276  LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP  335

Query  241  VEPNGNIIKYYIYIRSMANGNQDLQKDIVFGDRDLMFEARQLKEFQRYEFWDLQKDIVFG  300
            +E    +IK Y                +V+   D  ++     E +R+       D V  
Sbjct  336  LESANGVIKTY---------------KVVYAPSDEWYD-----ETKRHYKKTASSDTVL-  374

Query  301  DRDLMFEARQLKEFQRYEFWVTAATNIGEGPSSPRVSQSPISRVPARITSFSRHVLARAG  360
                      LK++  Y   V A T  G+G  S  +       VP   T     V+   G
Sbjct  375  --------HGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVM---G  423

Query  361  QSEVL-----PCRAVGLPAPSRTWRSSKGGAVSSRHRLLPDHSLAL  401
             + +L     P +  G+      +  ++G    ++ + +P + ++ 
Sbjct  424  NAAILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSF  469


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 91/195 (47%), Gaps = 12/195 (6%)

Query  26   TSYVVRLLAVNEPPLASYSHGDILGYQVTYREKSGGTQQV-RTVRGHSWLEVTLSTLRQF  84
            TS  +R+  V+ PPL S ++G I  Y+V Y        +  R  +  +  +  L  L+++
Sbjct  323  TSQTIRVGWVS-PPLES-ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKY  380

Query  85   TPYEITVCAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTALTSQSVRVRWEPPAPEHC  144
            T Y + V A    G G  S P+   T   VP+ AP D++   + + ++ V W PPA    
Sbjct  381  TNYTMQVLATTAGGDGVRSVPIHCQTEPDVPE-APTDVKALVMGNAAILVSWRPPA--QP  437

Query  145  NGIIQGYKVFYRHANPKKGVQASVEVKKTTNLETNLHG--LSKYTNYSLRVLAFTSAGEG  202
            NGII  Y V+ +     +G +   + +K  + + +     L K   Y   V A T+ GEG
Sbjct  438  NGIITQYTVYSK----AEGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEG  493

Query  203  IRSAPIHCMTEEDVP  217
             +S  I  M  + VP
Sbjct  494  QQSKSIVAMPSDQVP  508


 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 85/214 (40%), Gaps = 27/214 (13%)

Query  343  RVPARITSFSRHVLARAGQSEVLPCRAVGLPAPSRTWRSSK-------GGAVSSRHRLLP  395
            + P   T   R+  AR G+  VL C A G       W  +            + R  +L 
Sbjct  5    QAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILS  64

Query  396  D---HSLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTVQVAPGAP-VISVAGATSQSLT  451
                 SL++      D+  +TC+A N FG D+ +  + VQ  P  P  + V   + +S+ 
Sbjct  65   TGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQ  124

Query  452  LVWRVPDTGGSPITGNFGFIKAYTKAQGYTLNYRRNTEEWKKVS---FDSDQKLYILDGI  508
            L W  P  G SP+               Y + ++R+   W ++             +  +
Sbjct  125  LSWAQPYDGNSPL-------------DRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKL  171

Query  509  KCGSTYQLSLAATNSVGTGKSSSVISASTKGGAP  542
               +TY + + A N++GT +SS  ++  T   AP
Sbjct  172  SPATTYNIRIVAENAIGTSQSSEAVTIITAEEAP  205


 Score = 40.8 bits (94),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 30/112 (27%), Positives = 51/112 (46%), Gaps = 4/112 (4%)

Query  516  LSLAATNSVGTGKSSSVISASTKGGAPRVPAMEDLLVVNSTSATLYLETWPDGGCPVQRF  575
             +  ATN+ G+  +S  +        P +P    +L  +  S  L      DG  P+ R+
Sbjct  84   FTCVATNAFGSDDASINMIVQE---VPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRY  140

Query  576  SVACRSRGQTHWTEVEGARGGPRHEELVIADLSPATWYAVRVVAHNDAGSNQ  627
             +  + R +  W+E++         E  +  LSPAT Y +R+VA N  G++Q
Sbjct  141  IIEFK-RSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQ  191


>Q0E9J6_DROME unnamed protein product
Length=2017

 Score = 381 bits (978),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 220/611 (36%), Positives = 325/611 (53%), Gaps = 55/611 (9%)

Query  37    EPPLASYSHGDILGYQVTYREKSGGTQQVRTVRGHSWLE-----VTLSTLRQFTPYEITV  91
             +PP  +  +G+ILGY V Y+  +  +  V         E     + L  LR +T Y + +
Sbjct  1032  KPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVI  1091

Query  92    CAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTALTSQSVRVRWEPPAPEHCNGIIQGY  151
              AFN +G+GP S      T EG P   P D  CT LTSQ++RV W  P  E  NG+I+ Y
Sbjct  1092  QAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTY  1151

Query  152   KVFYRHANPKKGVQASVEVKKTTNLETNLHGLSKYTNYSLRVLAFTSAGEGIRSAPIHCM  211
             KV Y  ++     +     KKT + +T LHGL KYTNY+++VLA T+ G+G+RS PIHC 
Sbjct  1152  KVVYAPSDEWYD-ETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQ  1210

Query  212   TEEDVPGPPEMVKALAMTSDSILVAWTRPVEPNGNIIKYYIYIRSMANGNQDLQKDIVFG  271
             TE DVP  P  VKAL M + +ILV+W  P +PNG I +Y +Y  S A G +   K     
Sbjct  1211  TEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVY--SKAEGAETETK-----  1263

Query  272   DRDLMFEARQLKEFQRYEFWDLQKDIVFGDRDLMFEARQLKEFQRYEFWVTAATNIGEGP  331
                     +++  +Q                 + FEA +L++ + YEFWVTA+T IGEG 
Sbjct  1264  -------TQKVPHYQ-----------------MSFEATELEKNKPYEFWVTASTTIGEGQ  1299

Query  332   SSPRVSQSPISRVPARITSFSRHVLARAGQSEVLPCRAVGLPAPSRTWRSSKGGAVSS--  389
              S  +   P  +VPA+I SF     A   +   +PC AVG P P  TW+  KG   S+  
Sbjct  1300  QSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITWKI-KGVEFSAND  1358

Query  390   RHRLLPDHSLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTVQVAPGAPVISVAGATSQS  449
             R R+LPD SL +  +   DAG+Y+C AEN   +D +T+ L V   P +P ++++  T+ +
Sbjct  1359  RMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDA  1418

Query  450   LTLVWRVPDTGGSPITGNFGFIKAYTKAQGYTLNYRRNTEEWKKVSFDSDQKLYILDGIK  509
             LT+  +  +   +P+              GYTL+Y+    EW+      D + + ++G+ 
Sbjct  1419  LTVKLKPHEGDTAPL-------------HGYTLHYKPEFGEWETSEVSVDSQKHNIEGLL  1465

Query  510   CGSTYQLSLAATNSVGTGKSSSVISASTKGGAPRVPAMEDLLVVNSTSATLYLETWPDGG  569
             CGS YQ+     N++G G++S +++  TKG  P++P     + V+S S +L+ + W DGG
Sbjct  1466  CGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDGG  1525

Query  570   CPVQRFSVACRSRGQTHWTEVEGARGGPRHEELVIADLSPATWYAVRVVAHNDAGSNQHE  629
             CP+  F V  + R Q  W ++  +         V+ DL PATWY +R+ AHN AG    E
Sbjct  1526  CPMSHFVVESKKRDQIEWNQI--SNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAE  1583

Query  630   YVFATRSLRGG  640
             Y FAT ++ GG
Sbjct  1584  YDFATLTVTGG  1594


 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 136/346 (39%), Gaps = 47/346 (14%)

Query  68    VRGHSWLEVTLSTLRQFTPYEITVCAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTAL  127
             V GH+  E  +  L   T Y I + A N +G+  SS  + + T E  P   PQ+++   +
Sbjct  964   VPGHT-TEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1022

Query  128   TSQSVRVRWEPPAPEHCNGIIQGYKVFYRHANPK-----KGVQASVEVKKTTNLETNLHG  182
                ++RV W+PP     NG I GY V Y+ +N       + +    E  K  NLE  L  
Sbjct  1023  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE--LQN  1080

Query  183   LSKYTNYSLRVLAFTSAGEGIRSAPIHCMTEEDVPG-PPEMVKALAMTSDSILVAWTR-P  240
             L  YT YS+ + AF   G G  S      T E  P  PP       +TS +I V W   P
Sbjct  1081  LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP  1140

Query  241   VEPNGNIIKYYIYIRSMANGNQDLQKDIVFGDRDLMFEARQLKEFQRYEFWDLQKDIVFG  300
             +E    +IK Y                +V+   D  ++     E +R+       D V  
Sbjct  1141  LESANGVIKTY---------------KVVYAPSDEWYD-----ETKRHYKKTASSDTVL-  1179

Query  301   DRDLMFEARQLKEFQRYEFWVTAATNIGEGPSSPRVSQSPISRVPARITSFSRHVLARAG  360
                       LK++  Y   V A T  G+G  S  +       VP   T     V+   G
Sbjct  1180  --------HGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVM---G  1228

Query  361   QSEVL-----PCRAVGLPAPSRTWRSSKGGAVSSRHRLLPDHSLAL  401
              + +L     P +  G+      +  ++G    ++ + +P + ++ 
Sbjct  1229  NAAILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSF  1274


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 91/196 (46%), Gaps = 12/196 (6%)

Query  26    TSYVVRLLAVNEPPLASYSHGDILGYQVTYREKSGGTQQV-RTVRGHSWLEVTLSTLRQF  84
             TS  +R+  V+ PPL S ++G I  Y+V Y        +  R  +  +  +  L  L+++
Sbjct  1128  TSQTIRVGWVS-PPLES-ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKY  1185

Query  85    TPYEITVCAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTALTSQSVRVRWEPPAPEHC  144
             T Y + V A    G G  S P+   T   VP+ AP D++   + + ++ V W PPA    
Sbjct  1186  TNYTMQVLATTAGGDGVRSVPIHCQTEPDVPE-APTDVKALVMGNAAILVSWRPPA--QP  1242

Query  145   NGIIQGYKVFYRHANPKKGVQASVEVKKTTNLETNLHG--LSKYTNYSLRVLAFTSAGEG  202
             NGII  Y V+ +     +G +   + +K  + + +     L K   Y   V A T+ GEG
Sbjct  1243  NGIITQYTVYSK----AEGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEG  1298

Query  203   IRSAPIHCMTEEDVPG  218
              +S  I  M  + VP 
Sbjct  1299  QQSKSIVAMPSDQVPA  1314


 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/269 (23%), Positives = 105/269 (39%), Gaps = 32/269 (12%)

Query  289   EFWDLQKDIVFGDRDLMFEARQLKEFQRYEFWVTAATNIGEGPSSPRVSQSPIS-RVPAR  347
             E+ DL+K       +       +++     +   A   IG G S+  +    IS + P  
Sbjct  759   EYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIM----ISVQAPPE  814

Query  348   ITSFSRHVLARAGQSEVLPCRAVGLPAPSRTWRSSK-------GGAVSSRHRLLPD---H  397
              T   R+  AR G+  VL C A G       W  +            + R  +L      
Sbjct  815   FTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMS  874

Query  398   SLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTVQVAPGAP-VISVAGATSQSLTLVWRV  456
             SL++      D+  +TC+A N FG D+ +  + VQ  P  P  + V   + +S+ L W  
Sbjct  875   SLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQ  934

Query  457   PDTGGSPITGNFGFIKAYTKAQGYTLNYRRNTEEWKKVS---FDSDQKLYILDGIKCGST  513
             P  G SP+               Y + ++R+   W ++             +  +   +T
Sbjct  935   PYDGNSPL-------------DRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATT  981

Query  514   YQLSLAATNSVGTGKSSSVISASTKGGAP  542
             Y + + A N++GT +SS  ++  T   AP
Sbjct  982   YNIRIVAENAIGTSQSSEAVTIITAEEAP  1010


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 65/292 (22%), Positives = 112/292 (38%), Gaps = 49/292 (17%)

Query  360  GQSEVLPCRAVGLPAPSRTWRSSKGGAVSSRHRL-------LPDHSLALGFLRPDDAGNY  412
            G    + C+A G P P  TW+ + G        L       + + +L +  ++  + G Y
Sbjct  730  GSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYY  789

Query  413  TCLAENVFGRD-EVTYTLTVQVAP-------------GAP-VISVAGATSQSLTLVWRVP  457
             C A N  G        ++VQ  P             G P V+       + + ++W + 
Sbjct  790  LCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMN  849

Query  458  DTGGSPITGNFGFIKAYTKAQGY--TLNYRRNTEEWKKVSFDSDQKLYILDGIKCGSTYQ  515
            +    P   N   I+    + G   +L+ +R TE        SD  L+            
Sbjct  850  NMRLDPKNDNRYTIREEILSTGVMSSLSIKR-TER-------SDSALF------------  889

Query  516  LSLAATNSVGTGKSSSVISASTKGGAPRVPAMEDLLVVNSTSATLYLETWPDGGCPVQRF  575
             +  ATN+ G+  +S  +        P +P    +L  +  S  L      DG  P+ R+
Sbjct  890  -TCVATNAFGSDDASINMIVQE---VPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRY  945

Query  576  SVACRSRGQTHWTEVEGARGGPRHEELVIADLSPATWYAVRVVAHNDAGSNQ  627
             +  + R +  W+E++         E  +  LSPAT Y +R+VA N  G++Q
Sbjct  946  IIEFK-RSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQ  996


 Score = 36.6 bits (83),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (49%), Gaps = 7/84 (8%)

Query  359  AGQSEVLPCRAVGLPAPSRTW-RSSKGGAVSSRHRLLPDHSLAL-GFLRPDDAGNYTCLA  416
            AG++ ++ C   G P  S  W R ++   ++ + ++ P+ +L +    R  D   YTC+A
Sbjct  540  AGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVA  599

Query  417  ENVFGRD-----EVTYTLTVQVAP  435
            +N  G       EV   +  ++AP
Sbjct  600  KNQEGYSARGSLEVQVMVAPKIAP  623


 Score = 32.7 bits (73),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 27/66 (41%), Gaps = 9/66 (14%)

Query  365  LPCRAVGLPAPSRTWRSSKG---GAVSSRHRLLPDHSLALGFLRPDD------AGNYTCL  415
            + C+A G P P   W  S G   G V    ++  D  L     R +D      A  Y CL
Sbjct  59   IECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACL  118

Query  416  AENVFG  421
            A N FG
Sbjct  119  ARNQFG  124


 Score = 32.3 bits (72),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 41/104 (39%), Gaps = 8/104 (8%)

Query  336  VSQSPISRVPARITSFSR--HVLARAGQSEVLPCRAVGLPAPSRTWRSSKGGAVSSRHRL  393
            V   P+  V  +I+  +R  +  AR G +  L C     P P   W     G    +  +
Sbjct  237  VITEPVGSVAPKISVENRLKNAEARIGSTFTLFCPGQAYPVPFFRWYKFIEGTTRKQAVV  296

Query  394  LPDH------SLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTV  431
            L D       +L +     +D+G Y C+  N  G + V   LTV
Sbjct  297  LNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTV  340


 Score = 30.8 bits (68),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 100/242 (41%), Gaps = 43/242 (18%)

Query  52   QVTYREKSGGTQ-QVRTVRGHSWLEVTLSTLR----QFTPYEITVC-AFNLVGSGPSSPP  105
            QVT+++  G T  + + ++    + V   TL     Q T     +C A N +GSG S+  
Sbjct  746  QVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSA--  803

Query  106  LLVTTLEGVPDMA------------PQDLRCTALTSQSVRVRWEPPAPEHCNGIIQGYKV  153
            +++ +++  P+              P  L+C A   + + + W      + N +    K 
Sbjct  804  VIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILW------NMNNMRLDPKN  857

Query  154  FYRHANPKK----GVQASVEVKKTTNLETNLHGLSKYTNYSLRVLAFTSAGEGIRSAPIH  209
              R+   ++    GV +S+ +K+T   ++ L          +   AF S    I      
Sbjct  858  DNRYTIREEILSTGVMSSLSIKRTERSDSALFTC-------VATNAFGSDDASIN-----  905

Query  210  CMTEEDVPGPPEMVKALAMTSDSILVAWTRPVEPNGNIIKYYIYIRSMANGNQDLQKDIV  269
             M  ++VP  P  +K L  +  S+ ++W +P + N  + +Y I  +       ++ + IV
Sbjct  906  -MIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIV  964

Query  270  FG  271
             G
Sbjct  965  PG  966


>A1Z6X2_DROME unnamed protein product
Length=2022

 Score = 381 bits (978),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 220/611 (36%), Positives = 325/611 (53%), Gaps = 55/611 (9%)

Query  37    EPPLASYSHGDILGYQVTYREKSGGTQQVRTVRGHSWLE-----VTLSTLRQFTPYEITV  91
             +PP  +  +G+ILGY V Y+  +  +  V         E     + L  LR +T Y + +
Sbjct  1037  KPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVI  1096

Query  92    CAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTALTSQSVRVRWEPPAPEHCNGIIQGY  151
              AFN +G+GP S      T EG P   P D  CT LTSQ++RV W  P  E  NG+I+ Y
Sbjct  1097  QAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTY  1156

Query  152   KVFYRHANPKKGVQASVEVKKTTNLETNLHGLSKYTNYSLRVLAFTSAGEGIRSAPIHCM  211
             KV Y  ++     +     KKT + +T LHGL KYTNY+++VLA T+ G+G+RS PIHC 
Sbjct  1157  KVVYAPSDEWYD-ETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQ  1215

Query  212   TEEDVPGPPEMVKALAMTSDSILVAWTRPVEPNGNIIKYYIYIRSMANGNQDLQKDIVFG  271
             TE DVP  P  VKAL M + +ILV+W  P +PNG I +Y +Y  S A G +   K     
Sbjct  1216  TEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVY--SKAEGAETETK-----  1268

Query  272   DRDLMFEARQLKEFQRYEFWDLQKDIVFGDRDLMFEARQLKEFQRYEFWVTAATNIGEGP  331
                     +++  +Q                 + FEA +L++ + YEFWVTA+T IGEG 
Sbjct  1269  -------TQKVPHYQ-----------------MSFEATELEKNKPYEFWVTASTTIGEGQ  1304

Query  332   SSPRVSQSPISRVPARITSFSRHVLARAGQSEVLPCRAVGLPAPSRTWRSSKGGAVSS--  389
              S  +   P  +VPA+I SF     A   +   +PC AVG P P  TW+  KG   S+  
Sbjct  1305  QSKSIVAMPSDQVPAKIASFDDTFTATFKEDAKMPCLAVGAPQPEITWKI-KGVEFSAND  1363

Query  390   RHRLLPDHSLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTVQVAPGAPVISVAGATSQS  449
             R R+LPD SL +  +   DAG+Y+C AEN   +D +T+ L V   P +P ++++  T+ +
Sbjct  1364  RMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITHKLIVLAPPQSPHVTLSATTTDA  1423

Query  450   LTLVWRVPDTGGSPITGNFGFIKAYTKAQGYTLNYRRNTEEWKKVSFDSDQKLYILDGIK  509
             LT+  +  +   +P+              GYTL+Y+    EW+      D + + ++G+ 
Sbjct  1424  LTVKLKPHEGDTAPL-------------HGYTLHYKPEFGEWETSEVSVDSQKHNIEGLL  1470

Query  510   CGSTYQLSLAATNSVGTGKSSSVISASTKGGAPRVPAMEDLLVVNSTSATLYLETWPDGG  569
             CGS YQ+     N++G G++S +++  TKG  P++P     + V+S S +L+ + W DGG
Sbjct  1471  CGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNSVSLHFKAWKDGG  1530

Query  570   CPVQRFSVACRSRGQTHWTEVEGARGGPRHEELVIADLSPATWYAVRVVAHNDAGSNQHE  629
             CP+  F V  + R Q  W ++  +         V+ DL PATWY +R+ AHN AG    E
Sbjct  1531  CPMSHFVVESKKRDQIEWNQI--SNNVKPDNNYVVLDLEPATWYNLRITAHNSAGFTVAE  1588

Query  630   YVFATRSLRGG  640
             Y FAT ++ GG
Sbjct  1589  YDFATLTVTGG  1599


 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 136/346 (39%), Gaps = 47/346 (14%)

Query  68    VRGHSWLEVTLSTLRQFTPYEITVCAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTAL  127
             V GH+  E  +  L   T Y I + A N +G+  SS  + + T E  P   PQ+++   +
Sbjct  969   VPGHT-TEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPV  1027

Query  128   TSQSVRVRWEPPAPEHCNGIIQGYKVFYRHANPK-----KGVQASVEVKKTTNLETNLHG  182
                ++RV W+PP     NG I GY V Y+ +N       + +    E  K  NLE  L  
Sbjct  1028  NQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLE--LQN  1085

Query  183   LSKYTNYSLRVLAFTSAGEGIRSAPIHCMTEEDVPG-PPEMVKALAMTSDSILVAWTR-P  240
             L  YT YS+ + AF   G G  S      T E  P  PP       +TS +I V W   P
Sbjct  1086  LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP  1145

Query  241   VEPNGNIIKYYIYIRSMANGNQDLQKDIVFGDRDLMFEARQLKEFQRYEFWDLQKDIVFG  300
             +E    +IK Y                +V+   D  ++     E +R+       D V  
Sbjct  1146  LESANGVIKTY---------------KVVYAPSDEWYD-----ETKRHYKKTASSDTVL-  1184

Query  301   DRDLMFEARQLKEFQRYEFWVTAATNIGEGPSSPRVSQSPISRVPARITSFSRHVLARAG  360
                       LK++  Y   V A T  G+G  S  +       VP   T     V+   G
Sbjct  1185  --------HGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVM---G  1233

Query  361   QSEVL-----PCRAVGLPAPSRTWRSSKGGAVSSRHRLLPDHSLAL  401
              + +L     P +  G+      +  ++G    ++ + +P + ++ 
Sbjct  1234  NAAILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSF  1279


 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 91/196 (46%), Gaps = 12/196 (6%)

Query  26    TSYVVRLLAVNEPPLASYSHGDILGYQVTYREKSGGTQQV-RTVRGHSWLEVTLSTLRQF  84
             TS  +R+  V+ PPL S ++G I  Y+V Y        +  R  +  +  +  L  L+++
Sbjct  1133  TSQTIRVGWVS-PPLES-ANGVIKTYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKY  1190

Query  85    TPYEITVCAFNLVGSGPSSPPLLVTTLEGVPDMAPQDLRCTALTSQSVRVRWEPPAPEHC  144
             T Y + V A    G G  S P+   T   VP+ AP D++   + + ++ V W PPA    
Sbjct  1191  TNYTMQVLATTAGGDGVRSVPIHCQTEPDVPE-APTDVKALVMGNAAILVSWRPPA--QP  1247

Query  145   NGIIQGYKVFYRHANPKKGVQASVEVKKTTNLETNLHG--LSKYTNYSLRVLAFTSAGEG  202
             NGII  Y V+ +     +G +   + +K  + + +     L K   Y   V A T+ GEG
Sbjct  1248  NGIITQYTVYSK----AEGAETETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEG  1303

Query  203   IRSAPIHCMTEEDVPG  218
              +S  I  M  + VP 
Sbjct  1304  QQSKSIVAMPSDQVPA  1319


 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/269 (23%), Positives = 105/269 (39%), Gaps = 32/269 (12%)

Query  289   EFWDLQKDIVFGDRDLMFEARQLKEFQRYEFWVTAATNIGEGPSSPRVSQSPIS-RVPAR  347
             E+ DL+K       +       +++     +   A   IG G S+  +    IS + P  
Sbjct  764   EYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIM----ISVQAPPE  819

Query  348   ITSFSRHVLARAGQSEVLPCRAVGLPAPSRTWRSSK-------GGAVSSRHRLLPD---H  397
              T   R+  AR G+  VL C A G       W  +            + R  +L      
Sbjct  820   FTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILSTGVMS  879

Query  398   SLALGFLRPDDAGNYTCLAENVFGRDEVTYTLTVQVAPGAP-VISVAGATSQSLTLVWRV  456
             SL++      D+  +TC+A N FG D+ +  + VQ  P  P  + V   + +S+ L W  
Sbjct  880   SLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEVPEMPYALKVLDKSGRSVQLSWAQ  939

Query  457   PDTGGSPITGNFGFIKAYTKAQGYTLNYRRNTEEWKKVS---FDSDQKLYILDGIKCGST  513
             P  G SP+               Y + ++R+   W ++             +  +   +T
Sbjct  940   PYDGNSPL-------------DRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATT  986

Query  514   YQLSLAATNSVGTGKSSSVISASTKGGAP  542
             Y + + A N++GT +SS  ++  T   AP
Sbjct  987   YNIRIVAENAIGTSQSSEAVTIITAEEAP  1015


 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 63/292 (22%), Positives = 110/292 (38%), Gaps = 49/292 (17%)

Query  360   GQSEVLPCRAVGLPAPSRTWRSSKGGAVSSRHRL-------LPDHSLALGFLRPDDAGNY  412
             G    + C+A G P P  TW+ + G        L       + + +L +  ++  + G Y
Sbjct  735   GSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYY  794

Query  413   TCLAENVFGRD-EVTYTLTVQVAP-------------GAP-VISVAGATSQSLTLVWRVP  457
              C A N  G        ++VQ  P             G P V+       + + ++W + 
Sbjct  795   LCEAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMN  854

Query  458   DTGGSPITGNFGFIKAYTKAQGY--TLNYRRNTEEWKKVSFDSDQKLYILDGIKCGSTYQ  515
             +    P   N   I+    + G   +L+ +R           SD  L+            
Sbjct  855   NMRLDPKNDNRYTIREEILSTGVMSSLSIKRTER--------SDSALF------------  894

Query  516   LSLAATNSVGTGKSSSVISASTKGGAPRVPAMEDLLVVNSTSATLYLETWPDGGCPVQRF  575
              +  ATN+ G+  +S  +        P +P    +L  +  S  L      DG  P+ R+
Sbjct  895   -TCVATNAFGSDDASINMIVQE---VPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRY  950

Query  576   SVACRSRGQTHWTEVEGARGGPRHEELVIADLSPATWYAVRVVAHNDAGSNQ  627
              +  + R +  W+E++         E  +  LSPAT Y +R+VA N  G++Q
Sbjct  951   IIEFK-RSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQ  1001


 Score = 36.2 bits (82),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 18/65 (28%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query  359  AGQSEVLPCRAVGLPAPSRTW-RSSKGGAVSSRHRLLPDHSLAL-GFLRPDDAGNYTCLA  416
            AG++ ++ C   G P  S  W R ++   ++ + ++ P+ +L +    R  D   YTC+A
Sbjct  540  AGETLIVTCPVAGYPIDSIVWERDNRALPINRKQKVFPNGTLIIENVERNSDQATYTCVA  599

Query  417  ENVFG  421
            +N  G
Sbjct  600  KNQEG  604


 Score = 32.7 bits (73),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 27/66 (41%), Gaps = 9/66 (14%)

Query  365  LPCRAVGLPAPSRTWRSSKG---GAVSSRHRLLPDHSLALGFLRPDD------AGNYTCL  415
            + C+A G P P   W  S G   G V    ++  D  L     R +D      A  Y CL
Sbjct  59   IECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACL  118

Query  416  AENVFG  421
            A N FG
Sbjct  119  ARNQFG  124


 Score = 30.8 bits (68),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 51/242 (21%), Positives = 100/242 (41%), Gaps = 43/242 (18%)

Query  52   QVTYREKSGGTQ-QVRTVRGHSWLEVTLSTLR----QFTPYEITVC-AFNLVGSGPSSPP  105
            QVT+++  G T  + + ++    + V   TL     Q T     +C A N +GSG S+  
Sbjct  751  QVTWKKAVGDTPGEYKDLKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGLSA--  808

Query  106  LLVTTLEGVPDMA------------PQDLRCTALTSQSVRVRWEPPAPEHCNGIIQGYKV  153
            +++ +++  P+              P  L+C A   + + + W      + N +    K 
Sbjct  809  VIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILW------NMNNMRLDPKN  862

Query  154  FYRHANPKK----GVQASVEVKKTTNLETNLHGLSKYTNYSLRVLAFTSAGEGIRSAPIH  209
              R+   ++    GV +S+ +K+T   ++ L          +   AF S    I      
Sbjct  863  DNRYTIREEILSTGVMSSLSIKRTERSDSALFTC-------VATNAFGSDDASIN-----  910

Query  210  CMTEEDVPGPPEMVKALAMTSDSILVAWTRPVEPNGNIIKYYIYIRSMANGNQDLQKDIV  269
             M  ++VP  P  +K L  +  S+ ++W +P + N  + +Y I  +       ++ + IV
Sbjct  911  -MIVQEVPEMPYALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSRASWSEIDRVIV  969

Query  270  FG  271
             G
Sbjct  970  PG  971



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold567-size783925-augustus-gene-5.2-mRNA-1

Length=1466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KTC3_DROME  unnamed protein product                                 725     0.0  
Q7KTC0_DROME  unnamed protein product                                 725     0.0  
Q7KTB8_DROME  unnamed protein product                                 725     0.0  


>Q7KTC3_DROME unnamed protein product
Length=1548

 Score = 725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/987 (42%), Positives = 578/987 (59%), Gaps = 148/987 (15%)

Query  244   VHRTCPGNSLLTDANLTWYTHDPDVTPCVERTVLLWLPCAALWALCPVEASYILHSKTRD  303
             + R C   S   +A  TWYT+DPD TPC E+T L+W PCA  WA    +  Y+  S  R+
Sbjct  9     MDRFC--GSTFWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYLKASLDRN  66

Query  304   IPWNWRSISK-LVLIGVLMLLCLTDLAVVFHDHSLGYHVYPVGFCSPIIEIATLVLIGVL  362
             IPWN  ++SK LV +G+L++  L DL                        I  LV  G  
Sbjct  67    IPWNKLNVSKALVNLGLLVITAL-DL------------------------IMALVKKGGD  101

Query  363   MLLCLTDLAVVFHDHSLGYHVYPVGFCSPIIEIATLVVSAAFLVFMRERGLRTSGPLFIF  422
               L L DL V                  PII+ AT ++   F+   R+ G++T+G  FIF
Sbjct  102   SELPLYDLDV----------------WGPIIKFATFLLLFIFIPLNRKYGVQTTGCQFIF  145

Query  423   WLLLVLCGAPQFRTEL-------------EALSRDF---DVKTVTYLIHYPVVVVLFFLH  466
             W LL +   P+ RTE+             +   +DF   + + V++ I +    ++  L+
Sbjct  146   WFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILN  205

Query  467   CIADLPPAHSYYPIPEKPCPEKSASFPSRVIFKWIDPLVWRGFRTSLEMPDLFDLNPEDH  526
             C AD  P  + Y   E   PE SASF SR+ ++W D +  +G+R  LE  DL+DL P+D 
Sbjct  206   CFADGMPRQTKYQRGENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDS  265

Query  527   SRIVVPKFDKHWDCMVARKTRDS---DAKATFQKASGSISFRGGKQQKPVR----LSLLG  579
                V+P F  HW+  V +  ++    + KA F  ++G+++F     +K  R     S++ 
Sbjct  266   CSEVMPIFAHHWNQNVRKNYKNKARVEPKAQF--SNGNVTFENPHGEKNGRKKGMASIMP  323

Query  580   PLIKAFGSTFLFSISLRLTQDLLAFANPQILKYMIAFVESDD--PDWKGYMYAALMLVCG  637
             P+ K+FG  FLF   ++L  D L FA PQ+L  +I+FVE+ D  P+WKG +YA L+ V  
Sbjct  324   PIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLA  383

Query  638   TIQTFFQAHYFIKAQTAGMRVRSAVIAAIYRKALRISVSARKDSTVGEMVNLMAVDTQRL  697
               QTF    YF +    G+R+R+A+I AIYRKALRIS S +K+STVGE+VNLMAVD QR 
Sbjct  384   AAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRF  443

Query  698   MDLCHHVNLLWSAPLQITLALYFLWDMLGPSALAGVAVLGVFIPINSVIANAMKKLQIQQ  757
             M+L  ++N++WSAPLQI LALYFLW  LGPS LAG+AV+ + IP+N VIA+ +K  QI+Q
Sbjct  444   MELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQ  503

Query  758   MKMKDRRIKMMNEVLGGVRVLKQYAWELSYQKYVQHLREKEMAILKKAAYLQCFTSFLWT  817
             MK KD R+K+MNEVL G++VLK YAWE S++K V  +R+KE+A L+  AYL   TSFLW+
Sbjct  504   MKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS  563

Query  818   CAPFLVSLASFATFVLVDENNVLDAQTAFVSLSLFNIMRHPLTLIPQAIAAVIQASVSMK  877
             CAPFLVSL +FAT+VL+DENNVLDA   FVSLSLFNI+R PLT++P  I  ++Q  VS+ 
Sbjct  564   CAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVN  623

Query  878   RLNDFINKEELSADSVTHELTEKDPLVIEKGNFMWGPEEPLVLNNINLRVKQGSLVAIVG  937
             R+N F+N EEL  +SV H+ ++  P+ IE G F WG E  + L NIN+ VK+GSLVA+VG
Sbjct  624   RINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVG  681

Query  938   SVGSGKSSLLSALLGDLHRVSGRVNTKGSVAYVPQQAWIQNASLRENILFGQPLSNRQYY  997
             +VGSGKSS++ A LG++ +++G VNT G +AYVPQQAWIQNA++R+NILFGQ    ++Y 
Sbjct  682   TVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYN  741

Query  998   RVVDACALKQDLQMLP---------------GGDQTEI----------------------  1020
             +V+DACAL+ D+ +L                GG +  I                      
Sbjct  742   KVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAV  801

Query  1021  -------------------GEKTRVLVTHGITFLPEVDHILVLKDGEITEEGTYKDLLEK  1061
                                  K+RVLVTHG+TFLP+VD I V+K GEI+E GT+  L++ 
Sbjct  802   DAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN  861

Query  1062  KGAFADFLVQHLQDTMQGELSPQTGIKIFDIYNIEELKQQLERT------MGREELQHRL  1115
             KGAFADF++QHLQ+  + E                 +K+Q+  T      +G  E   +L
Sbjct  862   KGAFADFIIQHLQEGNEEEEELNQ------------IKRQISSTADVPELLGTVEKAIKL  909

Query  1116  SQTAS-SLSGSRSSLGDLTPRTGSLRR  1141
             ++T S S S S +S   L    GSLRR
Sbjct  910   ARTESLSDSISVTSADSLMGGGGSLRR  936


 Score = 129 bits (325),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 90/145 (62%), Gaps = 1/145 (1%)

Query  1305  VRWQVYGHYFRAIGMGFSFLALASNAVVQGFQVGSNFWLSVWSTNGYGDSNGSEPRNLYL  1364
             V + VY HY +++G+  S   L  N V Q FQ+GSN WL+ W+ N    +N +  R++YL
Sbjct  974   VEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWA-NDQNVANDTGLRDMYL  1032

Query  1365  GVYAALGLGQVLSVTVATLSVSIGTLNAAMLLHNKLLWNVLRLPQSLFDTTPIGRILTRF  1424
             GVY A G GQV +   ++L++S+G L  + LLH  LL+  LR P  LFDTTP+GRI+ RF
Sbjct  1033  GVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRF  1092

Query  1425  SSDVNVLDGTISMILRMCIPNIYRV  1449
             S D++ +D  +   +R+ I   Y V
Sbjct  1093  SKDIDTIDNVLPFNIRVVIGQAYMV  1117


 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (47%), Gaps = 13/118 (11%)

Query  918   LVLNNINLRVKQGSLVAIVGSVGSGKSSLLSALLGDLHRVSGRVNTKG------------  965
             LVL  ++  ++ G  V IVG  G+GKSSL  AL   +    GR++  G            
Sbjct  1324  LVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLR  1383

Query  966   -SVAYVPQQAWIQNASLRENILFGQPLSNRQYYRVVDACALKQDLQMLPGGDQTEIGE  1022
               +  +PQ   + + SLR N+   +  ++ + ++ ++   LK  ++ L  G   EI E
Sbjct  1384  SRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAE  1441


>Q7KTC0_DROME unnamed protein product
Length=1549

 Score = 725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/987 (42%), Positives = 578/987 (59%), Gaps = 148/987 (15%)

Query  244   VHRTCPGNSLLTDANLTWYTHDPDVTPCVERTVLLWLPCAALWALCPVEASYILHSKTRD  303
             + R C   S   +A  TWYT+DPD TPC E+T L+W PCA  WA    +  Y+  S  R+
Sbjct  9     MDRFC--GSTFWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYLKASLDRN  66

Query  304   IPWNWRSISK-LVLIGVLMLLCLTDLAVVFHDHSLGYHVYPVGFCSPIIEIATLVLIGVL  362
             IPWN  ++SK LV +G+L++  L DL                        I  LV  G  
Sbjct  67    IPWNKLNVSKALVNLGLLVITAL-DL------------------------IMALVKKGGD  101

Query  363   MLLCLTDLAVVFHDHSLGYHVYPVGFCSPIIEIATLVVSAAFLVFMRERGLRTSGPLFIF  422
               L L DL V                  PII+ AT ++   F+   R+ G++T+G  FIF
Sbjct  102   SELPLYDLDV----------------WGPIIKFATFLLLFIFIPLNRKYGVQTTGCQFIF  145

Query  423   WLLLVLCGAPQFRTEL-------------EALSRDF---DVKTVTYLIHYPVVVVLFFLH  466
             W LL +   P+ RTE+             +   +DF   + + V++ I +    ++  L+
Sbjct  146   WFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILN  205

Query  467   CIADLPPAHSYYPIPEKPCPEKSASFPSRVIFKWIDPLVWRGFRTSLEMPDLFDLNPEDH  526
             C AD  P  + Y   E   PE SASF SR+ ++W D +  +G+R  LE  DL+DL P+D 
Sbjct  206   CFADGMPRQTKYQRGENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDS  265

Query  527   SRIVVPKFDKHWDCMVARKTRDS---DAKATFQKASGSISFRGGKQQKPVR----LSLLG  579
                V+P F  HW+  V +  ++    + KA F  ++G+++F     +K  R     S++ 
Sbjct  266   CSEVMPIFAHHWNQNVRKNYKNKARVEPKAQF--SNGNVTFENPHGEKNGRKKGMASIMP  323

Query  580   PLIKAFGSTFLFSISLRLTQDLLAFANPQILKYMIAFVESDD--PDWKGYMYAALMLVCG  637
             P+ K+FG  FLF   ++L  D L FA PQ+L  +I+FVE+ D  P+WKG +YA L+ V  
Sbjct  324   PIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLA  383

Query  638   TIQTFFQAHYFIKAQTAGMRVRSAVIAAIYRKALRISVSARKDSTVGEMVNLMAVDTQRL  697
               QTF    YF +    G+R+R+A+I AIYRKALRIS S +K+STVGE+VNLMAVD QR 
Sbjct  384   AAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRF  443

Query  698   MDLCHHVNLLWSAPLQITLALYFLWDMLGPSALAGVAVLGVFIPINSVIANAMKKLQIQQ  757
             M+L  ++N++WSAPLQI LALYFLW  LGPS LAG+AV+ + IP+N VIA+ +K  QI+Q
Sbjct  444   MELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQ  503

Query  758   MKMKDRRIKMMNEVLGGVRVLKQYAWELSYQKYVQHLREKEMAILKKAAYLQCFTSFLWT  817
             MK KD R+K+MNEVL G++VLK YAWE S++K V  +R+KE+A L+  AYL   TSFLW+
Sbjct  504   MKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS  563

Query  818   CAPFLVSLASFATFVLVDENNVLDAQTAFVSLSLFNIMRHPLTLIPQAIAAVIQASVSMK  877
             CAPFLVSL +FAT+VL+DENNVLDA   FVSLSLFNI+R PLT++P  I  ++Q  VS+ 
Sbjct  564   CAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVN  623

Query  878   RLNDFINKEELSADSVTHELTEKDPLVIEKGNFMWGPEEPLVLNNINLRVKQGSLVAIVG  937
             R+N F+N EEL  +SV H+ ++  P+ IE G F WG E  + L NIN+ VK+GSLVA+VG
Sbjct  624   RINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVG  681

Query  938   SVGSGKSSLLSALLGDLHRVSGRVNTKGSVAYVPQQAWIQNASLRENILFGQPLSNRQYY  997
             +VGSGKSS++ A LG++ +++G VNT G +AYVPQQAWIQNA++R+NILFGQ    ++Y 
Sbjct  682   TVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYN  741

Query  998   RVVDACALKQDLQMLP---------------GGDQTEI----------------------  1020
             +V+DACAL+ D+ +L                GG +  I                      
Sbjct  742   KVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAV  801

Query  1021  -------------------GEKTRVLVTHGITFLPEVDHILVLKDGEITEEGTYKDLLEK  1061
                                  K+RVLVTHG+TFLP+VD I V+K GEI+E GT+  L++ 
Sbjct  802   DAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN  861

Query  1062  KGAFADFLVQHLQDTMQGELSPQTGIKIFDIYNIEELKQQLERT------MGREELQHRL  1115
             KGAFADF++QHLQ+  + E                 +K+Q+  T      +G  E   +L
Sbjct  862   KGAFADFIIQHLQEGNEEEEELNQ------------IKRQISSTADVPELLGTVEKAIKL  909

Query  1116  SQTAS-SLSGSRSSLGDLTPRTGSLRR  1141
             ++T S S S S +S   L    GSLRR
Sbjct  910   ARTESLSDSISVTSADSLMGGGGSLRR  936


 Score = 104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 77/129 (60%), Gaps = 2/129 (2%)

Query  1305  VRWQVYGHYFRAIGMGFSFLALASNAVVQGFQVGSNFWLSVWSTNGYGDSNGSEPRNLYL  1364
             V + VY HY +++G+  S   L  N V Q FQ+GSN WL+ W+ N    +N +  R++YL
Sbjct  974   VEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWA-NDQNVANDTGLRDMYL  1032

Query  1365  GVYAALGLGQVLSVTVATLSVSIGTLNAAMLLHNKLLWNVLRLPQ-SLFDTTPIGRILTR  1423
             GVY A G GQ +    A + V +G   AA  +HN+LL  ++R      FD TPIGR+L  
Sbjct  1033  GVYGAFGFGQGVLAYFAVVIVYLGGFQAAKTIHNELLAVIIRGSVCRFFDITPIGRLLNS  1092

Query  1424  FSSDVNVLD  1432
             FS D++V+D
Sbjct  1093  FSGDMDVVD  1101


 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (47%), Gaps = 13/118 (11%)

Query  918   LVLNNINLRVKQGSLVAIVGSVGSGKSSLLSALLGDLHRVSGRVNTKG------------  965
             LVL  ++  ++ G  V IVG  G+GKSSL  AL   +    GR++  G            
Sbjct  1325  LVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLR  1384

Query  966   -SVAYVPQQAWIQNASLRENILFGQPLSNRQYYRVVDACALKQDLQMLPGGDQTEIGE  1022
               +  +PQ   + + SLR N+   +  ++ + ++ ++   LK  ++ L  G   EI E
Sbjct  1385  SRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAE  1442


>Q7KTB8_DROME unnamed protein product
Length=1548

 Score = 725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/987 (42%), Positives = 578/987 (59%), Gaps = 148/987 (15%)

Query  244   VHRTCPGNSLLTDANLTWYTHDPDVTPCVERTVLLWLPCAALWALCPVEASYILHSKTRD  303
             + R C   S   +A  TWYT+DPD TPC E+T L+W PCA  WA    +  Y+  S  R+
Sbjct  9     MDRFC--GSTFWNATETWYTNDPDFTPCFEQTALVWTPCAFYWAFVIFDFYYLKASLDRN  66

Query  304   IPWNWRSISK-LVLIGVLMLLCLTDLAVVFHDHSLGYHVYPVGFCSPIIEIATLVLIGVL  362
             IPWN  ++SK LV +G+L++  L DL                        I  LV  G  
Sbjct  67    IPWNKLNVSKALVNLGLLVITAL-DL------------------------IMALVKKGGD  101

Query  363   MLLCLTDLAVVFHDHSLGYHVYPVGFCSPIIEIATLVVSAAFLVFMRERGLRTSGPLFIF  422
               L L DL V                  PII+ AT ++   F+   R+ G++T+G  FIF
Sbjct  102   SELPLYDLDV----------------WGPIIKFATFLLLFIFIPLNRKYGVQTTGCQFIF  145

Query  423   WLLLVLCGAPQFRTEL-------------EALSRDF---DVKTVTYLIHYPVVVVLFFLH  466
             W LL +   P+ RTE+             +   +DF   + + V++ I +    ++  L+
Sbjct  146   WFLLTVLSIPRCRTEVRLDAERQKILNSQQPSEQDFSWEEYQFVSFFIFFTFTSIMLILN  205

Query  467   CIADLPPAHSYYPIPEKPCPEKSASFPSRVIFKWIDPLVWRGFRTSLEMPDLFDLNPEDH  526
             C AD  P  + Y   E   PE SASF SR+ ++W D +  +G+R  LE  DL+DL P+D 
Sbjct  206   CFADGMPRQTKYQRGENEIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDS  265

Query  527   SRIVVPKFDKHWDCMVARKTRDS---DAKATFQKASGSISFRGGKQQKPVR----LSLLG  579
                V+P F  HW+  V +  ++    + KA F  ++G+++F     +K  R     S++ 
Sbjct  266   CSEVMPIFAHHWNQNVRKNYKNKARVEPKAQF--SNGNVTFENPHGEKNGRKKGMASIMP  323

Query  580   PLIKAFGSTFLFSISLRLTQDLLAFANPQILKYMIAFVESDD--PDWKGYMYAALMLVCG  637
             P+ K+FG  FLF   ++L  D L FA PQ+L  +I+FVE+ D  P+WKG +YA L+ V  
Sbjct  324   PIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLA  383

Query  638   TIQTFFQAHYFIKAQTAGMRVRSAVIAAIYRKALRISVSARKDSTVGEMVNLMAVDTQRL  697
               QTF    YF +    G+R+R+A+I AIYRKALRIS S +K+STVGE+VNLMAVD QR 
Sbjct  384   AAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRF  443

Query  698   MDLCHHVNLLWSAPLQITLALYFLWDMLGPSALAGVAVLGVFIPINSVIANAMKKLQIQQ  757
             M+L  ++N++WSAPLQI LALYFLW  LGPS LAG+AV+ + IP+N VIA+ +K  QI+Q
Sbjct  444   MELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQ  503

Query  758   MKMKDRRIKMMNEVLGGVRVLKQYAWELSYQKYVQHLREKEMAILKKAAYLQCFTSFLWT  817
             MK KD R+K+MNEVL G++VLK YAWE S++K V  +R+KE+A L+  AYL   TSFLW+
Sbjct  504   MKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWS  563

Query  818   CAPFLVSLASFATFVLVDENNVLDAQTAFVSLSLFNIMRHPLTLIPQAIAAVIQASVSMK  877
             CAPFLVSL +FAT+VL+DENNVLDA   FVSLSLFNI+R PLT++P  I  ++Q  VS+ 
Sbjct  564   CAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVN  623

Query  878   RLNDFINKEELSADSVTHELTEKDPLVIEKGNFMWGPEEPLVLNNINLRVKQGSLVAIVG  937
             R+N F+N EEL  +SV H+ ++  P+ IE G F WG E  + L NIN+ VK+GSLVA+VG
Sbjct  624   RINKFLNSEELDPNSVLHDSSKPHPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVG  681

Query  938   SVGSGKSSLLSALLGDLHRVSGRVNTKGSVAYVPQQAWIQNASLRENILFGQPLSNRQYY  997
             +VGSGKSS++ A LG++ +++G VNT G +AYVPQQAWIQNA++R+NILFGQ    ++Y 
Sbjct  682   TVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYN  741

Query  998   RVVDACALKQDLQMLP---------------GGDQTEI----------------------  1020
             +V+DACAL+ D+ +L                GG +  I                      
Sbjct  742   KVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAV  801

Query  1021  -------------------GEKTRVLVTHGITFLPEVDHILVLKDGEITEEGTYKDLLEK  1061
                                  K+RVLVTHG+TFLP+VD I V+K GEI+E GT+  L++ 
Sbjct  802   DAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN  861

Query  1062  KGAFADFLVQHLQDTMQGELSPQTGIKIFDIYNIEELKQQLERT------MGREELQHRL  1115
             KGAFADF++QHLQ+  + E                 +K+Q+  T      +G  E   +L
Sbjct  862   KGAFADFIIQHLQEGNEEEEELNQ------------IKRQISSTADVPELLGTVEKAIKL  909

Query  1116  SQTAS-SLSGSRSSLGDLTPRTGSLRR  1141
             ++T S S S S +S   L    GSLRR
Sbjct  910   ARTESLSDSISVTSADSLMGGGGSLRR  936


 Score = 106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 82/145 (57%), Gaps = 1/145 (1%)

Query  1305  VRWQVYGHYFRAIGMGFSFLALASNAVVQGFQVGSNFWLSVWSTNGYGDSNGSEPRNLYL  1364
             V + VY HY +++G+  S   L  N V Q FQ+GSN WL+ W+ N    +N +  R++YL
Sbjct  974   VEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWA-NDQNVANDTGLRDMYL  1032

Query  1365  GVYAALGLGQVLSVTVATLSVSIGTLNAAMLLHNKLLWNVLRLPQSLFDTTPIGRILTRF  1424
             GVY A G GQV S   + + V +G L     +  +L  N+L  PQ+ FD  P  RIL R 
Sbjct  1033  GVYGAFGFGQVFSYIGSVVIVYLGALIGTRKIFIQLFGNILHAPQAYFDIKPRARILDRL  1092

Query  1425  SSDVNVLDGTISMILRMCIPNIYRV  1449
             ++D+  LD  +  ++R+    ++RV
Sbjct  1093  ANDIYKLDVVLPELIRVFNSQVFRV  1117


 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (47%), Gaps = 13/118 (11%)

Query  918   LVLNNINLRVKQGSLVAIVGSVGSGKSSLLSALLGDLHRVSGRVNTKG------------  965
             LVL  ++  ++ G  V IVG  G+GKSSL  AL   +    GR++  G            
Sbjct  1324  LVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLR  1383

Query  966   -SVAYVPQQAWIQNASLRENILFGQPLSNRQYYRVVDACALKQDLQMLPGGDQTEIGE  1022
               +  +PQ   + + SLR N+   +  ++ + ++ ++   LK  ++ L  G   EI E
Sbjct  1384  SRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAE  1441



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= augustus-scaffold3884-size236876-processed-gene-0.2-mRNA-1

Length=78
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CHIF_DROME  unnamed protein product                                   47.0    1e-07
SVKA_DICDI  unnamed protein product                                   26.2    3.3  
Q7KTG2_DROME  unnamed protein product                                 25.0    7.4  


>CHIF_DROME unnamed protein product
Length=1711

 Score = 47.0 bits (110),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%)

Query  20   GYCEICQVKYSDQKTHVQSESHLQFVSNDRNFVSLDLLIQRRSSMDAFFQ  69
            G CEIC+++Y     H+QS+ H  F  N  NF++LD LIQ  + ++ F +
Sbjct  312  GVCEICKLEYDILNIHLQSKDHELFAKNSDNFLALDTLIQSSADVNRFLE  361


>SVKA_DICDI unnamed protein product
Length=478

 Score = 26.2 bits (56),  Expect = 3.3, Method: Composition-based stats.
 Identities = 15/52 (29%), Positives = 25/52 (48%), Gaps = 3/52 (6%)

Query  21   YCEICQVKYSDQKTHVQSESHLQFVSNDRNFVSLDLLIQRRSSMDAFFQLNG  72
            +C +C  K  +Q+   +     +F+   +   SL  LI+RR     + QLNG
Sbjct  238  FCALCLNKDPNQRPTAKDLLKHKFIKAAKKTSSLTDLIERRQK---WLQLNG  286


>Q7KTG2_DROME unnamed protein product
Length=4333

 Score = 25.0 bits (53),  Expect = 7.4, Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query  20    GYCEICQVKYSDQKTHVQSESHLQFV--SNDRNFVSLDLLIQRRSSMDAFFQLNG  72
             G+    +  Y D+ + VQ+  HL+ +  S   N  SL+ +I RR  +  F+ +  
Sbjct  1446  GHSVAVKANYKDRSSRVQALHHLKMIVESPSFNITSLN-IIYRRKQLLIFYDIQA  1499



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold5298-size165525-augustus-gene-0.9-mRNA-1

Length=658
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PTCD3_DROME  unnamed protein product                                  601     0.0  
VP13D_DROME  unnamed protein product                                  31.2    3.5  
GCP3_DROME  unnamed protein product                                   30.4    6.6  


>PTCD3_DROME unnamed protein product
Length=652

 Score = 601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/623 (48%), Positives = 428/623 (69%), Gaps = 10/623 (2%)

Query  27   STAAAIEE--VKIPVKIKRGPTDILRALASTVGCDYTAARYKYHDDPYLIPASNIGKRTY  84
            +TAA  E+  ++IP +I+R PTD+L+ALASTV  DYTA  YKYHDDP+LIP SN  KRTY
Sbjct  27   TTAAPAEDAPIEIPNRIERSPTDLLQALASTVARDYTAPHYKYHDDPFLIPMSNAAKRTY  86

Query  85   ALAKESGRKAAFWIRQENPNLFQHKVAEPPIQAFYPKPVYDESSDVSEETLQKCIEDVCI  144
            A++KESGRKAA WI++E+  LF H+ A+P I+ F P  VY E S V E +L + I    +
Sbjct  87   AMSKESGRKAAKWIKEEHRELFMHQEAQPAIEKFAPSMVYTEDSVVDETSLAQLISQGEL  146

Query  145  SDATTVYELLNSKGADISQETKLSLLELLCFYNCEDALSEDLIEERWFKQGSRKKERHRK  204
             DA  VY LL  KG  IS E K SLLEL+CF+N ++ + E+ IEERWF Q ++++ER  K
Sbjct  147  KDAVLVYNLLEQKGNPISPELKQSLLELVCFHNNQEPIPEEYIEERWFLQNNKRRERSGK  206

Query  205  TWKDSGLAETIFHSLEEPKTPAAYCALIQGMLRFYQVDRAWQLYEETLVKGFPLTTDTYN  264
            TWKD  LAE ++  +E PKTP +Y +LI+GM ++ Q +RA+ L +E   K   L T+T+N
Sbjct  207  TWKDGDLAEKLYSEIE-PKTPQSYASLIRGMAKYLQCERAYALLQEAGEKQVQLDTNTFN  265

Query  265  SLLSVASYLREGNDLRWKLVEELLTAMAKQGLAPSNTTLNSVLEAVSHMGLHRQARTYAL  324
            S++ + S+L++  + RW+L ++LL  M++Q L P+  TLN+VL+ +S  G  + AR  AL
Sbjct  266  SVIEIVSFLKDTAEQRWQLCKDLLNEMSQQKLRPNLGTLNAVLQCISTFGNFKVARAAAL  325

Query  325  QALKEFTSVGVEPSLATYYHLLVIFCKERGPVSSVLVDIMAHISGRAFTIQHVQDTHFFT  384
            QAL EF  +GV PSL +YY+LL+IFC+ERGPVS V+VDI+  ISG+ F IQH +DT+FF 
Sbjct  326  QALPEFKQLGVNPSLGSYYYLLIIFCRERGPVSHVIVDILNDISGKEFQIQHPKDTYFFA  385

Query  385  MAMEVCRYHLQDKDLAWEVDRLLHTADNYDLIGDSYKESVYYRNFFALLCSTEPLEVFME  444
             AM+VCR HL DK LA +VD LLHT  NYDL+GDS+KES+YYRN+ ALLC TE  E FM 
Sbjct  386  TAMDVCRNHLHDKSLAKKVDELLHTGKNYDLVGDSFKESIYYRNYLALLCQTESTEDFML  445

Query  445  FYNKMVPNIYVPEPGIMEEIIKAVDMNGAAEHLPLLWSHMVIFDHTDRENLLVAILAAMI  504
             Y+ +VPNIY+PEPGIMEEI++A+++NGA E++P LWS MV+FDHT RE+LL+ +L  ++
Sbjct  446  SYDLLVPNIYIPEPGIMEEILRAIEINGAVEYVPRLWSDMVVFDHTHRESLLLYVLRILV  505

Query  505  RNQP----PASSDLAAQFADVAWAVWQKLVDQNKERYSRLTXXA-MLGDVMVLYLRAGRF  559
             N+P    PA + L  Q A VA  ++++ V++  +R  +++    MLGD++ L +R G +
Sbjct  506  DNKPNPDSPAQAQLPEQGAKVALDMFER-VEEAIKRLRKVSFTGQMLGDILTLLVRGGSY  564

Query  560  PDACTVLRKLDKDQHTVVGVPGVSVLQLFLDSCVQLGDVENAMSCIQYCGDAGYPECGQL  619
              A  V   +DK+QH + G P ++ L  F+D+ VQ      A+  +QY  +  + +  +L
Sbjct  565  EKATEVFAHIDKNQHRIPGTPSLNALIEFVDASVQEKSPSQALFALQYAVENNF-DSREL  623

Query  620  AQLLQSSLPLSANQVEKLASIVG  642
            A+ +     L+   + KL S+VG
Sbjct  624  AKRIHEGFTLNETHLSKLKSLVG  646


>VP13D_DROME unnamed protein product
Length=3919

 Score = 31.2 bits (69),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (3%)

Query  80    GKRTYALAKESGRKAAFWIRQENPNLFQHKVAEPPIQA  117
             GK+   + K SG ++  W+   N  L +H+ + PPIQ 
Sbjct  3172  GKKVVIVEKNSGDRSQLWLMNSNGQL-EHEGSTPPIQT  3208


>GCP3_DROME unnamed protein product
Length=917

 Score = 30.4 bits (67),  Expect = 6.6, Method: Compositional matrix adjust.
 Identities = 41/153 (27%), Positives = 67/153 (44%), Gaps = 27/153 (18%)

Query  142  VCISDATTVYELLNSKGADISQETKLSLLELLCFYNCEDALSEDLIEERWFKQGSRK---  198
            V  SD +T +  + S G  +  + K    E L  ++ + A+  D  E + F+Q S     
Sbjct  289  VKFSDVSTGFNAIGSMGQALISKLK----EELANFHGQVAMLHD--EMQRFRQASVNGIA  342

Query  199  KERHRKTWKDSGLAETIFHSLEEPKTPAAYCALIQGMLRFYQVDRAWQLYEETLVKGFPL  258
             +  + +  D+G   T+F      K  A Y   +  M    ++  A Q+      KG  L
Sbjct  343  NKGKKDSGPDAGDEMTLF------KLLAWYIKPLHRMQWLTKIADACQVK-----KGGDL  391

Query  259  TTDTYNSLLSVASYLREGNDLRWKLVEELLTAM  291
             +  Y+       +L  GND+  KLVE+LLTA+
Sbjct  392  ASTVYD-------FLDNGNDMVNKLVEDLLTAI  417



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold5370-size181238-augustus-gene-0.8-mRNA-1

Length=223
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZU4_DROME  unnamed protein product                                 188     1e-59
Q86NC2_CAEEL  unnamed protein product                                 150     1e-44
Q585M6_TRYB2  unnamed protein product                                 29.3    2.8  


>Q9VZU4_DROME unnamed protein product
Length=265

 Score = 188 bits (478),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/227 (51%), Positives = 140/227 (62%), Gaps = 33/227 (15%)

Query  2    VRNHDAAQRAQLSDFGKYVAECLPKYVQKVQLTACDELEVLIVPEGVVPVLQFLKDHHNA  61
            VR  DA  R+ LSDFG+YVAECLPKYVQKVQLTA DELEVLI PEGVVPVLQFLKDHH A
Sbjct  49   VRQPDAVARSHLSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQFLKDHHQA  108

Query  62   QFTNLVDIAGMDVPSRQYS-TLLFSAMVRNHDAAQRAQLSDFGKYVAECLPKYVQKVQLT  120
            QFTNLVDIAG+DVP R+    ++++ +   +++  R +      Y  E  P        +
Sbjct  109  QFTNLVDIAGVDVPCRKNRFEVVYNLLSLRYNSRIRVK-----TYTDELTP------LDS  157

Query  121  ACDELEVLIVPEGVVPVLQFLKDHHNAQFTNLVDIAGM-------------DVPSRQYRF  167
            AC+      V +      + + D +   F N  D+  +             D P   Y  
Sbjct  158  ACE------VHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQRRDFPLSGY-V  210

Query  168  EVRYDDEKKRVVVEPLELAQEFRKFELSAPWEQFPNFQEGANAVVEV  214
            E+RYDDEKKRVV EPLELAQEFRKF+LSAPWEQFPNF+  AN   EV
Sbjct  211  ELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFR-NANPPAEV  256


>Q86NC2_CAEEL unnamed protein product
Length=268

 Score = 150 bits (378),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 120/232 (52%), Gaps = 37/232 (16%)

Query  6    DAAQRAQLSDFGKYVAECLPKYVQKVQLTACDELEVLIVPEGVVPVLQFLKDHHNAQFTN  65
            D  +R +L++FGKY AECLPK+VQKVQ  A DELE+LI P GVVPVL FLK +H+AQFTN
Sbjct  48   DEHKRERLANFGKYAAECLPKFVQKVQFAAGDELELLIHPSGVVPVLSFLKGNHSAQFTN  107

Query  66   LVDIAGMDVPSRQYS-TLLFSAMVRNHDAAQRAQLSDFGKYVAECLPKYVQKVQLTACDE  124
            L  I GMDVP+R+    +++S      +A  R +      Y  E  P           D 
Sbjct  108  LTFITGMDVPTRKNRLEVIYSLYSVRFNARVRVRT-----YTDEIAPIDSATPVFKGADW  162

Query  125  LEVLIVPEGVVPVLQFLKDHHNAQFTNLVDIAGM-------------DVPSRQYRFEVRY  171
             E  +             D +   F N  D+  +             D P   Y  EVRY
Sbjct  163  FEREVY------------DMYGVWFNNHPDLRRILTDYGFEGHPFRKDYPLSGYN-EVRY  209

Query  172  DDEKKRVVVEPLELAQEFRKFELSAPWEQFPNFQ-----EGANAVVEVKTTT  218
            D E KRVV EP ELAQEFRKF+L+ PWE FP F+      G   ++EV   T
Sbjct  210  DPELKRVVYEPSELAQEFRKFDLNTPWETFPAFRNQSITSGYETILEVAEPT  261


>Q585M6_TRYB2 unnamed protein product
Length=526

 Score = 29.3 bits (64),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 16/35 (46%), Positives = 21/35 (60%), Gaps = 2/35 (6%)

Query  50   PVLQFLKDHHN--AQFTNLVDIAGMDVPSRQYSTL  82
            PVLQ  + H+N  A+  N+ D A   VP RQ+ TL
Sbjct  368  PVLQLWRAHNNVNARLANVKDGADPLVPKRQFPTL  402



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold1378-size512979-augustus-gene-2.2-mRNA-1

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SBKH_DROME  unnamed protein product                                   238     3e-73
PAR1_CAEEL  unnamed protein product                                   101     2e-22
CHK1_CAEEL  unnamed protein product                                   93.6    3e-20


>SBKH_DROME unnamed protein product
Length=456

 Score = 238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/381 (35%), Positives = 211/381 (55%), Gaps = 25/381 (7%)

Query  53   GSVSRRAI---------GGSIHRIREFELEKVCLVEEFDILQIVGEGWFGKILLAEHRAT  103
             SVSRR+          GG IH I + EL  +   ++++I + + EG F KILL  HR T
Sbjct  64   ASVSRRSSIYKKPDKNDGGQIHLIPDVELPLMTFADQYNIEKTLAEGCFAKILLCRHRPT  123

Query  104  GAEMVLKALPKPYVALRDFYREFHYGLHLAAHKNVITTYDVAFETAGFYVFAQEYAPLGD  163
               +VLKA+      +++F +EFHY   L+ H ++++ Y VAF+T  +YVFA E+AP GD
Sbjct  124  NTLVVLKAVHAELTTIKEFQKEFHYNYELSHHHHILSAYAVAFQTMDYYVFAMEHAPYGD  183

Query  164  LTSNVSDTGIGELHSKRVAKQLASALEHLHMRDLVHRDVKLDNILVFKSDFLRIKLCDFG  223
            L SN+   G+ E   K +++QL+SAL  +H ++LVHRD+K++NILVF  DF R+KLCDFG
Sbjct  184  LASNIGPNGLHENACKLISEQLSSALGFMHSKNLVHRDLKIENILVFTPDFTRVKLCDFG  243

Query  224  ETRRAGTLVRR-RNEWLPYAPPEVLLTDSDETYKAVTSHDVWQFGVVIFVCLTGCLPWQK  282
             T + G LV + ++ W    PPE L    +E ++ +   D WQFG++++  LTG  PWQ 
Sbjct  244  ATTKKGLLVHKVKHTWTSCVPPEQLELIKNERFQCLPVSDSWQFGILLYNILTGNPPWQS  303

Query  283  AS-NDDPRYVRYLHWHSSSGVLMPVRRPKLFKLLTSKAQRLFRKFLEPRAEKRPSSLADL  341
            A    D  Y  ++ +          + P  F+  + +  R FRK+L    E R   + ++
Sbjct  304  ADWVKDQSYANFMKYEQRKT----TKVPDNFRRFSPRLMRCFRKYLSHDPEDR-CKITEV  358

Query  342  NKFVDDRWL-----TKTSLDRNTGPEQDEDGLCPSMYSFHSSVE-EKNKLLF--TLTQYG  393
             K++ DRW+     T  S    +    D+D  C  +      +  ++NKL F   ++ YG
Sbjct  359  AKYMKDRWVECRISTSKSATLISPTNHDQDS-CIYLNQREGRLSGDENKLRFKRMMSTYG  417

Query  394  IETTVDRSAKKDRIRDWIQSS  414
            ++  +D++  + R+ DW+ + 
Sbjct  418  LDIPIDQAMVRRRVWDWLSTC  438


>PAR1_CAEEL unnamed protein product
Length=1192

 Score = 101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 95/356 (27%), Positives = 173/356 (49%), Gaps = 41/356 (12%)

Query  78   VEEFDILQIVGEGWFGKILLAEHRATGAEMVLKALPKPYV---ALRDFYREFHYGLHLAA  134
            V ++ +L+ +G+G F K+ LA+H  TG E+ +K + K  +   +L+  +RE      L  
Sbjct  167  VGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIMKQLD-  225

Query  135  HKNVITTYDVAFETAGFYVFAQEYAPLGDLTSNVSDTG-IGELHSKRVAKQLASALEHLH  193
            H N++  Y V  ET        EYA  G++   +   G + E  ++   +Q+ SA+++LH
Sbjct  226  HPNIVKLYQV-METEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLH  284

Query  194  MRDLVHRDVKLDNILVFKSDFLRIKLCDFG--ETRRAGTLVRRRNEWLPYAPPEVLLTDS  251
             ++++HRD+K +N+L+ +   + IK+ DFG   T   G  +       PYA PE+    S
Sbjct  285  SKNIIHRDLKAENLLLDQD--MNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELF---S  339

Query  252  DETYKAVTSHDVWQFGVVIFVCLTGCLPWQKASNDDPRYVRYLHWHSSSGVLMPVRRPKL  311
             + Y      DVW  GV+++  ++G LP+      D + ++ L       VL    R   
Sbjct  340  GKKYDGPEV-DVWSLGVILYTLVSGSLPF------DGQNLKELRER----VLRGKYRIPF  388

Query  312  FKLLTSKAQRLFRKFLEPRAEKRPSSLADLNKFVDDRWLTKTSLDRNTGPEQDEDGLCPS  371
            +  +++  + L +KFL    ++R S    L+  + DRW+       N G E DE  L P 
Sbjct  389  Y--MSTDCENLLKKFLVINPQRRSS----LDNIMKDRWM-------NVGYEDDE--LKPF  433

Query  372  MYSFHSSVEEKN-KLLFTLTQYGI-ETTVDRSAKKDRIRDWIQSSVIGEETEEDLD  425
            +      ++E+  + L  + Q G  +  +  S +K++  D   + ++  E + D+D
Sbjct  434  IEPPKDQIDEQRIEKLIQIFQLGFNKAAILESVEKEKFEDIHATYLLLGERKSDMD  489


>CHK1_CAEEL unnamed protein product
Length=503

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 136/274 (50%), Gaps = 39/274 (14%)

Query  81   FDILQIVGEGWFGKILLAEHRATGAEMVLKALPKPYVA------LRDFYREFHYGLHLAA  134
            + ++Q +GEG FG++LL  +  T    V  A+ K  +A      + +  +E+     ++A
Sbjct  24   YRVVQTLGEGAFGEVLLIVN--TKNPEVAAAMKKINIANKSKDFIDNIRKEYLLQKRVSA  81

Query  135  --HKNVITTYDVAFETAGFYVFAQEYAPLGDLTSNVS-DTGIGELHSKRVAKQLASALEH  191
              H NVI    +  +   +Y+F  EYA  G+L   +  D G+  + ++   KQL   L+ 
Sbjct  82   VGHDNVIRMIGMRNDPQFYYLFL-EYADGGELFDKIEPDCGMSPVFAQFYFKQLICGLKF  140

Query  192  LHMRDLVHRDVKLDNILVFKSDFLRIKLCDFGETRRAGTLVRRRNE---------WLPYA  242
            +H  D+VHRD+K +N+L+  +  L+I   DFG      TL R + E          +PYA
Sbjct  141  IHDNDVVHRDIKPENLLLTGTHVLKIS--DFG----MATLYRNKGEERLLDLSCGTIPYA  194

Query  243  PPEVLLTDSDETYKAVTSHDVWQFGVVIFVCLTGCLPWQKASNDDPRYVRYLHWHSSSGV  302
             PE+    + + Y+     DVW  G+V+   LTG LPW +AS+       Y+ W S++ +
Sbjct  195  APELC---AGKKYRG-PPVDVWSSGIVLIAMLTGELPWDRASDASQ---SYMGWISNTSL  247

Query  303  LMPVRRPKLFKLLTSKAQRLFRKFLEPRAEKRPS  336
                 RP  +K +  +A  + RK +  + +KR +
Sbjct  248  ---DERP--WKKIDVRALCMLRKIVTDKTDKRAT  276



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold4512-size208729-augustus-gene-1.8-mRNA-1

Length=988
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VF51_DROME  unnamed protein product                                 375     3e-112
Q8IND5_DROME  unnamed protein product                                 355     5e-105
Q9VF53_DROME  unnamed protein product                                 295     1e-83 


>Q9VF51_DROME unnamed protein product
Length=1254

 Score = 375 bits (964),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 240/645 (37%), Positives = 335/645 (52%), Gaps = 117/645 (18%)

Query  33   TVLTINGKQYTVD-GSYPLDMSLNTFIRDVANLKGTKFMCEEGGCGCCVVTVSVKNPATG  91
            T  +ING  Y V+  + P D++LNTFIR+ A L  TKFMC+EGGCG C+  V        
Sbjct  3    TKFSINGLPYAVNLTNLPPDITLNTFIREHAQLTATKFMCQEGGCGACICVVRDGK----  58

Query  92   EVQTFAINSCLTFVLSCHGWSVTTVEGIGYRQKGYHPVQSTLAKFNGSQCGYCSPGMVMN  151
              +++A+NSCLT + +C    + T EG+G ++ GY+P+Q  LAK NG+QCG+CSPG VMN
Sbjct  59   --RSWAVNSCLTLLNTCAQLEIVTAEGLGNQRTGYNPIQKRLAKMNGTQCGFCSPGFVMN  116

Query  152  MYSLLTSNSNR-TMQEVENLFGGNICRCTGYRPILDAFKSFATDAPAALRDKCTDIEDVG  210
            MY L+  N  + TM EVEN FGGNICRCTGYRPILDA KSFA D+  A+  +C DIED+ 
Sbjct  117  MYGLMEQNEGKVTMAEVENSFGGNICRCTGYRPILDAMKSFAVDSNIAIPAECGDIEDLK  176

Query  211  KLKCPFKTWNGMSKSLVEEAQSQPVSGLAVPVHIIGYNG-DWYRVDSIDAIFDVF-KIIG  268
               CP KT              Q  SG  +P  ++  +G  W+   S+  +FD   K+  
Sbjct  177  PRNCP-KT-------------GQACSGSCLPSTLVYEDGVQWHWPKSLSELFDALDKVKD  222

Query  269  NSTYQLVAGNTARGVYHVVVEPRVYIDIGSVSGLRAVAVNSDNITLGANISLTDFMAFLR  328
            +  + LVAGNTA GVY    + + +ID+  V  L   +     + LGAN+SLT  M  +R
Sbjct  223  SEEFMLVAGNTAHGVYRRSTDIKHFIDVQGVEELHQHSSEGQQLKLGANLSLTQTMEIIR  282

Query  329  GHAQTAGYSYFTQMAKHIDLVANTPVR-------DIMPRAQN-----------------V  364
              ++  G+ Y   +  HIDL+AN PVR       +I  + QN                 V
Sbjct  283  TTSKQPGFEYLDVLWNHIDLIANVPVRNSGTLAGNISIKKQNPEFPSDIFISFEALNVKV  342

Query  365  HAVVNAG------FMFKLGTDGKCQVLEKPAIVYGGITSKFVH--------ASSTETYLA  410
             A+ NA           LGT+ K  VL K  ++      K+++        A +   Y+ 
Sbjct  343  VALKNAADEKEMSLAEYLGTNDKKLVL-KTFVLPAYPKDKYIYESYKIMPRAQNAHAYVN  401

Query  411  GKYLCQQDT-------------------LAGALQKL---------------NSEVQPDVR  436
              +L + +                     A A++KL                ++++  ++
Sbjct  402  AAFLLELEADNKVKSARICFGGIRPDFIHASAIEKLLVGQNPYESSLVEQTFTKLEDLIK  461

Query  437  PPEM----GPRYRKGLASALFYKVTAAPHARRYSSVVVRQFVLSVAGKKAKASYVSGGEV  492
            P E+     P YR  LA  LFYK             +++   ++  G+K    + SGG++
Sbjct  462  PDEVLPDASPAYRSKLACGLFYK------------FLLKHAPVAEVGEK----FRSGGQI  505

Query  493  LQRPVSSGQQKYQTTPSDYPVSQPVLKLEAFAQCSGEAEYVNDRLTVPGELYAALVLTTQ  552
            LQRP+SSG Q +QT   +YPV+Q V K+E   QCSGEA Y+ND LT    L+ A V  T+
Sbjct  506  LQRPLSSGLQVFQTQKKNYPVTQAVEKVEGMIQCSGEATYMNDVLTTSNTLHCAFVGATK  565

Query  553  PSGKIDSIDATEALKYPGVVAFYSAQDIPGQNNITPNPTLFTVED  597
                IDSIDA+EALK PGV+AFYSA+DIPG N        F VE+
Sbjct  566  VGSTIDSIDASEALKQPGVIAFYSAKDIPGTNTFCEPSFGFEVEE  610


 Score = 43.5 bits (101),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query  904  ELFCSGTVLYHGQPVGVIAAKTRQIANKAKRLVKIHYSGVAKPTIHVRETISRADTRAET  963
            E+FCSG V +  QP GVI A T   A++A +LV+I YS    P+   +   S  D  A +
Sbjct  610  EIFCSGLVRHSEQPAGVIVALTADQAHRAAKLVRISYS---NPSSDFKLQPSLGDVFA-S  665

Query  964  TTPATKTPLNSGKSGTGGKVK  984
             TP +   + + KS T  K+K
Sbjct  666  PTPDSSRIVPASKS-TSKKIK  685


>Q8IND5_DROME unnamed protein product
Length=1264

 Score = 355 bits (912),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 218/617 (35%), Positives = 320/617 (52%), Gaps = 79/617 (13%)

Query  35   LTINGKQYTVDGS-YPLDMSLNTFIRDVANLKGTKFMCEEGGCGCCVVTVSVKNPATGEV  93
              +NG  Y V  + YP D +LNTF+R+  +L  TK+MC EGGCG CV  +  ++P T EV
Sbjct  5    FNVNGFPYEVQAADYPPDTTLNTFLREHLHLTATKYMCLEGGCGSCVCVIRRRHPVTQEV  64

Query  94   QTFAINSCLTFVLSCHGWSVTTVEGIGYRQKGYHPVQSTLAKFNGSQCGYCSPGMVMNMY  153
            Q+ A NSCLT + +C    + T EG+G +  GYHP+Q  +A+ NG+QCGYCSPG VMNMY
Sbjct  65   QSRAANSCLTLLNTCDDAEIMTDEGLGNQLSGYHPIQKRVAQMNGTQCGYCSPGFVMNMY  124

Query  154  SLLTSNSNR-TMQEVENLFGGNICRCTGYRPILDAFKSFATDAPAALRDKCTDIEDVGKL  212
             LL  +  + +M +VE+ FGGN+CRCTGYRPILDA KSFA D+   +  +  DIED  +L
Sbjct  125  GLLEQHRGQVSMSQVEDAFGGNLCRCTGYRPILDAMKSFAVDSNVEVPAESVDIEDSFEL  184

Query  213  KCPFKTWNGMSKSLVEEAQSQPVSGLAVPVHIIGYNGDWYRVDSIDAIFDVFKIIGN-ST  271
             CP               QS   S    P+   G +  WY   ++  +F     + N   
Sbjct  185  LCP------------RTGQSCKGSCSRPPLRDHG-DSQWYWPKTLTELFGALSQVANGEL  231

Query  272  YQLVAGNTARGVYHVVVEPRVYIDIGSVSGLRAVAVNSDNITLGANISLTDFMAFLRGHA  331
            Y LVAGNTA GVY    + R +ID+  V  LR  ++ +D++ LG N++LTD M      A
Sbjct  232  YMLVAGNTAHGVYRRPRDIRHFIDVNMVPELRQYSIETDHLLLGGNVTLTDAMQVFLLAA  291

Query  332  QTAGYSYFTQMAKHIDLVANTPVRDIMPRAQNVHAVVNAGFMFKLGTDGKCQVLEKPAIV  391
            +  G+ Y  Q+ +H +L+AN PVR+    A N++ +    F F        + L+   +V
Sbjct  292  KRPGFEYCAQLWQHFNLIANVPVRNNGTLAGNIN-IKKQHFEFPSDVFITFEALDVHVLV  350

Query  392  Y---------------GGITSKFV-----------------------HASSTETYLAGKY  413
            Y               G  TSK V                        A +   Y+   +
Sbjct  351  YDNPSTQRVMNLLTYLGDTTSKLVLGGFILKAYPKDRFLFRSYKILPRAQNVHAYVNAGF  410

Query  414  LCQ----QDTLAGALQKLNSEVQPDV----RPPEMGP---RYRKGLASALFYKV------  456
            L +    Q  +  + +     ++PD     +  ++ P    Y     + +F ++      
Sbjct  411  LIEWQDIQHRIVHSARICFGNIRPDYIHDDQVEQLLPGRDLYDPATVAQIFQELPASLQP  470

Query  457  -----TAAPHARR-YSSVVVRQFVLSVAGK-KAKASYVSGGEVLQRPVSSGQQKYQTTPS  509
                  A+P  R+  +  ++ +F+L+ A K + +  + +GG +L+RP+SSG Q ++T   
Sbjct  471  EERPPEASPEYRQMLACSLLYKFLLATAPKERVRERFRTGGLLLERPLSSGSQSFETIKK  530

Query  510  DYPVSQPVLKLEAFAQCSGEAEYVNDRLTVPGELYAALVLTTQPSGKIDSIDATEALKYP  569
            +YPV+QPV KLE   QCSGEA Y+ND LT    ++ A V   +    I+ ID + AL+  
Sbjct  531  NYPVTQPVQKLEGLIQCSGEATYMNDLLTTSNAVHCAFVTAKRVGATIEQIDPSAALQCK  590

Query  570  GVVAFYSAQDIPGQNNI  586
            GVVAFYSA+DIPG NN 
Sbjct  591  GVVAFYSAEDIPGSNNF  607


 Score = 35.8 bits (81),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 35/79 (44%), Gaps = 7/79 (9%)

Query  904  ELFCSGTVLYHGQPVGVIAAKTRQIANKAKRLVKIHYS-------GVAKPTIHVRETISR  956
            E+F +G V Y  QP+GVIAA T   A  A  LV + Y+             +  ++T   
Sbjct  619  EVFVAGRVKYFDQPLGVIAALTHDAAVYAATLVVVTYARDQRKIFTTMNQVLAEKQTDRI  678

Query  957  ADTRAETTTPATKTPLNSG  975
              T+ +T  P    PL  G
Sbjct  679  VSTKKDTVEPLKLPPLAPG  697


>Q9VF53_DROME unnamed protein product
Length=1273

 Score = 295 bits (756),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 158/339 (47%), Positives = 215/339 (63%), Gaps = 21/339 (6%)

Query  35   LTINGKQYTVD-GSYPLDMSLNTFIRDVANLKGTKFMCEEGGCGCCVVTVSVKNPATGEV  93
            +TING  + V+  + P D+SLNTFIR+ A L GTKFMC+EGGCG CV T++  +P TGE+
Sbjct  5    ITINGTSHEVNLSALPADISLNTFIREYAGLTGTKFMCQEGGCGVCVCTLTGIHPETGEL  64

Query  94   QTFAINSCLTFVLSCHGWSVTTVEGIGYRQKGYHPVQSTLAKFNGSQCGYCSPGMVMNMY  153
            +T+A+NSCLT + +C G  VTT EG+G ++ GYH +Q  LAK NG+QCGYCSPG+VMNMY
Sbjct  65   RTWAVNSCLTLLNTCLGLEVTTSEGLGNKRVGYHAIQQRLAKMNGTQCGYCSPGIVMNMY  124

Query  154  SLLTSNSNR-TMQEVENLFGGNICRCTGYRPILDAFKSFATDAPAALRDKCTDIEDVGKL  212
             LL S   + TM+EVEN FGGNICRCTGYRPILDA KSFA D+   +  +C DIED+   
Sbjct  125  GLLKSKGGKVTMEEVENSFGGNICRCTGYRPILDAMKSFAVDSNIQVPAECIDIEDLSTK  184

Query  213  KCPFKTWNGMSKSLVEEAQSQPVSGLAVPVHIIGYNGDWYRVDSIDAIFDVFKIIGNST-  271
            KCP KT    S S  ++   QP      P        D  R     ++ D+F  +  +  
Sbjct  185  KCP-KTGQTCSGSCKKQ---QPKGSQLYP--------DGSRWSWPVSLGDLFAALQGAVK  232

Query  272  ----YQLVAGNTARGVYHVVVEPRVYIDIGSVSGLRAVAVNSDN--ITLGANISLTDFMA  325
                Y LVAGNTA GVY    + + +ID+  ++ L+   +++DN  +TLG N+SL++ M 
Sbjct  233  EKLPYMLVAGNTAHGVYRRSPDIKAFIDVSGLAELKGHKLSADNSSLTLGGNLSLSETME  292

Query  326  FLRGHAQTAGYSYFTQMAKHIDLVANTPVRDIMPRAQNV  364
              R    T G+ Y +Q+ +H+D +AN PVR+    A N+
Sbjct  293  LCRQLENTKGFEYLSQVWQHLDWIANVPVRNAGTLAGNL  331


 Score = 168 bits (426),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 136/248 (55%), Gaps = 25/248 (10%)

Query  357  IMPRAQNVHAVVNAGFMFKLGTDGKCQVLEKPAIVYGGITSKFVHASSTETYLAGKYLCQ  416
            IMPRAQN HA VNA F+ +   D K   ++   I +GGI  +FVHA++ E  +  K   +
Sbjct  402  IMPRAQNAHAYVNAAFLVEFTADAK---VKSARICFGGIHPEFVHATAIENLIRDKNPFE  458

Query  417  QDTLAGALQKLNSEVQPDVRPPEMGPRYRKGLASALFYKVTAAPHARRYSSVVVRQFVLS  476
               +  A  +L++ +QPD   P+  P YR+ LA  LFYK                 F+L 
Sbjct  459  NGLVEKAFGQLSTLLQPDAVLPDASPVYRRKLACGLFYK-----------------FLLK  501

Query  477  VAGKKAK---ASYVSGGEVLQRPVSSGQQKYQTTPSDYPVSQPVLKLEAFAQCSGEAEYV  533
            +A ++ +   + +V+GG +L+RPVSSGQQ ++T    YPV++   K E   QCSGEA Y 
Sbjct  502  IAAQRKQGLGSRFVTGGSLLKRPVSSGQQSFETFQEHYPVTKATEKHEGLIQCSGEATYS  561

Query  534  NDRLTVPGELYAALVLTTQPSGKIDSIDATEALKYPGVVAFYSAQDIPGQNNITPN--PT  591
            ND  T   +L+AA V+  +   K+  +D   AL  PGVVA+  A+DIPG N + P     
Sbjct  562  NDLPTQHNQLWAAFVIAKKVGAKVTKVDTQPALDLPGVVAYLDAKDIPGPNYVGPKIRDQ  621

Query  592  LFTVEDEE  599
             F  +DEE
Sbjct  622  FFFPKDEE  629


 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 31/45 (69%), Gaps = 0/45 (0%)

Query  904  ELFCSGTVLYHGQPVGVIAAKTRQIANKAKRLVKIHYSGVAKPTI  948
            ELF +G + ++GQPVG+I A +  +AN+A  LVK+ Y G A+  +
Sbjct  629  ELFATGEIKFYGQPVGIILANSNSLANRAAELVKLTYEGGAEEIL  673



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


Query= maker-scaffold3689-size247165-augustus-gene-0.2-mRNA-1

Length=587
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z026_DROME  unnamed protein product                                 482     1e-155
Q9VMF3_DROME  unnamed protein product                                 483     8e-155
B7Z025_DROME  unnamed protein product                                 482     1e-154


>B7Z026_DROME unnamed protein product
Length=1422

 Score = 482 bits (1241),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 248/488 (51%), Positives = 326/488 (67%), Gaps = 57/488 (12%)

Query  67    LEMNLFNGN------TTALPTNQNVEISNNNYIMHSLKVFRSDQTFKYLLVHQETTAQET  120
             L++N  N +       + L TN        +Y  H LKV+++DQT KY+L+++ETTA E 
Sbjct  725   LQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKETTAHEV  784

Query  121   VQLALHEFGVAEPGCGYFLCEVSVAEGGLVKQSRLPDHLHNLAERIGVNSRYYLKAYGST  180
             V L L EFG+ +P   + LCEVSV +GG+VKQ RLPD L NLAERI   +RYYLK   ST
Sbjct  785   VMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLKLNDST  844

Query  181   EPLVPDELVPELIKESKVHFLQLNSAQVAIQLTLQDFSIFKQIQNTEYVDHIFKLKSRYG  240
             EPLVPDEL  EL++ES VHFL LN+ ++AIQLTLQDF+ F+QI++TEYVD +F+L+SRYG
Sbjct  845   EPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFELRSRYG  904

Query  241   TPVLSRFEELANREMFWVITEICSELNLVRRTKSIKQFIKLARHCKVCNNFNSMFAILSG  300
              P+LS+F EL NREMFWV++EIC+E N+VRR K +KQFIK+ARHCK C NFNSMFAI+SG
Sbjct  905   VPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMFAIVSG  964

Query  301   LRYRSVSRLKLSWERLPVKYQKMFSDLEEFIDPSRNMSKYRQHVHSK-ISKSPIIPLYPL  359
             L + +VSRL+ +WE+LP KYQ++F+DL++ +DPSRNMSKYRQ V ++ +++ PIIP YP+
Sbjct  965   LGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPIIPFYPI  1024

Query  360   VMKDLTFIHEGNETFIDGLINFGKLRKFAEVVRSLNNMCSCPYDLFTLLEQGKALFAIKH  419
             V KDLTFIH GN+T +DGLINF KLR  A+ VR L +MCS PYDL ++LE       +K 
Sbjct  1025  VKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILE-------LKG  1077

Query  420   LENEVKKFAQSHVSGGQSSSAAMKTLNLNLTSSKCQTNEDGTMHNRRKTSPAALNLKKMF  479
                    F+ + +S  QS++AA   +  N   +  +         RRK S AA N KKMF
Sbjct  1078  QSPSNALFSLNQMSASQSNAAAGTVIAANAGQATIK---------RRKKSTAAPNPKKMF  1128

Query  480   EEREDEEERDEEEENEEEDEYEEEEENEEEEMEMEMAQMVRRVKEYLNNINVITDEEKLY  539
             EE                                  AQMVRRVK YLN++ +++DE+ L+
Sbjct  1129  EE----------------------------------AQMVRRVKAYLNSLKILSDEDLLH  1154

Query  540   VMSLMCEP  547
               SL CEP
Sbjct  1155  KFSLECEP  1162


>Q9VMF3_DROME unnamed protein product
Length=1573

 Score = 483 bits (1243),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 248/488 (51%), Positives = 326/488 (67%), Gaps = 57/488 (12%)

Query  67    LEMNLFNGN------TTALPTNQNVEISNNNYIMHSLKVFRSDQTFKYLLVHQETTAQET  120
             L++N  N +       + L TN        +Y  H LKV+++DQT KY+L+++ETTA E 
Sbjct  725   LQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKETTAHEV  784

Query  121   VQLALHEFGVAEPGCGYFLCEVSVAEGGLVKQSRLPDHLHNLAERIGVNSRYYLKAYGST  180
             V L L EFG+ +P   + LCEVSV +GG+VKQ RLPD L NLAERI   +RYYLK   ST
Sbjct  785   VMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLKLNDST  844

Query  181   EPLVPDELVPELIKESKVHFLQLNSAQVAIQLTLQDFSIFKQIQNTEYVDHIFKLKSRYG  240
             EPLVPDEL  EL++ES VHFL LN+ ++AIQLTLQDF+ F+QI++TEYVD +F+L+SRYG
Sbjct  845   EPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFELRSRYG  904

Query  241   TPVLSRFEELANREMFWVITEICSELNLVRRTKSIKQFIKLARHCKVCNNFNSMFAILSG  300
              P+LS+F EL NREMFWV++EIC+E N+VRR K +KQFIK+ARHCK C NFNSMFAI+SG
Sbjct  905   VPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMFAIVSG  964

Query  301   LRYRSVSRLKLSWERLPVKYQKMFSDLEEFIDPSRNMSKYRQHVHSK-ISKSPIIPLYPL  359
             L + +VSRL+ +WE+LP KYQ++F+DL++ +DPSRNMSKYRQ V ++ +++ PIIP YP+
Sbjct  965   LGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPIIPFYPI  1024

Query  360   VMKDLTFIHEGNETFIDGLINFGKLRKFAEVVRSLNNMCSCPYDLFTLLEQGKALFAIKH  419
             V KDLTFIH GN+T +DGLINF KLR  A+ VR L +MCS PYDL ++LE       +K 
Sbjct  1025  VKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILE-------LKG  1077

Query  420   LENEVKKFAQSHVSGGQSSSAAMKTLNLNLTSSKCQTNEDGTMHNRRKTSPAALNLKKMF  479
                    F+ + +S  QS++AA   +  N   +  +         RRK S AA N KKMF
Sbjct  1078  QSPSNALFSLNQMSASQSNAAAGTVIAANAGQATIK---------RRKKSTAAPNPKKMF  1128

Query  480   EEREDEEERDEEEENEEEDEYEEEEENEEEEMEMEMAQMVRRVKEYLNNINVITDEEKLY  539
             EE                                  AQMVRRVK YLN++ +++DE+ L+
Sbjct  1129  EE----------------------------------AQMVRRVKAYLNSLKILSDEDLLH  1154

Query  540   VMSLMCEP  547
               SL CEP
Sbjct  1155  KFSLECEP  1162


>B7Z025_DROME unnamed protein product
Length=1569

 Score = 482 bits (1241),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 248/488 (51%), Positives = 326/488 (67%), Gaps = 57/488 (12%)

Query  67    LEMNLFNGN------TTALPTNQNVEISNNNYIMHSLKVFRSDQTFKYLLVHQETTAQET  120
             L++N  N +       + L TN        +Y  H LKV+++DQT KY+L+++ETTA E 
Sbjct  725   LQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKETTAHEV  784

Query  121   VQLALHEFGVAEPGCGYFLCEVSVAEGGLVKQSRLPDHLHNLAERIGVNSRYYLKAYGST  180
             V L L EFG+ +P   + LCEVSV +GG+VKQ RLPD L NLAERI   +RYYLK   ST
Sbjct  785   VMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLKLNDST  844

Query  181   EPLVPDELVPELIKESKVHFLQLNSAQVAIQLTLQDFSIFKQIQNTEYVDHIFKLKSRYG  240
             EPLVPDEL  EL++ES VHFL LN+ ++AIQLTLQDF+ F+QI++TEYVD +F+L+SRYG
Sbjct  845   EPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFELRSRYG  904

Query  241   TPVLSRFEELANREMFWVITEICSELNLVRRTKSIKQFIKLARHCKVCNNFNSMFAILSG  300
              P+LS+F EL NREMFWV++EIC+E N+VRR K +KQFIK+ARHCK C NFNSMFAI+SG
Sbjct  905   VPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMFAIVSG  964

Query  301   LRYRSVSRLKLSWERLPVKYQKMFSDLEEFIDPSRNMSKYRQHVHSK-ISKSPIIPLYPL  359
             L + +VSRL+ +WE+LP KYQ++F+DL++ +DPSRNMSKYRQ V ++ +++ PIIP YP+
Sbjct  965   LGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPIIPFYPI  1024

Query  360   VMKDLTFIHEGNETFIDGLINFGKLRKFAEVVRSLNNMCSCPYDLFTLLEQGKALFAIKH  419
             V KDLTFIH GN+T +DGLINF KLR  A+ VR L +MCS PYDL ++LE       +K 
Sbjct  1025  VKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILE-------LKG  1077

Query  420   LENEVKKFAQSHVSGGQSSSAAMKTLNLNLTSSKCQTNEDGTMHNRRKTSPAALNLKKMF  479
                    F+ + +S  QS++AA   +  N   +  +         RRK S AA N KKMF
Sbjct  1078  QSPSNALFSLNQMSASQSNAAAGTVIAANAGQATIK---------RRKKSTAAPNPKKMF  1128

Query  480   EEREDEEERDEEEENEEEDEYEEEEENEEEEMEMEMAQMVRRVKEYLNNINVITDEEKLY  539
             EE                                  AQMVRRVK YLN++ +++DE+ L+
Sbjct  1129  EE----------------------------------AQMVRRVKAYLNSLKILSDEDLLH  1154

Query  540   VMSLMCEP  547
               SL CEP
Sbjct  1155  KFSLECEP  1162



Lambda      K        H
   0.318    0.131    0.399 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6681103968


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold1279-size534615-augustus-gene-4.5-mRNA-1

Length=395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MR81_DROME  unnamed protein product                                 49.7    3e-06
Q0KHR4_DROME  unnamed protein product                                 49.7    3e-06
Q24137_DROME  unnamed protein product                                 47.4    2e-05


>Q8MR81_DROME unnamed protein product
Length=1186

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/108 (29%), Positives = 55/108 (51%), Gaps = 3/108 (3%)

Query  280   LSDMASRLIRNYFVASRRLRPHCLPVGAVNTITRLSEAWARLALQQEVSPAHVMAVLFLY  339
             L+D A  +++ Y+V SR+ RP+         + +L+E +A+LAL+ EV  + V   +F  
Sbjct  1060  LTDGAQHMLQKYYVISRKERPNVFSSKTYIVLKQLAECFAKLALRLEVLESDVCVAIFHC  1119

Query  340   EEAMTAVFGPCLVTPRPPPTAYQHLPLHVQIDCKMKDFSEWAEQHISS  387
             E  +  +FG      + PP  +    +   ID  M  F+ W  Q+++S
Sbjct  1120  EHFVQGIFGA--KENQAPPAVFNFNVISC-IDPYMNKFTRWLLQYLNS  1164


>Q0KHR4_DROME unnamed protein product
Length=1186

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 31/108 (29%), Positives = 55/108 (51%), Gaps = 3/108 (3%)

Query  280   LSDMASRLIRNYFVASRRLRPHCLPVGAVNTITRLSEAWARLALQQEVSPAHVMAVLFLY  339
             L+D A  +++ Y+V SR+ RP+         + +L+E +A+LAL+ EV  + V   +F  
Sbjct  1060  LTDGAQHMLQKYYVISRKERPNVFSSKTYIVLKQLAECFAKLALRLEVLESDVCVAIFHC  1119

Query  340   EEAMTAVFGPCLVTPRPPPTAYQHLPLHVQIDCKMKDFSEWAEQHISS  387
             E  +  +FG      + PP  +    +   ID  M  F+ W  Q+++S
Sbjct  1120  EHFVQGIFGA--KENQAPPAVFNFNVISC-IDPYMNKFTRWLLQYLNS  1164


>Q24137_DROME unnamed protein product
Length=1186

 Score = 47.4 bits (111),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/108 (28%), Positives = 54/108 (50%), Gaps = 3/108 (3%)

Query  280   LSDMASRLIRNYFVASRRLRPHCLPVGAVNTITRLSEAWARLALQQEVSPAHVMAVLFLY  339
             L+D A  +++ Y+V SR+ RP+         + +L+E +A +AL+ EV  + V   +F  
Sbjct  1060  LTDGAQHMLQKYYVISRKERPNVFSSKTYIVLKQLAECFANVALRLEVLESDVCVAIFHC  1119

Query  340   EEAMTAVFGPCLVTPRPPPTAYQHLPLHVQIDCKMKDFSEWAEQHISS  387
             E  +  +FG      + PP  +    +   ID  M  F+ W  Q+++S
Sbjct  1120  EHFVQGIFGA--KENQAPPAVFNFNVISC-IDPYMNKFTRWLLQYLNS  1164



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold5971-size140842-augustus-gene-0.2-mRNA-1

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGJ7_DROME  unnamed protein product                                 94.7    6e-20
Q8SYM6_DROME  unnamed protein product                                 94.4    6e-20
Q94534_DROME  unnamed protein product                                 90.9    3e-19


>Q9VGJ7_DROME unnamed protein product
Length=895

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 127/265 (48%), Gaps = 28/265 (11%)

Query  91   LLKNSTFIPREVHMFNEILPRMSTLLTRALPNRHKEFFPRGYY--TRKTP--SYLIALED  146
            +L  + F   E  ++++ILP++  L           F P+ +   + K P  +  + + D
Sbjct  136  MLAMANFFNSENKVYSDILPKLEELYKAK--GLDITFAPKAFKLDSVKEPKLANTVLMSD  193

Query  147  LSPKGFKSPKRKDGLDLKQCLLALRALARFHAASVI-IQ----REDESLFSLFDKYFYEN  201
            LS  GFK+  R + L+L+Q   AL+ LA+FHAAS + +Q     ED+          + N
Sbjct  194  LSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQ----------FVN  243

Query  202  SDTGEDAERLPTKFISMLAE----TMKSRKDFD--PSWADRLQNRYKTLLKDLNHLRKRD  255
               G + E L   +  M+A      M + K+F     + ++L+  +  +  D  HL   D
Sbjct  244  GVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTAD  303

Query  256  DGRFNVLIRGDFAIHNVMYRHSKSSGQVESFMMVDFQTCSYSSPALDLQQFIMISANDKV  315
               FNVL  GD  ++N++++   S G+V+  + VDFQ   Y SP  DL   I+ S +   
Sbjct  304  PDEFNVLNHGDCWMNNLLFKLD-SKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDY  362

Query  316  RANHISILLREYHTELTTTLKSLGI  340
            + ++    +R YH +LT  L  LG 
Sbjct  363  KLDYFEYFIRHYHEQLTQHLDLLGF  387


 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 72/282 (26%), Positives = 126/282 (45%), Gaps = 30/282 (11%)

Query  69   DTTQHSLSLIVKTLVKDSSNVGLLKNSTFIPREVHMFNEILPRMSTLLTRALPNRHKEFF  128
            D T  + S I+K  V+  S      +    P+E+ M+ + +P    L   A       F 
Sbjct  548  DHTSKTFSYILK--VQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDA--GLTVTFT  603

Query  129  PRGYYTRKT--PSYLIALEDLSPKGFKSPKRKDGLDLKQCLLALRALARFHAASVIIQRE  186
               +   K     YL+ +E+L  KGFK   R  GL+++    +L+ LA++HAAS+  +  
Sbjct  604  ANSFVLNKAVKEEYLL-MENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKEL  662

Query  187  DESLFSLFDKYFYENSDTGEDAERLPTKFISMLAE----------TMKSRKDFDPSWADR  236
            + +   L++   Y         E+    F +M A           T +   ++ P     
Sbjct  663  NGAYPPLYNDGIY--------IEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPKLEWI  714

Query  237  LQNRYKTLLKDLNHLRKRDDGRFNVLIRGDFAIHNVMYRHSKSSGQVESFMMVDFQTCSY  296
            + N    +L+D     K ++  FNVL  GD  I+N+M+++  + G+++   ++D Q   Y
Sbjct  715  IDNHVDQVLED----AKINEQAFNVLNHGDAWINNIMFQYD-AEGRLKETYLLDHQNAKY  769

Query  297  SSPALDLQQFIMISANDKVRANHISILLREYHTELTTTLKSL  338
             +PA DL  F++ SA   ++ +    L+R YH  L    K L
Sbjct  770  GNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLL  811


>Q8SYM6_DROME unnamed protein product
Length=803

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/265 (29%), Positives = 127/265 (48%), Gaps = 28/265 (11%)

Query  91   LLKNSTFIPREVHMFNEILPRMSTLLTRALPNRHKEFFPRGYY--TRKTP--SYLIALED  146
            +L  + F   E  ++++ILP++  L           F P+ +   + K P  +  + + D
Sbjct  44   MLAMANFFNSENKVYSDILPKLEELYKAK--GLDITFAPKAFKLDSVKEPKLANTVLMSD  101

Query  147  LSPKGFKSPKRKDGLDLKQCLLALRALARFHAASVI-IQ----REDESLFSLFDKYFYEN  201
            LS  GFK+  R + L+L+Q   AL+ LA+FHAAS + +Q     ED+          + N
Sbjct  102  LSQDGFKNLNRLECLNLEQTKFALKKLAQFHAASSMNVQVNGPYEDQ----------FVN  151

Query  202  SDTGEDAERLPTKFISMLAE----TMKSRKDFD--PSWADRLQNRYKTLLKDLNHLRKRD  255
               G + E L   +  M+A      M + K+F     + ++L+  +  +  D  HL   D
Sbjct  152  GVMGGNKEVLMAFYEGMVASFRTALMANLKNFKNGEEFREKLEKAFVQIFLDFEHLMTAD  211

Query  256  DGRFNVLIRGDFAIHNVMYRHSKSSGQVESFMMVDFQTCSYSSPALDLQQFIMISANDKV  315
               FNVL  GD  ++N++++   S G+V+  + VDFQ   Y SP  DL   I+ S +   
Sbjct  212  PDEFNVLNHGDCWMNNLLFK-LDSKGEVQDMLFVDFQNPKYGSPTQDLFYLILTSVHIDY  270

Query  316  RANHISILLREYHTELTTTLKSLGI  340
            + ++    +R YH +LT  L  LG 
Sbjct  271  KLDYFEYFIRHYHEQLTQHLGLLGF  295


 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 72/282 (26%), Positives = 126/282 (45%), Gaps = 30/282 (11%)

Query  69   DTTQHSLSLIVKTLVKDSSNVGLLKNSTFIPREVHMFNEILPRMSTLLTRALPNRHKEFF  128
            D T  + S I+K  V+  S      +    P+E+ M+ + +P    L   A       F 
Sbjct  456  DHTSKTFSYILK--VQPKSTPDNFTDVNMFPKEMEMYQKYVPAFEQLYKDA--GLTVTFT  511

Query  129  PRGYYTRKT--PSYLIALEDLSPKGFKSPKRKDGLDLKQCLLALRALARFHAASVIIQRE  186
               +   K     YL+ +E+L  KGFK   R  GL+++    +L+ LA++HAAS+  +  
Sbjct  512  ANSFVLNKAVKEEYLL-MENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAASIKYKEL  570

Query  187  DESLFSLFDKYFYENSDTGEDAERLPTKFISMLAE----------TMKSRKDFDPSWADR  236
            + +   L++   Y         E+    F +M A           T +   ++ P     
Sbjct  571  NGAYPPLYNDGIY--------IEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPKLEWI  622

Query  237  LQNRYKTLLKDLNHLRKRDDGRFNVLIRGDFAIHNVMYRHSKSSGQVESFMMVDFQTCSY  296
            + N    +L+D     K ++  FNVL  GD  I+N+M+++  + G+++   ++D Q   Y
Sbjct  623  IDNHVDQVLED----AKINEQAFNVLNHGDAWINNIMFQYD-AEGRLKETYLLDHQNAKY  677

Query  297  SSPALDLQQFIMISANDKVRANHISILLREYHTELTTTLKSL  338
             +PA DL  F++ SA   ++ +    L+R YH  L    K L
Sbjct  678  GNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKLL  719


>Q94534_DROME unnamed protein product
Length=427

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 0/66 (0%)

Query  493  AALRDVRVDLPDAVSPGDTVTLKCEYDLEGESLYTVKWYKGRQEFFRFVPKELPHTRVFP  552
            AALRDVRV +P AV   +   LKC YD+E +SLY+VKWYKGR+EF+R+ PKE P  +VF 
Sbjct  25   AALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPKETPPMKVFH  84

Query  553  LPGINV  558
             PG+ V
Sbjct  85   FPGVKV  90



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold16-size2099125-augustus-gene-8.3-mRNA-1

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TYDP1_DROME  unnamed protein product                                  321     2e-102
Q4Q3N1_LEIMA  unnamed protein product                                 48.9    1e-05 


>TYDP1_DROME unnamed protein product
Length=580

 Score = 321 bits (823),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 230/367 (63%), Gaps = 7/367 (2%)

Query  161  PKNKHGKESRESASEATPSAPSPVSHVTSKSSSSDSDKKQQSANKRTTAPPQMVSEKERQ  220
            PK    KE    +S + P+  +PV+  +S S S D++    SA+    A  Q  S   ++
Sbjct  62   PKQATNKEQEAHSSSSKPAVTAPVASGSSSSGSLDTNPSGSSAS--GPAASQDTSNLAKK  119

Query  221  RHLN--DLKQLMPRASNFGDTATKLKVAEPYNFFLTTVKASAPTHSEPLSLTFSELLHPS  278
            + LN  +++  +P     G  A KL+ A PYN FLT +  S PTHSEPLS+T  E+L  S
Sbjct  120  QKLNAKNIRDYIPVVIEKGGMAKKLERAAPYNMFLTAITDSKPTHSEPLSITLQEILDES  179

Query  279  LGDLESSLQINFMVDLGWVIANYYVHGHSKKPLLILHGEDAEDLRDTKKLPQHIKAVRIK  338
            LG++ES++QINFMVD+GW++ +YY  G   KPLL+L+G+++ +L    K  Q + A+R+K
Sbjct  180  LGEIESTVQINFMVDIGWLLGHYYFAGILDKPLLLLYGDESPELLSIGKFKQQVTAIRVK  239

Query  339  TPHPFGHHHTKMTLLRYTDGSIRVVVSTANLVESDWENRTQGLWVSPACPELPLGSDTGA  398
             P PF   HTKM  L Y+DGS+RVV+STANL E DW NRTQGLW+SP  P LP+ +DTGA
Sbjct  240  MPTPFATSHTKMMFLGYSDGSMRVVISTANLYEDDWHNRTQGLWISPKLPALPVDADTGA  299

Query  399  GDSPTEFKTDLLRYLTAYRLPQLQEWVVRVRRADFSAVKVCFVSSVPGTHRGAEFEK--W  456
            G+S T FK DL+ YL  Y++ QLQ W+ R+R +DFSA+ V F+ SVPG HR        W
Sbjct  300  GESLTGFKQDLMLYLVEYKISQLQPWIARIRNSDFSAINVFFLGSVPGGHREGSVRGHPW  359

Query  457  GHRRLSSLLRKHVTGAVDSSWSIVAQCSSIGSLGAEPESWMCAELRTSMTQRAGANLALQ  516
            GH RL+SLL KH    +D    +V Q SSIGSLGA  ++W+  +   S+ + +     L+
Sbjct  360  GHARLASLLAKH-AAPIDDRIPVVCQSSSIGSLGANVQAWIQQDFVNSLKKDSTPVGKLR  418

Query  517  SAPQFKV  523
              P FK+
Sbjct  419  QMPPFKM  425


>Q4Q3N1_LEIMA unnamed protein product
Length=828

 Score = 48.9 bits (115),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 81/210 (39%), Gaps = 50/210 (24%)

Query  340  PHPFGHHHTKMTLLRYTDGSIRVVVSTANLVESDWENRTQGLWVS--PACPELPLGSDTG  397
            P  FG +HTKM L     G +RV + TANLVE DW  ++QG++V   P  P     +D  
Sbjct  298  PVAFGTYHTKMALCINGKG-LRVSIFTANLVEQDWCWKSQGIYVQDFPWKPVTERSNDDS  356

Query  398  AGDSPTEFKTDLLRYLT---------AYRLPQLQEWVVR---------------------  427
            AG    E                   A  +  L+ +++R                     
Sbjct  357  AGTIMVETAARSTSNSNNGSNTFTKGAEFVAHLRHYLMRCGVSLASACASPADAASAAGP  416

Query  428  --------VRRADFSAVKVCFVSSVPGTHRGAE---FEKWGHRRLSSLLRKHVT------  470
                    +   DF+A  V  VSSVPGT+   E     + G  RL  +LR+         
Sbjct  417  LGIFETDFLSHIDFTAAAVWLVSSVPGTYAHGEVCPVYRVGLCRLGEVLRRSALTTATAP  476

Query  471  GAVDSSWSIVAQCSSIGSLGAEPESWMCAE  500
             +VD SW   +Q S   +     ++ MC E
Sbjct  477  ASVDLSWQYSSQGSLNPAFLNSLQAAMCGE  506



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold616-size752226-augustus-gene-5.2-mRNA-1

Length=328
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0X9_DROME  unnamed protein product                                 199     6e-63
Q95SW9_DROME  unnamed protein product                                 196     8e-62
Q9W068_DROME  unnamed protein product                                 53.5    5e-08


>Q9W0X9_DROME unnamed protein product
Length=219

 Score = 199 bits (506),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/220 (45%), Positives = 145/220 (66%), Gaps = 2/220 (1%)

Query  109  MCYVIITVRSLLWTLLTLAATLALLSAVLTPRWLVGPPRIKSSDNGTVVYSPTVGVYNRC  168
            MCYVIIT+ SL+W L +L A +    A++TPRWLVGP +  +    +  +  +VG+Y RC
Sbjct  1    MCYVIITIASLVWFLCSLVADMLFAVALVTPRWLVGPAQ-GTDSTASSHHQSSVGIYTRC  59

Query  169  -VRLHGRQSCGPFAVHGLATDPLVFPACWKAALVFLSTGLAIMVLTVLSSLLSSCVQSIC  227
             V   G   CG F + GLATD  V+P  WKAA+ F+  G +++ +TV+ +L++ C QS C
Sbjct  60   KVMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSAC  119

Query  228  KKSIFTLSGAAQAVAGIFIILGIMLHPAGWGAPRVQKLCGYEAAPFYPAECSLGWAFYSA  287
             KSI  ++  AQ VAGI ++LG+ LHP GW A R+Q+LCG +A PFYPA+CS+G +FY  
Sbjct  120  GKSIHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCG  179

Query  288  VGGVALTFLCSVLSVQAEVATSSDKVQFQIHQGRTLICLP  327
            + GV LTF  + +S++AE +    +V+ ++  G  L+C+P
Sbjct  180  IIGVLLTFTAAGISLKAESSNMRTRVRRRVEAGSKLVCIP  219


>Q95SW9_DROME unnamed protein product
Length=219

 Score = 196 bits (498),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/220 (45%), Positives = 144/220 (65%), Gaps = 2/220 (1%)

Query  109  MCYVIITVRSLLWTLLTLAATLALLSAVLTPRWLVGPPRIKSSDNGTVVYSPTVGVYNRC  168
            MCYVIIT  SL+W L +L A +    A++TPRWLVGP +   S   +   S +VG+Y RC
Sbjct  1    MCYVIITSASLVWFLCSLVADMLFAVALVTPRWLVGPAQGTDSTASSHRQS-SVGIYTRC  59

Query  169  -VRLHGRQSCGPFAVHGLATDPLVFPACWKAALVFLSTGLAIMVLTVLSSLLSSCVQSIC  227
             V   G   CG F + GLATD  V+P  WKAA+ F+  G +++ +TV+ +L++ C QS C
Sbjct  60   KVMQEGGFQCGRFDLDGLATDSSVYPNEWKAAMFFVMLGFSLLSVTVILTLITCCRQSAC  119

Query  228  KKSIFTLSGAAQAVAGIFIILGIMLHPAGWGAPRVQKLCGYEAAPFYPAECSLGWAFYSA  287
             KSI  ++  AQ VAGI ++LG+ LHP GW A R+Q+LCG +A PFYPA+CS+G +FY  
Sbjct  120  GKSIHNMTACAQVVAGICMMLGLFLHPMGWRANRIQRLCGMDAEPFYPADCSIGVSFYCG  179

Query  288  VGGVALTFLCSVLSVQAEVATSSDKVQFQIHQGRTLICLP  327
            + GV LTF  + +S++AE +    +V+ ++  G  L+C+P
Sbjct  180  IIGVLLTFTAAGISLKAESSNMRTRVRRRVEAGSKLVCIP  219


>Q9W068_DROME unnamed protein product
Length=265

 Score = 53.5 bits (127),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/207 (23%), Positives = 85/207 (41%), Gaps = 20/207 (10%)

Query  119  LLWTLLTLAATLALLSAVLTPRWLVGPPRIKSSDNGTVVYSPTVGVYNRCVRLHGRQSCG  178
            +LW + T+   +  + A +TP W+  P      DN     +  +G++ +C R     +C 
Sbjct  27   VLWAIFTICYAIIGIVAFVTPEWIGDP------DNDG---AGRLGLWQQCQRDEIFDNCR  77

Query  179  PFAVHGLATDPLVFPACWKAALVFLSTGLAIMVLTVLSSLLSSCVQSICKKSIFTLSGAA  238
                         F    + A  F+   +A+ +LT+       C+  +    +F L G  
Sbjct  78   RRWESIFEVPTFSF----QLATFFMLGAIALALLTIF---FLVCLLFMKSTRVFHLCGWM  130

Query  239  QAVAGIFIILGIMLHPAGWGAPRVQKLCGYEAAPFYPAECSLGWAFYSA----VGGVALT  294
            Q ++ I +I+     P GW +   +K+CG EA  F    C + WA+  A    + GV L 
Sbjct  131  QIISAICMIVACAAFPFGWNSDDFRKICGPEANRFELGLCGIRWAYPLAIIGCIDGVVLA  190

Query  295  FLCSVLSVQAEVATSSDKVQFQIHQGR  321
             L  +L+ +          Q  +++G 
Sbjct  191  TLAFILATRHVRLQPDPIYQNSLYKGE  217



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold3354-size270901-augustus-gene-1.5-mRNA-1

Length=617
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4LG93_DROME  unnamed protein product                             398     6e-127
Q9W2D5_DROME  unnamed protein product                                 399     7e-127
Q95SL0_DROME  unnamed protein product                                 331     2e-106


>A0A0B4LG93_DROME unnamed protein product
Length=987

 Score = 398 bits (1022),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 288/504 (57%), Gaps = 107/504 (21%)

Query  130  GRGYMAWLAAVSAAFVYNCWVIPLRSAFPYQSADIHPAWFAADCLADAVYLLDVALVKAR  189
            G+ Y++WL  VS +F+YN WVIPLR++FP+Q+ +    W A D  AD +YLLDV   K R
Sbjct  412  GKIYISWLCVVSLSFLYNAWVIPLRASFPFQTKENTNIWLACDFCADIIYLLDVVFFKHR  471

Query  190  LMYMEDGFWVAEPALARRRYFATLQFKCACVSSRLTAFQMDVLSLLPTDLLYLKYGADML  249
            +MY+ +GFWV    L R+ Y   LQFK   ++                 LLY K G   +
Sbjct  472  VMYLFEGFWVKNKNLTRKNYMRKLQFKLDLLALLPLE------------LLYFKLGTQAV  519

Query  250  VLRLPRLLKIQTFWEMYDRTAAVLRQSSVVRLSRSISYVIYVIHLNACGYYFFSAWREDG  309
             LR PR  KIQ+FWE++     V+     VR++++++Y++Y+IH+ A  YY +S ++  G
Sbjct  520  WLRFPRFFKIQSFWEVFRLLDRVISSPHFVRVAKTLTYMLYMIHITAALYYAYSDYQGLG  579

Query  310  STNWVFSGKGTPYIQCFYFATKTTTAMGRNPKPDTLLETIFMNISWLVGVFMFAILIGQS  369
               WVFSGKG P                                                
Sbjct  580  QNRWVFSGKGHP------------------------------------------------  591

Query  370  PLRRYIQCFYFATKTTTAMGRNPKPDTLLETIFMNISWLVGVFMFAILIGQVREQVFVSA  429
                Y++CF FATKT T++G+NPKP+   E +FM ++WL+GVF+FA+LIGQ+R+ +  + 
Sbjct  592  ----YVRCFAFATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIISTAT  647

Query  430  RLRTEYRNLVDGTLEYMRRLSVDSKVQDRM-----------------------------D  460
            R + EYR L D TLEYMRRL++  +VQ R+                             D
Sbjct  648  RNKHEYRQLEDETLEYMRRLNLSQEVQSRVKMWFQFTWEQQRTLDESNILDALPINLKTD  707

Query  461  IAIHVHINTLSKVQMFKDCDPALLRDLVPQLKRVLFLPGDYICRKKQLVIGHCVFQGEVG  520
            IAI VHI TLSKVQ+F DC+ ALLRDLV +L+ V FLPGD++CRK           GEVG
Sbjct  708  IAISVHIQTLSKVQLFADCEEALLRDLVLKLRAVTFLPGDFVCRK-----------GEVG  756

Query  521  KEMYIVQTGVVQVMEGKE---VIATLTEGSVFGEISLLELGRGNRRTADVRSIGFSNLFV  577
            +EMYIV+ G VQVM G     V+ATLTEGSVFGEISLL +   +RRTADVRS G+SNLFV
Sbjct  757  REMYIVKLGQVQVMGGPSSDVVLATLTEGSVFGEISLLGINGADRRTADVRSKGYSNLFV  816

Query  578  LSKHDFNETIANYPDAQDLLRKRA  601
            LSK D NE IA YP AQ +L+KRA
Sbjct  817  LSKSDLNEVIAYYPTAQAILKKRA  840


>Q9W2D5_DROME unnamed protein product
Length=1040

 Score = 399 bits (1025),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 288/504 (57%), Gaps = 107/504 (21%)

Query  130  GRGYMAWLAAVSAAFVYNCWVIPLRSAFPYQSADIHPAWFAADCLADAVYLLDVALVKAR  189
            G+ Y++WL  VS +F+YN WVIPLR++FP+Q+ +    W A D  AD +YLLDV   K R
Sbjct  465  GKIYISWLCVVSLSFLYNAWVIPLRASFPFQTKENTNIWLACDFCADIIYLLDVVFFKHR  524

Query  190  LMYMEDGFWVAEPALARRRYFATLQFKCACVSSRLTAFQMDVLSLLPTDLLYLKYGADML  249
            +MY+ +GFWV    L R+ Y   LQFK   ++                 LLY K G   +
Sbjct  525  VMYLFEGFWVKNKNLTRKNYMRKLQFKLDLLALLPLE------------LLYFKLGTQAV  572

Query  250  VLRLPRLLKIQTFWEMYDRTAAVLRQSSVVRLSRSISYVIYVIHLNACGYYFFSAWREDG  309
             LR PR  KIQ+FWE++     V+     VR++++++Y++Y+IH+ A  YY +S ++  G
Sbjct  573  WLRFPRFFKIQSFWEVFRLLDRVISSPHFVRVAKTLTYMLYMIHITAALYYAYSDYQGLG  632

Query  310  STNWVFSGKGTPYIQCFYFATKTTTAMGRNPKPDTLLETIFMNISWLVGVFMFAILIGQS  369
               WVFSGKG P                                                
Sbjct  633  QNRWVFSGKGHP------------------------------------------------  644

Query  370  PLRRYIQCFYFATKTTTAMGRNPKPDTLLETIFMNISWLVGVFMFAILIGQVREQVFVSA  429
                Y++CF FATKT T++G+NPKP+   E +FM ++WL+GVF+FA+LIGQ+R+ +  + 
Sbjct  645  ----YVRCFAFATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIISTAT  700

Query  430  RLRTEYRNLVDGTLEYMRRLSVDSKVQDRM-----------------------------D  460
            R + EYR L D TLEYMRRL++  +VQ R+                             D
Sbjct  701  RNKHEYRQLEDETLEYMRRLNLSQEVQSRVKMWFQFTWEQQRTLDESNILDALPINLKTD  760

Query  461  IAIHVHINTLSKVQMFKDCDPALLRDLVPQLKRVLFLPGDYICRKKQLVIGHCVFQGEVG  520
            IAI VHI TLSKVQ+F DC+ ALLRDLV +L+ V FLPGD++CRK           GEVG
Sbjct  761  IAISVHIQTLSKVQLFADCEEALLRDLVLKLRAVTFLPGDFVCRK-----------GEVG  809

Query  521  KEMYIVQTGVVQVMEGKE---VIATLTEGSVFGEISLLELGRGNRRTADVRSIGFSNLFV  577
            +EMYIV+ G VQVM G     V+ATLTEGSVFGEISLL +   +RRTADVRS G+SNLFV
Sbjct  810  REMYIVKLGQVQVMGGPSSDVVLATLTEGSVFGEISLLGINGADRRTADVRSKGYSNLFV  869

Query  578  LSKHDFNETIANYPDAQDLLRKRA  601
            LSK D NE IA YP AQ +L+KRA
Sbjct  870  LSKSDLNEVIAYYPTAQAILKKRA  893


>Q95SL0_DROME unnamed protein product
Length=515

 Score = 331 bits (848),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 188/443 (42%), Positives = 246/443 (56%), Gaps = 107/443 (24%)

Query  191  MYMEDGFWVAEPALARRRYFATLQFKCACVSSRLTAFQMDVLSLLPTDLLYLKYGADMLV  250
            MY+ +GFWV    L R+ Y   LQFK   ++                 LLY K G   + 
Sbjct  1    MYLFEGFWVKNKNLTRKNYMRKLQFKLDLLALLPLE------------LLYFKLGTQAVW  48

Query  251  LRLPRLLKIQTFWEMYDRTAAVLRQSSVVRLSRSISYVIYVIHLNACGYYFFSAWREDGS  310
            LR PR  KIQ+FWE++     V+     VR++++++Y++Y+IH+ A  YY +S ++  G 
Sbjct  49   LRFPRFFKIQSFWEVFRLLDRVISSPHFVRVAKTLTYMLYMIHITAALYYAYSDYQGLGQ  108

Query  311  TNWVFSGKGTPYIQCFYFATKTTTAMGRNPKPDTLLETIFMNISWLVGVFMFAILIGQSP  370
              WVFSGKG P                                                 
Sbjct  109  NRWVFSGKGHP-------------------------------------------------  119

Query  371  LRRYIQCFYFATKTTTAMGRNPKPDTLLETIFMNISWLVGVFMFAILIGQVREQVFVSAR  430
               Y++CF FATKT T++G+NPKP+   E +FM ++WL+GVF+FA+LIGQ+R+ +  + R
Sbjct  120  ---YVRCFAFATKTATSIGKNPKPERQGEYVFMTVAWLMGVFVFALLIGQIRDIISTATR  176

Query  431  LRTEYRNLVDGTLEYMRRLSVDSKVQDRM-----------------------------DI  461
             + EYR L D TLEYMRRL++  +VQ R+                             DI
Sbjct  177  NKHEYRQLEDETLEYMRRLNLSQEVQSRVKMWFQFTWEQQRTLDESNILDALPINLKTDI  236

Query  462  AIHVHINTLSKVQMFKDCDPALLRDLVPQLKRVLFLPGDYICRKKQLVIGHCVFQGEVGK  521
            AI VHI TLSKVQ+F DC+ ALLRDLV +L+ V FLPGD++CRK           GEVG+
Sbjct  237  AISVHIQTLSKVQLFADCEEALLRDLVLKLRAVTFLPGDFVCRK-----------GEVGR  285

Query  522  EMYIVQTGVVQVMEGKE---VIATLTEGSVFGEISLLELGRGNRRTADVRSIGFSNLFVL  578
            EMYIV+ G VQVM G     V+ATLTEGSVFGEISLL +   +RRTADVRS G+SNLFVL
Sbjct  286  EMYIVKLGQVQVMGGPSSDVVLATLTEGSVFGEISLLGINGADRRTADVRSKGYSNLFVL  345

Query  579  SKHDFNETIANYPDAQDLLRKRA  601
            SK D NE IA YP AQ +L+KRA
Sbjct  346  SKSDLNEVIAYYPTAQAILKKRA  368



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold2270-size370992-augustus-gene-2.5-mRNA-1

Length=208


***** No hits found *****



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold5794-size155308-augustus-gene-0.1-mRNA-1

Length=160
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O17851_CAEEL  unnamed protein product                                 115     2e-30
Q9N574_CAEEL  unnamed protein product                                 96.7    8e-24
G5EGT6_CAEEL  unnamed protein product                                 96.7    8e-24


>O17851_CAEEL unnamed protein product
Length=509

 Score = 115 bits (287),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 80/110 (73%), Gaps = 1/110 (1%)

Query  1    LLLEVSEKNGKLSDEEIREEVDTFMFEGHDTTAASMAWIVFMLALHQEVQDKVHAELLQI  60
            LLLE+  + G +++++IREEVDTFMFEGHDTT+ASM W ++ LA + E Q+KV  E+  I
Sbjct  289  LLLELRNE-GLMNEDDIREEVDTFMFEGHDTTSASMGWTLWCLAHNPEFQEKVIQEVDGI  347

Query  61   FQLSERFPTLKDINEIKYLEQVIKETLRLYPSVPFIQRTASEDVRLGQKF  110
            F  S+R  T  D+ ++KYLE+ +KE+LR+YPSVPF  RT  +DV +   F
Sbjct  348  FGTSDRDCTNDDLKQMKYLEKCLKESLRMYPSVPFFGRTVEQDVVINGDF  397


 Score = 46.2 bits (108),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/69 (35%), Positives = 40/69 (58%), Gaps = 3/69 (4%)

Query  90   YPSVPFIQRTASEDVRLGQKFALLEEKIVLSSIMRKFKITSLQKREDTGLLAELVLRPEG  149
            Y  +PF   +A     +GQKFA++EEK V+S   RK+++T+ Q      +L EL+L+   
Sbjct  440  YSDIPF---SAGPRNCIGQKFAMMEEKAVISWFFRKYRVTASQPFGMNKILPELILKSSL  496

Query  150  GVKVSLTPR  158
            G  +++  R
Sbjct  497  GFPLTVHHR  505


>Q9N574_CAEEL unnamed protein product
Length=495

 Score = 96.7 bits (239),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 73/107 (68%), Gaps = 2/107 (2%)

Query  1    LLLEVSEKNGKLSDEEIREEVDTFMFEGHDTTAASMAWIVFMLALHQEVQDKVHAELLQI  60
            LLLE+  K+G++ + +++ EVDTFMFEGHDTT+  + W + +L  H EVQ KV AEL ++
Sbjct  274  LLLEMV-KSGQMDETDVQAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEV  332

Query  61   FQLSERFPTLKDINEIKYLEQVIKETLRLYPSVPFIQRTASEDVRLG  107
                E   T++ ++ +KYLE  +KE LRL+PSVP I R  S+D  +G
Sbjct  333  MGDDEDV-TIEHLSRMKYLECALKEALRLFPSVPIITRELSDDQVIG  378


 Score = 44.3 bits (103),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/67 (30%), Positives = 40/67 (60%), Gaps = 0/67 (0%)

Query  92   SVPFIQRTASEDVRLGQKFALLEEKIVLSSIMRKFKITSLQKREDTGLLAELVLRPEGGV  151
            S  FI  +A     +GQ+FAL+EEK++++ ++R F + +++   +     E+++RP   +
Sbjct  423  SFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNVKAVELMHEVRPKMEIIVRPVTPI  482

Query  152  KVSLTPR  158
             + LT R
Sbjct  483  HMKLTRR  489


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 96.7 bits (239),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 73/107 (68%), Gaps = 2/107 (2%)

Query  1    LLLEVSEKNGKLSDEEIREEVDTFMFEGHDTTAASMAWIVFMLALHQEVQDKVHAELLQI  60
            LLLE+  K+G++ + +++ EVDTFMFEGHDTT+  + W + +L  H EVQ KV AEL ++
Sbjct  274  LLLEMV-KSGQMDETDVQAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEV  332

Query  61   FQLSERFPTLKDINEIKYLEQVIKETLRLYPSVPFIQRTASEDVRLG  107
                E   T++ ++ +KYLE  +KE LRL+PSVP I R  S+D  +G
Sbjct  333  MGDDEDV-TIEHLSRMKYLECALKEALRLFPSVPIITRELSDDQVIG  378


 Score = 45.1 bits (105),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 40/67 (60%), Gaps = 0/67 (0%)

Query  92   SVPFIQRTASEDVRLGQKFALLEEKIVLSSIMRKFKITSLQKREDTGLLAELVLRPEGGV  151
            S  FI  +A     +GQ+FAL+EEK++++ ++R F I +++   +     E+++RP   +
Sbjct  423  SFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEVRPKMEIIVRPVTPI  482

Query  152  KVSLTPR  158
             + LT R
Sbjct  483  HMKLTRR  489



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold6368-size125520-augustus-gene-0.2-mRNA-1

Length=128
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q386R7_TRYB2  unnamed protein product                                 96.3    5e-24
Q57YY8_TRYB2  unnamed protein product                                 62.4    3e-12
DYHC_DICDI  unnamed protein product                                   62.4    4e-12


>Q386R7_TRYB2 unnamed protein product
Length=4307

 Score = 96.3 bits (238),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query  8     LPAYSLLAAACIIYLSASSEDERTSMLLSWETALGINEF-SLTLFLGSEKDTLQWLSEGL  66
             LP  +L+AAA I Y++  +ED R   L  W + L + +   LT ++ ++ + LQW SEGL
Sbjct  3204  LPKRALVAAAFITYIARETEDVRQRYLKQWSSRLNLPDVVKLTGYMRTDGELLQWKSEGL  3263

Query  67    PSGQLSIQNAVIILQTSLRPFLIDPSTLALDWLKKHLHHKTV--EVTSQNNSRFATTLEL  124
             PS  LS +NA+ +L +   P +IDPS  A++W+K +L    +  EVTS ++ RF+ TLEL
Sbjct  3264  PSDDLSQENAIAMLDSVQTPLVIDPSNQAIEWVKMNLKTNNIVSEVTSMHDERFSHTLEL  3323

Query  125   AIR  127
             A+R
Sbjct  3324  AVR  3326


>Q57YY8_TRYB2 unnamed protein product
Length=4674

 Score = 62.4 bits (150),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/123 (27%), Positives = 56/123 (46%), Gaps = 8/123 (7%)

Query  12    SLLAAACIIYLSASSEDERTSMLLSW-------ETALGINEFSLTLFLGSEKDTLQWLSE  64
             +LL    + Y  A + D R  + L+W       + A+  N F    FL    +   W   
Sbjct  3538  ALLVCGFLCYAGAFTADYRQKLWLNWIKEIKRLQIAISKN-FDFVEFLADPTEVRDWQQA  3596

Query  65    GLPSGQLSIQNAVIILQTSLRPFLIDPSTLALDWLKKHLHHKTVEVTSQNNSRFATTLEL  124
             GLP    S +N  ++++ +  P +IDP   A+ W+K+    K ++V  Q    F  T+E 
Sbjct  3597  GLPGDDFSKENGAVVMRGTRWPLMIDPQLQAIKWIKRMEKDKGLKVIDQKQPDFHKTVEY  3656

Query  125   AIR  127
             A++
Sbjct  3657  AVQ  3659


>DYHC_DICDI unnamed protein product
Length=4730

 Score = 62.4 bits (150),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 65/121 (54%), Gaps = 6/121 (5%)

Query  13    LLAAACIIYLSASSEDERTSMLLSWETAL---GIN---EFSLTLFLGSEKDTLQWLSEGL  66
             +LA+A + Y+    ++ RT ++  W   L   GI    + S+  FL   ++ L W +  L
Sbjct  3593  VLASAFLAYIGFFDQNFRTDLMRKWMIRLDSVGIKFKSDLSVPSFLSKPEERLNWHANSL  3652

Query  67    PSGQLSIQNAVIILQTSLRPFLIDPSTLALDWLKKHLHHKTVEVTSQNNSRFATTLELAI  126
             PS +L I+NA+++ + +  P +IDPS  A+++L      K +  TS  +S F   LE A+
Sbjct  3653  PSDELCIENAIMLKRFNRYPLVIDPSGQAMEFLMNQYADKKITKTSFLDSSFMKNLESAL  3712

Query  127   R  127
             R
Sbjct  3713  R  3713



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= augustus-scaffold4251-size213796-processed-gene-0.0-mRNA-1

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PAL2_DROME  unnamed protein product                                   120     1e-31
PAL1_DROME  unnamed protein product                                   115     2e-29
Q19770_CAEEL  unnamed protein product                                 29.3    3.3  


>PAL2_DROME unnamed protein product
Length=406

 Score = 120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/207 (36%), Positives = 105/207 (51%), Gaps = 9/207 (4%)

Query  46   MAATLALCLAACCL-LVACDA--RLPASIGDLLGRHDYLAQVSAPYFRARLLRRSANHCG  102
            M+  L + L A  L  VA  +   LPA +   LG    L +      RA + RR      
Sbjct  1    MSRLLFVALLAISLGYVASSSSNHLPAGLAMDLGPGVNLNERFFDQVRALIKRRLQEKGL  60

Query  103  VHPCTDGFTLTHSVMDAVAAQVEGELQYEEVAGPARAHQE----EGWPQALPHLGEVSGV  158
              P      +  +  DAVA Q   +  Y+ V  PA +       E WP      G+V+ V
Sbjct  61   AKPEQPELAMPLTDDDAVALQ--NQRSYDNVPLPAASVPTPVLVENWPTEQHSFGQVTAV  118

Query  159  SVNPVGQPVIFHRGPRVWDASSFNSSGHFQHVSEGPIPVDTVLVLEPVRGSVLASWGRGL  218
            +V+P G PV+FHR  R WD ++FN S  +  +  GPI  +T+ VL+   G++ + WG  +
Sbjct  119  AVDPQGSPVVFHRAERYWDVNTFNESNIYYLIEYGPIKENTIYVLDAKTGAIKSGWGSNM  178

Query  219  FYMPHGITISPQGDMWLTDVALHQVFK  245
            FYMPHG+TI   G+ W+TDVA+HQ FK
Sbjct  179  FYMPHGLTIDLHGNYWITDVAMHQAFK  205


>PAL1_DROME unnamed protein product
Length=541

 Score = 115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 65/104 (63%), Gaps = 0/104 (0%)

Query  142  EEGWPQALPHLGEVSGVSVNPVGQPVIFHRGPRVWDASSFNSSGHFQHVSEGPIPVDTVL  201
            +  WP     LG V+ VS +  G  VIFHR  RVW  ++F++   +Q    GPI   T+L
Sbjct  98   QNAWPANNVKLGAVTAVSFDKAGNVVIFHRVNRVWGQTTFDNRNQYQEKYRGPIRESTIL  157

Query  202  VLEPVRGSVLASWGRGLFYMPHGITISPQGDMWLTDVALHQVFK  245
             LEP  G V   WG+  FYMPHG+T+ P+ ++WLTDVA+HQVFK
Sbjct  158  ALEPATGKVQYDWGKNFFYMPHGLTVDPEDNVWLTDVAMHQVFK  201


>Q19770_CAEEL unnamed protein product
Length=654

 Score = 29.3 bits (64),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 0/30 (0%)

Query  199  TVLVLEPVRGSVLASWGRGLFYMPHGITIS  228
            T +  EP RG V A W  G+   P   T+S
Sbjct  388  TFMNFEPSRGLVFAEWASGVTVAPDNATVS  417



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold485-size837215-augustus-gene-2.1-mRNA-1

Length=171
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388B5_TRYB2  unnamed protein product                                 28.5    3.0  


>Q388B5_TRYB2 unnamed protein product
Length=517

 Score = 28.5 bits (62),  Expect = 3.0, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 23/47 (49%), Gaps = 0/47 (0%)

Query  38   VSHGGHYLGPRVHSLVSQQPKVIVPDPRYRRPAGKQRPSYSTAVRSQ  84
            ++   HY+   + S+     +V VPDPR +   GK R  Y   +R Q
Sbjct  387  ITTAQHYICNILPSMFYPMKQVPVPDPRNKTEQGKLREMYYGGLRDQ  433



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold3340-size269803-augustus-gene-1.5-mRNA-1

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0C4DHC0_DROME  unnamed protein product                             168     3e-47
A0A0B4LFF3_DROME  unnamed protein product                             169     2e-46
A0A0B4KF73_DROME  unnamed protein product                             169     2e-46


>A0A0C4DHC0_DROME unnamed protein product
Length=558

 Score = 168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 11/188 (6%)

Query  1    LEDVYSDLCAMLSESVLQGAEVIANRASEQCRRYEALSAQCKAVMAPTDLAHFVRSLSVP  60
            LE++++DL A++S+S++QGAEVIA +A++Q +RY +LS QC AV    DL +FVR L+ P
Sbjct  201  LEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQP  260

Query  61   HHNPHHPSFRHNFMAPQPPPPPENPDGTPAEPPPNEGNLPPPLKNELVVDRLANLQARPR  120
                  P  R  F +PQ     E  D            + P L+NELV DR + L  R  
Sbjct  261  SQAQKIP--RRLFASPQAEVGEEAGD---------HNEMTPCLRNELVFDRHSTLSQRSA  309

Query  121  YESLRKEALELETQIKQLQDSLDTLLRIQQRSLESNLCNKVNELQEDISMKRFDLRVAQI  180
             ESL++EA+ELE QI+QLQDS++ L R Q R +E  L NKVNELQED+SMK+FDLR  QI
Sbjct  310  LESLKREAIELELQIRQLQDSIEALNRTQTRGIEGQLYNKVNELQEDLSMKKFDLRAKQI  369

Query  181  HLSAVKSQ  188
            HL+A+++Q
Sbjct  370  HLAAIRAQ  377


>A0A0B4LFF3_DROME unnamed protein product
Length=936

 Score = 169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 11/188 (6%)

Query  1    LEDVYSDLCAMLSESVLQGAEVIANRASEQCRRYEALSAQCKAVMAPTDLAHFVRSLSVP  60
            LE++++DL A++S+S++QGAEVIA +A++Q +RY +LS QC AV    DL +FVR L+ P
Sbjct  461  LEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQP  520

Query  61   HHNPHHPSFRHNFMAPQPPPPPENPDGTPAEPPPNEGNLPPPLKNELVVDRLANLQARPR  120
                  P  R  F +PQ     E  D            + P L+NELV DR + L  R  
Sbjct  521  SQAQKIP--RRLFASPQAEVGEEAGD---------HNEMTPCLRNELVFDRHSTLSQRSA  569

Query  121  YESLRKEALELETQIKQLQDSLDTLLRIQQRSLESNLCNKVNELQEDISMKRFDLRVAQI  180
             ESL++EA+ELE QI+QLQDS++ L R Q R +E  L NKVNELQED+SMK+FDLR  QI
Sbjct  570  LESLKREAIELELQIRQLQDSIEALNRTQTRGIEGQLYNKVNELQEDLSMKKFDLRAKQI  629

Query  181  HLSAVKSQ  188
            HL+A+++Q
Sbjct  630  HLAAIRAQ  637


>A0A0B4KF73_DROME unnamed protein product
Length=1059

 Score = 169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 124/188 (66%), Gaps = 11/188 (6%)

Query  1    LEDVYSDLCAMLSESVLQGAEVIANRASEQCRRYEALSAQCKAVMAPTDLAHFVRSLSVP  60
            LE++++DL A++S+S++QGAEVIA +A++Q +RY +LS QC AV    DL +FVR L+ P
Sbjct  461  LEEIHNDLVAIVSDSLMQGAEVIAGKANDQAKRYNSLSNQCAAVSPQQDLVNFVRLLAQP  520

Query  61   HHNPHHPSFRHNFMAPQPPPPPENPDGTPAEPPPNEGNLPPPLKNELVVDRLANLQARPR  120
                  P  R  F +PQ     E  D            + P L+NELV DR + L  R  
Sbjct  521  SQAQKIP--RRLFASPQAEVGEEAGD---------HNEMTPCLRNELVFDRHSTLSQRSA  569

Query  121  YESLRKEALELETQIKQLQDSLDTLLRIQQRSLESNLCNKVNELQEDISMKRFDLRVAQI  180
             ESL++EA+ELE QI+QLQDS++ L R Q R +E  L NKVNELQED+SMK+FDLR  QI
Sbjct  570  LESLKREAIELELQIRQLQDSIEALNRTQTRGIEGQLYNKVNELQEDLSMKKFDLRAKQI  629

Query  181  HLSAVKSQ  188
            HL+A+++Q
Sbjct  630  HLAAIRAQ  637



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold1565-size666251-augustus-gene-4.3-mRNA-1

Length=1305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NAT10_DROME  unnamed protein product                                  1030    0.0  
Q582B4_TRYB2  unnamed protein product                                 817     0.0  
Q38CF6_TRYB2  unnamed protein product                                 33.1    2.2  


>NAT10_DROME unnamed protein product
Length=1008

 Score = 1030 bits (2663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/1022 (52%), Positives = 698/1022 (68%), Gaps = 82/1022 (8%)

Query  1     MVRKKIDNRIRIIIENGVALGHRTMFVIVGERGRDQVVILHHMLSKATIKARPNVLWCYK  60
             MV+KKIDNRIR++IENGV LGHRTMF+++G++ RDQV IL+ +L+K+T+KARP VLWCYK
Sbjct  1     MVKKKIDNRIRVMIENGVKLGHRTMFIVIGDKARDQVPILYDILTKSTVKARPTVLWCYK  60

Query  61    -KELGFSSHRKKKMKSLQKKIKSGRLNVNEDDPFELFVASTNIRYCYYTETQKILGNTFG  119
              K+   S+H KK+ K    KI  G+++VNE D F+ F  +T I   YY+ET  +LG T+G
Sbjct  61    NKDEAISNHGKKRAK----KIAVGKVDVNEADLFDSFRVATTIHGRYYSETHAVLGRTYG  116

Query  120   MCILQDFEALTPNILARTIETVEGGGLIILLLRSVASLRQLYTMTMDVHERLRTEAHSEV  179
             +C+LQDFEALTPN+LART+ETVEGGGLIILLL+++ SL+QLYTM+MDVH+R RTEAH  V
Sbjct  117   VCVLQDFEALTPNLLARTVETVEGGGLIILLLKTLQSLKQLYTMSMDVHKRFRTEAHQTV  176

Query  180   VARFNERYVSAVVYLPWEVTCPCRRFLLSLASCPRCLVMDDQLTVLPLSSHNLHVEAVDR  239
               RFNER                   +LSLA C RCLV++D LTVLPLSS  ++VE V+ 
Sbjct  177   TCRFNER------------------LILSLADCKRCLVVNDDLTVLPLSSKTINVEPVNP  218

Query  240   TDLDK-PDPA-LISIKESLEDLKPVGVLVKLCKTVDQAKAVLKFVEAISEKTLRSTVSLT  297
                 + P+ A L  +KESL  ++P G LV LCKT DQA AV +F+EA+ +K L+  +SLT
Sbjct  219   AGAGRSPNEASLKELKESLLTVQPAGALVNLCKTYDQANAVAQFIEALVDKQLKPPMSLT  278

Query  298   ASRGRGKSAALGIAMSAAVAFGYSNIFVTSPSPENLNTLFEFVFKGFDALEYQEHLDYDL  357
             A+RGRGKSAALG++++AAVAFGY NI+VTSP PENL TLFEFV KGFDALEYQEH DY +
Sbjct  279   AARGRGKSAALGLSIAAAVAFGYVNIYVTSPHPENLITLFEFVLKGFDALEYQEHADYTI  338

Query  358   IQSTNPEFNKAIVRVNIFRDHRQTIQYIHPTDAHKLGQAELVIIDEAAAIPLPYVKAMLG  417
             I+STN ++ KAI+R+NI R  RQTIQYI P+D H L  A+L++IDEAAAIPLP VK M+G
Sbjct  339   IRSTNADYKKAIIRINITRSSRQTIQYIAPSDTHLLNAADLLLIDEAAAIPLPLVKKMIG  398

Query  418   PYLMFLASTVNGYEGTGRSLSLKLLSQLR--TQAAPLGVTADKAKSASTGRGLQEVTLEE  475
             PYL+F+AST+NGYEGTGRSLSLKL+SQL+    A P                   + LEE
Sbjct  399   PYLVFMASTINGYEGTGRSLSLKLISQLQKDNNARP------------------PLKLEE  440

Query  476   SIRYKPGDAVEEWLTSLLCLDATTVQPMQSGCPPPESCDLYYINRDTLFCFHKASESFLQ  535
             SIRY+  D +E+WL +LLCLDA+TV  + SGCP P++C+LYY++RD LF +HKA+E+FL 
Sbjct  441   SIRYQENDDIEKWLINLLCLDASTVPSISSGCPTPDACELYYVDRDALFSYHKAAEAFLH  500

Query  536   RIVSLFVASHYKNSPNDLQMMSDAPAHHLFCLLGPVDPEQKHLPEVLVVIQVCLEGQVSK  595
             R+VS++V+SHYKN+PNDLQMMSDAPAHHLFCLLGPV      LPE+LVVIQV LEGQ+S 
Sbjct  501   RLVSIYVSSHYKNTPNDLQMMSDAPAHHLFCLLGPVQ-RMDALPEILVVIQVALEGQISA  559

Query  596   NSVVDGLSRGRRAHGDLIPWTIAQQFQDQDFPMLTGARIVRIATHPDYQGMGYGSRALTL  655
              S+ D L RG++A GDLIPW +A+Q+ D+DFP L G RIVR+ATHP+YQ MGYG RA+ L
Sbjct  560   QSISDSLGRGKKAAGDLIPWNVAEQYGDRDFPKLCGVRIVRVATHPNYQRMGYGKRAIQL  619

Query  656   LKHYYELKIPCISEDNPPEDH-----IESISTEEVGLLEERIVPRKSLPPLLLKLSERPP  710
             LK YY  K   + ED P         IE +  EE+ LL+E+I PR  +P LL +L ER P
Sbjct  620   LKDYYARKHTNL-EDGPVASKDAGKGIEEVEEEELSLLKEQIRPRSRIPTLLQRLHERVP  678

Query  711   EQLHYLGVAYGLTLPLIKFWKRAGFVPVYLRQTTNDLTGEHSCIMLQQLDIAGSEDAAAG  770
             E + Y+G +YGLT  L+KFWK AGFVPVYL Q +N+LT EHSCIML              
Sbjct  679   EHVDYIGTSYGLTTELLKFWKNAGFVPVYLSQKSNELTAEHSCIMLH---------TPNA  729

Query  771   GKWLLEFFADFRRRFLSLLGYQFRSFLPALALSVLQNKACKLPSRGLHPVHSDMFRLSEV  830
               WL  ++ DFRRR L L+G  FR F   L L++L+NK+       L  +   M      
Sbjct  730   TPWLGLYYQDFRRRVLKLMGKTFREFETKLCLALLKNKSVDTEGSALKVLDKPM------  783

Query  831   YGERGVEWKLSREELDAYVSQYDVKRLEMYANNMADYHLVMDLMPALARLYFLNLMGDVH  890
                           LD Y   +D++RLE YA   +++ L++DL+  +A+LYF   +  + 
Sbjct  784   --------------LDVYFLPHDLQRLESYARQQSEFRLIIDLLTDIAQLYFQGRIDGLQ  829

Query  891   LSAVQAAILLGVGLQYKTADSLAAELELQSSQLLGLFNRMMRRFVQFLLGILKQAIE-QR  949
             L  VQ  ILL +G+Q KT D+L  EL +  +QLL  F   M+R  Q    +L++ IE   
Sbjct  830   LDLVQQGILLALGVQGKTVDALGLELNMPGNQLLAKFFDAMKRCNQCFRSVLEEHIEGGM  889

Query  950   LAPPHTAPHVPVDPAAQGLREELDKAAKELRAKQKSQLEELKRENLSLYAIKGSEEEWGK  1009
             L     +    + P    L +ELD+ A++L  +Q+ +L+ LK E L  + IKG+EE+W K
Sbjct  890   LREADLSKGEELQPLTLSLDKELDQTAQKLSKQQRKELKRLKAEQLDEFQIKGTEEDWSK  949

Query  1010  SL  1011
             +L
Sbjct  950   AL  951


>Q582B4_TRYB2 unnamed protein product
Length=1039

 Score = 817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/963 (46%), Positives = 602/963 (63%), Gaps = 73/963 (8%)

Query  2    VRKKIDNRIRIIIENGVALGHRTMFVIVGERGRDQVVILHHMLSKATIKARPNVLWCYKK  61
            +++K+D+RIR +IEN V   HR + ++VG+RG+DQ+V LH M+S A   A+ NVLWC KK
Sbjct  19   IKRKVDDRIRKVIENAVHKRHRALLLLVGDRGKDQIVNLHQMVSHANHNAKVNVLWCMKK  78

Query  62   ELGF-SSHRKKKMKSLQKKIKSGRLNVNEDDPFELFVASTNIRYCYYTETQKILGNTFGM  120
            E  F S+  K++ K  + ++K G       + F+ F++ T IR+C Y ET KILG TFGM
Sbjct  79   EPDFGSTSLKQQEKKARLEVKGGMSTDATKEAFQTFLSQTIIRFCQYKETHKILGQTFGM  138

Query  121  CILQDFEALTPNILARTIETVEGGGLIILLLRSVASLRQLYTMTMDVHERLRTEAHSEVV  180
             +LQDFEA+TPN LARTIETV+GGG+I+++ R++ SL+QLYT+ MDVH R RTEA  +VV
Sbjct  139  AVLQDFEAMTPNTLARTIETVKGGGIIVIMFRAMKSLKQLYTIAMDVHSRYRTEALQDVV  198

Query  181  ARFNERYVSAVVYLPWEVTCPCRRFLLSLASCPRCLVMDDQLTVLPLSSHNLHVEAVDRT  240
             RFNER                  FLLSL  C   L +DD L VLP+++    VE+   T
Sbjct  199  PRFNER------------------FLLSLVDCDTSLCVDDDLNVLPITAKMCAVESARTT  240

Query  241  DLD---------KPDPALISIKESLEDLKPVGVLVKLCKTVDQAKAVLKFVEAISEKTLR  291
              D         K +  L ++KE L     VG L+ LC+T+DQ K +L  ++ + EK+L 
Sbjct  241  SYDETLVLQGRQKHEADLAALKERLRASNEVGPLISLCQTLDQGKTILSLMQTVVEKSLN  300

Query  292  STVSLTASRGRGKSAALGIAMSAAVAFGYSNIFVTSPSPENLNTLFEFVFKGFDALEYQE  351
            +T  +TA RGRGKSAALG+A + AVA GYSNIF T+PSPENL T FEFV +G   L Y+E
Sbjct  301  TTCVVTAGRGRGKSAALGLATAGAVAQGYSNIFCTAPSPENLQTFFEFVVRGLQELGYKE  360

Query  352  HLDYDLIQSTNPEFNKAIVRVNIFRDHRQTIQYIHPTDAHKLGQAELVIIDEAAAIPLPY  411
              D++ +QSTN EF+K I+R+N+FR+HRQT+QYI P DA K  QAEL IIDEAAA+PLP 
Sbjct  361  RTDFEAMQSTNVEFSKCIIRINVFREHRQTVQYISPNDASKFAQAELAIIDEAAALPLPI  420

Query  412  VKAMLGPYLMFLASTVNGYEGTGRSLSLKLLSQLRTQAAPLGVTADKAKSASTGRGLQEV  471
            VK MLGPYL+FL+ST++GYEGTGRSLS+KL++ +R  +     + + + +    R L+E+
Sbjct  421  VKQMLGPYLVFLSSTISGYEGTGRSLSMKLVADMRKHSG----STNASVAGDDRRLLREL  476

Query  472  TLEESIRYKPGDAVEEWLTSLLCLDATTVQPMQ-SGCPPPESCDLYYINRDTLFCFHKAS  530
            ++ + IRY P D VE WL  LLCLDA TV+P+     P P SC+LYY+NRD LF +H  +
Sbjct  477  SMSDPIRYGPNDPVEFWLNKLLCLDA-TVRPIAVKSSPHPNSCELYYVNRDALFSYHPLA  535

Query  531  ESFLQRIVSLFVASHYKNSPNDLQMMSDAPAHHLFCLLGPVDPEQKHLPEVLVVIQVCLE  590
            E  LQ IV++ VA+HYKN PNDLQ+MSDAP HHLF L       +  +P+V  VI  C E
Sbjct  536  EQLLQAIVAMLVAAHYKNQPNDLQLMSDAPGHHLFILCPSTVDAKSGIPDVFCVIHACEE  595

Query  591  GQVSKNSVVDGLSRGRRAHGDLIPWTIAQQFQDQDFPMLTGARIVRIATHPDYQGMGYGS  650
            G VS  ++   LSRG R  GDLIP+T++Q + ++ F  L G RIVRIAT+P+ Q  GYGS
Sbjct  596  GHVSSEAIKSNLSRGLRPSGDLIPYTLSQYYLEEGFAKLAGLRIVRIATNPELQRAGYGS  655

Query  651  RALTLLKHYYELKI---PCIS---EDNPPEDHIESISTEEVGLLEERIVPRKSLPPLLLK  704
            RAL LL+ YY   +   P  S    +N  E      + E    +   I PRK +P LL+ 
Sbjct  656  RALELLQQYYTGSVSLRPAASAAATENNTELKAVDDADEVSSTISHTIKPRKRIPSLLVP  715

Query  705  LSERPPEQLHYLGVAYGLTLPLIKFWKRAGFVPVYLRQTTNDLTGEHSCIMLQQLDIAGS  764
            L ERP E++ YLGV++G+T PL  FWKR GF P+YLR   N+LTGEHSC+M++       
Sbjct  716  LIERPYEEIDYLGVSFGVTTPLFNFWKRGGFEPLYLRHAANELTGEHSCVMVRSF-----  770

Query  765  EDAAAGGKWLLEFFADFRRRFLSLLGYQFRSFLPALALSVLQNKACKLPSRGLHPVHSDM  824
                  G  L    A+FRRRF+ LL   FR     LALS+L++     P +      +D+
Sbjct  771  ------GFDLGLLRAEFRRRFIPLLAMPFRQLPTELALSILKDVDVNDPQK--LAAATDL  822

Query  825  FRLSE----VYGERGVEWKLSREELDAYVSQYDVKRLEMYANNMADYHLVMDLMPALARL  880
              ++E    V G+    WK    EL    S  D+KRL++ A    +   V+DL+PALA+L
Sbjct  823  SHVAEHNVRVAGQPQCTWK----ELQEIFSISDLKRLKLNATTFVEGGHVLDLVPALAKL  878

Query  881  YFLNLM-------GDVHLSAVQAAILLGVGLQYKTADSLAAELELQSSQLLGLFNRMMRR  933
            YF + +         V LS  QAA+LLGVGLQ +T + +      Q +   G+  + +R 
Sbjct  879  YFESRLFHLPDGAEGVVLSHAQAAVLLGVGLQCQTIEEVG-----QQAVFSGVPTQQLRA  933

Query  934  FVQ  936
            F+Q
Sbjct  934  FLQ  936


>Q38CF6_TRYB2 unnamed protein product
Length=1719

 Score = 33.1 bits (74),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 35/81 (43%), Gaps = 13/81 (16%)

Query  1003  SEEEWGKSLAKGSKNLVSVKRQVSHHVTELYKWL-VCRYKWLVCRNKWLVCRYKWLVCRY  1061
             S +++GK+L    K L  +K   +H  T+    L +C+ K LV    W V    W  C  
Sbjct  305   SADKYGKTLLWDPKTLTPLKDLTTHMATDPGSMLSICKVKQLVS---WKV----WTACSG  357

Query  1062  KWLVCWYKWLVCRTAFPVLFD  1082
               + CW        + P+ FD
Sbjct  358   GKIYCWNA-----DSIPIAFD  373



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold1084-size576883-augustus-gene-0.4-mRNA-1

Length=284
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KIE7_DROME  unnamed protein product                                 66.6    4e-12
Q24241_DROME  unnamed protein product                                 66.6    5e-12
X2JCM1_DROME  unnamed protein product                                 66.2    6e-12


>Q0KIE7_DROME unnamed protein product
Length=1549

 Score = 66.6 bits (161),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 3/119 (3%)

Query  150  GSQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQL  209
            G+ +  + ++  +PL      G+V++  LLL  G  V      +G   LH AA+ GH+ +
Sbjct  652  GADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLV  709

Query  210  ARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA  268
            +++LL HGA++ ++R+R GYTPL  A   G L +VK+ +   AD+ ++ + G T L  A
Sbjct  710  SQILLEHGANI-SERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQA  767


 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 2/97 (2%)

Query  172  HVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTP  231
            H E A LLL    PVD+V  D     LH AA  GH+++A+LLL + A+ +A R+  G+TP
Sbjct  345  HDEAAHLLLDNKAPVDEVTVDYLT-ALHVAAHCGHVKVAKLLLDYKANPNA-RALNGFTP  402

Query  232  LMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA  268
            L  A  + +++MV+ L++ GA++  T + G T L  A
Sbjct  403  LHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVA  439


 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 2/119 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TPL     +G+V++A+LLL+    V+ V   +    LH A + G L L  LLL  GA +D
Sbjct  236  TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNIT-PLHVACKWGKLSLCTLLLCRGAKID  294

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFL  280
            A  +R G TPL  A   G + ++K+L++  A +     +G +AL  A  GE+   +  L
Sbjct  295  AA-TRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLL  352


 Score = 61.2 bits (147),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 61/120 (51%), Gaps = 2/120 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TPL      GHV ++ +LL  G  + +   + G   LH AA  GHL L +  + + AD++
Sbjct  696  TPLHVAAQEGHVLVSQILLEHGANISERTRN-GYTPLHMAAHYGHLDLVKFFIENDADIE  754

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFLE  281
               S  GYTPL  A  +G + ++  L+R  A+ +    DG TAL  A +  Y  V E L+
Sbjct  755  MS-SNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK  813


 Score = 50.8 bits (120),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 66/130 (51%), Gaps = 2/130 (2%)

Query  151  SQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLA  210
            +++  + +  +TPL      G++ +  LLL  G  ++    +D    LH AA+ G   + 
Sbjct  488  AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEIN-AQSNDKYSALHIAAKEGQENIV  546

Query  211  RLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARS  270
            ++LL +GA+ +A  ++ G+TPL  A   G+  +V+ L++ GA +   G +  T L  A  
Sbjct  547  QVLLENGAENNAV-TKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATH  605

Query  271  GEYTAVSEFL  280
                ++ E L
Sbjct  606  YNNPSIVELL  615


 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 76/159 (48%), Gaps = 9/159 (6%)

Query  124  QGFNKLVVASSLDKG--LENLLDNNTVAGSQLQKVLQTNETPLWSIGFHGHVELASLLLS  181
            +GF  L +A    K   ++ LL N    G+ +    + + TPL     + +  +  LLL 
Sbjct  562  KGFTPLHLACKYGKQNVVQILLQN----GASIDFQGKNDVTPLHVATHYNNPSIVELLLK  617

Query  182  GGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQL  241
             G   + +   +G   +H A +  +L++A  LL HGAD++   S+ G++PL  A   G +
Sbjct  618  NGSSPN-LCARNGQCAIHIACKKNYLEIAMQLLQHGADVNII-SKSGFSPLHLAAQGGNV  675

Query  242  RMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFL  280
             MV+ L+  G  +S    +G T L  A    +  VS+ L
Sbjct  676  DMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQIL  713


 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 62/123 (50%), Gaps = 4/123 (3%)

Query  161  ETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADL  220
            ETPL         ++  +LL     VD  I  +G   LH A+R G++ +  LLL HGA++
Sbjct  466  ETPLHLAARANQADIIRILLRSAK-VD-AIAREGQTPLHVASRLGNINIIMLLLQHGAEI  523

Query  221  DAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALD-SARSGEYTAVSEF  279
            +A+ S   Y+ L  A  EGQ  +V+ L+  GA+ +     G T L  + + G+   V   
Sbjct  524  NAQ-SNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQIL  582

Query  280  LES  282
            L++
Sbjct  583  LQN  585


 Score = 47.8 bits (112),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (3%)

Query  171  GHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYT  230
            G+V++   LL  G+ +D      G+  LH A+  G   +   L+L+ A+++ + S  G+T
Sbjct  84   GYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQLILYNANVNVQ-SLNGFT  141

Query  231  PLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA-RSGEYTAVSEFLES  282
            PL  A  E      + L+  GA+ S++ +DG T L  A + G    V+  LE+
Sbjct  142  PLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN  194


 Score = 45.4 bits (106),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 84/187 (45%), Gaps = 17/187 (9%)

Query  98   FKDMLQESLNVSRKCREDVEKLTNKVQGFNKLVVASSLDKGLENLLDNNTVAGSQLQKVL  157
             K +LQ++  +  K +  +  L    QG +        D+    LLDN     + + +V 
Sbjct  316  IKHLLQQNAPILTKTKNGLSALHMAAQGEH--------DEAAHLLLDNK----APVDEVT  363

Query  158  QTNETPLWSIGFHGHVELASLLLS-GGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLH  216
                T L      GHV++A LLL     P  + ++  G   LH A +   +++  LL+ H
Sbjct  364  VDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN--GFTPLHIACKKNRIKMVELLIKH  421

Query  217  GADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALD-SARSGEYTA  275
            GA++ A  +  G TPL  A   G + +V YL++  A   +    G+T L  +AR+ +   
Sbjct  422  GANIGAT-TESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADI  480

Query  276  VSEFLES  282
            +   L S
Sbjct  481  IRILLRS  487


 Score = 44.3 bits (103),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 52/110 (47%), Gaps = 3/110 (3%)

Query  173  VELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPL  232
            V  A LLL    P   ++   G   LH AA  G++ +A LLL + AD++   ++   TPL
Sbjct  214  VNAAKLLLQHD-PNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPL  271

Query  233  MTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA-RSGEYTAVSEFLE  281
              A   G+L +   L+  GA +     DG T L  A RSG    +   L+
Sbjct  272  HVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ  321


 Score = 37.7 bits (86),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 34/71 (48%), Gaps = 1/71 (1%)

Query  198  LHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSIT  257
            LH AA+   +  A+LLL H  + D   S+ G+TPL  A   G + +   L+   ADV+  
Sbjct  205  LHIAAKKNDVNAAKLLLQHDPNADIV-SKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV  263

Query  258  GDDGKTALDSA  268
                 T L  A
Sbjct  264  AKHNITPLHVA  274


>Q24241_DROME unnamed protein product
Length=1549

 Score = 66.6 bits (161),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 68/119 (57%), Gaps = 3/119 (3%)

Query  150  GSQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQL  209
            G+ +  + ++  +PL      G+V++  LLL  G  V      +G   LH AA+ GH+ +
Sbjct  652  GADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYG--VISAAAKNGLTPLHVAAQEGHVLV  709

Query  210  ARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA  268
            +++LL HGA++ ++R+R GYTPL  A   G L +VK+ +   AD+ ++ + G T L  A
Sbjct  710  SQILLEHGANI-SERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQA  767


 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 2/97 (2%)

Query  172  HVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTP  231
            H E A LLL    PVD+V  D     LH AA  GH+++A+LLL + A+ +A R+  G+TP
Sbjct  345  HDEAAHLLLDNKAPVDEVTVDYLT-ALHVAAHCGHVKVAKLLLDYKANPNA-RALNGFTP  402

Query  232  LMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA  268
            L  A  + +++MV+ L++ GA++  T + G T L  A
Sbjct  403  LHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVA  439


 Score = 63.5 bits (153),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 63/119 (53%), Gaps = 2/119 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TPL     +G+V++A+LLL+    V+ V   +    LH A + G L L  LLL  GA +D
Sbjct  236  TPLHIAAHYGNVDIATLLLNNKADVNYVAKHNIT-PLHVACKWGKLSLCTLLLCRGAKID  294

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFL  280
            A  +R G TPL  A   G + ++K+L++  A +     +G +AL  A  GE+   +  L
Sbjct  295  AA-TRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLL  352


 Score = 61.2 bits (147),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 61/120 (51%), Gaps = 2/120 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TPL      GHV ++ +LL  G  + +   + G   LH AA  GHL L +  + + AD++
Sbjct  696  TPLHVAAQEGHVLVSQILLEHGANISERTRN-GYTPLHMAAHYGHLDLVKFFIENDADIE  754

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFLE  281
               S  GYTPL  A  +G + ++  L+R  A+ +    DG TAL  A +  Y  V E L+
Sbjct  755  MS-SNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESLK  813


 Score = 51.6 bits (122),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/130 (27%), Positives = 67/130 (52%), Gaps = 2/130 (2%)

Query  151  SQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLA  210
            +++  +++  +TPL      G++ +  LLL  G  ++   +D     LH AA+ G   + 
Sbjct  488  AKVDAIVREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYS-ALHIAAKEGQENIV  546

Query  211  RLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARS  270
            ++LL +GA+ +A  ++ G+TPL  A   G+  +V+ L++ GA +   G +  T L  A  
Sbjct  547  QVLLENGAENNAV-TKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATH  605

Query  271  GEYTAVSEFL  280
                ++ E L
Sbjct  606  YNNPSIVELL  615


 Score = 50.4 bits (119),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/123 (31%), Positives = 63/123 (51%), Gaps = 4/123 (3%)

Query  161  ETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADL  220
            ETPL         ++  +LL     VD ++ + G   LH A+R G++ +  LLL HGA++
Sbjct  466  ETPLHLAARANQADIIRILLRSAK-VDAIVRE-GQTPLHVASRLGNINIIMLLLQHGAEI  523

Query  221  DAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALD-SARSGEYTAVSEF  279
            +A+ S   Y+ L  A  EGQ  +V+ L+  GA+ +     G T L  + + G+   V   
Sbjct  524  NAQ-SNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQIL  582

Query  280  LES  282
            L++
Sbjct  583  LQN  585


 Score = 49.7 bits (117),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 76/159 (48%), Gaps = 9/159 (6%)

Query  124  QGFNKLVVASSLDKG--LENLLDNNTVAGSQLQKVLQTNETPLWSIGFHGHVELASLLLS  181
            +GF  L +A    K   ++ LL N    G+ +    + + TPL     + +  +  LLL 
Sbjct  562  KGFTPLHLACKYGKQNVVQILLQN----GASIDFQGKNDVTPLHVATHYNNPSIVELLLK  617

Query  182  GGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQL  241
             G   + +   +G   +H A +  +L++A  LL HGAD++   S+ G++PL  A   G +
Sbjct  618  NGSSPN-LCARNGQCAIHIACKKNYLEIAMQLLQHGADVNII-SKSGFSPLHLAAQGGNV  675

Query  242  RMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFL  280
             MV+ L+  G  +S    +G T L  A    +  VS+ L
Sbjct  676  DMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQIL  713


 Score = 47.8 bits (112),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 58/113 (51%), Gaps = 3/113 (3%)

Query  171  GHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYT  230
            G+V++   LL  G+ +D      G+  LH A+  G   +   L+L+ A+++ + S  G+T
Sbjct  84   GYVDICCELLRRGIKIDNATKK-GNTALHIASLAGQHDVINQLILYNANVNVQ-SLNGFT  141

Query  231  PLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA-RSGEYTAVSEFLES  282
            PL  A  E      + L+  GA+ S++ +DG T L  A + G    V+  LE+
Sbjct  142  PLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN  194


 Score = 45.4 bits (106),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/187 (27%), Positives = 84/187 (45%), Gaps = 17/187 (9%)

Query  98   FKDMLQESLNVSRKCREDVEKLTNKVQGFNKLVVASSLDKGLENLLDNNTVAGSQLQKVL  157
             K +LQ++  +  K +  +  L    QG +        D+    LLDN     + + +V 
Sbjct  316  IKHLLQQNAPILTKTKNGLSALHMAAQGEH--------DEAAHLLLDNK----APVDEVT  363

Query  158  QTNETPLWSIGFHGHVELASLLLS-GGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLH  216
                T L      GHV++A LLL     P  + ++  G   LH A +   +++  LL+ H
Sbjct  364  VDYLTALHVAAHCGHVKVAKLLLDYKANPNARALN--GFTPLHIACKKNRIKMVELLIKH  421

Query  217  GADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALD-SARSGEYTA  275
            GA++ A  +  G TPL  A   G + +V YL++  A   +    G+T L  +AR+ +   
Sbjct  422  GANIGAT-TESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADI  480

Query  276  VSEFLES  282
            +   L S
Sbjct  481  IRILLRS  487


 Score = 44.3 bits (103),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 52/110 (47%), Gaps = 3/110 (3%)

Query  173  VELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPL  232
            V  A LLL    P   ++   G   LH AA  G++ +A LLL + AD++   ++   TPL
Sbjct  214  VNAAKLLLQHD-PNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV-AKHNITPL  271

Query  233  MTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSA-RSGEYTAVSEFLE  281
              A   G+L +   L+  GA +     DG T L  A RSG    +   L+
Sbjct  272  HVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQ  321


 Score = 37.7 bits (86),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 34/71 (48%), Gaps = 1/71 (1%)

Query  198  LHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSIT  257
            LH AA+   +  A+LLL H  + D   S+ G+TPL  A   G + +   L+   ADV+  
Sbjct  205  LHIAAKKNDVNAAKLLLQHDPNADIV-SKSGFTPLHIAAHYGNVDIATLLLNNKADVNYV  263

Query  258  GDDGKTALDSA  268
                 T L  A
Sbjct  264  AKHNITPLHVA  274


>X2JCM1_DROME unnamed protein product
Length=11634

 Score = 66.2 bits (160),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 47/131 (36%), Positives = 70/131 (53%), Gaps = 2/131 (2%)

Query  138  GLENLLDNNTVAGSQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHM  197
            G E ++D     G+ +    +    PL       HV+ A +LL    PVD+V  D     
Sbjct  282  GHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLT-A  340

Query  198  LHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSIT  257
            LH AA  GH+++A+LLL   AD +A R+  G+TPL  A  + +L++V+ L+R GA +S T
Sbjct  341  LHVAAHCGHVRVAKLLLDRNADANA-RALNGFTPLHIACKKNRLKVVELLLRHGASISAT  399

Query  258  GDDGKTALDSA  268
             + G T L  A
Sbjct  400  TESGLTPLHVA  410


 Score = 58.9 bits (141),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 79/158 (50%), Gaps = 8/158 (5%)

Query  126  FNKLVVASSLDKGLENLLDNNTVAGSQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMP  185
            F +   A +L++ LE+L +N  +  S    +   N   L S    GH+ + S LL  G  
Sbjct  15   FLRAARAGNLERVLEHLKNNIDINTSNANGL---NALHLASK--DGHIHVVSELLRRGAI  69

Query  186  VDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVK  245
            VD      G+  LH A+  G  ++ +LLL H A ++ + S+ G+TPL  A  E    +V+
Sbjct  70   VDSATKK-GNTALHIASLAGQEEVVKLLLEHNASVNVQ-SQNGFTPLYMAAQENHDAVVR  127

Query  246  YLVRAGADVSITGDDGKTALDSA-RSGEYTAVSEFLES  282
             L+  GA+ S+  +DG T L  A + G    V+  LES
Sbjct  128  LLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLES  165


 Score = 53.5 bits (127),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 51/163 (31%), Positives = 78/163 (48%), Gaps = 9/163 (6%)

Query  123  VQGFNKLVVASSLD--KGLENLLDNNTVAGSQLQKVLQTNETPLWSIGFHGHVELASLLL  180
            + GF  L +A   +  K +E LL +    G+ +    ++  TPL    F G + +   LL
Sbjct  368  LNGFTPLHIACKKNRLKVVELLLRH----GASISATTESGLTPLHVAAFMGCMNIVIYLL  423

Query  181  SGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQ  240
                  D V    G+  LH AAR     + R+LL +GA +DA R+R   TPL  A   G 
Sbjct  424  QHDASPD-VPTVRGETPLHLAARANQTDIIRILLRNGAQVDA-RAREQQTPLHIASRLGN  481

Query  241  LRMVKYLVRAGADVSITGDDGKTALD-SARSGEYTAVSEFLES  282
            + +V  L++ GA V  T  D  TAL  +A+ G+    +  +E+
Sbjct  482  VDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIEN  524


 Score = 53.1 bits (126),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/123 (32%), Positives = 65/123 (53%), Gaps = 3/123 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TPL      GH E+++LL+     V+    + G   +H  A+  ++ +A +L  +GA++D
Sbjct  636  TPLHLSSQEGHAEISNLLIEHKAAVNHPAKN-GLTPMHLCAQEDNVNVAEILEKNGANID  694

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTAL-DSARSGEYTAVSEFL  280
               ++ GYTPL  A   GQ  MV++L++ GA+V      G T L  +A+ G    V+  L
Sbjct  695  MA-TKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLL  753

Query  281  ESQ  283
            E +
Sbjct  754  EHK  756


 Score = 52.4 bits (124),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 3/133 (2%)

Query  150  GSQLQKVLQTNETPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQL  209
            G+Q+    +   T L      G  E+A++L+  G  +D      G   LH  A+ GH+++
Sbjct  492  GAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKK-GFTPLHLTAKYGHIKV  550

Query  210  ARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALD-SA  268
            A+LLL   AD+DA+  + G TPL  A      ++   L+  GA    T  +G T L  +A
Sbjct  551  AQLLLQKEADVDAQ-GKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAA  609

Query  269  RSGEYTAVSEFLE  281
            R  +    +  LE
Sbjct  610  RKNQMDIATTLLE  622


 Score = 50.8 bits (120),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 37/121 (31%), Positives = 59/121 (49%), Gaps = 2/121 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TP+       +V +A +L   G  +D +    G   LH A+  G   + R LL +GA++D
Sbjct  669  TPMHLCAQEDNVNVAEILEKNGANID-MATKAGYTPLHVASHFGQANMVRFLLQNGANVD  727

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFLE  281
            A  S G YTPL     +G   +V  L+   A+ +    +G+T L  AR   Y +V + L+
Sbjct  728  AATSIG-YTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSLK  786

Query  282  S  282
            +
Sbjct  787  T  787


 Score = 48.5 bits (114),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 47/156 (30%), Positives = 69/156 (44%), Gaps = 4/156 (3%)

Query  125  GFNKLVVASSLDKGLENLLDNNTVAGSQLQKVLQTNETPLWSIGFHGHVELASLLLSGGM  184
            GF  L +AS    G +N+ +     G+ +    + N +PL      G   + SLLL  G 
Sbjct  205  GFTPLHIASHY--GNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG  262

Query  185  PVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMV  244
             ++    D G   LH AAR GH Q+  +LL  GA + AK ++ G  PL  A     +   
Sbjct  263  NIEAKTRD-GLTPLHCAARSGHEQVVDMLLERGAPISAK-TKNGLAPLHMAAQGEHVDAA  320

Query  245  KYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFL  280
            + L+   A V     D  TAL  A    +  V++ L
Sbjct  321  RILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLL  356


 Score = 45.4 bits (106),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 36/120 (30%), Positives = 56/120 (47%), Gaps = 2/120 (2%)

Query  162  TPLWSIGFHGHVELASLLLSGGMPVDKVIDDDGDHMLHAAARGGHLQLARLLLLHGADLD  221
            TPL     + + ++A LLL  G         +G   LH AAR   + +A  LL +GA  +
Sbjct  570  TPLHVACHYNNQQVALLLLEKGAS-PHATAKNGHTPLHIAARKNQMDIATTLLEYGALAN  628

Query  222  AKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSITGDDGKTALDSARSGEYTAVSEFLE  281
            A+ S+ G+TPL  +  EG   +   L+   A V+    +G T +      +   V+E LE
Sbjct  629  AE-SKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILE  687


 Score = 38.5 bits (88),  Expect = 0.007, Method: Composition-based stats.
 Identities = 28/85 (33%), Positives = 44/85 (52%), Gaps = 2/85 (2%)

Query  198  LHAAARGGHLQLARLLLLHGADLDAKRSRGGYTPLMTAVDEGQLRMVKYLVRAGADVSIT  257
            LH AA+   ++ A LLL +  + D   S+ G+TPL  A   G   +   L++ GADV+ +
Sbjct  176  LHIAAKKDDVKAATLLLDNDHNPDVT-SKSGFTPLHIASHYGNQNIANLLIQKGADVNYS  234

Query  258  GDDGKTALD-SARSGEYTAVSEFLE  281
                 + L  +A+ G+   VS  LE
Sbjct  235  AKHNISPLHVAAKWGKTNMVSLLLE  259



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold1083-size585250-augustus-gene-4.6-mRNA-1

Length=320
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9N5S9_CAEEL  unnamed protein product                                 38.1    0.008
Q1ZXU8_CAEEL  unnamed protein product                                 35.8    0.044
Q21812_CAEEL  unnamed protein product                                 35.8    0.047


>Q9N5S9_CAEEL unnamed protein product
Length=410

 Score = 38.1 bits (87),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 43/102 (42%), Gaps = 1/102 (1%)

Query  183  YLPLMQRATDETDAQFSLRVSEAIAKQLGIVATSYTSA-DKAEFEKRCLMDQTAMVTRPV  241
            YLP M R   E    F+ RV + IA + G+V   +     +A+   + +  Q       +
Sbjct  266  YLPPMTRRDGEDAVDFANRVKKEIANKGGLVDLEWDGGLKRAKVPPKMVAKQQERYANRL  325

Query  242  SRTDPAIQAMADRVAEVLPDVPLDVILKDVASSNSFPKSAQD  283
            SR     + + D   +V  D   D++ K V+  NS     +D
Sbjct  326  SRYTSVSEVVKDEDVDVTSDSSSDLVDKPVSGYNSLEDLPED  367


>Q1ZXU8_CAEEL unnamed protein product
Length=455

 Score = 35.8 bits (81),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  183  YLPLMQRATDETDAQFSLRVSEAIAKQLGIVATSYTSADKAE  224
            YLP M R  +E    F+ RV  AIAK+ G++   +  A K E
Sbjct  326  YLPAMTRGENEDSISFAKRVKRAIAKKGGLIDLEWDGALKRE  367


>Q21812_CAEEL unnamed protein product
Length=512

 Score = 35.8 bits (81),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (55%), Gaps = 0/42 (0%)

Query  183  YLPLMQRATDETDAQFSLRVSEAIAKQLGIVATSYTSADKAE  224
            YLP M R  +E    F+ RV  AIAK+ G++   +  A K E
Sbjct  383  YLPAMTRGENEDSISFAKRVKRAIAKKGGLIDLEWDGALKRE  424



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold32-size2469902-augustus-gene-4.1-mRNA-1

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AGO3_BOMMO  unnamed protein product                                   414     2e-134
AGO3_DROME  unnamed protein product                                   334     2e-104
AUB_DROME  unnamed protein product                                    236     7e-68 


>AGO3_BOMMO unnamed protein product
Length=926

 Score = 414 bits (1065),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 238/586 (41%), Positives = 334/586 (57%), Gaps = 51/586 (9%)

Query  9    GYGRGRASILAQA-----GLDLGRANVSVSPVAAQEQVVAPPPVPVPVP------VLGRG  57
            G GRGR+  L QA      +D    + S SP +  EQ  AP  +    P      + GRG
Sbjct  5    GKGRGRSLALLQALKKSQMMDSPSQSESQSPESTPEQSTAPSTIASATPSTSGVSIGGRG  64

Query  58   RGQARIVELLQQQSAAAAAELSAASRQRDDAAAQPGQVQLPISG-GRGSRLLPFFPVEQQ  116
            R  A ++  +QQ+  +    +             P     P +G GRG +LL      Q+
Sbjct  65   RAAALMLAKMQQKPGSTTPAIFVP----------PSSTSAPTAGTGRGFKLLQNLQASQK  114

Query  117  PVGQASAQPPMVSAGRSSSILSALSGSLAPQKAPSQAQAPQPVAPVAQKPQAARVPALEE  176
               Q ++     SA    S +  L+  ++     +QA +             A+     E
Sbjct  115  ASSQIASSQVTSSA---QSDIKDLTEKMSETSVSAQASS------------VAKNKYFRE  159

Query  177  KMEHVSLQEKPPIVRMGESGTKIPAAANYIALNLEPGKGVYEYEVRFNPECDAMNFRFKM  236
                  +++ PP+V+ GE+G  I    NYI LN +    V+EYEV+F P+ D  + RFK+
Sbjct  160  ------VKDTPPVVKKGETGVPIEVTCNYIYLNFKENI-VFEYEVKFEPDQDYKHLRFKL  212

Query  237  LNEHILAIGGVKTFDGVTLYLPVKLPNEMTYLTSTHPASDVTVTISVQFKRQKRLGECIH  296
            LNEHI      KTFDG TLY+P +LP+ +  L ST+P     V +S+ F+R +RL E IH
Sbjct  213  LNEHIEHFKE-KTFDGTTLYVPHELPDAVRNLVSTNPYDQSKVNVSIIFRRTRRLSEMIH  271

Query  297  LYNVLFKRIMKELQMSRHGRHHFNPKDAQVIPQYKLEVWPGCITAVDEYEGGIQLCFDAS  356
            +YNV+FK IMK+L++ R GR H+N   A  IPQ+KLEVWPG +TAVDEYEGG+ L  D++
Sbjct  272  IYNVMFKCIMKDLKLIRFGRQHYNEHAAIQIPQHKLEVWPGYVTAVDEYEGGLMLTLDST  331

Query  357  HRVLRKQSVKEFMSEVIRKFPANYREEIAKGLIGSSVMTMYNNKLYRVDDIDWSKNPLST  416
            HRVLR Q+V   + EV++   AN++ ++   LIG+SVMT YN KL+RVD ID   +P ST
Sbjct  332  HRVLRTQTVLSLIKEVVQTEGANWKRKMTDILIGASVMTTYNKKLFRVDTIDDKMSPRST  391

Query  417  FTLSNGQE---VSFVDYYKRHYNIQIRDTQQPLLITKIKSR---KNEGTEELLALIPELA  470
            F  +   E   +SF+DYYK++Y I+I D  QPLLI++   R    +  T+ ++ LIPEL 
Sbjct  392  FEKTEKGETVQISFIDYYKKNYGIEIMDWDQPLLISRDTKRMPGSDTPTDFMICLIPELC  451

Query  471  NLTGLTDQMRNDFQIMKSIAMYTRISPNQRKLAMMKFIENVNSNPGASKLLSDWGLTLAS  530
             LTGLTD  R++F++MK +A YTRI+PNQR  A  K+IE+V  N  A   L+ WGL++A 
Sbjct  452  QLTGLTDDQRSNFRLMKDVATYTRITPNQRHAAFKKYIESVMKNETAKSRLAGWGLSIAP  511

Query  531  APVNLTARVLPPERIIFGQGAEVPGIPNADWSGAAMRNHVLHAVSI  576
              VNLTAR LPPE + FG    VPG PNA+W+    ++ V+ AV I
Sbjct  512  ETVNLTARTLPPETLYFGDNVRVPGKPNAEWNSEVTKHSVMQAVDI  557


>AGO3_DROME unnamed protein product
Length=867

 Score = 334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 182/522 (35%), Positives = 296/522 (57%), Gaps = 23/522 (4%)

Query  59   GQARIVELLQQQSAAAAAELSAASRQRDDAAAQPGQVQLPISGGRGSRLLPFFPVEQQPV  118
            G+  ++ L  + +      +S+   + D        +    S   G RLL    +E   +
Sbjct  3    GRGNLLSLFNKNAGNMGKSISSKDHEIDSG------LDFNNSESSGERLLSSHNIETDLI  56

Query  119  GQASAQPPMVSAGRSSS-ILSALSGSLAPQKAPSQAQAPQPVAPVAQKPQAARVPALEEK  177
               + Q   +S GR  + ++  L            +++ + +    + P++  + A E  
Sbjct  57   --TTLQHVNISVGRGRARLIDTLKTDDHTSNQFITSESKENITKKTKGPESEAI-ASENG  113

Query  178  MEHVSLQEKPPIVRMGESGTKIPAAANYIALNLEPGKGVYEYEVRFNPECDAMNFRFKML  237
            +         P +  G  G+ +    NY+ L  +  KGV+ YEVRF P  D+++ R K L
Sbjct  114  LFF-------PDLIYGSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYL  166

Query  238  NEHILAIGGVKTFDGVTLYLPVKLPNEMTYLTSTHPASDVTVTISVQFKRQKRLGECIHL  297
            N+H   +GG KTFDG TLYLP+ LPN+MT   S   A DV + I + +K+++ +  C  L
Sbjct  167  NDHKDKLGGTKTFDGNTLYLPILLPNKMTVFIS--KAEDVELQIRILYKKKEEMRNCTQL  224

Query  298  YNVLFKRIMKELQMSRHGRHHFNPKDAQVIPQYKLEVWPGCITAVDEYEGGIQLCFDASH  357
            YN+LF R+MK L   +  R  F+P   ++IP  KLEVWPG +TAVDEY+GG+ LC D SH
Sbjct  225  YNILFDRVMKVLNYVKFDRKQFDPSRPKIIPLAKLEVWPGYVTAVDEYKGGLMLCCDVSH  284

Query  358  RVLRKQSVKEFMSEVIRKFPANYREEIAKGLIGSSVMTMYNNKLYRVDDIDWSKNPLSTF  417
            R+L +++V E + ++ ++   +Y+E   K L+G+ V+T YNN+ Y+++DI + +NP   F
Sbjct  285  RILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQF  344

Query  418  TLSNGQEVSFVDYYKRHYNIQIRDTQQPLLITKIKSRKNEGTEELL--ALIPELANLTGL  475
             +  G   S+V+YYK+++NI I+D  QPL+ +  KSR      E L   LIPEL  LTGL
Sbjct  345  EIKTGC-TSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCLIPELCYLTGL  403

Query  476  TDQMRNDFQIMKSIAMYTRISPNQRKLAMMKFIENVNSNPGASKLLSDWGLTLASAPVNL  535
             D++R+D ++M+ IA +TR+SPNQR++A+ KF ENV++ P A ++L+ WGL+L +    +
Sbjct  404  RDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKI  463

Query  536  TARVLPPERIIFGQGAEVPGIPNADWSGAAMRNHVLHAVSIS  577
            + R +  E+I F + +   G  +A++S  A+ N +L  V +S
Sbjct  464  SGRQMDIEQIYFSKISVSAG-RSAEFSKHAVTNEMLKVVHLS  504


>AUB_DROME unnamed protein product
Length=866

 Score = 236 bits (601),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 121/387 (31%), Positives = 214/387 (55%), Gaps = 12/387 (3%)

Query  186  KPP--IVRMGESGTKIPAAANYIALNLEPGKGVYEYEVRFNPECDAMNFRFKMLNEHILA  243
            +PP    + G  GT I   ANY  +   P   +Y+Y V F P+ +A   R   L EH   
Sbjct  96   RPPGMTSKKGVVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGI  155

Query  244  IGGVKTFDGVTLYLPVKL------PNEMTYLTSTHPASDVTVTISVQFKRQKRLGECIHL  297
            +GG   FDG  ++   +       P  +  +T +    ++ + I      Q    E   +
Sbjct  156  LGGY-IFDGTNMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQV  214

Query  298  YNVLFKRIMKELQMSRHGRHHFNPKDAQVIPQYKLEVWPGCITAVDEYEGGIQLCFDASH  357
             N++ +R M+ L +    R++++P+    +  +++++WPG  T++ ++E  I LC +  H
Sbjct  215  LNLILRRAMEGLDLKLVSRYYYDPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICH  274

Query  358  RVLRKQSVKEFMSEVIRKFPANYREEIAKGLIGSSVMTMYNNKLYRVDDIDWSKNPLSTF  417
            +V+R +++   +S+ IR    +Y+    + ++G  ++T YNNK YR+DD+D+   PL  F
Sbjct  275  KVMRTETLYNILSDAIRD-SDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKF  333

Query  418  TLSNGQEVSFVDYYKRHYNIQIRDTQQPLLITKIKSRK-NEGTEELLALIPELANLTGLT  476
              ++G E+S+VDYYK+ YNI IRD +QPL++++   +    G ++ + +IPELA  TG+T
Sbjct  334  KTNDG-EISYVDYYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQAIMIIPELARATGMT  392

Query  477  DQMRNDFQIMKSIAMYTRISPNQRKLAMMKFIENVNSNPGASKLLSDWGLTLASAPVNLT  536
            D MR DF+ +++++ +TR++P++R   +  F + + S   + + L  W + L SA V + 
Sbjct  393  DAMRADFRTLRAMSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIP  452

Query  537  ARVLPPERIIFGQGAEVPGIPNADWSG  563
            ARVLPPE+I+FG          ADW+ 
Sbjct  453  ARVLPPEKILFGNQKIFVCDARADWTN  479



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold1603-size495074-augustus-gene-2.1-mRNA-1

Length=234
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q581Q7_TRYB2  unnamed protein product                                 65.1    4e-12
Q383Y5_TRYB2  unnamed protein product                                 56.6    3e-09
Q583R2_TRYB2  unnamed protein product                                 52.4    7e-08


>Q581Q7_TRYB2 unnamed protein product
Length=422

 Score = 65.1 bits (157),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 88/203 (43%), Gaps = 22/203 (11%)

Query  28   KDPVEKLRHLCL--ARGVTGVLSIGRIFRRMDDDGNKSLNLEEFTEGMNDTGLRLGEEDV  85
            K  V++ R L    A G  G+  + R      D G +S+   +F E + ++G+ L  ED+
Sbjct  15   KSIVQRTRRLLCNGASGANGIRKLSRGCGIAVDSGGQSMEKAKFVEALEESGVSLDSEDI  74

Query  86   KTLFDQFDKDGSGSISMDEFLLELRVSTTAETASPGLVCHLFGVPAMSETRLKVIDEAFK  145
            + +    D+ G G +   +F+  LR +                   ++  +L  I   + 
Sbjct  75   EAIVHVLDRSGDGVLDPTDFIAALRRN-------------------LTPLKLTWITRVWY  115

Query  146  KLDKTGDGVITIDDLRGVYSVKGNPRYLNGEETEEEILIKFLHNFERDDGSHDNKVTKEE  205
               ++ DG + ID++   Y+  G+P  +    +E+ +  +F   F       D  +T++E
Sbjct  116  TFTQSKDGSVYIDEVLSSYNAAGHPDVVQNIRSEQGVRSEFEAAFSTTTNP-DGAITRQE  174

Query  206  FVNYYAGVSASVDQDGYFDLMMR  228
            F  Y +GV+A    D  F  +MR
Sbjct  175  FEQYCSGVAALCANDLEFLTLMR  197


>Q383Y5_TRYB2 unnamed protein product
Length=552

 Score = 56.6 bits (135),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/169 (24%), Positives = 82/169 (49%), Gaps = 23/169 (14%)

Query  67   EEFTEGMNDTGLRLGEEDVKTLFDQFDKDGSGSISMDEFLLELRVSTTAETASPGLVCHL  126
            ++   G++  G+ +   ++  +F + D+ G+G +   EFL ELR             C L
Sbjct  343  QDIFHGISLMGVTIHPGELDVIFKKLDRVGNGFVVAQEFLRELR-------------CEL  389

Query  127  FGVPAMSETRLKVIDEAFKKLDKTGDGVITIDDLRG--VYSVKGNPRYLNGEETEEEILI  184
                   ++RL+ +  AF++L   G G +   D+    V++   +P    G  + EEI+ 
Sbjct  390  ------PQSRLQGVISAFQQLVIEGGGSVDYKDMLNLFVFNACFHPDVEEGIASREEIIF  443

Query  185  KFLHNFERDDGSHDNKVTKEEFVNYYAGVSASVDQDGYFDLMMRQSFKL  233
             F++ +   + +  + VT + FV YY  VS +++ D  F  M+++ +K+
Sbjct  444  DFINCWPNMNST--SSVTTDMFVAYYTDVSPAIESDERFFKMLKRCWKI  490


>Q583R2_TRYB2 unnamed protein product
Length=359

 Score = 52.4 bits (124),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 105/238 (44%), Gaps = 41/238 (17%)

Query  16   LVNRSEREAAVCKDPVEKLRH---LCLARGV--TGVLSIGRIFRRMDDDGNKSLNLE---  67
            L+ ++ R +    D ++++R      +  G+   G+ ++GR FR++  DG + ++ E   
Sbjct  142  LLQQTHRVSGEAIDALKRIREAYIFNVGNGIPEVGIKAMGRHFRKVGSDGRRWMSYEGIV  201

Query  68   -------EFTEGMNDTGLRLGEEDVKT----LFDQFDKDGSGSISMDEFLLELRVSTTAE  116
                    F   ++ +  +  EEDV T    +++ F K+    I  D F+  +R      
Sbjct  202  RFVKDSRNFNATLSFSDTQRTEEDVNTVATCIYNAFPKNEEECIDYDFFMDYVR------  255

Query  117  TASPGLVCHLFGVPAMSETRLKVIDEAFKKLDKTGDGVITIDDLRGVYSVKGNPRYLNGE  176
                           MS+ R   +   F+++D   DG + I D++  Y+ + +P      
Sbjct  256  -------------GPMSQERKDAVWNIFRRMDYDRDGNLNIIDIQACYNTQDHPTCSVDH  302

Query  177  ETEEEILIK-FLHNFERDDGSHDNKVTKEEFVNYYAGVSASVDQDGYFDLMMRQSFKL  233
              + + ++K FL  +  D+      V   EF++YY GVSA ++ D  F  ++   +KL
Sbjct  303  LFQSDKMLKGFLTIW--DENERCGLVPYAEFLDYYNGVSAVLEDDKVFFDVLNNQWKL  358



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold2364-size361272-augustus-gene-2.3-mRNA-1

Length=414
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FICD_DROME  unnamed protein product                                   487     1e-170
FICD_CAEEL  unnamed protein product                                   311     7e-102
Q38A83_TRYB2  unnamed protein product                                 34.7    0.17  


>FICD_DROME unnamed protein product
Length=492

 Score = 487 bits (1253),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 227/342 (66%), Positives = 278/342 (81%), Gaps = 1/342 (0%)

Query  49   EALGSLHAALEMKKAGKNEKALKLFQHSVALSPKHPDILNYYGEFLEETQKDIVRADHLY  108
            EALG+L  A ++  AGK++KA +LF+H++AL+P+HP++L  YGEFLE  Q++IV AD  Y
Sbjct  117  EALGALRMAQDLYLAGKDDKAARLFEHALALAPRHPEVLLRYGEFLEHNQRNIVLADQYY  176

Query  109  FQALALSPGHSRALGNRERTAPIVEEMDSSLLKRIDKKRDTLSAIPNSNSAFRRVKKEAY  168
            FQAL +SP +S AL NR+RTA +V+ +D   L+ +D KRD LSAI  SN A RR KKEAY
Sbjct  177  FQALTISPSNSEALANRQRTADVVQSLDERRLESLDSKRDALSAIHESNGALRRAKKEAY  236

Query  169  FQHIYHTVGIEGNTMTLAQTRSIVETRMAVAGKSIMEHGEILGLDAALKYINSTLVNRLG  228
            FQHIYH+VGIEGNTMTLAQTRSI+ETRMAV GKSI EH EILG+D A+KYIN++LV ++ 
Sbjct  237  FQHIYHSVGIEGNTMTLAQTRSILETRMAVDGKSIDEHNEILGMDLAMKYINASLVQKID  296

Query  229  ATSVKDILEIHRRVLGFVDPVEAGMFRRTQVYVGGHVPPGPLQITLLMEEFSRWLNSERV  288
             T +KDILE+HRRVLG VDP+E G FRR QVYVGGH+PPGP  + LLM+ F RWLNSE  
Sbjct  297  IT-IKDILELHRRVLGHVDPIEGGEFRRNQVYVGGHIPPGPGDLALLMQRFERWLNSEHS  355

Query  289  ARMHPIRYAALAHYKLVHIHPFSDGNGRTARLLMNTILMQAGFPPVIILKQDRHKYYEYL  348
            + +HP+ YAALAHYKLVHIHPF DGNGRT+RLLMNT+LM+AG+PPVII KQ R KYY +L
Sbjct  356  STLHPVNYAALAHYKLVHIHPFVDGNGRTSRLLMNTLLMRAGYPPVIIPKQQRSKYYHFL  415

Query  349  EAANRGDVRPFVRFIAECTEQTLNLYLWATSEYASQFPALSQ  390
            + AN GD+RPFVRFIA+CTE+TL+LYLWATS+   Q P L Q
Sbjct  416  KLANEGDIRPFVRFIADCTEKTLDLYLWATSDLPQQIPMLIQ  457


>FICD_CAEEL unnamed protein product
Length=508

 Score = 311 bits (798),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 225/330 (68%), Gaps = 3/330 (1%)

Query  49   EALGSLHAALEMKKAGKNEKALKLFQHSVALSPKHPDILNYYGEFLEETQKDIVRADHLY  108
            EA+ +  AA   +K G  E+A+ + +H++AL+P +P IL   G+ + E   ++V AD  Y
Sbjct  146  EAILAAKAAGRSRKDGNLERAMTIMEHAMALAPTNPQILIEMGQ-IREMHNELVEADQCY  204

Query  109  FQALALSPGHSRALGNRERTAPIVEEMDSSLLKRIDKKRDTLSAIPNSNSAFRRVKKEAY  168
             +ALA  PG+S AL  R RT P+V  +D  +L+ +   RD  + + +S +A RR+ +E Y
Sbjct  205  VKALAYDPGNSEALVLRARTTPLVSAIDRKMLRSVHDLRDEFNHLQHS-TALRRMMRETY  263

Query  169  FQHIYHTVGIEGNTMTLAQTRSIVETRMAVAGKSIMEHGEILGLDAALKYINSTLVNRL-  227
            F ++YHTV IEGNT++L QTR+I+E+ M + GKSI EH E++G+DAAL+++N +L+++  
Sbjct  264  FLYVYHTVAIEGNTLSLGQTRAILESGMVIPGKSIREHNEVIGMDAALRFLNCSLLSKEH  323

Query  228  GATSVKDILEIHRRVLGFVDPVEAGMFRRTQVYVGGHVPPGPLQITLLMEEFSRWLNSER  287
               S+ DILE+HRRVLG  DPVEAG  R TQVYVG   P  P  +   +++   WLN E 
Sbjct  324  DEISIDDILEMHRRVLGNADPVEAGRIRTTQVYVGRFTPVSPEYVMEQLKDIVDWLNDES  383

Query  288  VARMHPIRYAALAHYKLVHIHPFSDGNGRTARLLMNTILMQAGFPPVIILKQDRHKYYEY  347
               + PI  AA+AHYKLV +HPF+DGNGRTARLL+N I+M++GFPPVI+  + R +YY  
Sbjct  384  TLTIDPIERAAIAHYKLVLVHPFTDGNGRTARLLLNLIMMRSGFPPVILPVETRAEYYAS  443

Query  348  LEAANRGDVRPFVRFIAECTEQTLNLYLWA  377
            L  AN GD+RPFVR++A+ +E ++  Y+ A
Sbjct  444  LHVANLGDLRPFVRYVAKHSEASIQRYIGA  473


>Q38A83_TRYB2 unnamed protein product
Length=1664

 Score = 34.7 bits (78),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 20/70 (29%), Positives = 37/70 (53%), Gaps = 6/70 (9%)

Query  183   MTLAQTRSIVETRMAVAGKSIMEHGEILGLDAALKYINSTLVNRLGATSVKDILEIHRRV  242
             +TLAQT +++ TRM   G S++  GE +GL +   ++ +  + R       D++    ++
Sbjct  1122  LTLAQTAAVILTRMPSDGNSLLRTGEFIGLFSV--FVKTLSLYR----DDDDVISRGLKI  1175

Query  243   LGFVDPVEAG  252
             +G   PVE  
Sbjct  1176  VGVFKPVEVA  1185



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold5065-size175302-augustus-gene-0.2-mRNA-1

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q17NZ6_AEDAE  unnamed protein product                                 51.6    1e-07
Q9VPS2_DROME  unnamed protein product                                 47.4    1e-05
Q9VQX3_DROME  unnamed protein product                                 46.6    3e-05


>Q17NZ6_AEDAE unnamed protein product
Length=160

 Score = 51.6 bits (122),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 64/133 (48%), Gaps = 17/133 (13%)

Query  440  KFH--SRGADWTTANATCESESAHLLVVNSEEEAQLVVDLFARHPSRDVDYNDQIWVGVN  497
            KF+  S  A+W  AN  C S    L+ + S+E+   V   + R  S+  D N   W+G +
Sbjct  27   KFYIPSIRANWFKANEFCNSLKMRLVAIRSQEDNDAVAR-YVRTTSKFTD-NCSFWIGAS  84

Query  498  DLEEEGKFVTVLGGDLSAAGYASWFDGQPDDWRVVDPSGEDCVTMKRNKML------NDV  551
            DL +EG FV V  G+     Y +W + +P++    +   EDC+ +     L      ND 
Sbjct  85   DLADEGTFVWVATGE--EVTYTNWRENEPNN----EGGNEDCIQLAYIPALNYHWSWNDN  138

Query  552  HCTAK-MPYVCEA  563
             C  + + ++CE+
Sbjct  139  TCAGQSLYFICES  151


 Score = 47.8 bits (112),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/136 (29%), Positives = 65/136 (48%), Gaps = 23/136 (17%)

Query  268  KFY--SRGADWATAKTTCQSEGAHLLVVNSEEEAQLVVDLLARQPSPDADHKDQ--IWVG  323
            KFY  S  A+W  A   C S    L+ + S+E+     D +AR     +   D    W+G
Sbjct  27   KFYIPSIRANWFKANEFCNSLKMRLVAIRSQEDN----DAVARYVRTTSKFTDNCSFWIG  82

Query  324  VNDLEEEGKFNTV-LGEALSPAGYASWNEDQPDDLRVMDPNGEDCV------TMKWNKQL  376
             +DL +EG F  V  GE ++   Y +W E++P++    +   EDC+       + ++   
Sbjct  83   ASDLADEGTFVWVATGEEVT---YTNWRENEPNN----EGGNEDCIQLAYIPALNYHWSW  135

Query  377  NDLACT-DNVAFVCEA  391
            ND  C   ++ F+CE+
Sbjct  136  NDNTCAGQSLYFICES  151


>Q9VPS2_DROME unnamed protein product
Length=269

 Score = 47.4 bits (111),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 59/119 (50%), Gaps = 12/119 (10%)

Query  274  ADWATAKTTCQSEGAHLLVVNSEEEAQLVVDLLARQPSPDADHKDQIWVGVNDLEEEGKF  333
             DW  A + C   GAHLL + SE+E    +D +  +     D     W+ +ND+ + G+F
Sbjct  161  VDWFKATSMCHKMGAHLLTIQSEDE----LDAIRTELKDINDGSHDFWLDINDIAKWGEF  216

Query  334  NTVLGEALSPAGYASWNEDQPDDLRVMDPNGEDCVTMKWNKQLNDLACTDNVAFVCEAG  392
             + L   ++P  +  W++ +P  +++     + CV ++   ++ D  C++   F+C+  
Sbjct  217  IS-LATGMNPP-FLKWHKHRP-QVQI----HQRCVHLR-GGEMMDGKCSEQFLFICQLA  267


 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/192 (21%), Positives = 80/192 (42%), Gaps = 23/192 (12%)

Query  383  DNV--AFVCEAGDTQPITIAESDAAAGEEAQSSQEQSLSYEEEADPTRPG------YVKL  434
            DNV   F   +   + +   +   A+ E      +++L+   EA    P       + K+
Sbjct  89   DNVDNEFNALSAKIKNVKNIQRHLASLELQLQETKKALNLSVEAKKVMPKTEIPSQFQKI  148

Query  435  GEGSYKFHSR-GADWTTANATCESESAHLLVVNSEEEAQLVVDLFARHPSRDV-DYNDQI  492
            G   +    +   DW  A + C    AHLL + SE+E   +     R   +D+ D +   
Sbjct  149  GWRHFFIEKKHKVDWFKATSMCHKMGAHLLTIQSEDELDAI-----RTELKDINDGSHDF  203

Query  493  WVGVNDLEEEGKFVTVLGGDLSAAGYASWFDGQPDDWRVVDPSGEDCVTMKRNKMLNDVH  552
            W+ +ND+ + G+F+++  G      +  W   +P          + CV ++  +M+ D  
Sbjct  204  WLDINDIAKWGEFISLATG--MNPPFLKWHKHRPQ-----VQIHQRCVHLRGGEMM-DGK  255

Query  553  CTAKMPYVCEAG  564
            C+ +  ++C+  
Sbjct  256  CSEQFLFICQLA  267


>Q9VQX3_DROME unnamed protein product
Length=359

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 59/136 (43%), Gaps = 17/136 (13%)

Query  429  PGYVKLGEGSYKF-HSRGADWTTANATCESESAHLLVVNSEEEAQLVVDLFARHPSRDVD  487
            P + ++G   +   H    DW +A   C     ++  +  +EE   +        S  +D
Sbjct  236  PKFERIGSRLFYINHKDAYDWQSAVDFCRDMGGYIAAIKDQEELDAI--------SARLD  287

Query  488  YNDQIWVGVNDLEEEGKFVTVLGGDLSAAGYASWFDGQPDDWRVVDPSGEDCVTMKRNKM  547
             +   W+G+NDL+    +V+V  G      + +W  G+P+         E+CV + R+KM
Sbjct  288  -DKSYWLGINDLQSSNTYVSVASG--REVEFLNWNAGEPNH----GNEDENCVELIRSKM  340

Query  548  LNDVHCTAKMPYVCEA  563
             ND  C  K   +C+ 
Sbjct  341  -NDDPCHRKKHVICQT  355


 Score = 37.0 bits (84),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 72/169 (43%), Gaps = 22/169 (13%)

Query  229  KTKGNKKVELSKEGGTPEDHK---EEADPKR--PGYVKLGEGSYKFYSRGA-DWATAKTT  282
            K + N+K EL+K G     ++   +E   K   P + ++G   +    + A DW +A   
Sbjct  203  KLEQNQKDELTKLGAQQSANQVTLKEIYTKVFWPKFERIGSRLFYINHKDAYDWQSAVDF  262

Query  283  CQSEGAHLLVVNSEEEAQLVVDLLARQPSPDADHKDQIWVGVNDLEEEGKFNTVLGEALS  342
            C+  G ++  +  +EE   +        S   D K   W+G+NDL+    + +V      
Sbjct  263  CRDMGGYIAAIKDQEELDAI--------SARLDDKS-YWLGINDLQSSNTYVSVASG--R  311

Query  343  PAGYASWNEDQPDDLRVMDPNGEDCVTMKWNKQLNDLACTDNVAFVCEA  391
               + +WN  +P+         E+CV +  +K +ND  C      +C+ 
Sbjct  312  EVEFLNWNAGEPNH----GNEDENCVELIRSK-MNDDPCHRKKHVICQT  355



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold212-size1131905-augustus-gene-1.6-mRNA-1

Length=226
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38FG4_TRYB2  unnamed protein product                                 30.4    1.5  
PQE1_CAEEL  unnamed protein product                                   28.5    6.1  


>Q38FG4_TRYB2 unnamed protein product
Length=1366

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 24/42 (57%), Gaps = 5/42 (12%)

Query  151  GDHKPLLHGILSQHHHQVHP-GLLTAHRTSAYTTHSSTAARE  191
            GD    LH ++ Q    V P GLLTA + S YT  SS AARE
Sbjct  539  GDLGHPLHSLMGQ----VLPNGLLTASQNSGYTEMSSAAARE  576


>PQE1_CAEEL unnamed protein product
Length=1647

 Score = 28.5 bits (62),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 25/44 (57%), Gaps = 4/44 (9%)

Query  130  ELVRGAVL-EMAHSPPPVKREPGDHKPLLHGILSQHHHQVHPGL  172
            ++ +GA L  MA  PPP+ R PG H+  +H + S    QV P L
Sbjct  459  QMRQGAGLPNMAMPPPPLMRHPGPHQNPIHAMQSM---QVQPPL  499



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold5214-size169728-augustus-gene-0.13-mRNA-1

Length=181
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389W6_TRYB2  unnamed protein product                                 43.5    1e-05


>Q389W6_TRYB2 unnamed protein product
Length=148

 Score = 43.5 bits (101),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 42/79 (53%), Gaps = 7/79 (9%)

Query  95   ALVLYLVWALVPHEVLHAAGLSYWPHKYWAVAIPMQLCVALALFAFLVYPSLSLLMTPCA  154
            +LV+Y +WA +P   L     SY+P KYWAVAIP     A+ +   + Y ++  L+    
Sbjct  42   SLVVYFLWAFIPTSFLDMVLASYYPDKYWAVAIP-----AILVMTMVYYLTVHFLLMLYR  96

Query  155  SDMRTVTDSYALRLSQQAV  173
            +D   +TD + +  +  AV
Sbjct  97   TD--PLTDGFCVAQTNGAV  113



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold751-size915585-augustus-gene-2.2-mRNA-1

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VAR0_DROME  unnamed protein product                                 191     2e-52
Q95SK9_DROME  unnamed protein product                                 37.4    0.029
DDX49_DROME  unnamed protein product                                  36.2    0.070


>Q9VAR0_DROME unnamed protein product
Length=835

 Score = 191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/426 (28%), Positives = 222/426 (52%), Gaps = 25/426 (6%)

Query  31   DGLEPVPCQPWTSRLPKMAQPDLGYIAPEVQTSSICSILSDMFSLGMVICTIFNNGRPLI  90
            DG    P + +T+ L  +AQP L Y APE+  +S+ +  SD+FSLG++I TI+  G+PL 
Sbjct  198  DGTPHWPFREYTTSLHVLAQPSLEYTAPELALNSVNTPDSDLFSLGVLIFTIYA-GKPLK  256

Query  91   QANHSSSTYLKQLEVESMTQVRCSVLQLEDQLHNVLPKVPMALQEASVRLLSRDTRQRPT  150
                  S++            R     L  + +  +  VP  L E+   LL      RP 
Sbjct  257  MFGSDYSSF------------RRYANDLNQRKYPPMNAVPSELTESLKALLHPSANLRPK  304

Query  151  AQLLSLIKYFSGIKEKLCAFSDPAVHALQFLDVINMKDPSQKSHFYRNTLKDVLPYIPRK  210
               L  I YF           D  V  L +LD +   D  QKS FY+  L  ++P +P +
Sbjct  305  LHELKQIAYFQ----------DVGVKTLSYLDSLYQWDNLQKSKFYKG-LPQIIPTLPHR  353

Query  211  LWLQHVWPCLQQEMKTQEVLASVLQPIIFLIQECTIEEYESIILPSFRNVFSIPKSIQAT  270
            + L  + P L +E     ++  VL  ++ + +  +  EY   ILP  + +F +   IQ  
Sbjct  354  VNLHSILPYLVKEFVNSPMIPFVLPNVLLIAEMSSQREYCDHILPHLKPIFKLTDPIQIL  413

Query  271  VTLLENLHVILEKTPRDDIRSEVLPMLFNAFESTTIQVQSAALVAVTNVSEYLDETAIRR  330
            +  ++ + ++L+ TP ++++  VLP+L+ + E    Q+Q   L  +   S  +D  A++ 
Sbjct  414  LIFMQKMDLLLKLTPAEEVKQSVLPLLYRSLECDMPQIQDLCLAVLPTFSTLIDYNAMKN  473

Query  331  MVLPKTKSVYEKNSGDIKIVGNVLSCVEKTLDRLDKSQIIDEVLPLLWDVRLQDPDITIR  390
             VLP+ K +  ++S ++ +  N L  + K L+ LDK  ++DE+LP L  ++ ++P I + 
Sbjct  474  SVLPRIKKLCLQSS-NVSVKVNCLISIGKLLENLDKWLVLDEILPFLQQIQSREPAIIMG  532

Query  391  VVNIYRLMLSDKKYGLSVNLMATRVMPSLLPQTVNPSLNLEQFTNLLEVLQEMLDHIDRN  450
            ++ IY++ +++ K G++ ++MA + +P L+P +V   L + QF  ++ +++EM+  +++ 
Sbjct  533  IIGIYKIAMTNTKLGITKDVMAHKCIPYLVPLSVENGLTIAQFNTIISLIKEMMGRVEQE  592

Query  451  QRNKVK  456
            QR K++
Sbjct  593  QREKLQ  598


>Q95SK9_DROME unnamed protein product
Length=446

 Score = 37.4 bits (85),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 28/97 (29%), Positives = 49/97 (51%), Gaps = 13/97 (13%)

Query  55   YIAPEVQTSSICSILSDMFSLGMVICTIFNNGRPLIQANHSSSTYLKQLEVESMTQVRCS  114
            ++APEV      S  +DM+S+G VIC +  +G          S ++ + ++E+M+ V  +
Sbjct  197  FVAPEVVNFDCISYGTDMWSVG-VICYVLISGL---------SPFMGENDIETMSNVTIA  246

Query  115  VLQLEDQLHNVLPKVPMALQEASVRLLSRDTRQRPTA  151
                ED+  N +   P  L +   +LL++D   R TA
Sbjct  247  KYDFEDECFNGIS--PECL-DFIAKLLAKDLSTRMTA  280


>DDX49_DROME unnamed protein product
Length=521

 Score = 36.2 bits (82),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 21/44 (48%), Gaps = 0/44 (0%)

Query  183  VINMKDPSQKSHFYRNTLKDVLPYIPRKLWLQHVWPCLQQEMKT  226
            ++  KDP Q    YR   KD L  I RK  LQH  P   +E K 
Sbjct  421  IMEGKDPDQMEALYRKKQKDKLREIRRKRKLQHAEPAASEEGKA  464



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold138-size1309700-augustus-gene-8.2-mRNA-1

Length=870
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BOP1_DROME  unnamed protein product                                   934     0.0   
Q384Z1_TRYB2  unnamed protein product                                 367     3e-114
POC1_DROME  unnamed protein product                                   75.5    4e-14 


>BOP1_DROME unnamed protein product
Length=784

 Score = 934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/677 (64%), Positives = 534/677 (79%), Gaps = 45/677 (7%)

Query  199  EYK-SDSSDEEDIRNTVGNVPMKWYDEYKHLGYDWDGKKILKPPQGDALDNFLKRMEDPN  257
            EY+ SD+SDEEDIRNTVGN+PM WYDEYKH+GYDWD KKI+KPPQGD +D FL+++EDP+
Sbjct  147  EYQDSDTSDEEDIRNTVGNIPMHWYDEYKHIGYDWDAKKIIKPPQGDQIDEFLRKIEDPD  206

Query  258  FWRTVKDPQTGQDVILCDADVDLIHQIQSQKVPDAEFNEYAPWIEWFSSEVMQMPVRKFP  317
            FWRTVKDP TGQDV L D D+ LI +I S ++P+ +  EY PWIEWF+SEV +MP++  P
Sbjct  207  FWRTVKDPLTGQDVRLTDEDIALIKRIVSGRIPNKDHEEYEPWIEWFTSEVEKMPIKNVP  266

Query  318  EHKRSFLPSRSEKQKVSRIVHAIKMGWIKP-----RERKVDQGPKFYMLWQNDDSAEQMR  372
            +HKRSFLPS SEK++VSR+VHA+KMGW+K      RE++  +GPKFYMLW+ D S E MR
Sbjct  267  DHKRSFLPSVSEKKRVSRMVHALKMGWMKTTEEVEREKQAKRGPKFYMLWETDTSREHMR  326

Query  373  RIHNHIPAPKRNLPGHAESYNPPSEYLFDKREVSQSGLLLIVMLNSLPGSWSGQVGLEGG  432
            RIH+ + APKR+LPGHAESYNPP EYLFD +E                            
Sbjct  327  RIHDPVSAPKRDLPGHAESYNPPPEYLFDAKET---------------------------  359

Query  433  GGIYDSTLQAELKQWRKLRMTPWKRKLHFIPEKHSSLREVPAYKRYIRERFLRCLDLYLC  492
                        K+W KL+  P KRKLHF+P+K  SLREVPAY RY+RERFLRCLDLYLC
Sbjct  360  ------------KEWLKLKDEPHKRKLHFMPQKFKSLREVPAYSRYLRERFLRCLDLYLC  407

Query  493  PRARKMKLMIEPEDLVPQLPSPQDLQPFPTTQSLVYEGHTDLVRSITVEPRGQYFASGSD  552
            PRA+++KL I+ E L+P+LPSP+DLQPFPT +S+VY GHTDLVRS++VEP+G+Y  SGSD
Sbjct  408  PRAKRVKLNIDAEYLIPKLPSPRDLQPFPTVESMVYRGHTDLVRSVSVEPKGEYLVSGSD  467

Query  553  DLTVKIWEVATTRCVRTIAVGGVVRSVSWCPNHALSLVAVAADRKVLLINPRVGDRLVIS  612
            D TVKIWE+AT RC+RTI    VVR V+WCPN  LS++AVA   ++LL+NP+VGD++++ 
Sbjct  468  DKTVKIWEIATGRCIRTIETDEVVRCVAWCPNPKLSIIAVATGNRLLLVNPKVGDKVLVK  527

Query  613  KTDTLLRNPPPQDVIVPERVKSSVQWEEVSDELWDTGVCVIINHFKEVKQVTWHGRGDYF  672
            KTD LL   P QDVI  ER+K++VQW     +  + GV V+I HFK ++QVTWHGRGDY 
Sbjct  528  KTDDLLAEAPSQDVIESERIKTAVQWSNAEADEQEKGVRVVITHFKPIRQVTWHGRGDYL  587

Query  673  ATVMPEGQNRSVLIHQLSKRGSQLPFSRAKGLVQCVLFHPIRPIFFVATQKHVRVYDLVK  732
            ATVMPEG NRS LIHQLSKR SQ+PFS++KGL+Q VLFHP++P FFVATQ ++R+YDLVK
Sbjct  588  ATVMPEGANRSALIHQLSKRRSQIPFSKSKGLIQFVLFHPVKPCFFVATQHNIRIYDLVK  647

Query  733  QEMIKKLMSNSKWISSIAVHPGGDNVLVGTYDRKMLWFDLDLSTKPYQTLRLHGTAVRSV  792
            QE++KKL++NSKWIS +++HP GDN+LV TYD+KMLWFDLDLSTKPYQT+RLH  AVRSV
Sbjct  648  QELVKKLLTNSKWISGMSIHPKGDNLLVSTYDKKMLWFDLDLSTKPYQTMRLHRNAVRSV  707

Query  793  AYHNRYPLFASGSDDRSVIICHGMVYNDLLQNPLIVPLKRLNYHEPKNDFGVLDLVFHPT  852
            A+H RYPLFASGSDD++VI+ HGMVYNDLLQNPLIVPLK+L  HE +++FGVLD+ +HP 
Sbjct  708  AFHLRYPLFASGSDDQAVIVSHGMVYNDLLQNPLIVPLKKLQTHEKRDEFGVLDVNWHPV  767

Query  853  QPWVFSSGGDHTVRLYT  869
            QPWVFS+G D T+RLYT
Sbjct  768  QPWVFSTGADSTIRLYT  784


>Q384Z1_TRYB2 unnamed protein product
Length=781

 Score = 367 bits (941),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 228/721 (32%), Positives = 358/721 (50%), Gaps = 102/721 (14%)

Query  201  KSDSSDEEDIRNTVGNVPMKWYDEYKHLGYDWDGKKILKPPQGDALDNFLKRMEDPNFWR  260
            +SDSS++E   N VG++P++WY +  H GYD +G+K++K  +  AL+  L+  +DPN  R
Sbjct  110  ESDSSEDEATLNRVGDIPLEWYKDEAHYGYDVEGRKLMKS-ERSALERLLEATDDPNAMR  168

Query  261  TVKDPQTGQDVILCDADVDLIHQIQSQKVPDAEFNEYAP-WIEWFSSEVMQMPV-RKFPE  318
            T+ D    +  +L +AD+ +I  +Q  + P+  +N Y    ++    + +  P+ R    
Sbjct  169  TIYDALHDEKKVLSNADLQMIFNLQRNRTPNPNYNMYEDVAVDTVEFDPLNHPLARSAGP  228

Query  319  HKRSFLPSRSEKQKVSRIVHAIKMGWIKPRERKV--DQGPKFYMLWQNDDSAEQMR----  372
             KR FLPS  + + ++++V  + M   K +E K   +   +  +LW  DD    M     
Sbjct  229  SKRKFLPSDRDMKTIAKMVRRM-MKEDKEKENKPKDETESETTILW--DDGKVVMDTHTH  285

Query  373  -RIHNHIPAPKRNLPGHAESYNPPSEYLFDKREVSQSGLLLIVMLNSLPGSWSGQVGLEG  431
             + HN +P PK   PG  ESY PP EYL                                
Sbjct  286  FKYHNRVPKPKAAPPGTYESYRPPPEYL--------------------------------  313

Query  432  GGGIYDSTLQAELKQWRKLRMTPWKRKLHFIPEKHSSLREVPAYKRYIRERFLRCLDLYL  491
                      +E  + R  R+    +K HF+P    +LR VP Y   I++R+ RCLDL  
Sbjct  314  ---------PSERAKERFARLRAIDKKEHFLPRAFDALRHVPFYNHTIQDRYQRCLDLAF  364

Query  492  CPRARKMKLMIEPEDLVPQLPSPQDLQPFPTTQSLVYEGHTDLVRSITVEPRGQYFASGS  551
             PRA++ +L+++P  L+P+LP P+DL+P+P   S  Y+GHT  VRS+ V P GQY A+  
Sbjct  365  FPRAQRTRLVVDPSKLLPELPDPRDLRPYPERLSFQYKGHTATVRSVAVNPNGQYLATAC  424

Query  552  DDLTVKIWEVATTRCVRTIAVGGVVRSVSWCPNHALSLVAVAADRKVLLINPR-VGDRLV  610
            DD  V+++EV T R ++   +G  V+ V +CP   L+++AVA +  ++ I PR     LV
Sbjct  425  DDHLVRVYEVMTGRLMKRYDMGAPVQQVEFCPVKTLNILAVAVEYSLVFIVPRFAAHELV  484

Query  611  ISKTDTLLRNPPP-------------------------------------QDVIVPERVK  633
               T   LR P                                       QD+   E   
Sbjct  485  NENTLRHLRAPGTAVNNTEVEQVVGGEVSLGGGGITQAALDKDETAHSILQDLHDVEERD  544

Query  634  SSVQWEEVSDELWDTGVCVIINHFKEVKQVTWHGRGDYFATVMPEG--QNRSVLIHQLSK  691
               ++ + S +    G+ + I    +VK+ T+H RGDY   + P+   + R  ++ QLSK
Sbjct  545  KRAEFFDASAKERRAGIVLKIALHAKVKRFTFHARGDYLCALCPKDHVKYRQTVMLQLSK  604

Query  692  RGSQLPFSRAKGLVQCVLFHPIRPIFFVATQKHVRVYDLVKQEMIKKLMSNSKWISSIAV  751
            R    PF +   +V    FHP  P+FF++T   VR+Y+L+  ++ ++  +     + +++
Sbjct  605  RKVFCPFRKFSEVVTDCKFHPREPLFFLSTTNSVRMYNLLAHKLQRRYKAPGGITTCLSI  664

Query  752  HPGGDNVLVGTYDRKMLWFDLDLSTKPYQTLRLHGTAVRSVAYH---NRYPLFASGSDDR  808
            H  GDN LVG       W+D D S KPY+ +R H   V +VA+H   N YPLFASG+ D 
Sbjct  665  HTEGDNFLVGDTTSHTQWYDCDFSDKPYKRMRSHKGVVNAVAFHTNTNAYPLFASGAADG  724

Query  809  SVIICHGMVYNDLLQNPLIVPLKRLNYHEPKNDFGVLDLVFHPTQPWVFSSGGDHTVRLY  868
             V + HGMVY+D  +N L+VP+K L +        V  + +HPT PW+F+S  D  V  +
Sbjct  725  QVHVFHGMVYDDYNKNALLVPVKILKHRR-----AVYSVAWHPTLPWIFTSTEDGVVSAW  779

Query  869  T  869
            T
Sbjct  780  T  780


>POC1_DROME unnamed protein product
Length=391

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 130/295 (44%), Gaps = 22/295 (7%)

Query  528  YEGHTDLVRSITVEPRGQYFASGSDDLTVKIWEV-ATTRCVRTIAVGGVVRSVSWCPNHA  586
            + GH+  +  +   P G   A+ S D TV +W +    RC+R  +    V  V+W P   
Sbjct  14   FTGHSGGITQLRFGPDGAQIATSSTDSTVILWNLNQAARCIRFASHSAPVNGVAWSPKGN  73

Query  587  LSLVAVAADRKVLLINPRV----GDRLVISKTDTLLRNPPPQDVIVPERVKSSVQWEEVS  642
            L + +   DR V +  P++    G+ +  SK    +       +++          ++ S
Sbjct  74   L-VASAGHDRTVKIWEPKLRGVSGEFVAHSKAVRSVDFDSTGHLMLTAS-------DDKS  125

Query  643  DELWDTGVCVIINHFKE----VKQVTWHGRGDYFATVMPEGQNRSVLIHQLSKRGSQLPF  698
             ++W       ++ F +    V+   +   G   AT      ++SV I+ +        F
Sbjct  126  AKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVATA---SDDKSVRIYDVDSGECVRTF  182

Query  699  SRAKGLVQCVLFHPIRPIFFVATQ-KHVRVYDLVKQEMIKKLMSNSKWISSIAVHPGGDN  757
            +  +   + + +HP   +  VA     ++++D+   ++++  + +S  ++ +A HP G  
Sbjct  183  TEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSGSQLLQLYVVHSAPVNDVAFHPSGHF  242

Query  758  VLVGTYDRKMLWFDLDLSTKPYQTLRLHGTAVRSVAYHNRYPLFASGSDDRSVII  812
            +L G+ DR +   DL L  +P  TL  H  AV +VA+      FA+G  DR +++
Sbjct  243  LLSGSDDRTIRILDL-LEGRPIYTLTGHTDAVNAVAFSRDGDKFATGGSDRQLLV  296


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 94/230 (41%), Gaps = 26/230 (11%)

Query  645  LWD---TGVCV-IINHFKEVKQVTWHGRGDYFATVMPEGQNRSVLIHQLSKRGSQLPFSR  700
            LW+      C+   +H   V  V W  +G+  A+    G +R+V I +   RG    F  
Sbjct  44   LWNLNQAARCIRFASHSAPVNGVAWSPKGNLVASA---GHDRTVKIWEPKLRGVSGEFVA  100

Query  701  AKGLVQCVLFHPIRPIFFVATQ-KHVRVYDLVKQEMIKKLMSNSKWISSIAVHPGGDNVL  759
                V+ V F     +   A+  K  +++ + +++ +      + W+ S    P G  V 
Sbjct  101  HSKAVRSVDFDSTGHLMLTASDDKSAKIWRVARRQFVSSFAQQNNWVRSAKFSPNGKLVA  160

Query  760  VGTYDRKMLWFDLDLSTKPYQTLRLHGTAVRSVAYH--NRYPLFASGSDDRSVIICHGMV  817
              + D+ +  +D+D S +  +T      A R +A+H        A G +   +    G  
Sbjct  161  TASDDKSVRIYDVD-SGECVRTFTEERAAPRQLAWHPWGNMLAVALGCNRIKIFDVSG--  217

Query  818  YNDLLQNPLIVPLKRLNYHEPKNDFGVLDLVFHPTQPWVFSSGGDHTVRL  867
             + LLQ  ++       +  P ND     + FHP+  ++ S   D T+R+
Sbjct  218  -SQLLQLYVV-------HSAPVND-----VAFHPSGHFLLSGSDDRTIRI  254


 Score = 32.3 bits (72),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 24/44 (55%), Gaps = 0/44 (0%)

Query  527  VYEGHTDLVRSITVEPRGQYFASGSDDLTVKIWEVATTRCVRTI  570
            +Y  H+  V  +   P G +  SGSDD T++I ++   R + T+
Sbjct  223  LYVVHSAPVNDVAFHPSGHFLLSGSDDRTIRILDLLEGRPIYTL  266



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold454-size870616-augustus-gene-4.6-mRNA-1

Length=412


***** No hits found *****



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


Query= maker-scaffold508-size828076-augustus-gene-1.3-mRNA-1

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388R5_TRYB2  unnamed protein product                                 91.7    6e-21
SRRT_DROME  unnamed protein product                                   62.4    6e-10
SRRT_ANOGA  unnamed protein product                                   52.8    6e-07


>Q388R5_TRYB2 unnamed protein product
Length=219

 Score = 91.7 bits (226),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 63/199 (32%), Positives = 104/199 (52%), Gaps = 10/199 (5%)

Query  9    KLWRIRKTVMQLCHDRGYLVTQDELDQTLEQFKEQFGDKPSEKRPARSDLIVLVAH-NDD  67
            +++R+ +TV ++  DR Y V    + +T+ QF EQ+ D+   +R  R  + V        
Sbjct  17   RMFRVMRTVGEMMRDRKYQVPSSIIPETVGQFCEQYVDREG-RRIYRERMTVPCERVGGT  75

Query  68   PTDQMFVFFPDEPKIGIKTIKTYCQRMQEENIHRAIIVVQQGMTPSAKQASIFLLNSLID  127
               +  VFF  E  +G++ +K YCQ   + N  R IIV    +  + K+     ++ +  
Sbjct  76   HRSRAMVFFASE--LGMEGMKGYCQTAMDANCERVIIVTHGKVNATVKR----YVDCINR  129

Query  128  MAPKYILEQFLESELLINITEHELVPEHVVMTPEEKQELLSRYYSKLKENQLMRIQAGDP  187
                  ++ F E +L++NIT HELVP+H  +  EE +E+L  +   L+ N L RI + DP
Sbjct  130  SGTGQKVQLFDEDDLVVNITHHELVPKHTQLEDEEVKEMLEAH--SLELNMLPRILSTDP  187

Query  188  VARYFGLKRGQFENTLRRS  206
            VA Y GL+RG+     R+S
Sbjct  188  VAAYLGLERGRVVRIERKS  206


>SRRT_DROME unnamed protein product
Length=943

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 54/98 (55%), Gaps = 21/98 (21%)

Query  469  SEDEYDRKRRDKFRGERTESY--PRGESRRGGGSDERRRDDWIDSRN-------------  513
            S+DEYDRKRRDKFRGER ESY   R + RR  G     RD+W + RN             
Sbjct  4    SDDEYDRKRRDKFRGER-ESYRTERRDDRRPVGGSAGARDEWAE-RNPFRGGASAGGGGA  61

Query  514  RQRTEYRDYRGGGGRERY-SPAHSQDMVQPMKRMKSEW  550
            R R +Y DYRG G R RY SP      + P KRM+ +W
Sbjct  62   RHRPDYSDYRGPGARPRYGSPVRD---LPPAKRMRPDW  96


>SRRT_ANOGA unnamed protein product
Length=967

 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 44/78 (56%), Gaps = 3/78 (4%)

Query  469  SEDEYDRKRRDKFRGERTESYPRGESRRGGGSDERR--RDDWIDSRNRQRTEYRDYRGGG  526
            S+DEYDRKRRDKFRGER+         RG    +R   RDDW D R R R +YRDYR   
Sbjct  4    SDDEYDRKRRDKFRGERSAGGGGDSYGRGADRPDRSRGRDDWPD-RVRPRQDYRDYRPPP  62

Query  527  GRERYSPAHSQDMVQPMK  544
                YSPA     V+ M+
Sbjct  63   RDRGYSPAREGPTVKRMR  80



Lambda      K        H
   0.322    0.136    0.442 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4237558296


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold114-size1392915-augustus-gene-6.2-mRNA-1

Length=425
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PRS8_DROME  unnamed protein product                                   791     0.0  
Q38A02_TRYB2  unnamed protein product                                 574     0.0  
Q9NC95_9TRYP  unnamed protein product                                 566     0.0  


>PRS8_DROME unnamed protein product
Length=405

 Score = 791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/406 (97%), Positives = 395/406 (97%), Gaps = 1/406 (0%)

Query  19   MTLTNFEMEVDDKPSKGEGFRPYYITKIEELQLVVAEKSQNLRRLQAQRNELNAKVRMLR  78
            MT+TN  ME++    KGEGFR YYI KIEELQLVVAEK QNLRRLQAQRNELNAKVRMLR
Sbjct  1    MTVTN-RMEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLR  59

Query  79   EELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTANSRVALRNES  138
            EELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVT N RVALRNES
Sbjct  60   EELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNES  119

Query  139  YTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGI  198
            YTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGI
Sbjct  120  YTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGI  179

Query  199  AQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARE  258
            AQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARE
Sbjct  180  AQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMARE  239

Query  259  HAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI  318
            HAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
Sbjct  240  HAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI  299

Query  319  LDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK  378
            LDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
Sbjct  300  LDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK  359

Query  379  GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK  424
            GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Sbjct  360  GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK  405


>Q38A02_TRYB2 unnamed protein product
Length=408

 Score = 574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/387 (72%), Positives = 333/387 (86%), Gaps = 3/387 (1%)

Query  41   YYITKIEELQLVVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDK  100
            Y++ KI+EL+        N  RL+AQRNELN +VR L+EE+QLLQE GS V +VV+ M K
Sbjct  22   YFLQKIQELRAQEKRLQDNYMRLEAQRNELNRRVRHLKEEVQLLQESGSIVADVVRVMSK  81

Query  101  KKVLVKVHP-EGKFVVDLDKNIDINDVTANSRVALRNESYTLHKILPNKVDPLVSLMMVE  159
             KVLV V   +GK VVD++K ++I+D++ N RVALR+ ++ +H ILP KVDPLVSLM VE
Sbjct  82   GKVLVNVSSSQGKLVVDVEKTVNIDDLSRNVRVALRSGTFAIHYILPTKVDPLVSLMKVE  141

Query  160  KV-PDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLA  218
                +STY+ +GGL +Q+KEIKEVIEL VKHPELF+ALGIAQPKGVLLYGPPGTGKTLLA
Sbjct  142  NAGSESTYDEIGGLSRQVKEIKEVIELSVKHPELFEALGIAQPKGVLLYGPPGTGKTLLA  201

Query  219  RAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIE  278
            RAVAHHT+CTFIRVSG+ELVQK+IGEG+R+VRELFVMAREH+PSIIFMDEIDSIGS+R+E
Sbjct  202  RAVAHHTDCTFIRVSGAELVQKYIGEGARLVRELFVMAREHSPSIIFMDEIDSIGSTRLE  261

Query  279  -SGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPP  337
             +G GGDSEVQRTMLELLNQLDGFE+T++IKVIMATNR+DILD ALLRPGRIDRKIEFP 
Sbjct  262  NTGRGGDSEVQRTMLELLNQLDGFESTQSIKVIMATNRVDILDEALLRPGRIDRKIEFPA  321

Query  338  PNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVT  397
            P+E AR +ILKIHSRKMNLTRGINLR +AE     SGAE+K VCTEAGM+ALRERRVH+T
Sbjct  322  PDEPARFEILKIHSRKMNLTRGINLRTVAEKTNQCSGAELKAVCTEAGMFALRERRVHIT  381

Query  398  QEDFEMAVAKVMQKDSEKNMSIKKLWK  424
            QEDFE+AVAK+M KD +K++S+KK+WK
Sbjct  382  QEDFELAVAKIMHKDQDKSVSLKKMWK  408


>Q9NC95_9TRYP unnamed protein product
Length=408

 Score = 566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/387 (71%), Positives = 330/387 (85%), Gaps = 3/387 (1%)

Query  41   YYITKIEELQLVVAEKSQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDK  100
            Y++ KI+EL+        N  RL+AQRNELN +VR L+EE+QLLQE GS V +VV+ M K
Sbjct  22   YFLQKIQELRAQEKRLQDNYMRLEAQRNELNRRVRHLKEEVQLLQESGSIVADVVRVMSK  81

Query  101  KKVLVKVHP-EGKFVVDLDKNIDINDVTANSRVALRNESYTLHKILPNKVDPLVSLMMVE  159
             KVLV V   +GK VVD++K ++I+D++ N RVALR+ ++ +H ILP KVDPLVSLM VE
Sbjct  82   GKVLVNVSSSQGKLVVDVEKTVNIDDLSRNVRVALRSGTFAIHYILPTKVDPLVSLMKVE  141

Query  160  KV-PDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLA  218
                +STY+ +GGL +Q+KEIKEVIEL VKHPELF+ALGIAQPKGVLLYGPPGTGKTLLA
Sbjct  142  NAGSESTYDEIGGLSRQVKEIKEVIELSVKHPELFEALGIAQPKGVLLYGPPGTGKTLLA  201

Query  219  RAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIE  278
            RAVAHHT+CTFIRVSG+ELVQK+IGEG+R+VRELFVMAREH+PSIIFMDEIDSIGS+R+E
Sbjct  202  RAVAHHTDCTFIRVSGAELVQKYIGEGARLVRELFVMAREHSPSIIFMDEIDSIGSTRLE  261

Query  279  -SGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPP  337
             +G GGDSEVQRTMLELLNQLDGFE+T++IKVIMATNR+DILD ALLRPGRIDRKIEF  
Sbjct  262  NTGRGGDSEVQRTMLELLNQLDGFESTQSIKVIMATNRVDILDEALLRPGRIDRKIEFSA  321

Query  338  PNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVT  397
            P+E AR +ILKI+SRKMNLTRGINLR +AE     SGA  K VCTEAGM+ALRERRVH+T
Sbjct  322  PDEPARFEILKINSRKMNLTRGINLRTVAEKTNQCSGAAYKAVCTEAGMFALRERRVHIT  381

Query  398  QEDFEMAVAKVMQKDSEKNMSIKKLWK  424
            QEDFE+AVAK+M KD +K++S+KK+WK
Sbjct  382  QEDFELAVAKIMHKDQDKSVSLKKMWK  408



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold6356-size125267-augustus-gene-0.4-mRNA-1

Length=1022
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VM55_DROME  unnamed protein product                                 186     2e-47
E1JHA6_DROME  unnamed protein product                                 186     2e-47
Q9NGV4_DROME  unnamed protein product                                 182     1e-46


>Q9VM55_DROME unnamed protein product
Length=3557

 Score = 186 bits (471),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 132/234 (56%), Gaps = 21/234 (9%)

Query  199   FNQCFSSPCLNGGSCS-----------------VCEEEVDGCDSSPCLHGGSCTSQGPNY  241
              N C  +PCL G +C+                  CE+++D C S PC HG +C  +  ++
Sbjct  2179  INDCSENPCLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLCLSEPCKHG-TCVDRLFDH  2237

Query  242   TCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTDECAA  301
              C C PG+ G +C+I +D+CE+ PC N G+C D ++ Y C C  G+ G  C+   D+CA+
Sbjct  2238  ECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDGYSCNCEPGYTGKNCQHTIDDCAS  2297

Query  302   EPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDPCAVQPCDHGAT--CLGGDLTYTCE  359
              PC H A CVD +  +SC+CRPGYVG  CE    D C   PC+   T  CL  D  + C 
Sbjct  2298  NPCQHGATCVDQLDGFSCKCRPGYVGLSCE-AEIDECLSDPCNPVGTERCLDLDNKFECV  2356

Query  360   CLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPPYSGTLCEQEIDT  413
             C  G+ GP C  DID C +QPCL+ G C+D   GF C CEP +SG  CEQ++ T
Sbjct  2357  CRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTT  2410


 Score = 185 bits (469),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 130/439 (30%), Positives = 194/439 (44%), Gaps = 27/439 (6%)

Query  203   FSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDEC-  261
             F   C +G    +C  ++D C++ PCL+ G C  +   + C C PG++G+ CE +V  C 
Sbjct  2353  FECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTTCG  2412

Query  262   ESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCEC  321
               +PC N  SC D   +Y C+C  G  G  CE   + C  +PCMH   C D  +  +C C
Sbjct  2413  AQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSGLNCSC  2472

Query  322   RPGYVGAHCEDVWTDPCAVQPCDHGATCLGGDLTYTCECLAGYTGPQCEVDIDSCMSQPC  381
                Y G  C+  + D C    C +GATC+     Y+C+C  G+TG  CE DI  C    C
Sbjct  2473  PADYSGIGCQYEY-DACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIVDCKDNSC  2531

Query  382   LHGGQCQDLPAGFACHCEPPYSGTLCEQEIDTKVVLRFPS-SGTTDYTILSGPKKALNQV  440
               G  C DL  GF C C    +G  C + I     L F   S +T   ++  P    N +
Sbjct  2532  PPGATCVDLTNGFYCQCPFNMTGDDCRKAIQVDYDLYFSDPSRSTAAQVVPFPTGEANSL  2591

Query  441   TLCLWLRSADQFNYGTIFSY-----ATKHQDNSFTLTDYNGFV---LYVNGQRVFTDI--  490
             T+ +W++ A + + G  F+      A   Q     L  ++  V   L+ +    F     
Sbjct  2592  TVAMWVQFAQKDDRGIFFTLYGVQSARMTQQRRMLLQAHSSGVQVSLFEDQPDAFLSFGE  2651

Query  491   --VANDGWWHFVCVCWDSALGEWALYIDGYLGDWGSGLANGTAIPANGTLVLGQEQDRPG  548
                 NDG WH V V WD   G+  L  +G +       A G+ +P     VLG  Q  P 
Sbjct  2652  YTSVNDGQWHHVAVVWDGISGQLQLITEGLIASKMEYGAGGS-LPGYLWAVLGLPQ--PY  2708

Query  549   GGFSEV----ESFTGLMASVSLWDHTLSL-SHVSELATDC---PTTDGGNLLSWAHFLTG  600
             G  +E+      F G +    +W   L + S + +   DC   P    G +L+WA +   
Sbjct  2709  GLSNELAYSDSGFQGTITKAQVWARALDITSEIQKQVRDCRSEPVLYPGLILNWAGYEV-  2767

Query  601   LTGNLQVENSSFCSECEAP  619
              +G ++    S C + + P
Sbjct  2768  TSGGVERNVPSLCGQRKCP  2786


 Score = 184 bits (468),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 174/371 (47%), Gaps = 33/371 (9%)

Query  55    GMKPCVSCPLGSYQTLSGQTECLKCPDNTTTLRRGAKADQDCKGQKNAQKFVAGLERWSR  114
             G   C  CP G YQ    Q  CL+CP  T T   G K+  DC         V G   +S 
Sbjct  1868  GQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIP-------VCGYGTYSP  1920

Query  115   VSAMCDGVCRRKLNQFSRQMCWGRVQKTKMSCYLHAWFAVFA--------ERCSPDTASS  166
                +    C R  N F+ +   G  +  + +C   ++    A         +C+P T S+
Sbjct  1921  TGLVPCLECPR--NSFTAEPPTGGFKDCQ-ACPAQSFTYQPAASNKDLCRAKCAPGTYSA  1977

Query  167   TGLQPCLRCPAGYSQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSS  226
             TGL PC  CP  + Q +AG ++C +        N    SP   G     C+  V  C   
Sbjct  1978  TGLAPCSPCPLHHYQGAAGAQSCNECPS-----NMRTDSPASKGR--EQCKPVV--CGEG  2028

Query  227   PCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADG  286
              C HGG C   G +  C CP G++G  CE ++DEC S PC NGG C+D    Y C C  G
Sbjct  2029  ACQHGGLCVPMGHDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQGYRCECPAG  2088

Query  287   FQGDRCEEDTDECAAEPCMHEAACVD--GVASYSCECRPGYVGAHCEDVWTDPCAV--QP  342
             + G  C+E+  +C  + C   A C +  G  + +C CR GY G  C DV  DPC     P
Sbjct  2089  YSGINCQEEASDCGNDTCPARAMCKNEPGYKNVTCLCRSGYTGDQC-DVTIDPCTANGNP  2147

Query  343   CDHGATCLGGDL-TYTCECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPP  401
             C +GA+C   +   Y CEC+ G+ G  CE +I+ C   PCL G  C DL   F C C P 
Sbjct  2148  CGNGASCQALEQGRYKCECVPGWEGIHCEQNINDCSENPCLLGANCTDLVNDFQCACPPG  2207

Query  402   YSGTLCEQEID  412
             ++G  CEQ+ID
Sbjct  2208  FTGKRCEQKID  2218


 Score = 175 bits (443),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 127/235 (54%), Gaps = 9/235 (4%)

Query  180   SQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGP  239
             ++P A + TCVD           +S  C  G +   C+  +D C S+PC HG +C  Q  
Sbjct  2259  NRPCANEGTCVDLVDG-------YSCNCEPGYTGKNCQHTIDDCASNPCQHGATCVDQLD  2311

Query  240   NYTCSCPPGYAGVSCEIEVDECESSPCLNGGS--CEDSINEYVCLCADGFQGDRCEEDTD  297
              ++C C PGY G+SCE E+DEC S PC   G+  C D  N++ C+C DGF+G  C  D D
Sbjct  2312  GFSCKCRPGYVGLSCEAEIDECLSDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDID  2371

Query  298   ECAAEPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDPCAVQPCDHGATCLGGDLTYT  357
             +C A+PC++   C D V  + C C PG+ G  CE   T   A  PC + A+C+     Y 
Sbjct  2372  DCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTTCGAQAPCQNDASCIDLFQDYF  2431

Query  358   CECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPPYSGTLCEQEID  412
             C C +G  G  CE   + C+  PC+HGG+CQD  +G  C C   YSG  C+ E D
Sbjct  2432  CVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSGLNCSCPADYSGIGCQYEYD  2486


 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 67/154 (44%), Gaps = 7/154 (5%)

Query  178   GYSQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQ  237
             G   P     +C+D         Q +   C +G     CE   + C   PC+HGG C   
Sbjct  2412  GAQAPCQNDASCID-------LFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDF  2464

Query  238   GPNYTCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTD  297
             G    CSCP  Y+G+ C+ E D CE   C NG +C D+   Y C C  GF G  CE+D  
Sbjct  2465  GSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIV  2524

Query  298   ECAAEPCMHEAACVDGVASYSCECRPGYVGAHCE  331
             +C    C   A CVD    + C+C     G  C 
Sbjct  2525  DCKDNSCPPGATCVDLTNGFYCQCPFNMTGDDCR  2558


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/289 (27%), Positives = 127/289 (44%), Gaps = 28/289 (10%)

Query  585  TTDGGNLLSWAHFLTGLTGNLQVENSSFCSECEAPRAPGQGSVSVQSNTAV-----YRCD  639
            T   G +L    F +    N    +++F ++C   + PG G+++   +TA      + C 
Sbjct  523  TASSGEML--IKFTSDALHNAAGWSATFSADCPELQ-PGIGALASSRDTAFGTLVSFTCP  579

Query  640  DGHALLWEGETTPELRRRCLKQGLWE-GEEPVCRRVSCGFPGYIEHGFVRGRSYL-YGDV  697
             G      G+T   L   CL+ G W     P C+ V CG    I++GF  G S + Y  +
Sbjct  580  IGQEFA-TGKT--RLVTECLRGGNWSVSYIPKCQEVYCGPVPQIDNGFSIGSSNVTYRGI  636

Query  698  VQYRCRPGYTLV-GSSVR--VCRATGQWNDNPPRCQGKTCSVLSAPAGGQLQLLADEKDV  754
              Y+C  G+    G+ +    C   G+W +  P C    C+ L   A   + LL      
Sbjct  637  AMYQCYAGFAFASGAPIEKISCLPDGRW-ERQPHCMASQCAALPEVAHANVTLLNGGGR-  694

Query  755  VPQYGHQVEIWCDPGYRLLGPALLSCLRNGQWDSPLPTCQPTMCRNPPSVEHGSVLSGND  814
               YG  V+  C+PGY   G  +L+C+ NG W   +P C    C   P++ +G V+    
Sbjct  695  --SYGTIVQYECEPGYERNGHPVLTCMSNGTWSGDVPRCTRKRCFEFPTIANGFVVDST-  751

Query  815  TAGGDKLYEVGELARYDCEEGYQLEEAASPLTCRKLGAWAGQPPSCPPV  863
                 + Y  G+ AR  C +GY+L   ++ + C +   +  QPP+C  +
Sbjct  752  -----RAYLFGDEARVQCFKGYKL-IGSNIMRCSEAQKFE-QPPTCEDI  793


 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 71/265 (27%), Positives = 104/265 (39%), Gaps = 55/265 (21%)

Query  748   LADEKDVVPQYGHQVEIWCDPGYRL-LGPALL--SCLRNGQWD-SPLPTCQPTMCRNPPS  803
             LA  +D    +G  V   C  G     G   L   CLR G W  S +P CQ   C   P 
Sbjct  562   LASSRDTA--FGTLVSFTCPIGQEFATGKTRLVTECLRGGNWSVSYIPKCQEVYCGPVPQ  619

Query  804   VEHG-SVLSGNDTAGGDKLYEVGELARYDCEEGYQLEEAA--SPLTCRKLGAWAGQPPSC  860
             +++G S+ S N T  G        +A Y C  G+     A    ++C   G W  QP  C
Sbjct  620   IDNGFSIGSSNVTYRG--------IAMYQCYAGFAFASGAPIEKISCLPDGRWERQP-HC  670

Query  861   PPVLCPALPRMQDGDASLLQPGRDNHTTLEHGRKYEFRSEVEFRCAEGFNLEGEDTLECL  920
                 C ALP +   + +LL  G  ++ T+           V++ C  G+   G   L C+
Sbjct  671   MASQCAALPEVAHANVTLLNGGGRSYGTI-----------VQYECEPGYERNGHPVLTCM  719

Query  921   ASGEWSSPADGSWELANTTDATAVVNFDEPVCEK----EVPDNAYLAKELSAEQQLLDIG  976
             ++G WS                     D P C +    E P  A      S    L   G
Sbjct  720   SNGTWSG--------------------DVPRCTRKRCFEFPTIANGFVVDSTRAYLF--G  757

Query  977   TAVSVKCRLGYKLVGTDLWKCARSR  1001
                 V+C  GYKL+G+++ +C+ ++
Sbjct  758   DEARVQCFKGYKLIGSNIMRCSEAQ  782


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 95/246 (39%), Gaps = 31/246 (13%)

Query  690  RSYLYGDVVQYRCRPGYTLVGSSVRV---CRATGQWN-DNPPRCQGKTCSVLSAPAGGQL  745
            R   +G +V + C  G        R+   C   G W+    P+CQ   C  +     G  
Sbjct  566  RDTAFGTLVSFTCPIGQEFATGKTRLVTECLRGGNWSVSYIPKCQEVYCGPVPQIDNG--  623

Query  746  QLLADEKDVVPQYGHQVEIWCDPGYRLLGPA---LLSCLRNGQWDSPLPTCQPTMCRNPP  802
                   +V   Y       C  G+     A    +SCL +G+W+   P C  + C   P
Sbjct  624  -FSIGSSNVT--YRGIAMYQCYAGFAFASGAPIEKISCLPDGRWERQ-PHCMASQCAALP  679

Query  803  SVEHGSVLSGNDTAGGDKLYEVGELARYDCEEGYQLEEAASPLTCRKLGAWAGQPPSCPP  862
             V H +V   N   GG + Y  G + +Y+CE GY+       LTC   G W+G  P C  
Sbjct  680  EVAHANVTLLN---GGGRSY--GTIVQYECEPGYE-RNGHPVLTCMSNGTWSGDVPRCTR  733

Query  863  VLCPALPRMQDGDASLLQPGRDNHTTLEHGRKYEFRSEVEFRCAEGFNLEGEDTLECLAS  922
              C   P + +G              ++  R Y F  E   +C +G+ L G + + C  +
Sbjct  734  KRCFEFPTIANG------------FVVDSTRAYLFGDEARVQCFKGYKLIGSNIMRCSEA  781

Query  923  GEWSSP  928
             ++  P
Sbjct  782  QKFEQP  787


 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/327 (24%), Positives = 122/327 (37%), Gaps = 48/327 (15%)

Query  692   YLYGDVVQYRCRPGYTLVGSSVRVCRATGQWNDNPPRCQGKTC-SVLSAPAGGQLQLLAD  750
             Y +GDVV+++C  GY + GSS  +C ++GQWN + P C    C S+      G      D
Sbjct  1069  YHFGDVVRFQCHFGYIMSGSSAALCLSSGQWNASVPECNYAKCVSLPDDKLEGLTVARPD  1128

Query  751   EKDVVPQYGHQVEIWC-DPGYRLLGPA---LLSCLRNGQ------WDSPL-PTCQPTMCR  799
              + V+  +   V I C  PG +L   A      C+ + +      W S + P+C    C 
Sbjct  1129  PESVLVPFRDNVTITCGSPGRQLRATASSGFRQCVYDPKPGLPDYWLSGMQPSCPRVDCY  1188

Query  800   NP---PSVEHGSVLSGNDTAGGDKLYEVGELARYDCEEGYQLE----EAASPLTCRKLGA  852
             +P   P  E+G  +        D  Y+      + C+  ++L        + + C   G 
Sbjct  1189  SPMPTPGAEYGQFV--------DTRYQSSFF--FGCQNTFKLAGQTGRHDNVVRCGADGI  1238

Query  853   WAGQPPSCPPVLCPALPRMQDGDASLLQPGRDNHTTLEHGRKYEFRSEVEFRCAE-GFNL  911
             W      C   +C    R  DG               +  R YE  SEV F C   G+ L
Sbjct  1239  WDFGDLRCEGPVCEDPGRPADG--------------RQIARSYEQSSEVYFGCNRPGYIL  1284

Query  912   EGEDTLECLASGEWSSPADGSWELANTTDATAVVNFDEPVCE-KEVPDNA---YLAKELS  967
                  + C+   E               D+      + P  E K +  N+   +  K+ +
Sbjct  1285  INPRPITCIREPECKVIKPLGLSSGRIPDSAINATSERPNYEAKNIRLNSATGWCGKQEA  1344

Query  968   AEQQLLDIGTAVSVKCRLGYKLVGTDL  994
                  +D+G    VK  L   +V  D+
Sbjct  1345  FTYVSVDLGQIYRVKAILVKGVVTNDI  1371


 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 54/133 (41%), Gaps = 17/133 (13%)

Query  782   RNGQWDSPLPTCQPTMCRNPPSVEHGSVLSGNDTAGGDKLYEVGELARYDCEEGYQLEEA  841
             R+G       TC P MC    + E+G +LS  +       Y  G++ R+ C  GY +  +
Sbjct  1035  RDGDTYQRNKTCVPLMCPELEAPENGQLLSDKND------YHFGDVVRFQCHFGYIMSGS  1088

Query  842   ASPLTCRKLGAWAGQPPSCPPVLCPALPR--------MQDGDASLLQPGRDNHTTL--EH  891
             ++ L C   G W    P C    C +LP          +    S+L P RDN T      
Sbjct  1089  SAAL-CLSSGQWNASVPECNYAKCVSLPDDKLEGLTVARPDPESVLVPFRDNVTITCGSP  1147

Query  892   GRKYEFRSEVEFR  904
             GR+    +   FR
Sbjct  1148  GRQLRATASSGFR  1160


 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 122/344 (35%), Gaps = 90/344 (26%)

Query  57    KPCVSCPLGSYQTLSGQTECLKCPDNT----TTLRRGAKADQDCKGQKNAQKFV------  106
             K C++C  G+YQ+ +GQ +C KCP        T   GA++  DCK +  A K+       
Sbjct  3125  KTCIACSRGTYQSEAGQLQCSKCPVIAGRPGVTAGPGARSAADCKERCPAGKYFDAETGL  3184

Query  107   -----AGLERWSRVSAMCD----GVCRRKLNQFSRQMCWGRVQKTKMSCYLHAWFAVFAE  157
                   G  + +  S  C+    G   R     SR+ C     + + S           E
Sbjct  3185  CRSCGHGFYQPNEGSFSCELCGLGQTTRSTEATSRKEC-----RDECSSGQQLGADGRCE  3239

Query  158   RCSPDTASSTGLQP-CLRCPAGYSQPSAGQRTC------VDAAGQHVAFNQCFSSPCLNG  210
              C   T    G+QP C  CP G + P  G  +       V +AG ++   Q     C  G
Sbjct  3240  PCPRGTYRLQGVQPSCAACPLGRTTPKVGASSVEECTLPVCSAGTYLNATQNMCIECRKG  3299

Query  211   GSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYA-GVSCEIEVDECESSPC--L  267
                S  ++       + CL               CPP ++  ++      EC ++PC  +
Sbjct  3300  YYQSESQQ-------TSCLQ--------------CPPNHSTKITGATSKSEC-TNPCEHI  3337

Query  268   NGGSCEDSINEYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCECRPGY--  325
               G     +N Y  +                            V   + + CEC+PG+  
Sbjct  3338  AEGKPHCDVNAYCIM----------------------------VPETSDFKCECKPGFNG  3369

Query  326   VGAHCEDVWTDPCAVQPCDHGATCLGGDLTYTCECLAGYTGPQC  369
              G  C DV    C     + GA       T +C C+  +TGP C
Sbjct  3370  TGMACTDVCDGFCE----NSGACVKDLKGTPSCRCVGSFTGPHC  3409


 Score = 38.1 bits (87),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query  835   GYQLEEAASPLTCRKLGAWAGQPPSCPPVLCPALPRMQDGDASLLQPGRDNHTTLEHGRK  894
             GY +E + S     + G    +  +C P++CP L   ++G              L     
Sbjct  1024  GYHIERSESG---ERDGDTYQRNKTCVPLMCPELEAPENGQ------------LLSDKND  1068

Query  895   YEFRSEVEFRCAEGFNLEGEDTLECLASGEWSS  927
             Y F   V F+C  G+ + G     CL+SG+W++
Sbjct  1069  YHFGDVVRFQCHFGYIMSGSSAALCLSSGQWNA  1101


 Score = 30.8 bits (68),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 25/61 (41%), Gaps = 1/61 (2%)

Query  657   RCLKQGLWEGEEPVCRRVSCGFPGYIEHGFVRGRSYLYGDVVQYRC-RPGYTLVGSSVRV  715
             RC   G+W+  +  C    C  PG    G    RSY     V + C RPGY L+      
Sbjct  1232  RCGADGIWDFGDLRCEGPVCEDPGRPADGRQIARSYEQSSEVYFGCNRPGYILINPRPIT  1291

Query  716   C  716
             C
Sbjct  1292  C  1292


>E1JHA6_DROME unnamed protein product
Length=3589

 Score = 186 bits (471),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 132/234 (56%), Gaps = 21/234 (9%)

Query  199   FNQCFSSPCLNGGSCS-----------------VCEEEVDGCDSSPCLHGGSCTSQGPNY  241
              N C  +PCL G +C+                  CE+++D C S PC HG +C  +  ++
Sbjct  2179  INDCSENPCLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLCLSEPCKHG-TCVDRLFDH  2237

Query  242   TCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTDECAA  301
              C C PG+ G +C+I +D+CE+ PC N G+C D ++ Y C C  G+ G  C+   D+CA+
Sbjct  2238  ECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDGYSCNCEPGYTGKNCQHTIDDCAS  2297

Query  302   EPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDPCAVQPCDHGAT--CLGGDLTYTCE  359
              PC H A CVD +  +SC+CRPGYVG  CE    D C   PC+   T  CL  D  + C 
Sbjct  2298  NPCQHGATCVDQLDGFSCKCRPGYVGLSCE-AEIDECLSDPCNPVGTERCLDLDNKFECV  2356

Query  360   CLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPPYSGTLCEQEIDT  413
             C  G+ GP C  DID C +QPCL+ G C+D   GF C CEP +SG  CEQ++ T
Sbjct  2357  CRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTT  2410


 Score = 185 bits (470),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 130/439 (30%), Positives = 194/439 (44%), Gaps = 27/439 (6%)

Query  203   FSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDEC-  261
             F   C +G    +C  ++D C++ PCL+ G C  +   + C C PG++G+ CE +V  C 
Sbjct  2353  FECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTTCG  2412

Query  262   ESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCEC  321
               +PC N  SC D   +Y C+C  G  G  CE   + C  +PCMH   C D  +  +C C
Sbjct  2413  AQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSGLNCSC  2472

Query  322   RPGYVGAHCEDVWTDPCAVQPCDHGATCLGGDLTYTCECLAGYTGPQCEVDIDSCMSQPC  381
                Y G  C+  + D C    C +GATC+     Y+C+C  G+TG  CE DI  C    C
Sbjct  2473  PADYSGIGCQYEY-DACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIVDCKDNSC  2531

Query  382   LHGGQCQDLPAGFACHCEPPYSGTLCEQEIDTKVVLRFPS-SGTTDYTILSGPKKALNQV  440
               G  C DL  GF C C    +G  C + I     L F   S +T   ++  P    N +
Sbjct  2532  PPGATCVDLTNGFYCQCPFNMTGDDCRKAIQVDYDLYFSDPSRSTAAQVVPFPTGEANSL  2591

Query  441   TLCLWLRSADQFNYGTIFSY-----ATKHQDNSFTLTDYNGFV---LYVNGQRVFTDI--  490
             T+ +W++ A + + G  F+      A   Q     L  ++  V   L+ +    F     
Sbjct  2592  TVAMWVQFAQKDDRGIFFTLYGVQSARMTQQRRMLLQAHSSGVQVSLFEDQPDAFLSFGE  2651

Query  491   --VANDGWWHFVCVCWDSALGEWALYIDGYLGDWGSGLANGTAIPANGTLVLGQEQDRPG  548
                 NDG WH V V WD   G+  L  +G +       A G+ +P     VLG  Q  P 
Sbjct  2652  YTSVNDGQWHHVAVVWDGISGQLQLITEGLIASKMEYGAGGS-LPGYLWAVLGLPQ--PY  2708

Query  549   GGFSEV----ESFTGLMASVSLWDHTLSL-SHVSELATDC---PTTDGGNLLSWAHFLTG  600
             G  +E+      F G +    +W   L + S + +   DC   P    G +L+WA +   
Sbjct  2709  GLSNELAYSDSGFQGTITKAQVWARALDITSEIQKQVRDCRSEPVLYPGLILNWAGYEV-  2767

Query  601   LTGNLQVENSSFCSECEAP  619
              +G ++    S C + + P
Sbjct  2768  TSGGVERNVPSLCGQRKCP  2786


 Score = 184 bits (468),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 130/371 (35%), Positives = 174/371 (47%), Gaps = 33/371 (9%)

Query  55    GMKPCVSCPLGSYQTLSGQTECLKCPDNTTTLRRGAKADQDCKGQKNAQKFVAGLERWSR  114
             G   C  CP G YQ    Q  CL+CP  T T   G K+  DC         V G   +S 
Sbjct  1868  GQNSCTYCPRGYYQNRDRQGTCLRCPAGTYTKEEGTKSQADCIP-------VCGYGTYSP  1920

Query  115   VSAMCDGVCRRKLNQFSRQMCWGRVQKTKMSCYLHAWFAVFA--------ERCSPDTASS  166
                +    C R  N F+ +   G  +  + +C   ++    A         +C+P T S+
Sbjct  1921  TGLVPCLECPR--NSFTAEPPTGGFKDCQ-ACPAQSFTYQPAASNKDLCRAKCAPGTYSA  1977

Query  167   TGLQPCLRCPAGYSQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSS  226
             TGL PC  CP  + Q +AG ++C +        N    SP   G     C+  V  C   
Sbjct  1978  TGLAPCSPCPLHHYQGAAGAQSCNECPS-----NMRTDSPASKGR--EQCKPVV--CGEG  2028

Query  227   PCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADG  286
              C HGG C   G +  C CP G++G  CE ++DEC S PC NGG C+D    Y C C  G
Sbjct  2029  ACQHGGLCVPMGHDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQGYRCECPAG  2088

Query  287   FQGDRCEEDTDECAAEPCMHEAACVD--GVASYSCECRPGYVGAHCEDVWTDPCAV--QP  342
             + G  C+E+  +C  + C   A C +  G  + +C CR GY G  C DV  DPC     P
Sbjct  2089  YSGINCQEEASDCGNDTCPARAMCKNEPGYKNVTCLCRSGYTGDQC-DVTIDPCTANGNP  2147

Query  343   CDHGATCLGGDL-TYTCECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPP  401
             C +GA+C   +   Y CEC+ G+ G  CE +I+ C   PCL G  C DL   F C C P 
Sbjct  2148  CGNGASCQALEQGRYKCECVPGWEGIHCEQNINDCSENPCLLGANCTDLVNDFQCACPPG  2207

Query  402   YSGTLCEQEID  412
             ++G  CEQ+ID
Sbjct  2208  FTGKRCEQKID  2218


 Score = 175 bits (443),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 127/235 (54%), Gaps = 9/235 (4%)

Query  180   SQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGP  239
             ++P A + TCVD           +S  C  G +   C+  +D C S+PC HG +C  Q  
Sbjct  2259  NRPCANEGTCVDLVDG-------YSCNCEPGYTGKNCQHTIDDCASNPCQHGATCVDQLD  2311

Query  240   NYTCSCPPGYAGVSCEIEVDECESSPCLNGGS--CEDSINEYVCLCADGFQGDRCEEDTD  297
              ++C C PGY G+SCE E+DEC S PC   G+  C D  N++ C+C DGF+G  C  D D
Sbjct  2312  GFSCKCRPGYVGLSCEAEIDECLSDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDID  2371

Query  298   ECAAEPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDPCAVQPCDHGATCLGGDLTYT  357
             +C A+PC++   C D V  + C C PG+ G  CE   T   A  PC + A+C+     Y 
Sbjct  2372  DCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTTCGAQAPCQNDASCIDLFQDYF  2431

Query  358   CECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPPYSGTLCEQEID  412
             C C +G  G  CE   + C+  PC+HGG+CQD  +G  C C   YSG  C+ E D
Sbjct  2432  CVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSGLNCSCPADYSGIGCQYEYD  2486


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 78/289 (27%), Positives = 127/289 (44%), Gaps = 28/289 (10%)

Query  585  TTDGGNLLSWAHFLTGLTGNLQVENSSFCSECEAPRAPGQGSVSVQSNTAV-----YRCD  639
            T   G +L    F +    N    +++F ++C   + PG G+++   +TA      + C 
Sbjct  523  TASSGEML--IKFTSDALHNAAGWSATFSADCPELQ-PGIGALASSRDTAFGTLVSFTCP  579

Query  640  DGHALLWEGETTPELRRRCLKQGLWE-GEEPVCRRVSCGFPGYIEHGFVRGRSYL-YGDV  697
             G      G+T   L   CL+ G W     P C+ V CG    I++GF  G S + Y  +
Sbjct  580  IGQEFA-TGKT--RLVTECLRGGNWSVSYIPKCQEVYCGPVPQIDNGFSIGSSNVTYRGI  636

Query  698  VQYRCRPGYTLV-GSSVR--VCRATGQWNDNPPRCQGKTCSVLSAPAGGQLQLLADEKDV  754
              Y+C  G+    G+ +    C   G+W +  P C    C+ L   A   + LL      
Sbjct  637  AMYQCYAGFAFASGAPIEKISCLPDGRW-ERQPHCMASQCAALPEVAHANVTLLNGGGR-  694

Query  755  VPQYGHQVEIWCDPGYRLLGPALLSCLRNGQWDSPLPTCQPTMCRNPPSVEHGSVLSGND  814
               YG  V+  C+PGY   G  +L+C+ NG W   +P C    C   P++ +G V+    
Sbjct  695  --SYGTIVQYECEPGYERNGHPVLTCMSNGTWSGDVPRCTRKRCFEFPTIANGFVVDST-  751

Query  815  TAGGDKLYEVGELARYDCEEGYQLEEAASPLTCRKLGAWAGQPPSCPPV  863
                 + Y  G+ AR  C +GY+L   ++ + C +   +  QPP+C  +
Sbjct  752  -----RAYLFGDEARVQCFKGYKL-IGSNIMRCSEAQKFE-QPPTCEDI  793


 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 71/265 (27%), Positives = 104/265 (39%), Gaps = 55/265 (21%)

Query  748   LADEKDVVPQYGHQVEIWCDPGYRL-LGPALL--SCLRNGQWD-SPLPTCQPTMCRNPPS  803
             LA  +D    +G  V   C  G     G   L   CLR G W  S +P CQ   C   P 
Sbjct  562   LASSRDTA--FGTLVSFTCPIGQEFATGKTRLVTECLRGGNWSVSYIPKCQEVYCGPVPQ  619

Query  804   VEHG-SVLSGNDTAGGDKLYEVGELARYDCEEGYQLEEAA--SPLTCRKLGAWAGQPPSC  860
             +++G S+ S N T  G        +A Y C  G+     A    ++C   G W  QP  C
Sbjct  620   IDNGFSIGSSNVTYRG--------IAMYQCYAGFAFASGAPIEKISCLPDGRWERQP-HC  670

Query  861   PPVLCPALPRMQDGDASLLQPGRDNHTTLEHGRKYEFRSEVEFRCAEGFNLEGEDTLECL  920
                 C ALP +   + +LL  G  ++ T+           V++ C  G+   G   L C+
Sbjct  671   MASQCAALPEVAHANVTLLNGGGRSYGTI-----------VQYECEPGYERNGHPVLTCM  719

Query  921   ASGEWSSPADGSWELANTTDATAVVNFDEPVCEK----EVPDNAYLAKELSAEQQLLDIG  976
             ++G WS                     D P C +    E P  A      S    L   G
Sbjct  720   SNGTWSG--------------------DVPRCTRKRCFEFPTIANGFVVDSTRAYLF--G  757

Query  977   TAVSVKCRLGYKLVGTDLWKCARSR  1001
                 V+C  GYKL+G+++ +C+ ++
Sbjct  758   DEARVQCFKGYKLIGSNIMRCSEAQ  782


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 62/246 (25%), Positives = 95/246 (39%), Gaps = 31/246 (13%)

Query  690  RSYLYGDVVQYRCRPGYTLVGSSVRV---CRATGQWN-DNPPRCQGKTCSVLSAPAGGQL  745
            R   +G +V + C  G        R+   C   G W+    P+CQ   C  +     G  
Sbjct  566  RDTAFGTLVSFTCPIGQEFATGKTRLVTECLRGGNWSVSYIPKCQEVYCGPVPQIDNG--  623

Query  746  QLLADEKDVVPQYGHQVEIWCDPGYRLLGPA---LLSCLRNGQWDSPLPTCQPTMCRNPP  802
                   +V   Y       C  G+     A    +SCL +G+W+   P C  + C   P
Sbjct  624  -FSIGSSNVT--YRGIAMYQCYAGFAFASGAPIEKISCLPDGRWERQ-PHCMASQCAALP  679

Query  803  SVEHGSVLSGNDTAGGDKLYEVGELARYDCEEGYQLEEAASPLTCRKLGAWAGQPPSCPP  862
             V H +V   N   GG + Y  G + +Y+CE GY+       LTC   G W+G  P C  
Sbjct  680  EVAHANVTLLN---GGGRSY--GTIVQYECEPGYE-RNGHPVLTCMSNGTWSGDVPRCTR  733

Query  863  VLCPALPRMQDGDASLLQPGRDNHTTLEHGRKYEFRSEVEFRCAEGFNLEGEDTLECLAS  922
              C   P + +G              ++  R Y F  E   +C +G+ L G + + C  +
Sbjct  734  KRCFEFPTIANG------------FVVDSTRAYLFGDEARVQCFKGYKLIGSNIMRCSEA  781

Query  923  GEWSSP  928
             ++  P
Sbjct  782  QKFEQP  787


 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 77/327 (24%), Positives = 122/327 (37%), Gaps = 48/327 (15%)

Query  692   YLYGDVVQYRCRPGYTLVGSSVRVCRATGQWNDNPPRCQGKTC-SVLSAPAGGQLQLLAD  750
             Y +GDVV+++C  GY + GSS  +C ++GQWN + P C    C S+      G      D
Sbjct  1069  YHFGDVVRFQCHFGYIMSGSSAALCLSSGQWNASVPECNYAKCVSLPDDKLEGLTVARPD  1128

Query  751   EKDVVPQYGHQVEIWC-DPGYRLLGPA---LLSCLRNGQ------WDSPL-PTCQPTMCR  799
              + V+  +   V I C  PG +L   A      C+ + +      W S + P+C    C 
Sbjct  1129  PESVLVPFRDNVTITCGSPGRQLRATASSGFRQCVYDPKPGLPDYWLSGMQPSCPRVDCY  1188

Query  800   NP---PSVEHGSVLSGNDTAGGDKLYEVGELARYDCEEGYQLE----EAASPLTCRKLGA  852
             +P   P  E+G  +        D  Y+      + C+  ++L        + + C   G 
Sbjct  1189  SPMPTPGAEYGQFV--------DTRYQSSFF--FGCQNTFKLAGQTGRHDNVVRCGADGI  1238

Query  853   WAGQPPSCPPVLCPALPRMQDGDASLLQPGRDNHTTLEHGRKYEFRSEVEFRCAE-GFNL  911
             W      C   +C    R  DG               +  R YE  SEV F C   G+ L
Sbjct  1239  WDFGDLRCEGPVCEDPGRPADG--------------RQIARSYEQSSEVYFGCNRPGYIL  1284

Query  912   EGEDTLECLASGEWSSPADGSWELANTTDATAVVNFDEPVCE-KEVPDNA---YLAKELS  967
                  + C+   E               D+      + P  E K +  N+   +  K+ +
Sbjct  1285  INPRPITCIREPECKVIKPLGLSSGRIPDSAINATSERPNYEAKNIRLNSATGWCGKQEA  1344

Query  968   AEQQLLDIGTAVSVKCRLGYKLVGTDL  994
                  +D+G    VK  L   +V  D+
Sbjct  1345  FTYVSVDLGQIYRVKAILVKGVVTNDI  1371


 Score = 43.9 bits (102),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/133 (28%), Positives = 54/133 (41%), Gaps = 17/133 (13%)

Query  782   RNGQWDSPLPTCQPTMCRNPPSVEHGSVLSGNDTAGGDKLYEVGELARYDCEEGYQLEEA  841
             R+G       TC P MC    + E+G +LS  +       Y  G++ R+ C  GY +  +
Sbjct  1035  RDGDTYQRNKTCVPLMCPELEAPENGQLLSDKND------YHFGDVVRFQCHFGYIMSGS  1088

Query  842   ASPLTCRKLGAWAGQPPSCPPVLCPALPR--------MQDGDASLLQPGRDNHTTL--EH  891
             ++ L C   G W    P C    C +LP          +    S+L P RDN T      
Sbjct  1089  SAAL-CLSSGQWNASVPECNYAKCVSLPDDKLEGLTVARPDPESVLVPFRDNVTITCGSP  1147

Query  892   GRKYEFRSEVEFR  904
             GR+    +   FR
Sbjct  1148  GRQLRATASSGFR  1160


 Score = 41.2 bits (95),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 122/344 (35%), Gaps = 90/344 (26%)

Query  57    KPCVSCPLGSYQTLSGQTECLKCPDNT----TTLRRGAKADQDCKGQKNAQKFV------  106
             K C++C  G+YQ+ +GQ +C KCP        T   GA++  DCK +  A K+       
Sbjct  3157  KTCIACSRGTYQSEAGQLQCSKCPVIAGRPGVTAGPGARSAADCKERCPAGKYFDAETGL  3216

Query  107   -----AGLERWSRVSAMCD----GVCRRKLNQFSRQMCWGRVQKTKMSCYLHAWFAVFAE  157
                   G  + +  S  C+    G   R     SR+ C     + + S           E
Sbjct  3217  CRSCGHGFYQPNEGSFSCELCGLGQTTRSTEATSRKEC-----RDECSSGQQLGADGRCE  3271

Query  158   RCSPDTASSTGLQP-CLRCPAGYSQPSAGQRTC------VDAAGQHVAFNQCFSSPCLNG  210
              C   T    G+QP C  CP G + P  G  +       V +AG ++   Q     C  G
Sbjct  3272  PCPRGTYRLQGVQPSCAACPLGRTTPKVGASSVEECTLPVCSAGTYLNATQNMCIECRKG  3331

Query  211   GSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYA-GVSCEIEVDECESSPC--L  267
                S  ++       + CL               CPP ++  ++      EC ++PC  +
Sbjct  3332  YYQSESQQ-------TSCLQ--------------CPPNHSTKITGATSKSEC-TNPCEHI  3369

Query  268   NGGSCEDSINEYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCECRPGY--  325
               G     +N Y  +                            V   + + CEC+PG+  
Sbjct  3370  AEGKPHCDVNAYCIM----------------------------VPETSDFKCECKPGFNG  3401

Query  326   VGAHCEDVWTDPCAVQPCDHGATCLGGDLTYTCECLAGYTGPQC  369
              G  C DV    C     + GA       T +C C+  +TGP C
Sbjct  3402  TGMACTDVCDGFCE----NSGACVKDLKGTPSCRCVGSFTGPHC  3441


 Score = 38.1 bits (87),  Expect = 0.046, Method: Compositional matrix adjust.
 Identities = 24/93 (26%), Positives = 40/93 (43%), Gaps = 15/93 (16%)

Query  835   GYQLEEAASPLTCRKLGAWAGQPPSCPPVLCPALPRMQDGDASLLQPGRDNHTTLEHGRK  894
             GY +E + S     + G    +  +C P++CP L   ++G              L     
Sbjct  1024  GYHIERSESG---ERDGDTYQRNKTCVPLMCPELEAPENGQ------------LLSDKND  1068

Query  895   YEFRSEVEFRCAEGFNLEGEDTLECLASGEWSS  927
             Y F   V F+C  G+ + G     CL+SG+W++
Sbjct  1069  YHFGDVVRFQCHFGYIMSGSSAALCLSSGQWNA  1101


 Score = 30.8 bits (68),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 20/61 (33%), Positives = 25/61 (41%), Gaps = 1/61 (2%)

Query  657   RCLKQGLWEGEEPVCRRVSCGFPGYIEHGFVRGRSYLYGDVVQYRC-RPGYTLVGSSVRV  715
             RC   G+W+  +  C    C  PG    G    RSY     V + C RPGY L+      
Sbjct  1232  RCGADGIWDFGDLRCEGPVCEDPGRPADGRQIARSYEQSSEVYFGCNRPGYILINPRPIT  1291

Query  716   C  716
             C
Sbjct  1292  C  1292


>Q9NGV4_DROME unnamed protein product
Length=1551

 Score = 182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/439 (30%), Positives = 194/439 (44%), Gaps = 27/439 (6%)

Query  203  FSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDEC-  261
            F   C +G    +C  ++D C++ PCL+ G C  +   + C C PG++G+ CE +V  C 
Sbjct  347  FECVCRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTTCG  406

Query  262  ESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCEC  321
              +PC N  SC D   +Y C+C  G  G  CE   + C  +PCMH   C D  +  +C C
Sbjct  407  AQAPCQNDASCIDLFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSGLNCSC  466

Query  322  RPGYVGAHCEDVWTDPCAVQPCDHGATCLGGDLTYTCECLAGYTGPQCEVDIDSCMSQPC  381
               Y G  C+  + D C    C +GATC+     Y+C+C  G+TG  CE DI  C    C
Sbjct  467  PADYSGIGCQYEY-DACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIVDCKDNSC  525

Query  382  LHGGQCQDLPAGFACHCEPPYSGTLCEQEIDTKVVLRFPS-SGTTDYTILSGPKKALNQV  440
              G  C DL  GF C C    +G  C + I     L F   S +T   ++  P    N +
Sbjct  526  PPGATCVDLTNGFYCQCPFNMTGDDCRKAIQVDYDLYFSDPSRSTAAQVVPFPTGEANSL  585

Query  441  TLCLWLRSADQFNYGTIFSY-----ATKHQDNSFTLTDYNGFV---LYVNGQRVFTDI--  490
            T+ +W++ A + + G  F+      A   Q     L  ++  V   L+ +    F     
Sbjct  586  TVAMWVQFAQKDDRGIFFTLYGVQSARMTQQRRMLLQAHSSGVQVSLFEDQPDAFLSFGE  645

Query  491  --VANDGWWHFVCVCWDSALGEWALYIDGYLGDWGSGLANGTAIPANGTLVLGQEQDRPG  548
                NDG WH V V WD   G+  L  +G +       A G+ +P     VLG  Q  P 
Sbjct  646  YTSVNDGQWHHVAVVWDGISGQLQLITEGLIASKMEYGAGGS-LPGYLWAVLGLPQ--PY  702

Query  549  GGFSEV----ESFTGLMASVSLWDHTLSL-SHVSELATDC---PTTDGGNLLSWAHFLTG  600
            G  +E+      F G +    +W   L + S + +   DC   P    G +L+WA +   
Sbjct  703  GLSNELAYSDSGFQGTITKAQVWARALDITSEIQKQVRDCRSEPVLYPGLILNWAGYEV-  761

Query  601  LTGNLQVENSSFCSECEAP  619
             +G ++    S C + + P
Sbjct  762  TSGGVERNVPSLCGQRKCP  780


 Score = 181 bits (460),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 97/234 (41%), Positives = 132/234 (56%), Gaps = 21/234 (9%)

Query  199  FNQCFSSPCLNGGSCS-----------------VCEEEVDGCDSSPCLHGGSCTSQGPNY  241
             N C  +PCL G +C+                  CE+++D C S PC HG +C  +  ++
Sbjct  173  INDCSENPCLLGANCTDLVNDFQCACPPGFTGKRCEQKIDLCLSEPCKHG-TCVDRLFDH  231

Query  242  TCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTDECAA  301
             C C PG+ G +C+I +D+CE+ PC N G+C D ++ Y C C  G+ G  C+   D+CA+
Sbjct  232  ECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDGYSCNCEPGYTGKNCQHTIDDCAS  291

Query  302  EPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDPCAVQPCDHGAT--CLGGDLTYTCE  359
             PC H A CVD +  +SC+CRPGYVG  CE    D C   PC+   T  CL  D  + C 
Sbjct  292  NPCQHGATCVDQLDGFSCKCRPGYVGLSCE-AEIDECLSDPCNPVGTERCLDLDNKFECV  350

Query  360  CLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPPYSGTLCEQEIDT  413
            C  G+ GP C  DID C +QPCL+ G C+D   GF C CEP +SG  CEQ++ T
Sbjct  351  CRDGFKGPLCATDIDDCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTT  404


 Score = 171 bits (432),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/235 (40%), Positives = 127/235 (54%), Gaps = 9/235 (4%)

Query  180  SQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGP  239
            ++P A + TCVD           +S  C  G +   C+  +D C S+PC HG +C  Q  
Sbjct  253  NRPCANEGTCVDLVDG-------YSCNCEPGYTGKNCQHTIDDCASNPCQHGATCVDQLD  305

Query  240  NYTCSCPPGYAGVSCEIEVDECESSPCLNGGS--CEDSINEYVCLCADGFQGDRCEEDTD  297
             ++C C PGY G+SCE E+DEC S PC   G+  C D  N++ C+C DGF+G  C  D D
Sbjct  306  GFSCKCRPGYVGLSCEAEIDECLSDPCNPVGTERCLDLDNKFECVCRDGFKGPLCATDID  365

Query  298  ECAAEPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDPCAVQPCDHGATCLGGDLTYT  357
            +C A+PC++   C D V  + C C PG+ G  CE   T   A  PC + A+C+     Y 
Sbjct  366  DCEAQPCLNNGICRDRVGGFECGCEPGWSGMRCEQQVTTCGAQAPCQNDASCIDLFQDYF  425

Query  358  CECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACHCEPPYSGTLCEQEID  412
            C C +G  G  CE   + C+  PC+HGG+CQD  +G  C C   YSG  C+ E D
Sbjct  426  CVCPSGTDGKNCETAPERCIGDPCMHGGKCQDFGSGLNCSCPADYSGIGCQYEYD  480


 Score = 148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 105/195 (54%), Gaps = 6/195 (3%)

Query  223  CDSSPCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCL  282
            C    C HGG C   G +  C CP G++G  CE ++DEC S PC NGG C+D    Y C 
Sbjct  19   CGEGACQHGGLCVPMGHDIQCFCPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQGYRCE  78

Query  283  CADGFQGDRCEEDTDECAAEPCMHEAACVD--GVASYSCECRPGYVGAHCEDVWTDPCAV  340
            C  G+ G  C+E+  +C  + C   A C +  G  + +C CR GY G  C DV  DPC  
Sbjct  79   CPAGYSGINCQEEASDCGNDTCPARAMCKNEPGYKNVTCLCRSGYTGDQC-DVTIDPCTA  137

Query  341  --QPCDHGATCLGGDL-TYTCECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACH  397
               PC +GA+C   +   Y CEC+ G+ G  CE +I+ C   PCL G  C DL   F C 
Sbjct  138  NGNPCGNGASCQALEQGRYKCECVPGWEGIHCEQNINDCSENPCLLGANCTDLVNDFQCA  197

Query  398  CEPPYSGTLCEQEID  412
            C P ++G  CEQ+ID
Sbjct  198  CPPGFTGKRCEQKID  212


 Score = 142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 86/255 (34%), Positives = 122/255 (48%), Gaps = 48/255 (19%)

Query  201  QCFSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYAGVSCEIEVDE  260
            QCF   C  G S   CE+++D C S PC +GG C      Y C CP GY+G++C+ E  +
Sbjct  38   QCF---CPAGFSGRRCEQDIDECASQPCYNGGQCKDLPQGYRCECPAGYSGINCQEEASD  94

Query  261  C------------------------------------------ESSPCLNGGSCED-SIN  277
            C                                            +PC NG SC+     
Sbjct  95   CGNDTCPARAMCKNEPGYKNVTCLCRSGYTGDQCDVTIDPCTANGNPCGNGASCQALEQG  154

Query  278  EYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCECRPGYVGAHCEDVWTDP  337
             Y C C  G++G  CE++ ++C+  PC+  A C D V  + C C PG+ G  CE    D 
Sbjct  155  RYKCECVPGWEGIHCEQNINDCSENPCLLGANCTDLVNDFQCACPPGFTGKRCEQK-IDL  213

Query  338  CAVQPCDHGATCLGGDLTYTCECLAGYTGPQCEVDIDSCMSQPCLHGGQCQDLPAGFACH  397
            C  +PC HG TC+     + C C  G+TG  C+++ID C ++PC + G C DL  G++C+
Sbjct  214  CLSEPCKHG-TCVDRLFDHECVCHPGWTGSACDINIDDCENRPCANEGTCVDLVDGYSCN  272

Query  398  CEPPYSGTLCEQEID  412
            CEP Y+G  C+  ID
Sbjct  273  CEPGYTGKNCQHTID  287


 Score = 87.8 bits (216),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 67/153 (44%), Gaps = 7/153 (5%)

Query  178  GYSQPSAGQRTCVDAAGQHVAFNQCFSSPCLNGGSCSVCEEEVDGCDSSPCLHGGSCTSQ  237
            G   P     +C+D         Q +   C +G     CE   + C   PC+HGG C   
Sbjct  406  GAQAPCQNDASCID-------LFQDYFCVCPSGTDGKNCETAPERCIGDPCMHGGKCQDF  458

Query  238  GPNYTCSCPPGYAGVSCEIEVDECESSPCLNGGSCEDSINEYVCLCADGFQGDRCEEDTD  297
            G    CSCP  Y+G+ C+ E D CE   C NG +C D+   Y C C  GF G  CE+D  
Sbjct  459  GSGLNCSCPADYSGIGCQYEYDACEEHVCQNGATCVDNGAGYSCQCPPGFTGRNCEQDIV  518

Query  298  ECAAEPCMHEAACVDGVASYSCECRPGYVGAHC  330
            +C    C   A CVD    + C+C     G  C
Sbjct  519  DCKDNSCPPGATCVDLTNGFYCQCPFNMTGDDC  551


 Score = 38.9 bits (89),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 122/344 (35%), Gaps = 90/344 (26%)

Query  57    KPCVSCPLGSYQTLSGQTECLKCPDNT----TTLRRGAKADQDCKGQKNAQKFV------  106
             K C++C  G+YQ+ +GQ +C KCP        T   GA++  DCK +  A K+       
Sbjct  1119  KTCIACSRGTYQSEAGQLQCSKCPVIAGRPGVTAGPGARSAADCKERCPAGKYFDAETGL  1178

Query  107   -----AGLERWSRVSAMCD----GVCRRKLNQFSRQMCWGRVQKTKMSCYLHAWFAVFAE  157
                   G  + +  S  C+    G   R     SR+ C     + + S           E
Sbjct  1179  CRSCGHGFYQPNEGSFSCELCGLGQTTRSTEATSRKEC-----RDECSSGQQLGADGRCE  1233

Query  158   RCSPDTASSTGLQP-CLRCPAGYSQPSAGQRTC------VDAAGQHVAFNQCFSSPCLNG  210
              C   T    G+QP C  CP G + P  G  +       V +AG ++   Q     C  G
Sbjct  1234  PCPRGTYRLQGVQPSCAACPLGRTTPKVGASSVEECTLPVCSAGTYLNATQNMCIECRKG  1293

Query  211   GSCSVCEEEVDGCDSSPCLHGGSCTSQGPNYTCSCPPGYA-GVSCEIEVDECESSPC--L  267
                S  ++       + CL               CPP ++  ++      EC ++PC  +
Sbjct  1294  YYQSESQQ-------TSCLQ--------------CPPNHSTKITGATSKSEC-TNPCEHI  1331

Query  268   NGGSCEDSINEYVCLCADGFQGDRCEEDTDECAAEPCMHEAACVDGVASYSCECRPGY--  325
               G     +N Y  +                            V   + + CEC+PG+  
Sbjct  1332  AEGKPHCDVNAYCIM----------------------------VPETSDFKCECKPGFNG  1363

Query  326   VGAHCEDVWTDPCAVQPCDHGATCLGGDLTYTCECLAGYTGPQC  369
              G  C DV    C     + GA       T +C C+  +TGP C
Sbjct  1364  TGMACTDVCDGFCE----NSGACVKDLKGTPSCRCVGSFTGPHC  1403



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold1049-size585523-augustus-gene-1.2-mRNA-1

Length=181
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q586U2_TRYB2  unnamed protein product                                 52.8    9e-09
Q587D3_TRYB2  unnamed protein product                                 43.9    2e-05
Q38AY3_TRYB2  unnamed protein product                                 38.1    0.003


>Q586U2_TRYB2 unnamed protein product
Length=175

 Score = 52.8 bits (125),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 48/92 (52%), Gaps = 3/92 (3%)

Query  51   VRQGRGQQVEAGGRHAYRGDWDADTLSCPAAELRFPGGASYSGAVLDLRLHGEGSYRFPD  110
               G+G   +AGG   Y G W    ++     LRFP GA+Y G++      G G+Y +PD
Sbjct  73   FHHGKGVFKDAGGL-VYDGCWVEGDMTGEGL-LRFPSGATYEGSMYANSFWGTGTYTWPD  130

Query  111  GSRLEGVFACDRPAPGQARLIDPQGRPWTGEV  142
            GSR EG +  ++   G+   ID +G+ W G+ 
Sbjct  131  GSRYEGQWENNK-MHGKGTYIDAKGKRWAGKF  161


>Q587D3_TRYB2 unnamed protein product
Length=358

 Score = 43.9 bits (102),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 60/142 (42%), Gaps = 12/142 (8%)

Query  19   QDAAVHVGGDAFHFRNGAYYGGEYKATSAGSIVRQGRGQQVEAG----GRHAYRGDWDAD  74
            +D  +H G   + + NG  Y GE+K        R G+G  V A         Y G+W+  
Sbjct  100  KDGRMH-GKGTYCYSNGDKYEGEWKEDK-----RHGKGVVVYAAPDGCVSEKYDGEWNEG  153

Query  75   TLSCPAAELRFPGGASYSGAVLDLRLHGEGSYRFPDGSRLEGVFACDRPAPGQARLIDPQ  134
             +          GG  Y G  +D R+HG G+Y FP+G++ EG +  DR   G   L+   
Sbjct  154  RMQGWGKYFYADGGV-YEGEWVDGRMHGRGTYVFPNGNKYEGEWVEDRK-DGYGILLYTN  211

Query  135  GRPWTGEVGTAGVVLRPLLRFL  156
            G  + G         +  L FL
Sbjct  212  GERYEGYWHLDKAHGKGTLTFL  233


 Score = 36.6 bits (83),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query  83   LRFPGGASYSGAVLDLRLHGEGSYRFPDGSRLEGVFACDRPAPGQARLIDPQGRPWTGEV  142
            L++P    Y G  +  + HG G Y + DGSR EG +  D+   G        G  +TGE 
Sbjct  18   LQYPNKEKYDGDWVFGKRHGTGVYVYADGSRYEGEWVDDK-VHGNGACYYTSGNVYTGEW  76

Query  143  GTAGVVLRPLLRF  155
                +  R +L +
Sbjct  77   SMGRINGRGVLEY  89


 Score = 35.8 bits (81),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 32/68 (47%), Gaps = 2/68 (3%)

Query  66   AYRGDWDADTLSCPAAELRFPGGASYSGAVLDLRLHGEGSYRFPDGSRLEGVFA-CDRPA  124
             Y G+W  D  +     L++  G  Y G   + R HG+G    PDGS  EG FA   +  
Sbjct  260  TYDGEWRDDD-AWGYGVLQYANGCRYEGEWAEDRRHGKGLLVLPDGSSYEGSFAHGKKDG  318

Query  125  PGQARLID  132
            PG+  L D
Sbjct  319  PGKIILKD  326


 Score = 34.7 bits (78),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (52%), Gaps = 1/58 (2%)

Query  65   HAYRGDWDADTLSCPAAELRFPGGASYSGAVLDLRLHGEGSYRFPDGSRLEGVFACDR  122
            + Y G+W    ++     L +  G  Y G   D R+HG+G+Y + +G + EG +  D+
Sbjct  70   NVYTGEWSMGRINGRGV-LEYHDGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEWKEDK  126


>Q38AY3_TRYB2 unnamed protein product
Length=690

 Score = 38.1 bits (87),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 44/94 (47%), Gaps = 6/94 (6%)

Query  25   VGGDAFHFRNGAYYGGEYKATSAGSIVRQGRGQQVEAGGRHAYRGDWDADTLSCPAAELR  84
             G     + +G+ Y GE++          G G   +A G   + G+W + T      +++
Sbjct  596  CGSGTLRYADGSVYVGEWRNDKP-----HGCGCFTDACGE-THVGEWCSGTQKDVRGKIQ  649

Query  85   FPGGASYSGAVLDLRLHGEGSYRFPDGSRLEGVF  118
            F  G+ Y G V + R HG+G   +PDG+  +G F
Sbjct  650  FIDGSMYEGDVCNRRPHGKGRLCYPDGTVFDGTF  683


 Score = 31.2 bits (69),  Expect = 0.45, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 37/85 (44%), Gaps = 3/85 (4%)

Query  51   VRQGRGQQVEAGGRHAYRGDWDADTLSCPAAELRFPGGASYSGAVLDLRLHGEGSYRFPD  110
            VR G G  V + G  A  G W+ D L CP     +P G+ Y G       HG G++    
Sbjct  293  VRSGEGLFVYSSGV-AVTGKWENDEL-CPEVRANYPDGSFYVGEWTKGCRHGNGTHTDAP  350

Query  111  GSRLEGVFACDRPAPGQARLIDPQG  135
            G+   G +  D+   G+ +L    G
Sbjct  351  GNVFVGKWEDDKRT-GEGKLTFANG  374


 Score = 31.2 bits (69),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 26/99 (26%)

Query  66   AYRGDWDADTLSCPAAELRFPGGASYSGAVLDLRLHGEGSY-------------------  106
             Y GDW ++   C +  LR+  G+ Y G   + + HG G +                   
Sbjct  585  VYEGDW-SNGGRCGSGTLRYADGSVYVGEWRNDKPHGCGCFTDACGETHVGEWCSGTQKD  643

Query  107  -----RFPDGSRLEGVFACDRPAPGQARLIDPQGRPWTG  140
                 +F DGS  EG   C+R   G+ RL  P G  + G
Sbjct  644  VRGKIQFIDGSMYEGD-VCNRRPHGKGRLCYPDGTVFDG  681


 Score = 30.0 bits (66),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 38/89 (43%), Gaps = 7/89 (8%)

Query  34   NGAYYGGEYKATSAGSIVRQGRGQQVEAGGRHAYRGDWDADTLSCPAAELRFPGGASYSG  93
            NG  Y G +K        R G G+ VE G   +Y G+W    + C     R   G +Y G
Sbjct  420  NGDKYEGSWKDDK-----RHGFGKFVETGLNRSYAGEW-FKGVRCGLGVQRAVDG-TYHG  472

Query  94   AVLDLRLHGEGSYRFPDGSRLEGVFACDR  122
               D    GEG Y+  +GS   G +  DR
Sbjct  473  EFEDDVRCGEGYYQGCNGSMYRGSWKGDR  501



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold985-size604716-augustus-gene-1.1-mRNA-1

Length=125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2J6D4_DROME  unnamed protein product                                 176     1e-58
CYC2_DROME  unnamed protein product                                   176     1e-58
CYC1_DROME  unnamed protein product                                   136     8e-43


>X2J6D4_DROME unnamed protein product
Length=108

 Score = 176 bits (447),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)

Query  29   QLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAPGYTYTDANKSKGITWNRDTLFIY  88
            +LFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQA G+ YTDANK+KGITWN DTLF Y
Sbjct  13   KLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLFEY  72

Query  89   LENPKKFIPGTKMVFAGLKKPQERADIICYVEQATK  124
            LENPKK+IPGTKM+FAGLKKP ER D+I Y++ ATK
Sbjct  73   LENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK  108


>CYC2_DROME unnamed protein product
Length=108

 Score = 176 bits (447),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)

Query  29   QLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAPGYTYTDANKSKGITWNRDTLFIY  88
            +LFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQA G+ YTDANK+KGITWN DTLF Y
Sbjct  13   KLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAAGFAYTDANKAKGITWNEDTLFEY  72

Query  89   LENPKKFIPGTKMVFAGLKKPQERADIICYVEQATK  124
            LENPKK+IPGTKM+FAGLKKP ER D+I Y++ ATK
Sbjct  73   LENPKKYIPGTKMIFAGLKKPNERGDLIAYLKSATK  108


>CYC1_DROME unnamed protein product
Length=105

 Score = 136 bits (343),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 75/93 (81%), Gaps = 0/93 (0%)

Query  29   QLFVQRCAQCHTVEAGGKHKVGPNLHGLIGRKTGQAPGYTYTDANKSKGITWNRDTLFIY  88
            ++FVQ+CAQCHT E GGKHKVGPNL G++GRK G A GY YTDAN  KG+TW    L  Y
Sbjct  11   KIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGVTWTEGNLDEY  70

Query  89   LENPKKFIPGTKMVFAGLKKPQERADIICYVEQ  121
            L++PKK+IPGTKMVFAGLKK +ERAD+I +++ 
Sbjct  71   LKDPKKYIPGTKMVFAGLKKAEERADLIAFLKS  103



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold7975-size82043-augustus-gene-0.0-mRNA-1

Length=255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OCT1_CAEEL  unnamed protein product                                   58.9    8e-10
Q4QAR5_LEIMA  unnamed protein product                                 57.8    2e-09
Q9VNX2_DROME  unnamed protein product                                 55.8    8e-09


>OCT1_CAEEL unnamed protein product
Length=585

 Score = 58.9 bits (141),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 98/225 (44%), Gaps = 35/225 (16%)

Query  22   MWGFLSDSLGRQRLLCLGFFMDVICGVISSFSQNFQVLVVFRFFSGFIISGPHAMLISFL  81
            ++G+++D  GR+R   +   + ++CG  SSF+++ +  ++ RFF+G  ++ P    I F+
Sbjct  171  LFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIESFIILRFFTG--LAFPALFQIPFI  228

Query  82   --AEFHSQKYRARMIILTGVYGAIANISLPGLAWLIIPQSWVWSLFGGYITYNSWRVFVA  139
               EF     R    ++T ++   A ++L G+  + I                 WR    
Sbjct  229  ICMEFMGNSGRIFSGLMTSLFFGAA-MALLGVVAMFI---------------RRWRQLTF  272

Query  140  LCTIPSFLAGCLMMCFDESPKFLVSRGQEDEALRVLKKVYSINTRKHPDSYPVKALVSGG  199
             C  P            ESP++ VS G+  +A + LKK+  +N + + D   V  LV   
Sbjct  273  FCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVD---VDELVD--  327

Query  200  IETRSSQVVIEEQDTFEKFLTLVKSGWKQVMPLFKVPHVTSALLV  244
               ++ Q   EE++T              V  LFK P++    L+
Sbjct  328  -SMKNHQNAAEEKETKRS---------HNVTDLFKTPNLRRKTLI  362


>Q4QAR5_LEIMA unnamed protein product
Length=547

 Score = 57.8 bits (138),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/161 (27%), Positives = 76/161 (47%), Gaps = 12/161 (7%)

Query  19   SAFMWGFLSDSLGRQRLLCLGFFMDVICGVISSFSQNFQVLVVFRFFSGFIISGPHAMLI  78
             AF+ GF+S + GR+  + +   + VI  V+   + N +V++V R   G  I    A + 
Sbjct  57   GAFISGFISAAFGRRPCIAVADALFVIGSVLMGAAPNVEVVLVSRVIVGLAIGISSATIP  116

Query  79   SFLAEFHSQKYRARMIILTGVYGAIANISLPGLAWLIIPQSWVWSLFGGYITYN-SWRVF  137
             +LAE  S K+R   I+L  ++         G   +++           + + N  WRV 
Sbjct  117  VYLAEVTSPKHRGATIVLNNLFLTGGQFVAAGFTAIMVV----------FTSKNIGWRVA  166

Query  138  VALCTIPSFL-AGCLMMCFDESPKFLVSRGQEDEALRVLKK  177
            + +  +P+ + A CL+    ESP++L+S+G    A  V  K
Sbjct  167  IGIGALPAVVQAFCLLFFLPESPRWLLSKGHAGRAKAVADK  207


>Q9VNX2_DROME unnamed protein product
Length=568

 Score = 55.8 bits (133),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/196 (23%), Positives = 86/196 (44%), Gaps = 17/196 (9%)

Query  24   GFLSDSLGRQRLLCLGFFMDVICGVISSFSQNFQVLVVFRFFSGFIISGPHAMLISFLAE  83
            GF++D  GR   + LG  +  + GVI SFS ++   +VF F      S  ++       E
Sbjct  181  GFVADRYGRSFSIALGGILGAVLGVIRSFSPSYGWFLVFEFLDNMTSSTLYSTCFVIGIE  240

Query  84   FHSQKYRARMIILTGVYGAIANISLPGLAWLIIPQSWVWSLFGGYITYNSWRVFVALCTI  143
                K R     +  V+ A+  + L   A                  ++ WR+ + +   
Sbjct  241  LVGPKRRVLACSVITVFYAVGEVLLAMSA----------------KAFHDWRILLRITYG  284

Query  144  PSFLAGCLMMCFDESPKFLVSRGQEDEALRVLKKVYSINTRKHPDSYPVKALVSGGIE-T  202
            PS +         ES ++L+S+G+E+ A  +L++   +N R+ P+S   K +++   +  
Sbjct  285  PSLILLAYFWILPESVRWLLSQGKEERAKNILRRAAHVNKRELPESVLDKLVLANRDKLQ  344

Query  203  RSSQVVIEEQDTFEKF  218
            +SS+     ++ F+ F
Sbjct  345  QSSESRFPIREAFKNF  360



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= augustus-scaffold17-size2088793-processed-gene-19.0-mRNA-1

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54XR3_DICDI  unnamed protein product                                 43.9    2e-05
CAPS_DROME  unnamed protein product                                   30.0    0.94 
ESS2_CAEEL  unnamed protein product                                   28.5    3.2  


>Q54XR3_DICDI unnamed protein product
Length=716

 Score = 43.9 bits (102),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 8/54 (15%)

Query  2    VGGHSSMLSLDEATVCKPLVPRELDFYK--TLPEPVRK-----FVPAFYGVVQV  48
            VGGHS+MLS++   +CKPL+ REL FY+   L   +       F+  F+GVV+V
Sbjct  108  VGGHSAMLSVN-GNICKPLINRELQFYEFSQLKNNIHSFFISPFLANFFGVVEV  160


>CAPS_DROME unnamed protein product
Length=1447

 Score = 30.0 bits (66),  Expect = 0.94, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 32/67 (48%), Gaps = 2/67 (3%)

Query  9    LSLDEATVCKPLVPRELDFYKTLPEPVRKFVPAFYGVVQVRVLQEEE-GYVTLAATPPEC  67
            L  D+A   KP+   + DF  T P PV K V  +     +  L+++E G VTL  TP   
Sbjct  483  LQTDQAEASKPMWDTQGDFTTTHPLPVVK-VKLYTENPGMLALEDKELGKVTLKPTPLSS  541

Query  68   YQPQSSR  74
              P+  R
Sbjct  542  KSPEWHR  548


>ESS2_CAEEL unnamed protein product
Length=531

 Score = 28.5 bits (62),  Expect = 3.2, Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 6/48 (13%)

Query  94   IAKLFREDQEEEVPAALNPWVFKCHRKYLQNLIT-NAIAGKVSGILSL  140
            +AK+ RE ++     A  PWV+K   ++ +NL+T  AIA +    L+L
Sbjct  186  LAKVMRERED-----ARRPWVYKAEEEHNKNLVTRQAIAAEADVQLAL  228



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold2419-size355437-augustus-gene-2.10-mRNA-1

Length=171
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U370_CAEEL  unnamed protein product                                 32.7    0.13 
B7Z0R2_DROME  unnamed protein product                                 30.8    0.71 
A0A0B4KHD2_DROME  unnamed protein product                             30.8    0.71 


>Q9U370_CAEEL unnamed protein product
Length=1076

 Score = 32.7 bits (73),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 54/124 (44%), Gaps = 19/124 (15%)

Query  5    VDGEAGGQARPPKPTHQRSLSKPISFPANSSCS--SGAS---SSDVSCGQLRNSWSEASM  59
            V  EA  Q RP     +  L  P+    N+S +   GAS    + +SC + +   ++ + 
Sbjct  697  VCDEASPQKRPNVENPRYQLENPVMTNVNTSPNHIEGASQEFGAMMSCWKSQTIIADQAY  756

Query  60   EEAPPLPPRGHTPDRRNTTFFFEASQTPPAPPKRLVKKGSGPTTDSLADTSLELDQL-TD  118
            E+A     R +    +N TFFF        P KRL  +   PT D +  +   LD++ T 
Sbjct  757  EKA-----RQNRKTLQNNTFFF--------PSKRLSDQAVAPTEDEIKSSRARLDEIKTH  803

Query  119  TSEH  122
              EH
Sbjct  804  WEEH  807


>B7Z0R2_DROME unnamed protein product
Length=2002

 Score = 30.8 bits (68),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)

Query  62    APPLPPRGHTPDRR  75
             APPLPPRG TPD+R
Sbjct  1732  APPLPPRGITPDKR  1745


>A0A0B4KHD2_DROME unnamed protein product
Length=2008

 Score = 30.8 bits (68),  Expect = 0.71, Method: Compositional matrix adjust.
 Identities = 12/14 (86%), Positives = 13/14 (93%), Gaps = 0/14 (0%)

Query  62    APPLPPRGHTPDRR  75
             APPLPPRG TPD+R
Sbjct  1738  APPLPPRGITPDKR  1751



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold1665-size455626-augustus-gene-2.1-mRNA-1

Length=198
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RBP2A_PLAF7  unnamed protein product                                  33.5    0.11 
Q8IHP3_PLAF7  unnamed protein product                                 31.6    0.49 
C6KSX6_PLAF7  unnamed protein product                                 28.9    3.2  


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 33.5 bits (75),  Expect = 0.11, Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 66/118 (56%), Gaps = 5/118 (4%)

Query  66    QQRNLVLTKEAQLGQIREKRQIQQLQKQLQDFWDDAMKRELEAKLEQEMEAARRRVLAEK  125
             +Q    L KE +L +  ++R  ++ Q+QLQ   ++ +KR+ + +L++E EA +R+     
Sbjct  2741  RQEQERLQKEEELKRQEQERLEREKQEQLQK--EEELKRQEQERLQKE-EALKRQEQERL  2797

Query  126   AAQDFLKEQMKEKEQAAEAEMLKMKEEEEAAVKIKEELRQEEIARKLTKPFAVRREHL  183
               ++ LK Q +E+ +  + E L  ++EEE   + +E L++EE  ++  +    + E L
Sbjct  2798  QKEEELKRQEQERLEREKQEQL--QKEEELKRQEQERLQKEEALKRQEQERLQKEEEL  2853


 Score = 32.3 bits (72),  Expect = 0.26, Method: Composition-based stats.
 Identities = 43/160 (27%), Positives = 84/160 (53%), Gaps = 29/160 (18%)

Query  29    RRAEEIKNKKEAERKEIVEKKRIQQYMERCEVIRPMVQQRNLVLTKEAQLGQIREKRQIQ  88
             +R E+ + +KE E K        +Q  ER E      +++   L KE +L    ++++ +
Sbjct  2740  KRQEQERLQKEEELK--------RQEQERLE------REKQEQLQKEEEL----KRQEQE  2781

Query  89    QLQKQLQDFWDDAMKRELEAKLEQEMEAARR---RVLAEKAAQDFLKEQMKEKEQAAEAE  145
             +LQK+      +A+KR+ + +L++E E  R+   R+  EK  Q   +E++K +EQ    +
Sbjct  2782  RLQKE------EALKRQEQERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQK  2835

Query  146   MLKMKEEEEAAVKIKEELRQEEIARKLTKP--FAVRREHL  183
                +K +E+  ++ +EEL+++E  R   K    A R +H+
Sbjct  2836  EEALKRQEQERLQKEEELKRQEQERLERKKIELAEREQHI  2875


 Score = 30.8 bits (68),  Expect = 0.91, Method: Composition-based stats.
 Identities = 42/162 (26%), Positives = 81/162 (50%), Gaps = 12/162 (7%)

Query  2     LQENEESAVHRAKLAEKAKNCEL---EQRKRRAEEIKNKKEAERKEIVEKKRIQQYMERC  58
             L+  E+  + R K  +  K  EL   EQ + + EE   ++E ER +  E+ + +Q  ER 
Sbjct  2753  LKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELK-RQEQERL  2811

Query  59    EVIRPMVQQRNLVLTKEAQLGQIREKRQIQQLQKQLQDFWDDAMKRELEAKLEQEM--EA  116
             E  +    Q+   L ++ Q    +E+   +Q Q++LQ   ++ +KR+ + +LE++    A
Sbjct  2812  EREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQK--EEELKRQEQERLERKKIELA  2869

Query  117   ARRRVLAEKAAQDFLK----EQMKEKEQAAEAEMLKMKEEEE  154
              R + +  K   D +K    E  KEK++  + + +K++   E
Sbjct  2870  EREQHIKSKLESDMVKIIKDELTKEKDEIIKNKDIKLRHSLE  2911


 Score = 30.0 bits (66),  Expect = 1.4, Method: Composition-based stats.
 Identities = 33/144 (23%), Positives = 84/144 (58%), Gaps = 7/144 (5%)

Query  41    ERKEIVEKKRIQQYMERCEVIRPMVQQRNLVLTKEAQLGQIREKRQIQQLQKQLQDFWDD  100
             + KE +E+++ +Q  +  E+ +   +++     +EA   Q +E+ Q ++  K+ +    +
Sbjct  2703  QEKERLEREKQEQLKKEEELRKKEQERQEQQQKEEALKRQEQERLQKEEELKRQE---QE  2759

Query  101   AMKRELEAKLEQEMEAARR---RVLAEKAAQDFLKEQMKEKEQAAEAEMLKMKEEEEAAV  157
              ++RE + +L++E E  R+   R+  E+A +   +E+++++E+    E  +++ E++  +
Sbjct  2760  RLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREKQEQL  2819

Query  158   KIKEELRQEEIARKLTKPFAVRRE  181
             + +EEL+++E  R L K  A++R+
Sbjct  2820  QKEEELKRQEQER-LQKEEALKRQ  2842


>Q8IHP3_PLAF7 unnamed protein product
Length=2055

 Score = 31.6 bits (70),  Expect = 0.49, Method: Composition-based stats.
 Identities = 38/164 (23%), Positives = 77/164 (47%), Gaps = 5/164 (3%)

Query  3     QENEESAVHRAKLAEKAKNCELEQRKRRAEEIKNKKEAERKEI---VEKKRIQQYMERCE  59
             +  ++ A+ RA+ A + +     +  RR EE +  ++A R EI   VE  R  +   R E
Sbjct  1098  ESKKKEAMKRAEDARRIEEARRAEDARRIEEARRAEDARRVEIARRVEDARRIEISRRAE  1157

Query  60    VIRPMVQQRNLVLTKEAQLGQIREKRQIQQLQK-QLQDFWDDAMKRELEAKLEQEMEAAR  118
               + +   R  +  + A+L +  + R+I+  ++ + +   ++A + E E ++E    A  
Sbjct  1158  DAKRIEAARRAIEVRRAELRKAEDARRIEAARRYENERRIEEARRYEDEKRIEAVKRAEE  1217

Query  119   RRVLAEKAAQDFLKEQMKEKEQAAEAEMLKMKEEEEAAVKIKEE  162
              R   E+A +   +   +E  +  EA M      + AA+K +E+
Sbjct  1218  VRKDEEEAKRAEKERNNEEIRKFEEARMAHFARRQ-AAIKAEEK  1260


>C6KSX6_PLAF7 unnamed protein product
Length=1422

 Score = 28.9 bits (63),  Expect = 3.2, Method: Composition-based stats.
 Identities = 30/134 (22%), Positives = 68/134 (51%), Gaps = 13/134 (10%)

Query  34    IKNKKEAERKEIVEKKRIQQYMERCEVIRPMVQQRNLVLTKEAQLGQIREKRQIQQLQKQ  93
             +  KK  E   + + ++IQ+  ++    + M Q+ N++     Q  +I+E+++    QK+
Sbjct  1015  VYQKKMQEHNMLEQDQKIQEEKKKLLYQKKM-QEHNML----EQDQKIQEEKKKLLYQKK  1069

Query  94    LQDFWDDAMKRELEAKLEQEMEAARRRVLAEKAAQDFLKEQMKEKEQAAEAEMLKMKEEE  153
             +Q+   + ++++ + + E+ ME        +K  + FL+++ KE EQ  E   ++ +   
Sbjct  1070  MQE--HNMLEQDKKIQEEKFMEKK------QKLTEQFLEQKQKEDEQILERNKIEKQNIM  1121

Query  154   EAAVKIKEELRQEE  167
                 K++EE  Q E
Sbjct  1122  NKLKKLEEEKNQFE  1135



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold90-size1469227-augustus-gene-13.12-mRNA-1

Length=609
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MCM10_DROME  unnamed protein product                                  303     3e-93
O16880_CAEEL  unnamed protein product                                 31.2    3.2  
U2AF1_DROME  unnamed protein product                                  29.3    8.2  


>MCM10_DROME unnamed protein product
Length=776

 Score = 303 bits (777),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 178/460 (39%), Positives = 256/460 (56%), Gaps = 63/460 (14%)

Query  71   AVENVSMAKVLSDQDKPI---------EKKKFSRQFT--------KQRNSHLVHKGDTDS  113
            A EN +     S++ KP          E   F+  FT        KQ+N+ ++ + + DS
Sbjct  28   AAENENTKSAESEKAKPTAPILVPKLREDNSFANAFTFEKIVKPEKQKNAAIIKEPELDS  87

Query  114  SDDEDNKYFEEQNYTAYG--------------------RTVKHLLNESVGSAT-------  146
            SDDE+ K F E+ Y  YG                    R V   L +S+   T       
Sbjct  88   SDDEEVKNFLERKYNEYGSDINKRLKQQQENAYESKVAREVDQELKKSIHVVTSTPQPLK  147

Query  147  --NEGAKQRTGSRAAWRRPLPPASAAPACVPGQARTGTKPPSTAEIDGDPIFGIRIVNPL  204
              +   K+++     ++RP PP +AA A       + +  P +A +  DP+FG+R++NPL
Sbjct  148  NPHNPIKRQSAVSTTFQRP-PPVAAAVAST-----SQSSAPVSA-VFTDPVFGLRMINPL  200

Query  205  ISSISLKERMVGRQVVPLANLKRHLLREDHSSDWVVGGVVVSKSGARTSQKGAEYAIWRI  264
            +SS  L+ERM GR+ VP + +  H+ R D + DWV+ G +VSK+  + ++KG  Y+ W++
Sbjct  201  VSSSLLQERMTGRKPVPFSGVAYHIERGDLAKDWVIAGALVSKNPVKNTKKGDPYSTWKL  260

Query  265  SDLKAGLKTASVFLFGKCFKELWKTNVGTILGILNPKPLDNRDGSGDEAAVSVDNPQKVM  324
            SDL+  +KT S+FLF +  K LWKT  G  L +LNP   + R GS D A +S+D+ QKVM
Sbjct  261  SDLRGEVKTISLFLFKEAHKSLWKTAEGLCLAVLNPTIFERRAGSSDVACLSIDSSQKVM  320

Query  325  IMGTSKDFGMCKSRKKNGDNCMSFVNTNQCEYCVFHLQAAYKSCSRRMELQSPCAGRGLD  384
            I+G SKD G C++ KKNGD C S VN   C+YC+FH++  Y   SRR ELQS  AGRG++
Sbjct  321  ILGQSKDLGTCRATKKNGDKCTSVVNLTDCDYCIFHVKQEYGKMSRRSELQSATAGRGIN  380

Query  385  KLRNKVLGKNEVFYAGQSYAAVPAKKSHKLMSKDNERLKKLSDF-YKPDAVGAASLGRGN  443
            +LRNKVLGKNEVFY GQ++ AVPA+KS KL++K+ +RL  L+ +   P A  A    +  
Sbjct  381  ELRNKVLGKNEVFYGGQTFTAVPARKSAKLITKERDRLSMLAGYDVSPFAHTANHTSKPK  440

Query  444  KENKTRTKY------ISTL---LEKSGDQAKKDQERLRKL  474
                T+  Y      +S L   +E S  Q  +D ERLR L
Sbjct  441  TAEPTKIPYAERGGPVSRLAGGVEASRKQRVQDLERLRLL  480


 Score = 147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 110/171 (64%), Gaps = 20/171 (12%)

Query  441  RGNKENKTRTKYISTLLEKSGDQAKK------DQERLRKLS-SALLQSSSTNTDSNVKTA  493
            RG++  K R   I  L EK    AK+      D+E +RK     ++ ++S++T+      
Sbjct  581  RGSESGKRRA--IDELNEKFSSSAKRQKIDEDDRELMRKSRIEKIMAATSSHTN------  632

Query  494  DAGTVQAKLVDNEAQEEYFDRLEKKEKLEDKMLSTYKVPCKAVRCLKCKYTAFSASELCK  553
                   ++ + EAQEEYF++LE+KE +E+KML+TYK+PCKAV C  CKYTAFSAS+ CK
Sbjct  633  -----LVEMREREAQEEYFNKLERKEAMEEKMLTTYKMPCKAVICQVCKYTAFSASDRCK  687

Query  554  TERHPLKVTDGVKRFFKCCNCGNRTVTLELIPLWSCKNCSSSHWERAPMMK  604
             ++HPLKV D  KRFF+C +CGNRT T+  +P  SCKNC  S W+R  M++
Sbjct  688  EQKHPLKVVDAEKRFFQCKDCGNRTTTVFKLPKQSCKNCKGSRWQRTAMIR  738


>O16880_CAEEL unnamed protein product
Length=1080

 Score = 31.2 bits (69),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 16/62 (26%), Positives = 32/62 (52%), Gaps = 2/62 (3%)

Query  77   MAKVLSDQDKPIEKKKFS--RQFTKQRNSHLVHKGDTDSSDDEDNKYFEEQNYTAYGRTV  134
            + +++ + DK + K KFS   +     ++++   G  +S  D D+ Y E+QN   Y   +
Sbjct  877  LNEIVCEFDKLLSKPKFSSVEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNI  936

Query  135  KH  136
            +H
Sbjct  937  RH  938


>U2AF1_DROME unnamed protein product
Length=264

 Score = 29.3 bits (64),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 0/58 (0%)

Query  459  KSGDQAKKDQERLRKLSSALLQSSSTNTDSNVKTADAGTVQAKLVDNEAQEEYFDRLE  516
            + GD+  +   +     + LLQ+   N  ++ K+AD   + A + D E QE Y +  E
Sbjct  28   RHGDRCSRIHNKPTFSQTVLLQNLYVNPQNSAKSADGSHLVANVSDEEMQEHYDNFFE  85



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold6217-size130280-augustus-gene-0.3-mRNA-1

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQW0_DROME  unnamed protein product                                 246     3e-70
M9MSQ5_DROME  unnamed protein product                                 246     4e-70
Q9VWB7_DROME  unnamed protein product                                 246     5e-70


>Q8IQW0_DROME unnamed protein product
Length=1034

 Score = 246 bits (628),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 188/306 (61%), Gaps = 43/306 (14%)

Query  277  SRIKAEKIRIALEKMKEASVKKLFIKAFSVDGSTKSLMVDEKMTCAYVTRLLADKNHVHM  336
            S  KA+KI++AL K++ A +++LF+KAF+ DG++KSL+VDE+M C +VTRLLADKNHV M
Sbjct  218  SITKADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQM  277

Query  337  DPKWAIIEHLPDLYMERVYEDHELLVENLMMWTRDSKNKLLFLERMDKIQLFTHPEKFLL  396
               WA++EHL DL MER++EDHELLV+NLM W  D+ N++LF +R DK+ LF  PE +L 
Sbjct  278  QSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLP  337

Query  397  S-STEQGTDFDDHARAMLLEVILLSSFVISGLAEFFSSTGVGVPEVEGPLYLKADSKKGW  455
                  G   D+  R MLL+             EFF S      +++GPLY+KAD KKGW
Sbjct  338  GPQMAPGCQHDEQTRQMLLD-------------EFFDSHNQL--QMDGPLYMKADPKKGW  382

Query  456  KKHHFVLRASGLYYWPKEKVKSSRDLVCLATFDVNQEFFSSTGVGVPEVEGPLYLKADSK  515
            K++HFVLR+SGLYY+PKEK K++RDL CL  F  +  +   TG+G              +
Sbjct  383  KRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFHGHNVY---TGLGW-------------R  426

Query  516  KGWKK---HHFVLRASGLYYWPKE----KVKSSRDLVC----LATFDVNQYGRHLMDNYR  564
            K WK    + F  +A G     K     K+  + DL      L    V +YG+ L D+++
Sbjct  427  KKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHK  486

Query  565  SLVDDL  570
            SL++DL
Sbjct  487  SLLEDL  492


 Score = 32.7 bits (73),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)

Query  224  RTESPDNDSAFSDNV  238
            RTESPDNDSAFSD V
Sbjct  136  RTESPDNDSAFSDTV  150


 Score = 30.4 bits (67),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)

Query  126  LTDSQDVDLDAILGELCALESQ  147
            L DSQ+ +LD ILGEL  LE+Q
Sbjct  4    LEDSQESELDQILGELSLLEAQ  25


>M9MSQ5_DROME unnamed protein product
Length=1113

 Score = 246 bits (629),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 188/306 (61%), Gaps = 43/306 (14%)

Query  277  SRIKAEKIRIALEKMKEASVKKLFIKAFSVDGSTKSLMVDEKMTCAYVTRLLADKNHVHM  336
            S  KA+KI++AL K++ A +++LF+KAF+ DG++KSL+VDE+M C +VTRLLADKNHV M
Sbjct  297  SITKADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQM  356

Query  337  DPKWAIIEHLPDLYMERVYEDHELLVENLMMWTRDSKNKLLFLERMDKIQLFTHPEKFLL  396
               WA++EHL DL MER++EDHELLV+NLM W  D+ N++LF +R DK+ LF  PE +L 
Sbjct  357  QSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLP  416

Query  397  S-STEQGTDFDDHARAMLLEVILLSSFVISGLAEFFSSTGVGVPEVEGPLYLKADSKKGW  455
                  G   D+  R MLL+             EFF S      +++GPLY+KAD KKGW
Sbjct  417  GPQMAPGCQHDEQTRQMLLD-------------EFFDSHNQL--QMDGPLYMKADPKKGW  461

Query  456  KKHHFVLRASGLYYWPKEKVKSSRDLVCLATFDVNQEFFSSTGVGVPEVEGPLYLKADSK  515
            K++HFVLR+SGLYY+PKEK K++RDL CL  F  +  +   TG+G              +
Sbjct  462  KRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFHGHNVY---TGLGW-------------R  505

Query  516  KGWKK---HHFVLRASGLYYWPKE----KVKSSRDLVC----LATFDVNQYGRHLMDNYR  564
            K WK    + F  +A G     K     K+  + DL      L    V +YG+ L D+++
Sbjct  506  KKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHK  565

Query  565  SLVDDL  570
            SL++DL
Sbjct  566  SLLEDL  571


 Score = 33.5 bits (75),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 22/52 (42%)

Query  96   SYRFSMANLEVHNPIAVEQKSFGTKVMSGFLTDSQDVDLDAILGELCALESQ  147
            +YR SMANLE                      DSQ+ +LD ILGEL  LE+Q
Sbjct  75   TYRISMANLE----------------------DSQESELDQILGELSLLEAQ  104


 Score = 32.7 bits (73),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)

Query  224  RTESPDNDSAFSDNV  238
            RTESPDNDSAFSD V
Sbjct  215  RTESPDNDSAFSDTV  229


>Q9VWB7_DROME unnamed protein product
Length=1162

 Score = 246 bits (629),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 135/306 (44%), Positives = 188/306 (61%), Gaps = 43/306 (14%)

Query  277  SRIKAEKIRIALEKMKEASVKKLFIKAFSVDGSTKSLMVDEKMTCAYVTRLLADKNHVHM  336
            S  KA+KI++AL K++ A +++LF+KAF+ DG++KSL+VDE+M C +VTRLLADKNHV M
Sbjct  346  SITKADKIQLALHKLESAPIRRLFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQM  405

Query  337  DPKWAIIEHLPDLYMERVYEDHELLVENLMMWTRDSKNKLLFLERMDKIQLFTHPEKFLL  396
               WA++EHL DL MER++EDHELLV+NLM W  D+ N++LF +R DK+ LF  PE +L 
Sbjct  406  QSNWALVEHLGDLQMERLFEDHELLVDNLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLP  465

Query  397  S-STEQGTDFDDHARAMLLEVILLSSFVISGLAEFFSSTGVGVPEVEGPLYLKADSKKGW  455
                  G   D+  R MLL+             EFF S      +++GPLY+KAD KKGW
Sbjct  466  GPQMAPGCQHDEQTRQMLLD-------------EFFDSHNQL--QMDGPLYMKADPKKGW  510

Query  456  KKHHFVLRASGLYYWPKEKVKSSRDLVCLATFDVNQEFFSSTGVGVPEVEGPLYLKADSK  515
            K++HFVLR+SGLYY+PKEK K++RDL CL  F  +  +   TG+G              +
Sbjct  511  KRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFHGHNVY---TGLGW-------------R  554

Query  516  KGWKK---HHFVLRASGLYYWPKE----KVKSSRDLVC----LATFDVNQYGRHLMDNYR  564
            K WK    + F  +A G     K     K+  + DL      L    V +YG+ L D+++
Sbjct  555  KKWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSHK  614

Query  565  SLVDDL  570
            SL++DL
Sbjct  615  SLLEDL  620


 Score = 33.5 bits (75),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 25/52 (48%), Gaps = 22/52 (42%)

Query  96   SYRFSMANLEVHNPIAVEQKSFGTKVMSGFLTDSQDVDLDAILGELCALESQ  147
            +YR SMANLE                      DSQ+ +LD ILGEL  LE+Q
Sbjct  124  TYRISMANLE----------------------DSQESELDQILGELSLLEAQ  153


 Score = 32.7 bits (73),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 14/15 (93%), Gaps = 0/15 (0%)

Query  224  RTESPDNDSAFSDNV  238
            RTESPDNDSAFSD V
Sbjct  264  RTESPDNDSAFSDTV  278



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold10327-size79373-augustus-gene-0.3-mRNA-1

Length=255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DERL1_CAEEL  unnamed protein product                                  212     1e-68
DERL1_DROME  unnamed protein product                                  201     2e-64
Q9VEU2_DROME  unnamed protein product                                 120     7e-33


>DERL1_CAEEL unnamed protein product
Length=245

 Score = 212 bits (539),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/242 (46%), Positives = 151/242 (62%), Gaps = 3/242 (1%)

Query  3    DIGEWFKSLPLFTRYWFALSAGISLIARLGIISPHYFYLTSELFFQKFQLWRPITAAFYY  62
            D+  +   +P+ TRYWF  S  I L+ R G I+  + +L  +L   KFQ WRP+TA  YY
Sbjct  2    DLENFLLGIPIVTRYWFLASTIIPLLGRFGFINVQWMFLQWDLVVNKFQFWRPLTALIYY  61

Query  63   PMSPPGVGFHFLTNLYFLYHYSRNLETGLFDGRPADYFFMLLFCWLCTAIVSMLANLLVL  122
            P++P   GFH+L   YFLY+YS+ LE+  + GR ADY FML+F W   + + M  ++  L
Sbjct  62   PVTPQ-TGFHWLMMCYFLYNYSKALESETYRGRSADYLFMLIFNWFFCSGLCMALDIYFL  120

Query  123  MDQMVMCVLYVWCQLNKEVIVSFWFGTQFKAVYLPWVLFGIYFIIGRGGLQELIGILVGH  182
            ++ MV+ VLYVWCQ+NK+ IVSFWFG +F A YLPWVL+G   ++  GG  EL+GILVGH
Sbjct  121  LEPMVISVLYVWCQVNKDTIVSFWFGMRFPARYLPWVLWGFNAVLRGGGTNELVGILVGH  180

Query  183  LYFFLMFKYPQEMGGPSLLTTPSILYRYFPSTRSGIHG-FGQAPISRRPAGDDRGGGGGG  241
             YFF+  KYP E  G  L++TP  L+R  P    GIHG  G    +R+     +  GG G
Sbjct  181  AYFFVALKYPDEY-GVDLISTPEFLHRLIPDEDGGIHGQDGNIRGARQQPRGHQWPGGVG  239

Query  242  GR  243
             R
Sbjct  240  AR  241


>DERL1_DROME unnamed protein product
Length=245

 Score = 201 bits (512),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 143/250 (57%), Gaps = 9/250 (4%)

Query  3    DIGEWFKSLPLFTRYWFALSAGISLIARLGIISPHYFYLTSELFFQKFQLWRPITAAFYY  62
            D G W++SLP FTRYW   +  +S++ R  +I  H+ +L     F K QLWR +T+ F +
Sbjct  2    DAGVWYRSLPRFTRYWLTATVVLSMLCRFDVIPLHWLHLDRSAVFSKLQLWRCMTSLFVF  61

Query  63   PMSPPGVGFHFLTNLYFLYHYSRNLETGLFDGRPADYFFMLLFCWLCTAIVSMLANLLVL  122
            P+S     FHFL N +F+  YS  LE   +   PADY ++L+   +   I  M+ N+  L
Sbjct  62   PISS-NTAFHFLINCFFIVQYSSKLEKDQYSRSPADYLYLLIVSAVLANIGGMIFNVYFL  120

Query  123  MDQMVMCVLYVWCQLNKEVIVSFWFGTQFKAVYLPWVLFGIYFIIGRGGLQELIGILVGH  182
            MD +V+ + Y+WCQLNK+V VSFWFGT+FKA+YLPWVL    FI     L  L+GI VGH
Sbjct  121  MDTLVLAITYIWCQLNKDVTVSFWFGTRFKAMYLPWVLAAFEFIF-HFSLASLVGIFVGH  179

Query  183  LYFFLMFKYPQEMGGPSLLTTPSILYRYFPSTRSGIHGFGQAPISRRPAGDDRGGGGGGG  242
            +Y+F  F+Y Q++GG  LL TP  L R  P    G  GFG  P SR P            
Sbjct  180  VYYFFKFQYSQDLGGTPLLETPQFLKRLVPDVSGGFGGFGLPPESRAPPRQ-------AT  232

Query  243  RHNWGRGNVL  252
               WGRG  L
Sbjct  233  ESPWGRGMTL  242


>Q9VEU2_DROME unnamed protein product
Length=261

 Score = 120 bits (302),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/239 (33%), Positives = 115/239 (48%), Gaps = 7/239 (3%)

Query  1    MSDIGEWFKSLPLFTRYWFALSAGISLIARLGIISPHYFYLTSELFFQKFQLWRPITAAF  60
            M+ + +++  +P+ TR +  +    +L   L ++SP   Y    L  +KFQ+WR  T   
Sbjct  1    MNALRQFYLEIPVVTRAYTTVCVLTTLAVHLDLVSPLQLYFNPTLIVRKFQIWRLATTFL  60

Query  61   YYPMSPPGVGFHFLTNLYFLYHYSRNLETGLFDGRPADYFFMLLFCWLCTAIVSMLANLL  120
            Y+      +G  F  N+ F Y Y R LE G F GR +D+  M +F  +      +  NLL
Sbjct  61   YFGT----IGISFFFNMVFTYRYCRMLEDGSFRGRSSDFVMMFIFGGVLMTFFGIFVNLL  116

Query  121  VLMDQMVMCVLYVWCQLNKEVIVSFWFGTQFKAVYLPWVLFGIYFIIGRGGLQELIGILV  180
             L     + ++YVW + N  V ++F+    F+A YLPWVL     I+G     ++IG+ V
Sbjct  117  FLGQAFTLMLVYVWSRRNPLVPMNFFGVLNFQAPYLPWVLLCCSMILGNTVWVDVIGMGV  176

Query  181  GHLYFFLMFKYPQEMGGPSLLTTPSILYRYFPSTRSGIHGFGQAPISRRPAGDDRGGGG  239
            GH+Y+ L   YP    G  L+ TP  L R F      I    QA    RP G   GG G
Sbjct  177  GHIYYVLEDVYPTLSNGYRLIKTPYFLKRLF---NEHIERNFQAAAEDRPGGFPWGGEG  232



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold3941-size236702-augustus-gene-1.11-mRNA-1

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VP27_DROME  unnamed protein product                                 798     0.0  
M9PIG4_DROME  unnamed protein product                                 794     0.0  
Q9U4Y0_DROME  unnamed protein product                                 35.4    0.17 


>Q9VP27_DROME unnamed protein product
Length=1103

 Score = 798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/832 (48%), Positives = 555/832 (67%), Gaps = 33/832 (4%)

Query  1    LSSISDQCQHKIW--QHTIDLVDDNNLKKLLDHACSQDSVVKKCGTSDSLLACLIDNR-E  57
            L  + + CQ+ +W  Q  + L        L  +  ++   ++ C  +  L +CL   R +
Sbjct  76   LMDLPEGCQNALWMQQRQLQLPAWLESTFLPAYCPAERPKLESCLNAVHLWSCLEQQRLK  135

Query  58   SITYVPCKAFIQRLEWVVFSDFRTISTFVNECRTSINMFHCGRLPSD---EPVSQGKTLA  114
             +    C   ++R    +  D+  +  F   C   +    CGRL  D     +SQ  T+ 
Sbjct  136  LLQNNACHQHLRRAYESLGQDYSAVDEFYTACGPLVEENKCGRLNVDHLPSVLSQLTTVQ  195

Query  115  CLQQHIDDLDLK--CQKQVFHLSEVQADDIKLDRQLYLACQADHLRLCPDIPSNSENVYR  172
            CLQ+      ++  CQ  +  +            +L+  CQ D    C    S +   Y+
Sbjct  196  CLQESATKTGIEPVCQAAINSI------------ELFRVCQEDFSSFCSQEKSGTAAGYK  243

Query  173  CLMQHRLDRTMSAECHEQLQRRQKLIARDYKVSKGLARSCKEDIRLYHCRRSVSDDKEIR  232
            CL++H+   +MS++C  ++  R + I RDY+VS GLA++CK+DI+LYHCRR VS+DK +R
Sbjct  244  CLVRHKNHPSMSSQCSARITLRDQQIGRDYRVSHGLAKACKDDIKLYHCRRGVSEDKHVR  303

Query  233  LAQILLCLEGVIRNGTKVSQDCQLEMVEHRKILMEDYRLSPEIVSQCSGDISKFC-----  287
            LAQILLCLE V +NGTK++  C  E+ +HR++LM DY+LSPE+++ C+ DI KFC     
Sbjct  304  LAQILLCLESVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPELLNDCADDIPKFCPDEHK  363

Query  288  ----SGL-EVGGKTIHCLMDHVRPRKRKERVSAQCQRALEVLVKEADVGEDWRVDPVLRE  342
                +G+   GG+ IHCL++HV+ R+ + RV+AQCQR LE L+K +D GEDWRVDPVLR 
Sbjct  364  AQLVNGMTSTGGEIIHCLLEHVKARRPQRRVTAQCQRGLETLIKASDAGEDWRVDPVLRR  423

Query  343  ACKPVVQRSCRDVRGGDARVMTCLMEKLGTDYMTPDCEAALIEIQYFVARDFKLDPQLYR  402
            ACKPVV   CRDV+GG+ARVM CLME +GT  M PDCE AL+ I+YFVARDFKLDPQLY+
Sbjct  424  ACKPVVDVVCRDVQGGEARVMGCLMEHIGTPVMLPDCEQALLIIEYFVARDFKLDPQLYK  483

Query  403  KCHDDAVKLCHAKKAWTD--DGQMDPERGPLVLPCLYRYAYHTQDKMRLKSECLEEIRRV  460
             C DDAVK C AKK W D  + QMDPERGP++LPCL+R A+   +   L+ +C +E++RV
Sbjct  484  HCRDDAVKYCRAKKQWDDAQNIQMDPERGPMILPCLHRMAFSEDEHQTLRKDCFQEVKRV  543

Query  461  MRQRAVSVDLQPEVEEVCLENLATMCSDKTNKGEEMVCLQDNLESLTLECRQAVSNFTEE  520
            MRQRA+S+DL PEVE+ CL +L+  C+D T KG EM CLQ N++ L  EC+  V  +TEE
Sbjct  544  MRQRAISMDLIPEVEDYCLNDLSAFCADCTEKGSEMECLQKNMDQLQPECKTVVVKYTEE  603

Query  521  QAEHVELNPVLMSTCQGVMEKHCASVLQTGRDEGDIMECLVEHKNEPDVRSSYKCRAAIE  580
            +A HVELNPV+M+ C   M++HC+++L++G+D GD+M+CL+ HKN+ D+R   +CRAAIE
Sbjct  604  EAAHVELNPVIMNVCGEAMQQHCSAILKSGKDNGDMMDCLIAHKNDADLRKDLRCRAAIE  663

Query  581  HFQLISLKNYHFTYKFKEACRPHVIRYCPGARTKLEVITCLSEHVRNDTIHDAKHSIPRD  640
            HFQ+ISLK++HFT KFKEACRP+V R+C  + TK EV+ CLSE +RNDTI   +H IP++
Sbjct  664  HFQIISLKSFHFTTKFKEACRPYVQRFCSSSATKNEVVACLSEVMRNDTIKAQRHQIPKE  723

Query  641  CRQQLRAQLFQQRENINFDPGLKGACVKDIKKFCSGMVEGAGQILECLQINVKNLTPGCH  700
            CR Q++AQL+QQRE+I  DP L  AC +++++FC    +G GQ LECL     +L   CH
Sbjct  724  CRHQVKAQLYQQRESIQLDPKLANACKRELEQFCEEE-KGPGQALECLIRKTHSLGKPCH  782

Query  701  RAIFNVEKQELLDSSSDYVLITTCRQMIRQFCHEEDQSHALECLKRYKDEMTFDPKCKVM  760
             AIF V+K EL DS +DY L+TTC++MI +FC   D S  L+CLK YKD+  FD +C ++
Sbjct  783  HAIFMVKKSELGDSGTDYTLLTTCKEMIYKFCPSTDSSKLLDCLKTYKDDTQFDQRCHLV  842

Query  761  VVRRMIEQNQDYRFNPLLQKGCHLDIPKFCADVVATEPQDKELEGKVIKCLK  812
            VV RMIEQN D+RFNP LQ  C  +I ++C+++VA+   ++EL GKVI CLK
Sbjct  843  VVNRMIEQNTDFRFNPSLQSACGKNIDRYCSNIVASALPNEELNGKVIHCLK  894


 Score = 154 bits (389),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 180/839 (21%), Positives = 347/839 (41%), Gaps = 109/839 (13%)

Query  33    CSQDSVVKKCGTSDSLLACLIDNRESITYVP-CKAFIQRLEWVVFSDFRTISTFVNECRT  91
             CSQ+    K GT+     CL+ ++   +    C A I   +  +  D+R        C+ 
Sbjct  231   CSQE----KSGTAAGY-KCLVRHKNHPSMSSQCSARITLRDQQIGRDYRVSHGLAKACKD  285

Query  92    SINMFHCGR-LPSDEPVSQGKTLACLQ---QHIDDLDLKCQKQVFHLSEVQADDIKLDRQ  147
              I ++HC R +  D+ V   + L CL+   ++   L   C  ++     +   D +L  +
Sbjct  286   DIKLYHCRRGVSEDKHVRLAQILLCLESVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPE  345

Query  148   LYLACQADHLRLCPD---------IPSNSENVYRCLMQH----RLDRTMSAECHEQLQRR  194
             L   C  D  + CPD         + S    +  CL++H    R  R ++A+C   L+  
Sbjct  346   LLNDCADDIPKFCPDEHKAQLVNGMTSTGGEIIHCLLEHVKARRPQRRVTAQCQRGLETL  405

Query  195   QKL--IARDYKVSKGLARSCKEDIRLYHCRRSVSDDKEIRLAQILLCLEGVIRNGTKVS-  251
              K      D++V   L R+CK  + +  CR     D +   A+++ CL   I  GT V  
Sbjct  406   IKASDAGEDWRVDPVLRRACKPVVDVV-CR-----DVQGGEARVMGCLMEHI--GTPVML  457

Query  252   QDCQLEMVEHRKILMEDYRLSPEIVSQCSGDISKFCSG-------------LEVGGKTIH  298
              DC+  ++     +  D++L P++   C  D  K+C                E G   + 
Sbjct  458   PDCEQALLIIEYFVARDFKLDPQLYKHCRDDAVKYCRAKKQWDDAQNIQMDPERGPMILP  517

Query  299   CLMDHVRPRKRKERVSAQCQRALEVLVKEADVGEDWRVDPVLREACKPVVQRSCRDVRGG  358
             CL          + +   C + ++ ++++  +  D  + P + + C   +   C D    
Sbjct  518   CLHRMAFSEDEHQTLRKDCFQEVKRVMRQRAISMD--LIPEVEDYCLNDLSAFCADCTEK  575

Query  359   DARVMTCLMEKLGTDYMTPDCEAALIEIQYFVARDFKLDPQLYRKCHDDAVKLCHA-KKA  417
              +  M CL + +  D + P+C+  +++     A   +L+P +   C +   + C A  K+
Sbjct  576   GSE-MECLQKNM--DQLQPECKTVVVKYTEEEAAHVELNPVIMNVCGEAMQQHCSAILKS  632

Query  418   WTDDGQMDPERGPLVLPCLYRYAYHTQDKMRLKSECLEEIRRVMRQRAVSVDLQPEVEEV  477
               D+G M        + CL   A+     +R    C   I         S     + +E 
Sbjct  633   GKDNGDM--------MDCLI--AHKNDADLRKDLRCRAAIEHFQIISLKSFHFTTKFKEA  682

Query  478   CLENLATMCSDKTNKGEEMVCLQDNLESLTL---------ECRQAVSNFTEEQAEHVELN  528
             C   +   CS    K E + CL + + + T+         ECR  V     +Q E ++L+
Sbjct  683   CRPYVQRFCSSSATKNEVVACLSEVMRNDTIKAQRHQIPKECRHQVKAQLYQQRESIQLD  742

Query  529   PVLMSTCQGVMEKHCASVLQTGRDEGDIMECLVEHKNEPDVRSSYKCRAAIEHFQLISLK  588
             P L + C+  +E+ C    +  +  G  +ECL+   +         C  AI   +   L 
Sbjct  743   PKLANACKRELEQFC----EEEKGPGQALECLIRKTHS----LGKPCHHAIFMVKKSELG  794

Query  589   NYHFTYKFKEACRPHVIRYCPGARTKLEVITCLSEHVRNDTIHDAKHSIPRDCRQQLRAQ  648
             +    Y     C+  + ++CP   +  +++ CL  + ++DT  D +      C   +  +
Sbjct  795   DSGTDYTLLTTCKEMIYKFCPSTDSS-KLLDCLKTY-KDDTQFDQR------CHLVVVNR  846

Query  649   LFQQRENINFDPGLKGACVKDIKKFCSGMVEGA-------GQILECLQINVKN--LTPGC  699
             + +Q  +  F+P L+ AC K+I ++CS +V  A       G+++ CL+   +   L   C
Sbjct  847   MIEQNTDFRFNPSLQSACGKNIDRYCSNIVASALPNEELNGKVIHCLKDKFRQSALDEPC  906

Query  700   HRAIFNVEKQELLDSSSDYVLITTCRQMIRQFCH----EEDQSHALECLKR-YKDEMTFD  754
              + +  + +++ L+   + +L   C+  I++ C      ++     ECLK  +  +   +
Sbjct  907   AKEMIKILQEQALNYKLNPLLQVFCKSEIQELCKANVDSDEHGQLAECLKTAFLQKQIIN  966

Query  755   PKCKVMVVRRMIEQNQDYRFNPLLQKGCHLDIPKFCADVVATEPQDKELEGKVIKCLKV  813
              +C++ V   + E   D   +P+L+  C +D+ ++C+ V A         G+ + CL+ 
Sbjct  967   RQCQMEVATLIAEAKADIHVDPILETACTVDLLRYCSKVAAG-------NGRKLNCLRT  1018


 Score = 109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 179/802 (22%), Positives = 311/802 (39%), Gaps = 135/802 (17%)

Query  3     SISDQCQHKIWQHTIDLVDDNNLKKLLDHACSQDSVVKKC--GTSD-------SLLACLI  53
             S+S QC  +I      +  D  +   L  AC  D  +  C  G S+        +L CL 
Sbjct  253   SMSSQCSARITLRDQQIGRDYRVSHGLAKACKDDIKLYHCRRGVSEDKHVRLAQILLCLE  312

Query  54    DNRESITYV--PCKAFIQRLEWVVFSDFRTISTFVNECRTSINMF----HCGRLPSDEPV  107
                ++ T +  PC   +     ++ +D++     +N+C   I  F    H  +L +    
Sbjct  313   SVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPELLNDCADDIPKFCPDEHKAQLVNGMTS  372

Query  108   SQGKTLACLQQHIDD------LDLKCQKQVFHLSEVQ--ADDIKLDRQLYLACQADHLRL  159
             + G+ + CL +H+        +  +CQ+ +  L +     +D ++D  L  AC+     +
Sbjct  373   TGGEIIHCLLEHVKARRPQRRVTAQCQRGLETLIKASDAGEDWRVDPVLRRACKPVVDVV  432

Query  160   CPDIPSNSENVYRCLMQHRLDRTMSAECHEQLQRRQKLIARDYKVSKGLARSCKEDIRLY  219
             C D+      V  CLM+H     M  +C + L   +  +ARD+K+   L + C++D   Y
Sbjct  433   CRDVQGGEARVMGCLMEHIGTPVMLPDCEQALLIIEYFVARDFKLDPQLYKHCRDDAVKY  492

Query  220   -HCRRSVSDDKEIRL-----AQILLCLEGVIRNGTK---VSQDCQLEM---VEHRKILME  267
                ++   D + I++       IL CL  +  +  +   + +DC  E+   +  R I M+
Sbjct  493   CRAKKQWDDAQNIQMDPERGPMILPCLHRMAFSEDEHQTLRKDCFQEVKRVMRQRAISMD  552

Query  268   DYRLSPEIVSQCSGDISKFCSGLEVGGKTIHCL---MDHVRPR------KRKERVSAQ--  316
                L PE+   C  D+S FC+     G  + CL   MD ++P       K  E  +A   
Sbjct  553   ---LIPEVEDYCLNDLSAFCADCTEKGSEMECLQKNMDQLQPECKTVVVKYTEEEAAHVE  609

Query  317   --------CQRALE----VLVK-----------------EADVGEDWRVDPVL-------  340
                     C  A++     ++K                 +AD+ +D R    +       
Sbjct  610   LNPVIMNVCGEAMQQHCSAILKSGKDNGDMMDCLIAHKNDADLRKDLRCRAAIEHFQIIS  669

Query  341   ----------REACKPVVQRSCRDVRGGDARVMTCLMEKLGTDYMTP-------DCEAAL  383
                       +EAC+P VQR C         V+ CL E +  D +         +C   +
Sbjct  670   LKSFHFTTKFKEACRPYVQRFCSS-SATKNEVVACLSEVMRNDTIKAQRHQIPKECRHQV  728

Query  384   IEIQYFVARDFKLDPQLYRKCHDDAVKLCHAKKAWTDDGQMDPERGP-LVLPCLYRYAYH  442
                 Y      +LDP+L   C  +  + C            + E+GP   L CL R  + 
Sbjct  729   KAQLYQQRESIQLDPKLANACKRELEQFC------------EEEKGPGQALECLIRKTH-  775

Query  443   TQDKMRLKSECLEEIRRVMRQRAVSVDLQPEVEEVCLENLATMCSDKTNKGEEMVCLQDN  502
                   L   C   I  V +           +   C E +   C   T+  + + CL+  
Sbjct  776   -----SLGKPCHHAIFMVKKSELGDSGTDYTLLTTCKEMIYKFCPS-TDSSKLLDCLKTY  829

Query  503   LESLTLE--CRQAVSNFTEEQAEHVELNPVLMSTCQGVMEKHC----ASVLQTGRDEGDI  556
              +    +  C   V N   EQ      NP L S C   ++++C    AS L      G +
Sbjct  830   KDDTQFDQRCHLVVVNRMIEQNTDFRFNPSLQSACGKNIDRYCSNIVASALPNEELNGKV  889

Query  557   MECLVEHKNEPDVRSSYKCRAAIEHFQLISLKNYHFTYKFKEACRPHVIRYCPGARTKLE  616
             + CL + K           +  I+  Q  +L NY      +  C+  +   C  A    +
Sbjct  890   IHCL-KDKFRQSALDEPCAKEMIKILQEQAL-NYKLNPLLQVFCKSEIQELC-KANVDSD  946

Query  617   VITCLSEHVRNDTIHDAKHSIPRDCRQQLRAQLFQQRENINFDPGLKGACVKDIKKFCSG  676
                 L+E ++   +   K  I R C+ ++   + + + +I+ DP L+ AC  D+ ++CS 
Sbjct  947   EHGQLAECLKTAFLQ--KQIINRQCQMEVATLIAEAKADIHVDPILETACTVDLLRYCSK  1004

Query  677   MVEGAGQILECLQINVKNLTPG  698
             +  G G+ L CL+  +K+ TP 
Sbjct  1005  VAAGNGRKLNCLRTLLKD-TPN  1025


 Score = 38.1 bits (87),  Expect = 0.038, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 9/157 (6%)

Query  48    LLACLIDN-RESITYVPC-KAFIQRLEWVVFSDFRTISTFVNECRTSINMFHCGRLPSDE  105
             ++ CL D  R+S    PC K  I+ L+     +++        C++ I       + SDE
Sbjct  889   VIHCLKDKFRQSALDEPCAKEMIKILQEQAL-NYKLNPLLQVFCKSEIQELCKANVDSDE  947

Query  106   PVSQGKTL--ACLQQHIDDLDLKCQKQVFHLSEVQADDIKLDRQLYLACQADHLRLCPDI  163
                  + L  A LQ+ I  ++ +CQ +V  L      DI +D  L  AC  D LR C  +
Sbjct  948   HGQLAECLKTAFLQKQI--INRQCQMEVATLIAEAKADIHVDPILETACTVDLLRYCSKV  1005

Query  164   PSNSENVYRCLMQHRLD--RTMSAECHEQLQRRQKLI  198
              + +     CL     D   ++ A+C E+LQRR ++ 
Sbjct  1006  AAGNGRKLNCLRTLLKDTPNSLEADCREKLQRRIEMF  1042


>M9PIG4_DROME unnamed protein product
Length=1107

 Score = 794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/836 (48%), Positives = 556/836 (67%), Gaps = 37/836 (4%)

Query  1    LSSISDQCQHKIW--QHTIDLVDDNNLKKLLDHACSQDSVVKKCGTSDSLLACLIDNR-E  57
            L  + + CQ+ +W  Q  + L        L  +  ++   ++ C  +  L +CL   R +
Sbjct  76   LMDLPEGCQNALWMQQRQLQLPAWLESTFLPAYCPAERPKLESCLNAVHLWSCLEQQRLK  135

Query  58   SITYVPCKAFIQRLEWVVFSDFRTISTFVNECRTSINMFHCGRLPSD---EPVSQGKTLA  114
             +    C   ++R    +  D+  +  F   C   +    CGRL  D     +SQ  T+ 
Sbjct  136  LLQNNACHQHLRRAYESLGQDYSAVDEFYTACGPLVEENKCGRLNVDHLPSVLSQLTTVQ  195

Query  115  CLQQHIDDLDLK--CQKQVFHLSEVQADDIKLDRQLYLACQADHLRLCPDIPSNSENVYR  172
            CLQ+      ++  CQ  +  +            +L+  CQ D    C    S +   Y+
Sbjct  196  CLQESATKTGIEPVCQAAINSI------------ELFRVCQEDFSSFCSQEKSGTAAGYK  243

Query  173  CLMQHRLDRTMSAECHEQLQRRQKLIARDYKVSKGLARSCKEDIRLYHCRRSVSDDKEIR  232
            CL++H+   +MS++C  ++  R + I RDY+VS GLA++CK+DI+LYHCRR VS+DK +R
Sbjct  244  CLVRHKNHPSMSSQCSARITLRDQQIGRDYRVSHGLAKACKDDIKLYHCRRGVSEDKHVR  303

Query  233  LAQILLCLEGVIRNGTKVSQDCQLEMVEHRKILMEDYRLSPEIVSQCSGDISKFC-----  287
            LAQILLCLE V +NGTK++  C  E+ +HR++LM DY+LSPE+++ C+ DI KFC     
Sbjct  304  LAQILLCLESVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPELLNDCADDIPKFCPDEHK  363

Query  288  ----SGL-EVGGKTIHCLMDHVRPRKRKERVSAQCQRALEVLVKEADVGEDWRVDPVLRE  342
                +G+   GG+ IHCL++HV+ R+ + RV+AQCQR LE L+K +D GEDWRVDPVLR 
Sbjct  364  AQLVNGMTSTGGEIIHCLLEHVKARRPQRRVTAQCQRGLETLIKASDAGEDWRVDPVLRR  423

Query  343  ACKPVVQRSCRDVRGGDARVMTCLMEKLGTDYMTPDCEAALIEIQYFVARDFKLDPQLYR  402
            ACKPVV   CRDV+GG+ARVM CLME +GT  M PDCE AL+ I+YFVARDFKLDPQLY+
Sbjct  424  ACKPVVDVVCRDVQGGEARVMGCLMEHIGTPVMLPDCEQALLIIEYFVARDFKLDPQLYK  483

Query  403  KCHDDAVKLCHAKKAWTD--DGQMDPERGPLVLPCLYRYAYHTQDKMRLKSECLEEIRRV  460
             C DDAVK C AKK W D  + QMDPERGP++LPCL+R A+   +   L+ +C +E++RV
Sbjct  484  HCRDDAVKYCRAKKQWDDAQNIQMDPERGPMILPCLHRMAFSEDEHQTLRKDCFQEVKRV  543

Query  461  MRQRAVSVDLQPEVEEVCLENLATMCSDKTNKGEEMVCLQDNLESLTLECRQAVSNFTEE  520
            MRQRA+S+DL PEVE+ CL +L+  C+D T KG EM CLQ N++ L  EC+  V  +TEE
Sbjct  544  MRQRAISMDLIPEVEDYCLNDLSAFCADCTEKGSEMECLQKNMDQLQPECKTVVVKYTEE  603

Query  521  QAEHVELNPVLMSTCQGVMEKHCASVLQTGRDEGDIMECLVEHKNEPDVRSSYKCRAAIE  580
            +A HVELNPV+M+ C   M++HC+++L++G+D GD+M+CL+ HKN+ D+R   +CRAAIE
Sbjct  604  EAAHVELNPVIMNVCGEAMQQHCSAILKSGKDNGDMMDCLIAHKNDADLRKDLRCRAAIE  663

Query  581  HFQLISLKNYHFTYKFKEACRPHVIRYCPGARTKLEVITCLSEHVRNDTIHDAKHSIPRD  640
            HFQ+ISLK++HFT KFKEACRP+V R+C  + TK EV+ CLSE +RNDTI   +H IP++
Sbjct  664  HFQIISLKSFHFTTKFKEACRPYVQRFCSSSATKNEVVACLSEVMRNDTIKAQRHQIPKE  723

Query  641  CRQQLRAQLFQQRENINFDPGLKGACVKDIKKFCSGMVEGAGQI----LECLQINVKNLT  696
            CR Q++AQL+QQRE+I  DP L  AC +++++FC    +G GQ+    LECL     +L 
Sbjct  724  CRHQVKAQLYQQRESIQLDPKLANACKRELEQFCEEE-KGPGQVNEKALECLIRKTHSLG  782

Query  697  PGCHRAIFNVEKQELLDSSSDYVLITTCRQMIRQFCHEEDQSHALECLKRYKDEMTFDPK  756
              CH AIF V+K EL DS +DY L+TTC++MI +FC   D S  L+CLK YKD+  FD +
Sbjct  783  KPCHHAIFMVKKSELGDSGTDYTLLTTCKEMIYKFCPSTDSSKLLDCLKTYKDDTQFDQR  842

Query  757  CKVMVVRRMIEQNQDYRFNPLLQKGCHLDIPKFCADVVATEPQDKELEGKVIKCLK  812
            C ++VV RMIEQN D+RFNP LQ  C  +I ++C+++VA+   ++EL GKVI CLK
Sbjct  843  CHLVVVNRMIEQNTDFRFNPSLQSACGKNIDRYCSNIVASALPNEELNGKVIHCLK  898


 Score = 155 bits (392),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 180/839 (21%), Positives = 346/839 (41%), Gaps = 105/839 (13%)

Query  33    CSQDSVVKKCGTSDSLLACLIDNRESITYVP-CKAFIQRLEWVVFSDFRTISTFVNECRT  91
             CSQ+    K GT+     CL+ ++   +    C A I   +  +  D+R        C+ 
Sbjct  231   CSQE----KSGTAAGY-KCLVRHKNHPSMSSQCSARITLRDQQIGRDYRVSHGLAKACKD  285

Query  92    SINMFHCGR-LPSDEPVSQGKTLACLQ---QHIDDLDLKCQKQVFHLSEVQADDIKLDRQ  147
              I ++HC R +  D+ V   + L CL+   ++   L   C  ++     +   D +L  +
Sbjct  286   DIKLYHCRRGVSEDKHVRLAQILLCLESVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPE  345

Query  148   LYLACQADHLRLCPD---------IPSNSENVYRCLMQH----RLDRTMSAECHEQLQRR  194
             L   C  D  + CPD         + S    +  CL++H    R  R ++A+C   L+  
Sbjct  346   LLNDCADDIPKFCPDEHKAQLVNGMTSTGGEIIHCLLEHVKARRPQRRVTAQCQRGLETL  405

Query  195   QKL--IARDYKVSKGLARSCKEDIRLYHCRRSVSDDKEIRLAQILLCLEGVIRNGTKVS-  251
              K      D++V   L R+CK  + +  CR     D +   A+++ CL   I  GT V  
Sbjct  406   IKASDAGEDWRVDPVLRRACKPVVDVV-CR-----DVQGGEARVMGCLMEHI--GTPVML  457

Query  252   QDCQLEMVEHRKILMEDYRLSPEIVSQCSGDISKFCSG-------------LEVGGKTIH  298
              DC+  ++     +  D++L P++   C  D  K+C                E G   + 
Sbjct  458   PDCEQALLIIEYFVARDFKLDPQLYKHCRDDAVKYCRAKKQWDDAQNIQMDPERGPMILP  517

Query  299   CLMDHVRPRKRKERVSAQCQRALEVLVKEADVGEDWRVDPVLREACKPVVQRSCRDVRGG  358
             CL          + +   C + ++ ++++  +  D  + P + + C   +   C D    
Sbjct  518   CLHRMAFSEDEHQTLRKDCFQEVKRVMRQRAISMD--LIPEVEDYCLNDLSAFCADCTEK  575

Query  359   DARVMTCLMEKLGTDYMTPDCEAALIEIQYFVARDFKLDPQLYRKCHDDAVKLCHA-KKA  417
              +  M CL + +  D + P+C+  +++     A   +L+P +   C +   + C A  K+
Sbjct  576   GSE-MECLQKNM--DQLQPECKTVVVKYTEEEAAHVELNPVIMNVCGEAMQQHCSAILKS  632

Query  418   WTDDGQMDPERGPLVLPCLYRYAYHTQDKMRLKSECLEEIRRVMRQRAVSVDLQPEVEEV  477
               D+G M        + CL   A+     +R    C   I         S     + +E 
Sbjct  633   GKDNGDM--------MDCLI--AHKNDADLRKDLRCRAAIEHFQIISLKSFHFTTKFKEA  682

Query  478   CLENLATMCSDKTNKGEEMVCLQDNLESLTL---------ECRQAVSNFTEEQAEHVELN  528
             C   +   CS    K E + CL + + + T+         ECR  V     +Q E ++L+
Sbjct  683   CRPYVQRFCSSSATKNEVVACLSEVMRNDTIKAQRHQIPKECRHQVKAQLYQQRESIQLD  742

Query  529   PVLMSTCQGVMEKHCASVLQTGRDEGDIMECLVEHKNEPDVRSSYKCRAAIEHFQLISLK  588
             P L + C+  +E+ C      G+     +ECL+   +         C  AI   +   L 
Sbjct  743   PKLANACKRELEQFCEEEKGPGQVNEKALECLIRKTHS----LGKPCHHAIFMVKKSELG  798

Query  589   NYHFTYKFKEACRPHVIRYCPGARTKLEVITCLSEHVRNDTIHDAKHSIPRDCRQQLRAQ  648
             +    Y     C+  + ++CP   +  +++ CL  + ++DT  D +      C   +  +
Sbjct  799   DSGTDYTLLTTCKEMIYKFCPSTDSS-KLLDCLKTY-KDDTQFDQR------CHLVVVNR  850

Query  649   LFQQRENINFDPGLKGACVKDIKKFCSGMVEGA-------GQILECLQINVKN--LTPGC  699
             + +Q  +  F+P L+ AC K+I ++CS +V  A       G+++ CL+   +   L   C
Sbjct  851   MIEQNTDFRFNPSLQSACGKNIDRYCSNIVASALPNEELNGKVIHCLKDKFRQSALDEPC  910

Query  700   HRAIFNVEKQELLDSSSDYVLITTCRQMIRQFCH----EEDQSHALECLKR-YKDEMTFD  754
              + +  + +++ L+   + +L   C+  I++ C      ++     ECLK  +  +   +
Sbjct  911   AKEMIKILQEQALNYKLNPLLQVFCKSEIQELCKANVDSDEHGQLAECLKTAFLQKQIIN  970

Query  755   PKCKVMVVRRMIEQNQDYRFNPLLQKGCHLDIPKFCADVVATEPQDKELEGKVIKCLKV  813
              +C++ V   + E   D   +P+L+  C +D+ ++C+ V A         G+ + CL+ 
Sbjct  971   RQCQMEVATLIAEAKADIHVDPILETACTVDLLRYCSKVAAG-------NGRKLNCLRT  1022


 Score = 110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 179/801 (22%), Positives = 313/801 (39%), Gaps = 129/801 (16%)

Query  3     SISDQCQHKIWQHTIDLVDDNNLKKLLDHACSQDSVVKKC--GTSD-------SLLACLI  53
             S+S QC  +I      +  D  +   L  AC  D  +  C  G S+        +L CL 
Sbjct  253   SMSSQCSARITLRDQQIGRDYRVSHGLAKACKDDIKLYHCRRGVSEDKHVRLAQILLCLE  312

Query  54    DNRESITYV--PCKAFIQRLEWVVFSDFRTISTFVNECRTSINMF----HCGRLPSDEPV  107
                ++ T +  PC   +     ++ +D++     +N+C   I  F    H  +L +    
Sbjct  313   SVSKNGTKLAPPCLTELTDHRRMLMTDYQLSPELLNDCADDIPKFCPDEHKAQLVNGMTS  372

Query  108   SQGKTLACLQQHIDD------LDLKCQKQVFHLSEVQ--ADDIKLDRQLYLACQADHLRL  159
             + G+ + CL +H+        +  +CQ+ +  L +     +D ++D  L  AC+     +
Sbjct  373   TGGEIIHCLLEHVKARRPQRRVTAQCQRGLETLIKASDAGEDWRVDPVLRRACKPVVDVV  432

Query  160   CPDIPSNSENVYRCLMQHRLDRTMSAECHEQLQRRQKLIARDYKVSKGLARSCKEDIRLY  219
             C D+      V  CLM+H     M  +C + L   +  +ARD+K+   L + C++D   Y
Sbjct  433   CRDVQGGEARVMGCLMEHIGTPVMLPDCEQALLIIEYFVARDFKLDPQLYKHCRDDAVKY  492

Query  220   -HCRRSVSDDKEIRL-----AQILLCLEGVIRNGTK---VSQDCQLEM---VEHRKILME  267
                ++   D + I++       IL CL  +  +  +   + +DC  E+   +  R I M+
Sbjct  493   CRAKKQWDDAQNIQMDPERGPMILPCLHRMAFSEDEHQTLRKDCFQEVKRVMRQRAISMD  552

Query  268   DYRLSPEIVSQCSGDISKFCSGLEVGGKTIHCL---MDHVRPR------KRKERVSAQ--  316
                L PE+   C  D+S FC+     G  + CL   MD ++P       K  E  +A   
Sbjct  553   ---LIPEVEDYCLNDLSAFCADCTEKGSEMECLQKNMDQLQPECKTVVVKYTEEEAAHVE  609

Query  317   --------CQRALE----VLVK-----------------EADVGEDWRVDPVL-------  340
                     C  A++     ++K                 +AD+ +D R    +       
Sbjct  610   LNPVIMNVCGEAMQQHCSAILKSGKDNGDMMDCLIAHKNDADLRKDLRCRAAIEHFQIIS  669

Query  341   ----------REACKPVVQRSCRDVRGGDARVMTCLMEKLGTDYMTP-------DCEAAL  383
                       +EAC+P VQR C         V+ CL E +  D +         +C   +
Sbjct  670   LKSFHFTTKFKEACRPYVQRFCSS-SATKNEVVACLSEVMRNDTIKAQRHQIPKECRHQV  728

Query  384   IEIQYFVARDFKLDPQLYRKCHDDAVKLCHAKKAWTDDGQMDPERGPLVLPCLYRYAYHT  443
                 Y      +LDP+L   C  +  + C  +K     GQ++ +     L CL R  +  
Sbjct  729   KAQLYQQRESIQLDPKLANACKRELEQFCEEEKG---PGQVNEK----ALECLIRKTH--  779

Query  444   QDKMRLKSECLEEIRRVMRQRAVSVDLQPEVEEVCLENLATMCSDKTNKGEEMVCLQDNL  503
                  L   C   I  V +           +   C E +   C   T+  + + CL+   
Sbjct  780   ----SLGKPCHHAIFMVKKSELGDSGTDYTLLTTCKEMIYKFCPS-TDSSKLLDCLKTYK  834

Query  504   ESLTLE--CRQAVSNFTEEQAEHVELNPVLMSTCQGVMEKHC----ASVLQTGRDEGDIM  557
             +    +  C   V N   EQ      NP L S C   ++++C    AS L      G ++
Sbjct  835   DDTQFDQRCHLVVVNRMIEQNTDFRFNPSLQSACGKNIDRYCSNIVASALPNEELNGKVI  894

Query  558   ECLVEHKNEPDVRSSYKCRAAIEHFQLISLKNYHFTYKFKEACRPHVIRYCPGARTKLEV  617
              CL + K           +  I+  Q  +L NY      +  C+  +   C  A    + 
Sbjct  895   HCL-KDKFRQSALDEPCAKEMIKILQEQAL-NYKLNPLLQVFCKSEIQELC-KANVDSDE  951

Query  618   ITCLSEHVRNDTIHDAKHSIPRDCRQQLRAQLFQQRENINFDPGLKGACVKDIKKFCSGM  677
                L+E ++   +   K  I R C+ ++   + + + +I+ DP L+ AC  D+ ++CS +
Sbjct  952   HGQLAECLKTAFLQ--KQIINRQCQMEVATLIAEAKADIHVDPILETACTVDLLRYCSKV  1009

Query  678   VEGAGQILECLQINVKNLTPG  698
               G G+ L CL+  +K+ TP 
Sbjct  1010  AAGNGRKLNCLRTLLKD-TPN  1029


 Score = 38.1 bits (87),  Expect = 0.037, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 71/157 (45%), Gaps = 9/157 (6%)

Query  48    LLACLIDN-RESITYVPC-KAFIQRLEWVVFSDFRTISTFVNECRTSINMFHCGRLPSDE  105
             ++ CL D  R+S    PC K  I+ L+     +++        C++ I       + SDE
Sbjct  893   VIHCLKDKFRQSALDEPCAKEMIKILQEQAL-NYKLNPLLQVFCKSEIQELCKANVDSDE  951

Query  106   PVSQGKTL--ACLQQHIDDLDLKCQKQVFHLSEVQADDIKLDRQLYLACQADHLRLCPDI  163
                  + L  A LQ+ I  ++ +CQ +V  L      DI +D  L  AC  D LR C  +
Sbjct  952   HGQLAECLKTAFLQKQI--INRQCQMEVATLIAEAKADIHVDPILETACTVDLLRYCSKV  1009

Query  164   PSNSENVYRCLMQHRLD--RTMSAECHEQLQRRQKLI  198
              + +     CL     D   ++ A+C E+LQRR ++ 
Sbjct  1010  AAGNGRKLNCLRTLLKDTPNSLEADCREKLQRRIEMF  1046


>Q9U4Y0_DROME unnamed protein product
Length=420

 Score = 35.4 bits (80),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 43/104 (41%), Gaps = 3/104 (3%)

Query  7    QCQHKIWQHTIDLVDDNNLKKLLDHACSQDSVVKKCGTSDSLLACLIDNRESITYVPCKA  66
            Q Q      T D+VD  N+    D     D ++K+ G+S  +   LI   E IT  P   
Sbjct  23   QAQEGATAPTEDVVDPWNVASSNDAGVDYDKLIKRFGSS-KIDEELIARFEKITGKPAHH  81

Query  67   FIQRLEWVVFSDFRTISTFVNECRTSINMFHCGRLPSDEPVSQG  110
            FI+R  +    D  TI T   + +      + GR PS   +  G
Sbjct  82   FIRRGMFFSHRDLHTILTLREQGKPF--YLYTGRGPSSGSLHVG  123



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold1633-size589899-augustus-gene-2.3-mRNA-1

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

IF4A_DROME  unnamed protein product                                   595     0.0  
IF4A3_DROME  unnamed protein product                                  588     0.0  
Q8IKF0_PLAF7  unnamed protein product                                 546     0.0  


>IF4A_DROME unnamed protein product
Length=403

 Score = 595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/398 (76%), Positives = 345/398 (87%), Gaps = 14/398 (4%)

Query  58   VLTLSLFQVVDNFDDMHLKEELLRGIYAYGFEKPSAIQQRAIMPCVKGHDVIAQAQSDVA  117
            V+  +  +V DNFDDM+L+EELLRGIY YGFEKPSAIQQRAI+PCV+G DVIAQAQS   
Sbjct  20   VIESTWHEVYDNFDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQS---  76

Query  118  RLVMPRVLVVAGTGKTATFSISILQLIDTNIHDCQALILAPTRELAQQIQKVVIALGDFM  177
                       GTGKTATFSI+ILQ IDT+I +CQALILAPTRELA QIQ+VV+ALG++M
Sbjct  77   -----------GTGKTATFSIAILQQIDTSIRECQALILAPTRELATQIQRVVMALGEYM  125

Query  178  NAQCHACIGGTNVREDMRKLEMGVHVVVGTPGRVYDMINRRALRTDHIKMFVLDEADEML  237
                HACIGGTNVRED R LE G HVVVGTPGRVYDMINR+ LRT +IK+FVLDEADEML
Sbjct  126  KVHSHACIGGTNVREDARILESGCHVVVGTPGRVYDMINRKVLRTQYIKLFVLDEADEML  185

Query  238  SRGFKDQIHDVFRTLSLEVQVILLSATMPSDVLEVTSLFMRNPIRILVKKEELTLEGIKQ  297
            SRGFKDQI DVF+ L  +VQVILLSATMP DVLEV+  FMR+P+ ILVKKEELTLEGIKQ
Sbjct  186  SRGFKDQIQDVFKMLPPDVQVILLSATMPPDVLEVSRCFMRDPVSILVKKEELTLEGIKQ  245

Query  298  FFIFVEREDWKFDTLCDLYETLSITQAVIFCNTRRKVDWLTENMHSRDFTVSAMHGDMEQ  357
            F++ V++E+WK  TLCDLY+TLSITQ+VIFCNTRRKVD LT+ M   +FTVSAMHGDMEQ
Sbjct  246  FYVNVKQENWKLGTLCDLYDTLSITQSVIFCNTRRKVDQLTQEMSIHNFTVSAMHGDMEQ  305

Query  358  RERDVIMRQFRTGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGR  417
            R+R+VIM+QFR+GSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGR
Sbjct  306  RDREVIMKQFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGR  365

Query  418  KGVAINFVTEDDKRTLKDIEQFYNTHIDEMPLNVADLI  455
            KGVAINF+T+DD+R LKDIEQFY+T I+EMP N+ADLI
Sbjct  366  KGVAINFITDDDRRILKDIEQFYHTTIEEMPANIADLI  403


>IF4A3_DROME unnamed protein product
Length=399

 Score = 588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/391 (72%), Positives = 327/391 (84%), Gaps = 14/391 (4%)

Query  65   QVVDNFDDMHLKEELLRGIYAYGFEKPSAIQQRAIMPCVKGHDVIAQAQSDVARLVMPRV  124
            +V+  F+ M+LKEELLRGIYAYGFEKPSAIQQR+I P VKG DVIAQAQS          
Sbjct  23   EVIPTFNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQS----------  72

Query  125  LVVAGTGKTATFSISILQLIDTNIHDCQALILAPTRELAQQIQKVVIALGDFMNAQCHAC  184
                GTGKTATFSISILQ +DT + + Q L L+PTRELA QIQKV++ALGD MN QCH C
Sbjct  73   ----GTGKTATFSISILQSLDTTLRETQVLCLSPTRELAVQIQKVILALGDMMNVQCHVC  128

Query  185  IGGTNVREDMRKLEMGVHVVVGTPGRVYDMINRRALRTDHIKMFVLDEADEMLSRGFKDQ  244
            IGGTN+ ED+RKL+ G H+V GTPGRV+DMI RR LRT  IKM VLDEADEML++GFK+Q
Sbjct  129  IGGTNLGEDIRKLDYGQHIVSGTPGRVFDMIKRRVLRTRAIKMLVLDEADEMLNKGFKEQ  188

Query  245  IHDVFRTLSLEVQVILLSATMPSDVLEVTSLFMRNPIRILVKKEELTLEGIKQFFIFVER  304
            I+DV+R L    QV+L+SAT+P ++LE+TS FM +PIRILVK++ELTLEGIKQFF+ VER
Sbjct  189  IYDVYRYLPPATQVVLISATLPHEILEMTSKFMTDPIRILVKRDELTLEGIKQFFVAVER  248

Query  305  EDWKFDTLCDLYETLSITQAVIFCNTRRKVDWLTENMHSRDFTVSAMHGDMEQRERDVIM  364
            E+WKFDTLCDLY+TL+ITQAVIFCNT+RKVDWLTE M   +FTVS+MHGDM Q+ERD IM
Sbjct  249  EEWKFDTLCDLYDTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERDEIM  308

Query  365  RQFRTGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF  424
            ++FR G SRVLITTD+ ARGIDVQQVSLVINYDLP+NRE YIHRIGR GRFGRKGVAINF
Sbjct  309  KEFRAGQSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIGRSGRFGRKGVAINF  368

Query  425  VTEDDKRTLKDIEQFYNTHIDEMPLNVADLI  455
            V  DD R L+DIEQ+Y+T IDEMP+NVADLI
Sbjct  369  VKSDDIRILRDIEQYYSTQIDEMPMNVADLI  399


>Q8IKF0_PLAF7 unnamed protein product
Length=398

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/393 (67%), Positives = 324/393 (82%), Gaps = 16/393 (4%)

Query  65   QVVDNFDDMHLKEELLRGIYAYGFEKPSAIQQRAIMPCVKGHDVIAQAQSDVARLVMPRV  124
            ++VD FD + L E+LLRGIY+YGFEKPSAIQQR I P + G+D I QAQS          
Sbjct  20   EIVDTFDALGLNEKLLRGIYSYGFEKPSAIQQRGIKPILNGYDTIGQAQS----------  69

Query  125  LVVAGTGKTATFSISILQLIDTNIHDCQALILAPTRELAQQIQKVVIALGDFMNAQCHAC  184
                GTGKTATF IS LQLI+ +   CQALILAPTRELAQQIQKVV+ALGD++  +CHAC
Sbjct  70   ----GTGKTATFVISSLQLINYDYVACQALILAPTRELAQQIQKVVLALGDYLKVKCHAC  125

Query  185  IGGTNVREDMRKLEMGVHVVVGTPGRVYDMINRRALRTDHIKMFVLDEADEMLSRGFKDQ  244
            +GGT VRED+ KL+ GVH+VVGTPGRVYDMI++R L  D +K+F+LDEADEMLSRGFK Q
Sbjct  126  VGGTVVREDIDKLKQGVHMVVGTPGRVYDMIDKRHLGVDRLKLFILDEADEMLSRGFKAQ  185

Query  245  IHDVFRTLSLEVQVILLSATMPSDVLEVTSLFMRNPIRILVKKEELTLEGIKQFFIFVER  304
            I++VF+ L  ++QV L SATMP ++LE+T+ FMR+P  ILVKK+ELTLEGI+QF++ VE+
Sbjct  186  IYEVFKKLVPDIQVALFSATMPQEILELTTRFMRDPKTILVKKDELTLEGIRQFYVAVEK  245

Query  305  EDWKFDTLCDLYETLSITQAVIFCNTRRKVDWLTENMHSRDFTVSAMHGDMEQRERDVIM  364
            E+WK DTLCDLYETL+ITQ++I+CNTR+KVD LT+ MH+R FTVS MHGDM+Q++RD+IM
Sbjct  246  EEWKLDTLCDLYETLTITQSIIYCNTRKKVDILTQEMHNRLFTVSCMHGDMDQKDRDLIM  305

Query  365  RQFRTGSSRVLITTDLLARGIDVQQVSLVINYDLPSNRENYIHRIGRGGRFGRKGVAINF  424
            R+FR+GS+RVL+TTDLLARGIDVQQVSLVINYDLP++ + YIHRIGR GRFGRKGVAINF
Sbjct  306  REFRSGSTRVLVTTDLLARGIDVQQVSLVINYDLPASPDTYIHRIGRSGRFGRKGVAINF  365

Query  425  VTE--DDKRTLKDIEQFYNTHIDEMPLNVADLI  455
            VT    +K  LK IE +Y+T I+EMPL VAD +
Sbjct  366  VTNDDKEKDKLKKIESYYSTQIEEMPLEVADYL  398



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold438-size875215-augustus-gene-2.4-mRNA-1

Length=391
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMZ4_DROME  unnamed protein product                                 89.0    5e-19
Q8IH92_DROME  unnamed protein product                                 88.6    6e-19
Q9N6D8_DROME  unnamed protein product                                 87.8    6e-19


>Q8IMZ4_DROME unnamed protein product
Length=495

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 95/177 (54%), Gaps = 15/177 (8%)

Query  101  KTSCLFSSQLNKVFLPMNSS--LPVHFTCQWGAPDLYVRALPVFLEADELQFPVTRCSHH  158
            K+  ++S  LNK+++ MN +  + V F  +     L +R    F  ++++  PV RC +H
Sbjct  212  KSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCF--SNDVSAPVVRCQNH  269

Query  159  MRELDDTNIDFPFPPHVIRCESMDSCYVEDT----LSRRLSVLTPLGLPPP----GSKHV  210
            +     T  +      ++R E+ +S Y  +     +S R SV+ PL +       G    
Sbjct  270  LSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQ  329

Query  211  TMQYKFVCKTSCMGGMNRRPIQVIFTLERHTGEVVGRSAVKVRICSCPKRDMRKEEK  267
            T+ +KFVC+ SC+G   R+   ++F LE+  G++VG+  + V+IC+CPKRD  ++E+
Sbjct  330  TLAFKFVCQNSCIG---RKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDER  383


>Q8IH92_DROME unnamed protein product
Length=519

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 95/177 (54%), Gaps = 15/177 (8%)

Query  101  KTSCLFSSQLNKVFLPMNSS--LPVHFTCQWGAPDLYVRALPVFLEADELQFPVTRCSHH  158
            K+  ++S  LNK+++ MN +  + V F  +     L +R    F  ++++  PV RC +H
Sbjct  236  KSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCF--SNDVSAPVVRCQNH  293

Query  159  MRELDDTNIDFPFPPHVIRCESMDSCYVEDT----LSRRLSVLTPLGLPPP----GSKHV  210
            +     T  +      ++R E+ +S Y  +     +S R SV+ PL +       G    
Sbjct  294  LSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQ  353

Query  211  TMQYKFVCKTSCMGGMNRRPIQVIFTLERHTGEVVGRSAVKVRICSCPKRDMRKEEK  267
            T+ +KFVC+ SC+G   R+   ++F LE+  G++VG+  + V+IC+CPKRD  ++E+
Sbjct  354  TLAFKFVCQNSCIG---RKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDER  407


>Q9N6D8_DROME unnamed protein product
Length=385

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 95/177 (54%), Gaps = 15/177 (8%)

Query  101  KTSCLFSSQLNKVFLPMNSS--LPVHFTCQWGAPDLYVRALPVFLEADELQFPVTRCSHH  158
            K+  ++S  LNK+++ MN +  + V F  +     L +R    F  ++++  PV RC +H
Sbjct  102  KSLWMYSIPLNKLYIRMNKAFNVDVQFKSKMPIQPLNLRVFLCF--SNDVSAPVVRCQNH  159

Query  159  MRELDDTNIDFPFPPHVIRCESMDSCYVEDT----LSRRLSVLTPLGLPPP----GSKHV  210
            +     T  +      ++R E+ +S Y  +     +S R SV+ PL +       G    
Sbjct  160  LSVEPLTANNAKMRESLLRSENPNSVYCGNAQGKGISERFSVVVPLNMSRSVTRSGLTRQ  219

Query  211  TMQYKFVCKTSCMGGMNRRPIQVIFTLERHTGEVVGRSAVKVRICSCPKRDMRKEEK  267
            T+ +KFVC+ SC+G   R+   ++F LE+  G++VG+  + V+IC+CPKRD  ++E+
Sbjct  220  TLAFKFVCQNSCIG---RKETSLVFCLEKACGDIVGQHVIHVKICTCPKRDRIQDER  273



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold682-size719083-augustus-gene-3.2-mRNA-1

Length=929
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAND_DROME  unnamed protein product                                   1126    0.0  
CAN5_CAEEL  unnamed protein product                                   149     3e-37
CANA_DROME  unnamed protein product                                   140     6e-34


>CAND_DROME unnamed protein product
Length=1594

 Score = 1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/924 (64%), Positives = 665/924 (72%), Gaps = 146/924 (16%)

Query  114   WTCKKCTLVNTGCAMACEVCGGSKLRSITLVEDATLRKGEFWT--------------CSS  159
             WTCKKCTLVN   AMAC VCGGSKL+SI+ +ED TLRKGEFWT              CS+
Sbjct  708   WTCKKCTLVNYSTAMACVVCGGSKLKSISSIEDMTLRKGEFWTCSHCTLKNSLHSPVCSA  767

Query  160   C-----------------------------------------TLKNPLRTSTCLVCKTSK  178
             C                                         +  N ++  T L    + 
Sbjct  768   CKSHRQPQLSMAMEAVRERPDGQSYEEQDAAAVGGGGGSAHQSGANEVKAPTALNLPLTS  827

Query  179   VVLEVP-------RAAG--GSRSPSPRLGL-------------GAVPKQRH--------R  208
             V L +P        AAG  GSRSPSPR+ L             GA+PK RH        R
Sbjct  828   VALPMPMLQLPTSTAAGLRGSRSPSPRMQLLPSLQQQRNSSSSGAIPK-RHSTGGSIVPR  886

Query  209   KVSSRGQVRTPVLSEHAAPPPPVL--------------------WRCKLCTYENRTASAA  248
              +S  G     +          V+                    W+C  CTY+N  AS  
Sbjct  887   NISIAGLANYNLQQGQGVGSASVVSASGAGSGAGAVGASTSTKKWQCPACTYDNCAASVV  946

Query  249   CEMCHSSRCLSSSVALTNGTPSPGDVSSISAASVVRQESELMEHLRHVEEREALDKWERI  308
             C++C S R L+S+V L           +++ A + RQES+LME+LR +EE EAL KW+ I
Sbjct  947   CDICSSPRGLASAV-LGEALGRKSVRVALTPADI-RQESKLMENLRQLEETEALTKWQNI  1004

Query  309   VKFCKENKEPFVDDSFPPAPKSLYYNTAET--KDNHVVKWLRPHQIVTEGDVKLEWAVFR  366
             +++C++N E FVDDSFPPAPKSLYYN A    + N VV+W RPH+I  +G     WAVFR
Sbjct  1005  IQYCRDNSELFVDDSFPPAPKSLYYNPASGAGEGNPVVQWRRPHEINCDGGAYPPWAVFR  1064

Query  367   RPLPSDISQGVLGNCWLLSALAVLAEREDLVKKVMVMREFCPQGAYQVRLCKDGKWTTVL  426
              PLPSDI QGVLGNCWLLSALAVLAEREDLVK+V+V +E C QGAYQVRLCKDGKWTTVL
Sbjct  1065  TPLPSDICQGVLGNCWLLSALAVLAEREDLVKEVLVTKEICGQGAYQVRLCKDGKWTTVL  1124

Query  427   VDDLLPCDKRGHLVYSQVQSNVCACRRVHILMYFIRRCRHIFMPSVQAKKKQLWVPLIEK  486
             VDDLLPCDKRGHLVYSQ                              AK+KQLWVPLIEK
Sbjct  1125  VDDLLPCDKRGHLVYSQ------------------------------AKRKQLWVPLIEK  1154

Query  487   AVAKIHGCYEALVSGRAIEGLATLTGAPCESVPLQPSSLP--SEDELDRDLIWAQLLSSR  544
             AVAKIHGCYEALVSGRAIEGLATLTGAPCES+PLQ SSLP  SEDELD+DLIWAQLLSSR
Sbjct  1155  AVAKIHGCYEALVSGRAIEGLATLTGAPCESIPLQASSLPMPSEDELDKDLIWAQLLSSR  1214

Query  545   QARFLMGASCGGGNMKVDEDEYQRKGLRPRHAYSVLDVRDVQGNRLLRFRNPWGHYSWKG  604
               RFLMGASCGGGNMKVDE+EYQ+KGLRPRHAYSVLDV+D+QG+RLL+ RNPWGHYSW+G
Sbjct  1215  CVRFLMGASCGGGNMKVDEEEYQQKGLRPRHAYSVLDVKDIQGHRLLKLRNPWGHYSWRG  1274

Query  605   DWSDGSPIWTPQLREILMPKGASDGVFWISFEDVLKYFDCIDICKVRSGWSEVRLRGTLP  664
             DWSD S +WT  LR+ LMP GAS+GVFWISFEDVL YFDCIDICKVRSGW+EVRL+GTL 
Sbjct  1275  DWSDDSSLWTDDLRDALMPHGASEGVFWISFEDVLNYFDCIDICKVRSGWNEVRLQGTLQ  1334

Query  665   PLSSVDHLSCVLLTVLEPTEAEFTLFQEGQRNSEKSQRSQLDLCVVVFRTRSPAQPEVGR  724
             PL S+   SCVLLTVLEPTEAEFTLFQEGQRNSEKSQRSQLDLCVV+FRTRSPA PE+GR
Sbjct  1335  PLCSI---SCVLLTVLEPTEAEFTLFQEGQRNSEKSQRSQLDLCVVIFRTRSPAAPEIGR  1391

Query  725   LVEHSKRQVRGFVGCHKMLEGDLYILVCLAFNHWHTGMDDPASYPEYVLAIHSSKRLLVE  784
             LVEHSKRQVRGFVGCHKMLE D+Y+LVCLAFNHWHTG++DP  YP+ +LAIHSSKRLLVE
Sbjct  1392  LVEHSKRQVRGFVGCHKMLERDIYLLVCLAFNHWHTGIEDPHQYPQCILAIHSSKRLLVE  1451

Query  785   QVSPPAYVLADAIISLTLAKGQRHEGREGMTAYYLTKGWAGLVVMVENRHENKWIHVKCD  844
             Q+SP  ++LADAIISLTL KGQRHEGREGMTAYYLTKGWAGLVVMVENRHENKWIHVKCD
Sbjct  1452  QISPSPHLLADAIISLTLTKGQRHEGREGMTAYYLTKGWAGLVVMVENRHENKWIHVKCD  1511

Query  845   CQESYNVVSTRGELRTVDSVPPLHRQVIIVLTQLEGSGGFSIAHRLTHRLANSSGLHDWG  904
             CQESYNVVSTRGEL+TVDSVPPL RQVIIVLTQLEGSGGFSIAHRLTHRLANS GLHDWG
Sbjct  1512  CQESYNVVSTRGELKTVDSVPPLQRQVIIVLTQLEGSGGFSIAHRLTHRLANSRGLHDWG  1571

Query  905   PPGLSHYPHIDKQVEGLHSPRLIT  928
             PPG +H P I+  V GLH+PRLIT
Sbjct  1572  PPGATHCPPIEN-VHGLHAPRLIT  1594


 Score = 30.4 bits (67),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 38/114 (33%), Gaps = 37/114 (32%)

Query  151  KGEFWTCSSCTLKNPLRTSTCLVCKTSKVVLEVPRAAGGSRSPSPRLGLGAVPKQRHRKV  210
            + E WTC  CTL N      C+VC             GGS+  S    + ++     RK 
Sbjct  704  RDEPWTCKKCTLVNYSTAMACVVC-------------GGSKLKS----ISSIEDMTLRKG  746

Query  211  SSRGQVRTPVLSEHAAPPPPVLWRCKLCTYENRTASAACEMCHSSRCLSSSVAL  264
                                  W C  CT +N   S  C  C S R    S+A+
Sbjct  747  E--------------------FWTCSHCTLKNSLHSPVCSACKSHRQPQLSMAM  780


>CAN5_CAEEL unnamed protein product
Length=648

 Score = 149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 110/395 (28%), Positives = 179/395 (45%), Gaps = 82/395 (21%)

Query  291  EHLRHVEEREALDKWERIVKFCKENKEPFVDDSFPPAPKSLYYNTAETKDNHVVKWLRPH  350
            E  RH   +     +E++ K C + K+PFVD  FPP  +SL+    ++ D   + W RP 
Sbjct  5    EKTRHFGNQ----NYEKLRKICIKKKQPFVDTLFPPTNQSLFLEQRQSSD---IVWKRPG  57

Query  351  QIVTEGDVKLEWAVFRRPLPSDISQGVLGNCWLLSALAVLAEREDLVKKVMV-------M  403
            ++  +  + +E A      P+D++QG+LGNCW +SA + L     L+ +V+         
Sbjct  58   ELHPDPHLFVEGAS-----PNDVTQGILGNCWFVSACSALTHNFKLLAQVIPDADDQEWS  112

Query  404  REFCPQGAYQVRLCKDGKWTTVLVDDLLPCDKRGHLVYSQVQSNVCACRRVHILMYFIRR  463
             +    G ++ R  + GKW  V++DDLLP  + G L++++ ++                 
Sbjct  113  TKHAYAGIFRFRFWRFGKWVEVVIDDLLPT-RDGKLLFARSKT-----------------  154

Query  464  CRHIFMPSVQAKKKQLWVPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESVPLQPS  523
                          + W  L+EKA AK++GCYE LV G   + L  ++G   E+  L   
Sbjct  155  ------------PNEFWSALLEKAFAKLYGCYENLVGGHLSDALQDVSGGVAET--LHVR  200

Query  524  SLPSEDELDRDLIWAQLLSSRQARFLMGA---SCGGGNMKVDEDEYQRKGLRPRHAYSV-  579
                +D  D +L   +L +  +  F  GA   +      K + +E    GL   HAY+V 
Sbjct  201  KFLKDDPNDTEL---KLFNDLKTAFDKGALVVAAIAARTKEEIEESLDCGLVKGHAYAVS  257

Query  580  ----LDVRD---------VQGNR----LLRFRNPWGHYSWKGDWSDGSPIWTPQLREILM  622
                +DV +         + G++    L+R +NPWG   W G WSD SP W       L 
Sbjct  258  AVCTIDVTNPNERSFTSFIMGSKRKQNLIRLQNPWGEKEWNGAWSDDSPEWQNVSASQLS  317

Query  623  PKG-------ASDGVFWISFEDVLKYFDCIDICKV  650
              G       + DG FW+ +E  + YF  I +C++
Sbjct  318  TMGVQPANSDSDDGDFWMPWESFVHYFTDISLCQL  352


>CANA_DROME unnamed protein product
Length=828

 Score = 140 bits (354),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 112/362 (31%), Positives = 165/362 (46%), Gaps = 66/362 (18%)

Query  305  WERIVKFCKENKEPFVDDSFPPAPKSLYYNTAETKDNHVVKWLRPHQIVTEGDVKLE-WA  363
            +E I+  C  +   F D  FP + +SL +  +   D H+ +WLRPH+I       +E ++
Sbjct  75   YETILNSCLASGSLFEDPLFPASNESLQF--SRRPDRHI-EWLRPHEIAENPQFFVEGYS  131

Query  364  VFRRPLPSDISQGVLGNCWLLSALAVLAEREDLVKKVMVMREFCPQ---GAYQVRLCKDG  420
             F      D+ QG LG+CWLL+A A L +  +L  +V+   +   +   G +  R  + G
Sbjct  132  RF------DVQQGELGDCWLLAATANLTQESNLFFRVIPAEQSFEENYAGIFHFRFWQYG  185

Query  421  KWTTVLVDDLLPCDKRGHLVYSQVQSNVCACRRVHILMYFIRRCRHIFMPSVQAKKKQLW  480
            KW  V++DD LP    G L+Y                                 +K + W
Sbjct  186  KWVDVIIDDRLPT-YNGELMYMH-----------------------------STEKNEFW  215

Query  481  VPLIEKAVAKIHGCYEALVSGRAIEGLATLTGAPCESVPLQPSSLPSEDELDRDLIWAQL  540
              L+EKA AK+HG YEAL  G   E +   TG   E   L+ +  P         ++  L
Sbjct  216  SALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSEWYDLKEA--PGN-------LFTIL  266

Query  541  LSSRQARFLMGASCGGGNMKVDEDEYQRKGLRPRHAYSVLDV---RDVQGNR-----LLR  592
              + +   +MG S    +  V E E   +GL   HAYS+  V     V  NR     ++R
Sbjct  267  QKAAERNSMMGCSI-EPDPNVTEAE-TPQGLIRGHAYSITKVCLIDIVTPNRQGKIPMIR  324

Query  593  FRNPWGHYS-WKGDWSDGSPIWTPQLREILMPKGAS---DGVFWISFEDVLKYFDCIDIC  648
             RNPWG+ + W G WSD SP W     E     G +   DG FW+SF+D L +FD ++IC
Sbjct  325  MRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEIC  384

Query  649  KV  650
             +
Sbjct  385  NL  386



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold160-size1280976-augustus-gene-1.1-mRNA-1

Length=165
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 143     1e-40
Q9VIB5_DROME  unnamed protein product                                 140     1e-39
Q961N0_DROME  unnamed protein product                                 134     3e-37


>Q24201_DROME unnamed protein product
Length=556

 Score = 143 bits (361),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 101/164 (62%), Gaps = 8/164 (5%)

Query  5    QAPWPPEQWYGVRDASKFGSPCYQID-DYDVLMGDEDCLFLNVFTPKLPSRHAVSLPVMV  63
            +AP  P  W GVRD S+      Q+   +D + G EDCL+LNV+T  +    A   PVMV
Sbjct  58   KAPQRPIPWEGVRDCSQPKDKAVQVQFVFDKVEGSEDCLYLNVYTNNVKPDKA--RPVMV  115

Query  64   WFHRGAFVHGSGDIY---PGHMMDRKVVIVSLNYRLNVFGFLSVKGTD--VAGNAGLKDQ  118
            W H G F+ G  +     P + M   VV+V++ YRL   GF+S+K  +  V GNAGLKDQ
Sbjct  116  WIHGGGFIIGEANREWYGPDYFMKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQ  175

Query  119  VAALHWVRRNIAHFGGNPNCVTIFGSSAGGASVQYHMMSPLSEG  162
            V AL W++ N A FGG+PNC+T+FG SAGGAS  Y M++  ++G
Sbjct  176  VLALKWIKNNCASFGGDPNCITVFGESAGGASTHYMMLTDQTQG  219


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 140 bits (354),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 100/164 (61%), Gaps = 8/164 (5%)

Query  5    QAPWPPEQWYGVRDASKFGSPCYQID-DYDVLMGDEDCLFLNVFTPKLPSRHAVSLPVMV  63
            +AP  P  W  VRD S+      Q+   +D + G EDCL+LNV+T  +    A   PVMV
Sbjct  74   KAPQRPIPWERVRDCSQPKDKAVQVQFVFDKVEGSEDCLYLNVYTNNVKPDKA--RPVMV  131

Query  64   WFHRGAFVHGSGDIY---PGHMMDRKVVIVSLNYRLNVFGFLSVKGTD--VAGNAGLKDQ  118
            W H G F+ G  +     P + M   VV+V++ YRL   GF+S+K  +  V GNAGLKDQ
Sbjct  132  WIHGGGFIIGEANREWYGPDYFMKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQ  191

Query  119  VAALHWVRRNIAHFGGNPNCVTIFGSSAGGASVQYHMMSPLSEG  162
            V AL W++ N A FGG+PNC+T+FG SAGGAS  Y M++  ++G
Sbjct  192  VLALKWIKNNCASFGGDPNCITVFGESAGGASTHYMMLTDQTQG  235


>Q961N0_DROME unnamed protein product
Length=566

 Score = 134 bits (337),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 99/164 (60%), Gaps = 8/164 (5%)

Query  5    QAPWPPEQWYGVRDASKFGSPCYQIDDY-DVLMGDEDCLFLNVFTPKLPSRHAVSLPVMV  63
            +AP PPE W GV + +   S   Q +    ++ G EDCL LNV+   L S     LPV+V
Sbjct  75   RAPQPPEPWQGVLNCTTNRSKPMQRNMLLGIVEGSEDCLHLNVYVKALKSEKP--LPVIV  132

Query  64   WFHRGAFVHG--SGDIY-PGHMMDRKVVIVSLNYRLNVFGFLSVK--GTDVAGNAGLKDQ  118
            W + G F  G  S DIY P + M + VV V++NYRL   GFLS+K    DV GNAGLKDQ
Sbjct  133  WIYGGGFQKGEASRDIYSPDYFMKKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQ  192

Query  119  VAALHWVRRNIAHFGGNPNCVTIFGSSAGGASVQYHMMSPLSEG  162
            V AL W+ +NIAHF G+PN +T+ G SAG ASV   M +  + G
Sbjct  193  VMALRWISQNIAHFNGDPNNITLMGESAGSASVHVMMTTEQTRG  236



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold6645-size116099-augustus-gene-0.5-mRNA-1

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YELL_DROME  unnamed protein product                                   241     7e-73
MRJP1_APIME  unnamed protein product                                  202     3e-59
YELF2_DROME  unnamed protein product                                  161     7e-44


>YELL_DROME unnamed protein product
Length=541

 Score = 241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 142/420 (34%), Positives = 226/420 (54%), Gaps = 24/420 (6%)

Query  98   GELTVVATVLLHCGVVANQLNVKYEWKTPEFTFPSEEVKQAMISNGSYIPGNPFMLDVDV  157
            G + V    L+     A +L  +Y W   +F FP+  +K   +++G YIP N   + V+ 
Sbjct  6    GWILVTLITLVTPSWAAYKLQERYSWSQLDFAFPNTRLKDQALASGDYIPQNALPVGVEH  65

Query  158  WNNGSEQKVFVTTPRFKPGTPGTLYVLSKTQGNDTDPASPLLEPYPNWEWNRQGNC-DSL  216
            + N    ++FVT PR++ G P TL  ++  +   +   SP L PYP+W  N  G+C +S+
Sbjct  66   FGN----RLFVTVPRWRDGIPATLTYINMDR---SLTGSPELIPYPDWRSNTAGDCANSI  118

Query  217  TSVFRTQLDSFGRLWVIDSGVVDVTTNLTSICPPQIVVFDALTNKLVSRYRIPQQDLSTN  276
            T+ +R ++D  GRLWV+D+G V +    T+ CP  + VFD  T+  + RY +P  D + N
Sbjct  119  TTAYRIKVDECGRLWVLDTGTVGIGNTTTNPCPYAVNVFDLTTDTRIRRYELPGVDTNPN  178

Query  277  SLLNTIAADVRDHSDGK-CNDSFAYVTDVQAHALIVYDANRVKSWRV-ASSYFGPYPTAT  334
            + +  IA D+     GK C+D++AY  D   + LI Y     KSWR  A SYF P P   
Sbjct  179  TFIANIAVDI-----GKNCDDAYAYFADELGYGLIAYSWELNKSWRFSAHSYFFPDPLRG  233

Query  335  SFSIAGESFNL-TDGVLGLALGPLIDDD-RTLYFNSLASYKETWVRASVLRNESLFSKDS  392
             F++AG +F    +G+ G++L P+  D  RTLYF+ LAS+++  V   +LR+E   ++  
Sbjct  234  DFNVAGINFQWGEEGIFGMSLSPIRSDGYRTLYFSPLASHRQFAVSTRILRDE---TRTE  290

Query  393  DAKASLFTESEGDRPSQTAATAMNKNSVLFFNLLSNTTLNCWNSRLPYTSQNLVELVKDE  452
            D+        E    S T +  M+ + +  FNL+    + CW+S +PY+ Q    + +D+
Sbjct  291  DSYHDFVALDERGPNSHTTSRVMSDDGIELFNLIDQNAVGCWHSSMPYSPQFHGIVDRDD  350

Query  453  EALQFVSGMKVVQNKLGKETVWGLSCRFQKVLTGSFNTSEVNFRVVTASVADLVKGTSCD  512
              L F + +K+ +NK     VW LS R    L    + S+ NFR+ TA +A L++ T CD
Sbjct  351  VGLVFPADVKIDENK----NVWVLSDRMPVFLLSDLDYSDTNFRIYTAPLATLIENTVCD  406


>MRJP1_APIME unnamed protein product
Length=432

 Score = 202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/414 (30%), Positives = 216/414 (52%), Gaps = 43/414 (10%)

Query  117  LNVKYEWKTPEFTFPSEEVKQAMISNGSYIPGNPFMLDVDVWNNGSEQKVFVTTPRFKPG  176
            L + +EWK  ++ F S+E +Q  I +G Y   N +  D+D W++    K+FVT  R+  G
Sbjct  31   LPILHEWKFFDYDFGSDERRQDAILSGEYDYKNNYPSDIDQWHD----KIFVTMLRYN-G  85

Query  177  TPGTLYVLSKTQGNDTDPASPLLEPYPNWEWNRQGNCDSLTSVFRTQLDSFGRLWVIDSG  236
             P +L V+SK  G+      PLL+PYP+W + +  +C  + S  +  +D   RLWV+DSG
Sbjct  86   VPSSLNVISKKVGD----GGPLLQPYPDWSFAKYDDCSGIVSASKLAIDKCDRLWVLDSG  141

Query  237  VVDVTTNLTSICPPQIVVFDALTNKLVSRYRIPQQDLSTNSL-----LNTIAADVRDHSD  291
            +V+   N   +C P+++ FD  T++L+ +  IP  D++ N+      L+++A    D   
Sbjct  142  LVN---NTQPMCSPKLLTFDLTTSQLLKQVEIP-HDVAVNATTGKGRLSSLAVQSLD---  194

Query  292  GKCN---DSFAYVTDVQAHALIVYDANRVKSWRVASSYFGPYPTATSFSIAGESFNLTDG  348
              CN   D+  Y+ D +   LIVY  +     R+ S+ F   P  T  +I GES+   DG
Sbjct  195  --CNTNSDTMVYIADEKGEGLIVYHNSDDSFHRLTSNTFDYDPKFTKMTIDGESYTAQDG  252

Query  349  VLGLALGPLIDDDRTLYFNSLASYKETWVRASVLRNESLFSKDSDAKASLFTESEGDRPS  408
            + G+AL P+ ++   LY++ +AS    +V     R     + D       +   +    +
Sbjct  253  ISGMALSPMTNN---LYYSPVASTSLYYVNTEQFR-----TSDYQQNDIHYEGVQNILDT  304

Query  409  QTAATAMNKNSVLFFNLLSNTTLNCWNSRLPYTSQNLVELVKDEEALQFVSGMKVVQ---  465
            Q++A  ++K+ VLFF L+ ++ L CWN        N+  + + +E LQ ++ MK+ +   
Sbjct  305  QSSAKVVSKSGVLFFGLVGDSALGCWNEHRTLERHNIRTVAQSDETLQMIASMKIKEALP  364

Query  466  ------NKLGKETVWGLSCRFQKVLTGSFNTSEVNFRVVTASVADLVKGTSCDS  513
                    + +E +  LS + QK++   FN  +VNFR++ A+V +L+  T C++
Sbjct  365  HVPIFDRYINREYILVLSNKMQKMVNNDFNFDDVNFRIMNANVNELILNTRCEN  418


>YELF2_DROME unnamed protein product
Length=452

 Score = 161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 106/373 (28%), Positives = 177/373 (47%), Gaps = 15/373 (4%)

Query  142  NGSYIPGNPFMLDVDVWNNGSEQKVFVTTPRFKPGTPGTLYVLSKTQGNDTDPASPLLEP  201
            N SYIP N    +V +       ++FVT PR + G P TL  +   +  D    SP L  
Sbjct  93   NASYIPYN----NVPMGATHFRGRLFVTMPRRRVGIPSTLNYIDLAE--DGSNRSPKLRA  146

Query  202  YPNWEWNR-QGNCDSLTSVFRTQLDSFGRLWVIDSGVVDVTTNLTSICPPQIVVFDALTN  260
            YPN+  N+   + ++L SV+RT +D+  RLW ID+G+++   N   I  P I V D  T+
Sbjct  147  YPNFALNQFNASAENLVSVYRTSVDACQRLWFIDTGMLEYPNNRQQIRRPSIWVVDLATD  206

Query  261  KLVSRYRIPQQDLSTNSLLNTIAADVRDHSDGKCNDSFAYVTDVQAHALIVYDANRVKSW  320
            +++ R+ +P+    T   L +I  DV+    G+C D++AY+ D+    L VY     + W
Sbjct  207  QVLKRFDVPESIAETGRGLASITVDVK---AGQCGDAYAYIPDLVYRRLYVYHLRNDRIW  263

Query  321  RVASSYFGPYPTATSFSIAGESFNLTDGVLGLALGPL-IDDDRTLYFNSLASYKETWVRA  379
                +YF   P +   SI G++F   DG+  + LG   +D  R  YF+ +AS  E  V  
Sbjct  264  SFEHNYFNFDPLSGDLSIGGQTFRWDDGIFSITLGAQKLDGSRDAYFHPMASTNEFVVSN  323

Query  380  SVLRNESLFSKDSDAKASLFTESEGDRPSQTAATAMNKNSVLFFNLLSNTTLNCWNSRLP  439
             VL+ ES  ++           S G     T         V+FF+ +    + CW +  P
Sbjct  324  RVLQQESNAARSDHGNDFRVLGSRGPSTQSTMHAYDPGTGVIFFDEIQRNGVGCWKTSKP  383

Query  440  YTSQNLVELVKDEEALQFVSGMKVVQNKLGKETVWGLSCRFQKVLTGSFNTSEVNFRVVT  499
             +++N   +  + E + + S + + ++     T+W +S      +  + +TS  NFR+  
Sbjct  384  ISAENYGSVDSNAEDMIYPSDLSIDEDG----TIWVMSNSMPIFIYSTLDTSIYNFRIWK  439

Query  500  ASVADLVKGTSCD  512
               +   +GT C+
Sbjct  440  QKASLAKRGTVCE  452



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold742-size696548-augustus-gene-3.7-mRNA-1

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NEDD4_DROME  unnamed protein product                                  381     5e-120
SUDX_DROME  unnamed protein product                                   318     1e-96 
K7WBL1_9CRUS  unnamed protein product                                 314     4e-96 


>NEDD4_DROME unnamed protein product
Length=1007

 Score = 381 bits (978),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 185/365 (51%), Positives = 247/365 (68%), Gaps = 6/365 (2%)

Query  174  SPGLSRANARAPA-PYRRDFEAKLRNFYRKLESKGYGQGPSKLKLHIRREHLLEDAFNKI  232
             P LS  N    A PY RD++ K   F  K   +     P+K ++ IRR  +LED++  I
Sbjct  610  DPRLSNPNIAGQAVPYSRDYKQKYEYF--KSHIRKPTNVPNKFEIRIRRTSILEDSYRII  667

Query  233  MAASKKDLQKSKLYVTFDREEGLDYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTVQV  292
             + +K DL K+KL+V F+ E GLDYGG +RE+F+LLS+E+FNPYYGLFEYSA D YT+Q+
Sbjct  668  SSVTKTDLLKTKLWVEFEGETGLDYGGLAREWFYLLSKEMFNPYYGLFEYSAMDNYTLQI  727

Query  293  SPMSAFVDNHH-EWFRFSGRVLGLALVHQYLLDAFFTRPFYKALLRLPVSLSDLESLDAE  351
            +  S   +  H  +F+F GR+ G+A+ H  LLDAFF RPFYK +L+ P+ L D+ES+D E
Sbjct  728  NNGSGLCNEEHLSYFKFIGRIAGMAVYHGKLLDAFFIRPFYKMMLQKPIDLKDMESVDTE  787

Query  352  FHQSLLWIKENDITGDLLDLTFAVTEEVFGQVVERELKPGGRNINVTEKNKKEYLERVVR  411
            ++ SL+WIKEND    +L+LTF + E+VFGQ  + ELKPGG NI+VT +NK EY++ V+ 
Sbjct  788  YYNSLMWIKENDPR--ILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKLVIE  845

Query  412  WRLERGVAEQTESLVRGFYEVVDPRLVSVFDARELELVIAGTAEIDLADWRKNTEYRSGY  471
            WR    V EQ  S + GF  ++   L+ +FD  ELEL++ G   ID+ DWR+NT Y+  Y
Sbjct  846  WRFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDWRENTLYKGDY  905

Query  472  HDNHPVIQWFWTAIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRKFCVEKWGKP  531
            H NH +IQWFW A+  FSNE R RLLQFVTGTS +P  GF  L GS GP+ F +EKWG P
Sbjct  906  HMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKWGTP  965

Query  532  NSLPR  536
            N+ PR
Sbjct  966  NNFPR  970


 Score = 137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/222 (38%), Positives = 115/222 (52%), Gaps = 31/222 (14%)

Query  434   DPRLV--------SVFDARELELVIAGTAEIDLADWRKNTEYRSGYHDNHPVIQWFWTAI  485
             DPR++         VF  +    +  G A ID+ +  K+   +        VI+W     
Sbjct  799   DPRILELTFCLDEDVFGQKSQHELKPGGANIDVTNENKDEYIKL-------VIEW-----  846

Query  486   ERFSNEQRLRLLQFVTGTSSIP-------YEGFSALRGSTGPRKFCVEKWGKPNSLPRTL  538
              RF    + ++  F+ G  SI        ++         G +   V+ W + N+L +  
Sbjct  847   -RFVARVKEQMSSFLDGFGSIIPLNLIKIFDEHELELLMCGIQNIDVKDW-RENTLYKG-  903

Query  539   PGYHDNHPVIQWFWTAIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRKFCVEKW  598
               YH NH +IQWFW A+  FSNE R RLLQFVTGTS +P  GF  L GS GP+ F +EKW
Sbjct  904   -DYHMNHIIIQWFWRAVLSFSNEMRSRLLQFVTGTSRVPMNGFKELYGSNGPQMFTIEKW  962

Query  599   GKPNSLPRAHTCFNRLDLPPYPTPEILYEKLLLAVEETNTFG  640
             G PN+ PRAHTCFNRLDLPPY     L +KL+ A+E +  F 
Sbjct  963   GTPNNFPRAHTCFNRLDLPPYEGYLQLKDKLIKAIEGSQGFA  1004


>SUDX_DROME unnamed protein product
Length=949

 Score = 318 bits (814),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 155/365 (42%), Positives = 232/365 (64%), Gaps = 5/365 (1%)

Query  173  ASPGLSRANARAPAPYRRDFEAKLRNFYRKLESKGYGQGPSKLKLHIRREHLLEDAFNKI  232
             +P  ++     P  Y R F  KL  F    +S      PS +K+ + R+ L ED++++I
Sbjct  555  GAPKGAKGVYGVPRAYERSFRWKLSQFRYLCQSNAL---PSHIKITVTRQTLFEDSYHQI  611

Query  233  MAASKKDLQKSKLYVTFDREEGLDYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTVQV  292
            M     +L++ +LY+ F  EEGLDYGG SRE+FFLLS E+ NP Y LFEY+  + Y++Q+
Sbjct  612  MRLPAYELRR-RLYIIFRGEEGLDYGGVSREWFFLLSHEVLNPMYCLFEYANKNNYSLQI  670

Query  293  SPMSAFVDNHHEWFRFSGRVLGLALVHQYLLDAFFTRPFYKALLRLPVSLSDLESLDAEF  352
            +P S    +H ++F+F GR + +AL H   + + FT PFYK +L   +++ D+E++D EF
Sbjct  671  NPASYVNPDHLQYFKFIGRFIAMALYHGRFIYSGFTMPFYKRMLNKKLTIKDIETIDPEF  730

Query  353  HQSLLWIKENDITGDLLDLTFAVTEEVFGQVVERELKPGGRNINVTEKNKKEYLERVVRW  412
            + SL+W+K+N+I    L+L F+V  EV GQ++  ELK  G    VTE+NK+EY+  +  W
Sbjct  731  YNSLIWVKDNNIDECGLELWFSVDFEVLGQIIHHELKENGEKERVTEENKEEYITLMTEW  790

Query  413  RLERGVAEQTESLVRGFYEVVDPRLVSVFDARELELVIAGTAEIDLADWRKNTEYRSGYH  472
            R+ RG+ +QT++ + GF EVV    +  FD RELEL++ G  ++D+ DW++NT YR  Y+
Sbjct  791  RMTRGIEQQTKTFLEGFNEVVPLEWLKYFDERELELILCGMQDVDVEDWQRNTIYRH-YN  849

Query  473  DNHPVIQWFWTAIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRKFCVEKWGKPN  532
             N   + WFW  +    NE+R RLLQFVTGT  +P  GF+ L GS GP++FC+EK GK  
Sbjct  850  RNSKQVVWFWQFVRETDNEKRARLLQFVTGTCRVPVGGFAELMGSNGPQRFCIEKVGKET  909

Query  533  SLPRT  537
             LPR+
Sbjct  910  WLPRS  914


>K7WBL1_9CRUS unnamed protein product
Length=856

 Score = 314 bits (805),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/394 (42%), Positives = 238/394 (60%), Gaps = 14/394 (4%)

Query  171  PQASPGLSRANARAPAPYRRDFEAKLRNFYRKLESKGYGQGPSKLKLHIRREHLLEDAFN  230
            P A+ GL  A    P  Y R F  KL  F     S      PS +KL + R+ L ED+F+
Sbjct  461  PNAARGLKGAYG-VPQAYERSFRWKLSQFRYLCTSNAL---PSHIKLTVSRQTLFEDSFH  516

Query  231  KIMAASKKDLQKSKLYVTFDREEGLDYGGPSREFFFLLSRELFNPYYGLFEYSANDTYTV  290
            +IM     +L++ +LY+ F  EEGLDYGG +RE+F LLS E+ NP Y LFEY+    Y++
Sbjct  517  QIMRLPAYELRR-RLYIIFRGEEGLDYGGVAREWFLLLSHEVLNPMYCLFEYANKSNYSL  575

Query  291  QVSPMSAFVDNHHEWFRFSGRVLGLALVHQYLLDAFFTRPFYKALLRLPVSLSDLESLDA  350
            Q++P S    +H  +F+F GR + +AL H   + + FT PFYK +L   +++ D+ES+D 
Sbjct  576  QINPASHVNPDHLHYFKFIGRFIAMALYHGKFIYSGFTLPFYKRMLNKKLNVKDVESIDP  635

Query  351  EFHQSLLWIKENDITGDLLDLTFAVTEEVFGQVVERELKPGGRNINVTEKNKKEYLERVV  410
            EFH S++WI+EN+I    L+L F+   EV GQV +  +K  G  I VTE+NK+EY+  + 
Sbjct  636  EFHNSIVWIRENNIEEVGLELYFSADFEVLGQVSQHNIKEDGDQIRVTEENKEEYVMLLT  695

Query  411  RWRLERGVAEQTESLVRGFYEVVDPRLVSVFDARELELVIAGTAEIDLADWRKNTEYRSG  470
             WR+ RG+ +QT +L+ GF EVV    +  FD RELEL++ G  EID+ DW+K+T YR  
Sbjct  696  EWRMTRGIEDQTRALLDGFSEVVPLEWLKYFDERELELMLVGMQEIDVEDWQKHTVYRH-  754

Query  471  YHDNHPVIQWFWTAIERFSNEQRLRLLQFVTGTSSIPYEGFSALRGSTGPRKFCVEKWGK  530
            Y  N   +QWFW  ++   NE+R RLLQFV GT  +P  GF+ L GS GP++FC+E+ GK
Sbjct  755  YTRNSKQVQWFWQFMKAMDNEKRARLLQFVCGTCRVPVGGFAELMGSNGPQRFCIERVGK  814

Query  531  PNSLPRT--------LPGYHDNHPVIQWFWTAIE  556
               LP++        LP Y     +++    AIE
Sbjct  815  ETWLPKSHTCFNRLDLPPYRSYEQLVEKLTYAIE  848



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold3513-size258726-augustus-gene-0.4-mRNA-1

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CPSF3_DROME  unnamed protein product                                  916     0.0   
Q581U7_TRYB2  unnamed protein product                                 558     0.0   
INT11_DROME  unnamed protein product                                  338     2e-109


>CPSF3_DROME unnamed protein product
Length=684

 Score = 916 bits (2367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/505 (84%), Positives = 469/505 (93%), Gaps = 0/505 (0%)

Query  19   TKRKSDSQVPAEESDQLLIRPLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALPF  78
            T+   D+++P EESD L I+PLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALP+
Sbjct  2    TQATGDARMPDEESDLLQIKPLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALPY  61

Query  79   VDLVEADEIDLLLISHFHLDHCGALPWFLQRTSFKGRCFMTHATKAIYRWLLSDYIKVSN  138
            VDL+EADEIDLL ISHFHLDHCGALPWFL +TSFKGRCFMTHATKAIYRW+LSDYIK+SN
Sbjct  62   VDLIEADEIDLLFISHFHLDHCGALPWFLMKTSFKGRCFMTHATKAIYRWMLSDYIKISN  121

Query  139  ISTEQMLYTEADLETSMDKIETINFHEEKDVCGIKFWAYNAGHVLGAAMFMIEIAGVKIL  198
            ISTEQMLYTEADLE SM+KIETINFHEE+DV G++F AY AGHVLGAAMFMIEIAG+KIL
Sbjct  122  ISTEQMLYTEADLEASMEKIETINFHEERDVMGVRFCAYIAGHVLGAAMFMIEIAGIKIL  181

Query  199  YTGDFSRQEDRHLMAAEIPNVHPDVLITESTYGTHIHEKREEREARFTTLVHDIVNRGGR  258
            YTGDFSRQEDRHLMAAE+P + PDVLITESTYGTHIHEKRE+RE RFT+LV  IV +GGR
Sbjct  182  YTGDFSRQEDRHLMAAEVPPMKPDVLITESTYGTHIHEKREDRENRFTSLVQKIVQQGGR  241

Query  259  CLIPVFALGRAQELLLILDEYWSLHPELYDIPIYYASSLAKKCMAVYQTYVNAMNDKIRR  318
            CLIPVFALGRAQELLLILDE+WS +P+L++IPIYYASSLAKKCMAVYQTY+NAMND+IRR
Sbjct  242  CLIPVFALGRAQELLLILDEFWSQNPDLHEIPIYYASSLAKKCMAVYQTYINAMNDRIRR  301

Query  319  QIAINNPFVFKHISNLKGIDHFDDIGPCVVMASPGMMQSGLSRELFESWCTDAKNGVIIA  378
            QIA+NNPFVF+HISNLKGIDHF+DIGPCV+MASPGMMQSGLSRELFESWCTD KNGVIIA
Sbjct  302  QIAVNNPFVFRHISNLKGIDHFEDIGPCVIMASPGMMQSGLSRELFESWCTDPKNGVIIA  361

Query  379  GYCVEGTLAKTILSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFVRCLKPPHVV  438
            GYCVEGTLAK +LSEPEEITT+SGQKLPL MSVDYISFSAHTDYQQTSEF+R LKP HVV
Sbjct  362  GYCVEGTLAKAVLSEPEEITTLSGQKLPLNMSVDYISFSAHTDYQQTSEFIRLLKPTHVV  421

Query  439  LVHGEQNEMSRLKAALQREYEDDPNTKMEIHNPRNTAAVELYFRGEKTAKVMGSLAVEKP  498
            LVHGEQNEMSRLK ALQREYE D +T ++ +NPRNT AV+LYFRGEKTAKVMGSLA +  
Sbjct  422  LVHGEQNEMSRLKLALQREYEADASTDIKFYNPRNTHAVDLYFRGEKTAKVMGSLAAKNS  481

Query  499  KPGHKLSGVLVKRNFNYHMLAPSDL  523
            + G KLSGVLVKR+F YH+LAPSDL
Sbjct  482  EVGSKLSGVLVKRDFKYHLLAPSDL  506


>Q581U7_TRYB2 unnamed protein product
Length=770

 Score = 558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/496 (54%), Positives = 376/496 (76%), Gaps = 9/496 (2%)

Query  32   SDQLLIRPLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALPFVDLVEADEIDLLL  91
            +D++ I P+G+G EVGRSC+++ +KG+ +MLDCG HP  SG+D+LPF D +  DEIDL+L
Sbjct  36   TDEVEILPIGSGGEVGRSCVVVRYKGRSVMLDCGNHPAKSGLDSLPFFDSIRCDEIDLVL  95

Query  92   ISHFHLDHCGALPWFLQRTSFKGRCFMTHATKAIYRWLLSDYIKVSNISTEQMLYTEADL  151
            I+HFHLDHCGALP+F ++TSF+GR FMT ATKA Y+ +++D++++   S E ++  E  L
Sbjct  96   ITHFHLDHCGALPYFCEQTSFRGRIFMTSATKAFYKMVMNDFLRI-GASAEDIVNNEW-L  153

Query  152  ETSMDKIETINFHEEKDVCGIKFWAYNAGHVLGAAMFMIEIAGVKILYTGDFSRQEDRHL  211
            +++++KIET+ +HEE  V GI F  +NAGHVLGAA+FM++IAG+K+LYTGDFSR  DRHL
Sbjct  154  QSTIEKIETVEYHEEVTVNGIHFQPFNAGHVLGAALFMVDIAGMKLLYTGDFSRVPDRHL  213

Query  212  MAAEIPNVHPDVLITESTYGTHIHEKREEREARFTTLVHDIVNRGGRCLIPVFALGRAQE  271
            + AE+P   PD+LI EST G    E REERE+ FTT VHD+V  GGRCL+PVFALGRAQE
Sbjct  214  LGAEVPPYSPDILIAESTNGIRELESREERESLFTTWVHDVVKGGGRCLVPVFALGRAQE  273

Query  272  LLLILDEYWSLHPELYDIPIYYASSLAKKCMAVYQTYVNAMNDKIRRQIAIN-NPFVFKH  330
            LLLIL+EYW  H EL  IPIYYASSLA++CM +YQT+V+AMND++++Q   + NPFVFK+
Sbjct  274  LLLILEEYWEAHKELQHIPIYYASSLAQRCMKLYQTFVSAMNDRVKKQHENHRNPFVFKY  333

Query  331  ISNLKGIDHFDDIGPCVVMASPGMMQSGLSRELFESWCTDAKNGVIIAGYCVEGTLAKTI  390
            I +L     F+D GPCVV+ASPGM+QSG+S ELFE WC D +NG+I+AGYCV+GT+AK I
Sbjct  334  IQSLLDTRSFEDTGPCVVLASPGMLQSGISLELFERWCGDKRNGIIVAGYCVDGTIAKDI  393

Query  391  LSEPEEITTMSGQKLPLKM-SVDYISFSAHTDYQQTSEFVRCL-KPPHVVLVHGEQNEMS  448
            LS+P EIT   G+ LPL+M ++  +SFSAH+D +QT +F++ L K  HV+LVHG    M 
Sbjct  394  LSKPREITKPDGKVLPLRMRTIQSVSFSAHSDGRQTRDFIQALPKTKHVILVHGNVGAMG  453

Query  449  RLKAALQREYEDDPNTKMEIHNPRNTAAVELYFRGEKTAKVMGSLAVEKPKPGHKLSGVL  508
            +LK  LQ+++ D     ++++  +N  A+ + F  ++TAKV+G+LA   P+ G  +SGVL
Sbjct  454  QLKNKLQQDFAD---RGVQVYATKNQEAIRIPFSVQRTAKVLGTLARNPPRDGEFISGVL  510

Query  509  V-KRNFNYHMLAPSDL  523
            +   +  Y ++ P+D+
Sbjct  511  LMSGHHTYSVVHPTDI  526


>INT11_DROME unnamed protein product
Length=597

 Score = 338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 182/444 (41%), Positives = 262/444 (59%), Gaps = 16/444 (4%)

Query  37   IRPLGAGQEVGRSCIMLEFKGKKIMLDCGIHPGLSGMDALPFVDLVEAD-----EIDLLL  91
            I PLGAGQ+VGRSC++L   GK IMLDCG+H G +     P    +  +      ID ++
Sbjct  6    ITPLGAGQDVGRSCLLLSMGGKNIMLDCGMHMGYNDERRFPDFSYIVPEGPITSHIDCVI  65

Query  92   ISHFHLDHCGALPWFLQRTSFKGRCFMTHATKAIYRWLLSDYIKVS-NISTEQMLYTEAD  150
            ISHFHLDHCGALP+  +   + G  +MTH TKAI   LL D  KV+     E   +T   
Sbjct  66   ISHFHLDHCGALPYMSEIVGYTGPIYMTHPTKAIAPILLEDMRKVAVERKGESNFFTTQM  125

Query  151  LETSMDKIETINFHEEKDV-CGIKFWAYNAGHVLGAAMFMIEIAGVKILYTGDFSRQEDR  209
            ++  M K+  +  H+   V   ++  AY AGHVLGAAMF I++    ++YTGD++   DR
Sbjct  126  IKDCMKKVIPVTLHQSMMVDTDLEIKAYYAGHVLGAAMFWIKVGSQSVVYTGDYNMTPDR  185

Query  210  HLMAAEIPNVHPDVLITESTYGTHIHEKREEREARFTTLVHDIVNRGGRCLIPVFALGRA  269
            HL AA I    PD+LI+ESTY T I + +  RE  F   VH+ V +GG+ LIPVFALGRA
Sbjct  186  HLGAAWIDKCRPDLLISESTYATTIRDSKRCRERDFLKKVHECVAKGGKVLIPVFALGRA  245

Query  270  QELLLILDEYWSLHPELYDIPIYYASSLAKKCMAVYQTYVNAMNDKIRRQIAINNPFVFK  329
            QEL ++L+ YW      Y  PIY+A  L +K    Y+ ++   N KIR+     N F FK
Sbjct  246  QELCILLETYWERMNLKY--PIYFALGLTEKANTYYKMFITWTNQKIRKTFVHRNMFDFK  303

Query  330  HISNLKGIDHFDDIGPCVVMASPGMMQSGLSRELFESWCTDAKNGVIIAGYCVEGTLAKT  389
            HI       + D+ G  VV A+PGM+ +GLS ++F+ W  +  N VI+ GYCV+GT+   
Sbjct  304  HIKPFDKA-YIDNPGAMVVFATPGMLHAGLSLQIFKKWAPNENNMVIMPGYCVQGTVGNK  362

Query  390  ILSEPEEITTMSGQKLPLKMSVDYISFSAHTDYQQTSEFVRCLKPPHVVLVHGEQNEMSR  449
            IL   +++   + Q + +KM+V+Y+SFSAH D +   + ++  +P +V+LVHGE  +M  
Sbjct  363  ILGGAKKVEFENRQVVEVKMAVEYMSFSAHADAKGIMQLIQNCEPKNVMLVHGEAGKMKF  422

Query  450  LKAALQREYEDDPNTKMEIHNPRN  473
            L++ ++ E+       +E + P N
Sbjct  423  LRSKIKDEFN------LETYMPAN  440



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold1084-size576883-augustus-gene-1.3-mRNA-1

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95U30_DROME  unnamed protein product                                 289     6e-91
A0A0B4K6V8_DROME  unnamed protein product                             289     6e-91
Q24198_DROME  unnamed protein product                                 285     2e-89


>Q95U30_DROME unnamed protein product
Length=542

 Score = 289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 175/539 (32%), Positives = 279/539 (52%), Gaps = 28/539 (5%)

Query  22   EGVTVKVVQGTLKGAEEVGTFTKAKFYGFKGVRYARPPLGQLRFKAPEAPASWTGVRDAL  81
            E   + +  G +KG + +  +    ++ F+ + +A+PPLG+LRF+AP     W+GV D  
Sbjct  8    ETCELTLPVGQIKGVKRLSLYDDP-YFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCT  66

Query  82   AEGAICKQAG-----NRGNEDCLFLNVYTPQLPAGGKNPKLPVMVWIHGGGFTSGSSGSA  136
                   Q G       G EDCL+LNVY+ QL +      LPVMV+I+GG FT G +   
Sbjct  67   HYAEKPTQRGLLTREIEGGEDCLYLNVYSKQLKS---EKPLPVMVYIYGGAFTVGEATRE  123

Query  137  IYGPEFLVHAGVIVVSLNYRLGVLGFLSLEGSD--VTSNNGLRDQQQALKWVQQNIASFG  194
            +YGP++ +   V++V+LNYR+  LGFLSL+     V  N GL+DQ  ALKWV+Q I++F 
Sbjct  124  LYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFN  183

Query  195  GDADKVTIFGQSAGGASIHYLLLSPLSKGLFQKAISESGSAFNPWAYMTSPKQR-ALNLA  253
            GD   +T+FG+SAGG S H+++ +  ++GLF KAI  SG+  N WA   +P +  A  LA
Sbjct  184  GDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWA--NNPAEDFAFRLA  241

Query  254  HFLGYKGANSSQQVADFLRGVNAAQLANNQ----TQGKPGEKYPFVPAVEKGVASGVAFL  309
               G+ G N   +V ++L+GV A  L N+        + G  + F P VE  V      +
Sbjct  242  QQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCV-V  300

Query  310  PDEPITLMKEGKFLHVPTVIGSASAEAKMSAIGMNKSASNWKKVNSEMESFVPCDLGLAT  369
            P  P+ + ++    + P ++G  S E       ++ +      ++ +    VP D+   +
Sbjct  301  PKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVS  360

Query  370  GSNKSLEIAARIKRFYFGNQDVSSSTVLQYSDLVTDTRYVRGVYKAVTEMTCHSSASVFY  429
               ++LE + R+ + YFG    SS  +L   D  +   +  G  +       ++ A  +Y
Sbjct  361  SEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNARLTYAKAPTYY  420

Query  430  YRFAVDG-KINYSYMSGATSTIK-GAGHSDELCYLFNCKAFDKKNLTQTSPELVSLRRMV  487
            YRF  D    N+         IK G  H+D+L YLF      K  L +TS E  ++ RM+
Sbjct  421  YRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFRNAGSWK--LDKTSAEYRTIERMI  478

Query  488  NMWTNFAKTGNPSYQTL----WQPTTSKD-RYYMNIDTQLTLEKNFEEKRMAFWDEIYQ  541
             +WT FA T NP+   +    W+P+T  D +  +NI + +T+    E +++  WD +Y+
Sbjct  479  GIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNLYK  537


>A0A0B4K6V8_DROME unnamed protein product
Length=543

 Score = 289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 175/539 (32%), Positives = 279/539 (52%), Gaps = 28/539 (5%)

Query  22   EGVTVKVVQGTLKGAEEVGTFTKAKFYGFKGVRYARPPLGQLRFKAPEAPASWTGVRDAL  81
            E   + +  G +KG + +  +    ++ F+ + +A+PPLG+LRF+AP     W+GV D  
Sbjct  9    ETCELTLPVGQIKGVKRLSLYDDP-YFSFEKIPFAKPPLGELRFRAPVPADPWSGVLDCT  67

Query  82   AEGAICKQAG-----NRGNEDCLFLNVYTPQLPAGGKNPKLPVMVWIHGGGFTSGSSGSA  136
                   Q G       G EDCL+LNVY+ QL +      LPVMV+I+GG FT G +   
Sbjct  68   HYAEKPTQRGLLTREIEGGEDCLYLNVYSKQLKS---EKPLPVMVYIYGGAFTVGEATRE  124

Query  137  IYGPEFLVHAGVIVVSLNYRLGVLGFLSLEGSD--VTSNNGLRDQQQALKWVQQNIASFG  194
            +YGP++ +   V++V+LNYR+  LGFLSL+     V  N GL+DQ  ALKWV+Q I++F 
Sbjct  125  LYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFN  184

Query  195  GDADKVTIFGQSAGGASIHYLLLSPLSKGLFQKAISESGSAFNPWAYMTSPKQR-ALNLA  253
            GD   +T+FG+SAGG S H+++ +  ++GLF KAI  SG+  N WA   +P +  A  LA
Sbjct  185  GDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWA--NNPAEDFAFRLA  242

Query  254  HFLGYKGANSSQQVADFLRGVNAAQLANNQ----TQGKPGEKYPFVPAVEKGVASGVAFL  309
               G+ G N   +V ++L+GV A  L N+        + G  + F P VE  V      +
Sbjct  243  QQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCV-V  301

Query  310  PDEPITLMKEGKFLHVPTVIGSASAEAKMSAIGMNKSASNWKKVNSEMESFVPCDLGLAT  369
            P  P+ + ++    + P ++G  S E       ++ +      ++ +    VP D+   +
Sbjct  302  PKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVS  361

Query  370  GSNKSLEIAARIKRFYFGNQDVSSSTVLQYSDLVTDTRYVRGVYKAVTEMTCHSSASVFY  429
               ++LE + R+ + YFG    SS  +L   D  +   +  G  +       ++ A  +Y
Sbjct  362  SEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNARLTYAKAPTYY  421

Query  430  YRFAVDG-KINYSYMSGATSTIK-GAGHSDELCYLFNCKAFDKKNLTQTSPELVSLRRMV  487
            YRF  D    N+         IK G  H+D+L YLF      K  L +TS E  ++ RM+
Sbjct  422  YRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFRNAGSWK--LDKTSAEYRTIERMI  479

Query  488  NMWTNFAKTGNPSYQTL----WQPTTSKD-RYYMNIDTQLTLEKNFEEKRMAFWDEIYQ  541
             +WT FA T NP+   +    W+P+T  D +  +NI + +T+    E +++  WD +Y+
Sbjct  480  GIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNLYK  538


>Q24198_DROME unnamed protein product
Length=542

 Score = 285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/539 (32%), Positives = 278/539 (52%), Gaps = 28/539 (5%)

Query  22   EGVTVKVVQGTLKGAEEVGTFTKAKFYGFKGVRYARPPLGQLRFKAPEAPASWTGVRDAL  81
            E   + +  G +KG + +  +    ++ F+ + +A+ PLG+LRF+AP     W+GV D  
Sbjct  8    ETCELTLPVGQIKGVKRLSLYDDP-YFSFEKIPFAKTPLGELRFRAPVPADPWSGVLDCT  66

Query  82   AEGAICKQAG-----NRGNEDCLFLNVYTPQLPAGGKNPKLPVMVWIHGGGFTSGSSGSA  136
                   Q G       G EDCL+LNVY+ QL +      LPVMV+I+GG FT G +   
Sbjct  67   HYAEKPTQRGLLTREIEGGEDCLYLNVYSKQLKS---EKPLPVMVYIYGGAFTVGEATRE  123

Query  137  IYGPEFLVHAGVIVVSLNYRLGVLGFLSLEGSD--VTSNNGLRDQQQALKWVQQNIASFG  194
            +YGP++ +   V++V+LNYR+  LGFLSL+     V  N GL+DQ  ALKWV+Q I++F 
Sbjct  124  LYGPDYFMTKDVVLVTLNYRVDCLGFLSLKDPSLKVPGNAGLKDQVLALKWVKQYISNFN  183

Query  195  GDADKVTIFGQSAGGASIHYLLLSPLSKGLFQKAISESGSAFNPWAYMTSPKQR-ALNLA  253
            GD   +T+FG+SAGG S H+++ +  ++GLF KAI  SG+  N WA   +P +  A  LA
Sbjct  184  GDDSNITVFGESAGGCSTHFMMCTEQTRGLFHKAIPMSGTVHNYWA--NNPAEDFAFRLA  241

Query  254  HFLGYKGANSSQQVADFLRGVNAAQLANNQ----TQGKPGEKYPFVPAVEKGVASGVAFL  309
               G+ G N   +V ++L+GV A  L N+        + G  + F P VE  V      +
Sbjct  242  QQNGFTGENDDAKVLEYLQGVPARDLVNHNLLTPEHRRNGLLFAFGPTVEAYVGEDCV-V  300

Query  310  PDEPITLMKEGKFLHVPTVIGSASAEAKMSAIGMNKSASNWKKVNSEMESFVPCDLGLAT  369
            P  P+ + ++    + P ++G  S E       ++ +      ++ +    VP D+   +
Sbjct  301  PKPPVEMARDAWSNNFPVMLGGTSFEGLFMYPAVSANLKALDSLSQDPTRLVPVDVRTVS  360

Query  370  GSNKSLEIAARIKRFYFGNQDVSSSTVLQYSDLVTDTRYVRGVYKAVTEMTCHSSASVFY  429
               ++LE + R+ + YFG    SS  +L   D  +   +  G  +       ++ A  +Y
Sbjct  361  SEKENLEYSQRLMKAYFGYSPPSSELLLNMLDFYSYKIFWHGFNRTFNARLTYAKAPTYY  420

Query  430  YRFAVDG-KINYSYMSGATSTIK-GAGHSDELCYLFNCKAFDKKNLTQTSPELVSLRRMV  487
            YRF  D    N+         IK G  H+D+L YLF      K  L +TS E  ++ RM+
Sbjct  421  YRFDFDSPNFNFYRAKFCGDKIKTGVAHADDLSYLFRNAGSWK--LDKTSAEYRTIERMI  478

Query  488  NMWTNFAKTGNPSYQTL----WQPTTSKD-RYYMNIDTQLTLEKNFEEKRMAFWDEIYQ  541
             +WT FA T NP+   +    W+P+T  D +  +NI + +T+    E +++  WD +Y+
Sbjct  479  GIWTAFAATSNPNCPEIGHLEWKPSTKNDPKRVINISSDVTIIDLPEYEKLQIWDNLYK  537



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold4306-size210133-augustus-gene-1.5-mRNA-1

Length=115
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9BI89_CAEEL  unnamed protein product                                 30.4    0.25 
MYSP1_DROME  unnamed protein product                                  26.9    4.3  
MYSP2_DROME  unnamed protein product                                  26.9    4.3  


>Q9BI89_CAEEL unnamed protein product
Length=459

 Score = 30.4 bits (67),  Expect = 0.25, Method: Composition-based stats.
 Identities = 19/81 (23%), Positives = 37/81 (46%), Gaps = 9/81 (11%)

Query  16   GQTLKLLSLKKRDVDRTQRPVLTYCAPDRY-----SPLWSLFDPQCRGLTRDEMEAEARR  70
            G +L  ++ +   +    +  L +C   +Y       L  LF+  C  L++ ++E   ++
Sbjct  90   GDSLMTMTSQDNHIQFLHKSPLIFCVVSKYPEQLDQQLEVLFEQICSILSKSQLENVYKK  149

Query  71   LCYVPGDVNDLRSMLEGANRM  91
                 GD  DLR +L G +R+
Sbjct  150  ----KGDNYDLRKLLRGTDRL  166


>MYSP1_DROME unnamed protein product
Length=879

 Score = 26.9 bits (58),  Expect = 4.3, Method: Composition-based stats.
 Identities = 14/47 (30%), Positives = 29/47 (62%), Gaps = 1/47 (2%)

Query  60   TRDEMEAEARRLCYVPGDVNDLRSMLEGANRMEYIID-QHKDALKKL  105
            T D+     RRL  + G++ ++RS L+ ANR +  ++ Q+++A  ++
Sbjct  597  TLDQYAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRI  643


>MYSP2_DROME unnamed protein product
Length=640

 Score = 26.9 bits (58),  Expect = 4.3, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 29/47 (62%), Gaps = 1/47 (2%)

Query  60   TRDEMEAEARRLCYVPGDVNDLRSMLEGANRMEYIID-QHKDALKKL  105
            T D+     RRL  + G++ ++RS L+ ANR +  ++ Q+++A  ++
Sbjct  358  TLDQYAVAQRRLAGLNGELEEVRSHLDSANRAKRTVELQYEEAASRI  404



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold846-size651511-augustus-gene-2.2-mRNA-1

Length=449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OCTL_DROME  unnamed protein product                                   153     1e-40
Q961J5_DROME  unnamed protein product                                 115     1e-27
OCT1_CAEEL  unnamed protein product                                   111     4e-26


>OCTL_DROME unnamed protein product
Length=567

 Score = 153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 109/379 (29%), Positives = 172/379 (45%), Gaps = 90/379 (24%)

Query  160  GNDGVQATIGDVGRWQLLIFVWVSMAKFPVAWHIMGIVFL--------APPVKALCRQDL  211
            G D     +GD GR+Q +I+  + +   PVA+H +  VFL        A P +     DL
Sbjct  2    GYDEAIIHLGDFGRYQKIIYFLICLTSIPVAFHKLAGVFLLAKPDFRCALPFENGSSYDL  61

Query  212  NS---------SDHCTATDGNGTEQ--------------PCTSWHYDRSVFSETIITEWD  248
             +         ++ C+  D + TE+               C+S+ YDRS +  + +TEW+
Sbjct  62   PTHLWNLSYPENERCSYYDVDYTEEYLNGSIPRSSNETKTCSSYVYDRSKYLNSAVTEWN  121

Query  249  LVCSRNQLSNVAQTVFMFGVLAGNALFGIAADRFGRKAPLVIAVALQSLAGVAAAVVPWF  308
            LVC R+ ++  + ++FM GVL G+ +FG  +D++GRK  L  ++ +Q L GV A V P +
Sbjct  122  LVCGRDFMAATSDSLFMLGVLLGSIVFGQLSDKYGRKPILFASLVIQVLFGVLAGVAPEY  181

Query  309  EAFLALRFLVAFATGGSMITSFVLC-----------------------------------  333
              +   R +V   T G  + ++V+                                    
Sbjct  182  FTYTFARLMVGATTSGVFLVAYVVAMEMVGPDKRLYAGIFVMMFFSVGFMLTAVFAYFVH  241

Query  334  ----------------EFLAETIPESPRWLLTAGRESEAIEILGKAAKMNKM---DE--S  372
                             F    IPES RWLL  GR+  AI  + KAA+ NK+   DE  S
Sbjct  242  DWRWLQIALTLPGLIFMFYYWIIPESARWLLLKGRKDCAIANMQKAARFNKVEISDEALS  301

Query  373  QVLPAVKNFISDKEKQLESSEDKKA---SVLDLFRTPNLRITTLCLYFNWLVCGFCFYGL  429
            ++L   +N     +++LE  E  +    SV DLF  PNLR  TL ++ +WLV    +YGL
Sbjct  302  ELLDEGENSEEKAKQKLEDQELDEGPPPSVWDLFCYPNLRRKTLLIFLDWLVTSGVYYGL  361

Query  430  AQYMGQIGGNIFVNIFVNG  448
            +     +GGN+ +N  ++G
Sbjct  362  SWNTSNLGGNVLLNFVISG  380


>Q961J5_DROME unnamed protein product
Length=604

 Score = 115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/275 (28%), Positives = 121/275 (44%), Gaps = 54/275 (20%)

Query  228  PCTS-WHYDRSVFSETIITEWDLVCSRNQLSNVAQTVFMFGVLAGNALFGIAADRFGRKA  286
            PC   WHYD+S++S T++ EW+LVC R+ L  +A  VF  G L GN +FG   D +GR+ 
Sbjct  124  PCQHGWHYDKSIYSSTVVQEWNLVCDRSFLVTLALVVFGVGGLLGNYVFGYLVDLWGRRP  183

Query  287  PLVIAVALQSLAGVAAAVVPWFEAFLALRFLVAFATGGSMITSFVL------------CE  334
                 + L+ +A  A+A    +  +L LRF+V       + + +VL            C 
Sbjct  184  SFYAYLLLEIIACAASAFAWNYYTWLGLRFVVGLTVPAILASPYVLAIELVGPERRVFCT  243

Query  335  FLAE---------------------------------------TIPESPRWLLTAGRESE  355
             ++                                         +PESPRWL+  G+   
Sbjct  244  IVSNIAYSLGLVVLAGVIYIVRDWRELSLAVSMPLLMLFSCFFVLPESPRWLMAVGKTRR  303

Query  356  AIEILGKAAKMN--KMDESQVLPAVKNFISDKEKQLESSEDKKASVLDLFRTPNLRITTL  413
            AI+IL   A++N  +++   V    +  +  +  + +SS      +LDLFR PN+R  TL
Sbjct  304  AIKILKVMARVNGVRVNRDFVERLQRKLVITRAAETKSSMTTHYGILDLFRGPNMRRKTL  363

Query  414  CLYFNWLVCGFCFYGLAQYMGQIGGNIFVNIFVNG  448
             +   W      + GL+ Y   +GG+   N F+ G
Sbjct  364  IITLIWFANTSVYVGLSYYAPALGGDEIWNFFLAG  398


>OCT1_CAEEL unnamed protein product
Length=585

 Score = 111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 88/374 (24%), Positives = 154/374 (41%), Gaps = 91/374 (24%)

Query  162  DGVQATIGDVGRWQLLIFVWVSM-AKFPVAWHIMGIVFLA---------PPVKALCRQDL  211
            D V   +G+ G +Q++ F  + +    P A+    I F+          P  K   R   
Sbjct  27   DFVLEQVGNYGTYQIVFFFIICLPTSLPSAFSAFNIPFVVGNPPHTCHIPEGKEYLRPLT  86

Query  212  NSSDHCTATDGNGTE---------------------QPCTS-WHYDRSVFSETIITEWDL  249
            N +   +    N T+                      PC + W YD S + ++++TE++L
Sbjct  87   NDTQILSCKQYNETQINVFRAFTSAPVDTYSDRISLVPCQNGWDYDNSTYLDSLVTEFNL  146

Query  250  VCSRNQLSNVAQTVFMFGVLAGNALFGIAADRFGRKAPLVIAVALQSLAGVAAAVVPWFE  309
            VC +     ++ T F  G   GN LFG  AD+FGR+    + + +  + G A++     E
Sbjct  147  VCDQQAWIEISTTSFYVGSFIGNCLFGYVADKFGRRRSFFVILTVLIVCGTASSFAKDIE  206

Query  310  AFLALRFLVAFATGGSMITSFVLC-EFLAET-----------------------------  339
            +F+ LRF    A        F++C EF+  +                             
Sbjct  207  SFIILRFFTGLAFPALFQIPFIICMEFMGNSGRIFSGLMTSLFFGAAMALLGVVAMFIRR  266

Query  340  ---------------------IPESPRWLLTAGRESEAIEILGKAAKMN---KMDESQVL  375
                                 +PESPRW ++ G+ ++A + L K AKMN    +D  +++
Sbjct  267  WRQLTFFCNAPFAFYIIYYFFLPESPRWSVSVGKWADAKKQLKKIAKMNGKSNVDVDELV  326

Query  376  PAVKNFISDKEKQLESSEDKKA-SVLDLFRTPNLRITTLCLYFNWLVCGFCFYGLAQYMG  434
             ++KN     +   E  E K++ +V DLF+TPNLR  TL + + W++    + GL   + 
Sbjct  327  DSMKN----HQNAAEEKETKRSHNVTDLFKTPNLRRKTLIVTYIWVMNAIIYNGLTLNVS  382

Query  435  QIGGNIFVNIFVNG  448
             +  + + +  +NG
Sbjct  383  NLPVDDYWSFIING  396



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold10188-size39778-augustus-gene-0.2-mRNA-1

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z9J8_DROME  unnamed protein product                                 194     7e-60
Q9W1L8_DROME  unnamed protein product                                 127     2e-34
A0A173GP47_PHOPY  unnamed protein product                             117     3e-30


>A1Z9J8_DROME unnamed protein product
Length=346

 Score = 194 bits (493),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 103/260 (40%), Positives = 152/260 (58%), Gaps = 7/260 (3%)

Query  10   VWLQCSTCVSEVDERRPERECV-CCRFSMFINDSMILQFLWENGANPSKLAPLTVFRRPG  68
            +WL  +    E  + RP  E      F +F++  +  +   EN  +   L  +    RPG
Sbjct  82   IWLVANGLDFEHAQERPLTERFPFFEFPLFVHPKIKEELQEENRDSAEALEFIEKIARPG  141

Query  69   YETLGKL--HSPRFIKTHLPFSLLPPELLDSGCKVVYMARNPKDVAVSFYHFIRLIRYMG  126
            YE L ++     RFIKTH PFSL+PP +L+  CKV+Y+ R+PKDVAVS+YH  RL R  G
Sbjct  142  YEALSEIPRSQRRFIKTHFPFSLMPPSVLEKKCKVIYVVRDPKDVAVSYYHLNRLFRTQG  201

Query  127  YQGDFETYWNQFQRNNLPWTPYWSHLKEGWDRRHHPNVMFVFYEDMLKDMSGVIERVSRF  186
            Y GDFE YW+ FQ    PW PY+SH+KE  +  H  NV+F+ YEDML D+ G I  ++ F
Sbjct  202  YVGDFERYWHYFQNGLNPWLPYYSHVKEAREHAHLSNVLFLRYEDMLADLPGAINSIASF  261

Query  187  IGRPVSDKQVEALQDYLHIDNFRRNPAVNMDFLKNAGLLNSGEEPFIREGGTGS--SRSV  244
            +  P   + ++ L D+L I +FR N +VNM  + + G+LN GE  F+R G   +   +  
Sbjct  262  LECPPKPEDMDRLLDHLSIRSFRENKSVNMHEMASVGVLNKGEAGFVRSGAKTAYQPQQE  321

Query  245  FPED--LSRLADAWIQENLQ  262
            F E+  L + A+ W+++N++
Sbjct  322  FVENPKLLKSANEWVEQNIK  341


>Q9W1L8_DROME unnamed protein product
Length=338

 Score = 127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 107/198 (54%), Gaps = 6/198 (3%)

Query  75   LHSPRFIKTHLPFSLLPPELLDSGCKVVYMARNPKDVAVSFYHFIRLIRYMGYQGDFETY  134
            L SPR IK+HLP  +LP ++     K++Y+ RNPKD A+S++H  R +  +GYQG    +
Sbjct  131  LPSPRLIKSHLPAWMLPRQIWSKRPKIIYVYRNPKDAAISYFHHWRGM--VGYQGTKSDF  188

Query  135  WNQFQRNNLPWTPYWSHLKEGWDRRHHPNVMFVFYEDMLKDMSGVIERVSRFIGRPVSDK  194
             + F    + +TP W H+ + W  RH PN+ F  YE M   +  VI  V++F+ R VS +
Sbjct  189  MHSFIDGYVNFTPCWPHILDFWQLRHEPNIFFTSYERMKGQLGQVISEVAQFLERSVSQE  248

Query  195  QVEALQDYLHIDNFRRNPAVN----MDFLKNAGLLNSGEEPFIREGGTGSSRSVFPEDLS  250
            Q++ +Q +L  ++ R NPA N     + +K A      E  F+R G  GS +     D+ 
Sbjct  249  QMQQMQRHLSFESMRDNPACNHVKEFESMKAAAGREVEEFRFVRRGVVGSHKDELTADII  308

Query  251  RLADAWIQENLQRTGIEM  268
            R  D W   NL+   + M
Sbjct  309  REFDLWSDSNLRDFKLNM  326


>A0A173GP47_PHOPY unnamed protein product
Length=370

 Score = 117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 118/219 (54%), Gaps = 12/219 (5%)

Query  53   ANPSKLAPLTVFRRPGY-----ETLGKLHSPRFIKTHLPFSLLPPELLDSGCK--VVYMA  105
             N +K+  +    RP Y       L  L   RFIKTHL ++LLP ++L+   K  ++Y+ 
Sbjct  129  VNFAKMTEMLGSTRPEYIGNSINYLRDLEGTRFIKTHLTYNLLPEQILNGNRKPKIIYVM  188

Query  106  RNPKDVAVSFYHFIRLIRYMGYQGDFETYWNQFQRNNLPWTPYWSHLKEGWDRRHHPNVM  165
            R+PKDV VS+YH  RLI+  G++ DF+ +   F    + +  YW H+   W+ R  PNV+
Sbjct  189  RDPKDVCVSYYHHGRLIQ--GWRADFQNFSKVFLSEKIMFGSYWKHVLGYWEHRDKPNVL  246

Query  166  FVFYEDMLKDMSGVIERVSRFIGRPVSDKQVEALQDYLHIDNFRRNPAVNMDFLKNAGL-  224
             + YE+M KD+  VI + ++F+ + +++ ++  L  +L  ++ + N AVN      + + 
Sbjct  247  ILTYEEMKKDLLSVIRKTAQFLDKKLNENKIPQLLKHLSFESMKNNRAVNQQDKIESRMK  306

Query  225  --LNSGEEPFIREGGTGSSRSVFPEDLSRLADAWIQENL  261
              L   +  F+R G + + +    E+L    D W ++++
Sbjct  307  HKLVPEQGAFMRSGTSQNYKGEMSEELILKFDEWTKKSI  345



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


Query= maker-scaffold3264-size280432-augustus-gene-1.6-mRNA-1

Length=550
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961H2_DROME  unnamed protein product                                 145     1e-37
Q9XXR3_CAEEL  unnamed protein product                                 30.0    5.4  
CANA_DROME  unnamed protein product                                   30.0    6.9  


>Q961H2_DROME unnamed protein product
Length=507

 Score = 145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 114/446 (26%), Positives = 207/446 (46%), Gaps = 10/446 (2%)

Query  54   IEPILFFLVLPSTLSALAMQNLYIEKACRVNLNYSKELCSQLMSGVE--TNETSKIGLEA  111
            +EP +F +     L     QN  + + C     ++   C  L+ G++  ++   ++ +  
Sbjct  54   LEPAVFLIFFARNLIGAVYQNQILYQTCITIEKFNATQCEPLL-GIDRGSDADKEVEVIV  112

Query  112  ETLVSWMQTWKTVITYLPPTILMLFLGSWSDRHARRKPFILLPIAGDICTNLGFLLCTYY  171
            +T  + +    +++  + P    LFLG WSD+  RR P +L    G +   L  ++ TY 
Sbjct  113  QTYSANIMMTTSLLESIIPAFASLFLGPWSDKFGRR-PILLTTFTGYLTGALILIVITYI  171

Query  172  FLELPMEVVGVMESVFPAL-AGGLFTMFMGVFSYLADITSLETRTHRIGIANIFLSVCTP  230
                 +     + S  P++ +GG   +  G++ Y++D+     +  R+ +    L     
Sbjct  172  TRSTNISPWWFLLSSVPSVVSGGTCALITGIYCYISDVAKERKKALRMVLNEASLCAGIM  231

Query  231  VGSALSGVITKYLGYYGAFSISLALTLTGFVYCLFRVKEARPPIPAPSGFSFFRDLFDCR  290
            VG+  SG I         FSI+ +L +   +Y L  V E+  P    +G S  R+ F   
Sbjct  232  VGNVASGYIYAATNALVLFSIAGSLMMFALMYVLLFVPESLNPGDIHTG-SRVREFFRFD  290

Query  291  HIQDTFQVGFKKRDDDRRKWIIMLVILSVLIVGPITGEFSIAYLYTFKRFTWREVDFSLY  350
             + D  +  FK+R +  R  I + +I   + +  + GE ++ Y++   +F W   DFSL+
Sbjct  291  LVTDLIRTCFKRRPNFDRTIIWLTMIALTIAIFDMEGESTVNYMFVQDKFNWTIKDFSLF  350

Query  351  ATCGGIVNFIGTTVGITLFVKILKLSDGLLGVIGCVGKIFASLVYCFASQSWMLYLGLAL  410
                 ++  +G+ VG+ +  ++LK+S   + ++     +  S V   A     LYLG+ L
Sbjct  351  NASRIVIQIVGSIVGMLVLRRVLKMSIVTMAMLSLACCVLESTVRATAVYWQELYLGMTL  410

Query  411  DFFGGMTLVALRAIGSKIVPCNEQGKLNSLFGVFESLAPLAYSTLYNSVFAVTAEMFPGA  470
                G+     RAI S + P  E GK+ +L    ES++PL  + LY +V+  T E +PGA
Sbjct  411  GMMRGVMGPMCRAILSHVAPATEVGKIFALTTSMESVSPLGAAPLYTTVYKATLENYPGA  470

Query  471  VYFMSALF----TVPIAVVFMMMRHM  492
              F+SA       + IAV+F + + M
Sbjct  471  FNFISAALYFVCYILIAVIFGIQKSM  496


>Q9XXR3_CAEEL unnamed protein product
Length=606

 Score = 30.0 bits (66),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (64%), Gaps = 0/33 (0%)

Query  239  ITKYLGYYGAFSISLALTLTGFVYCLFRVKEAR  271
            +T+ +G YGAF +   LT+  F++ LF V E +
Sbjct  524  LTQVIGKYGAFWLYAGLTVIAFIFILFLVPETK  556


>CANA_DROME unnamed protein product
Length=828

 Score = 30.0 bits (66),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 27/39 (69%), Gaps = 1/39 (3%)

Query  87   YSKELCSQLMSGVETNETSKIGLEA-ETLVSWMQTWKTV  124
            +SK++C  +++ ++ +++ K+G E  ETL+S +  WK +
Sbjct  699  FSKDVCRSMVAMLDADKSGKLGFEEFETLLSEIAKWKAI  737



Lambda      K        H
   0.319    0.136    0.384 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4651794560


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold3630-size249649-augustus-gene-1.5-mRNA-1

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZU2_DROME  unnamed protein product                                 560     0.0  
Q9VWI1_DROME  unnamed protein product                                 559     0.0  
E1JJR3_DROME  unnamed protein product                                 559     0.0  


>Q9XZU2_DROME unnamed protein product
Length=1613

 Score = 560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/661 (47%), Positives = 392/661 (59%), Gaps = 69/661 (10%)

Query  1    MAVDGVAPRAKMNQQRGRRFRSAKEAEVLEKKAKESGEELPSEERFDSNCITPGTVFMAR  60
            ++VDGVAPRAKMNQQR RRFR+A+EAE  E KA + GE L   ERFDSNCITPGT FM R
Sbjct  83   LSVDGVAPRAKMNQQRSRRFRTAREAEQQEAKAAQRGE-LREHERFDSNCITPGTEFMVR  141

Query  61   LHEQLKYFVVFKISTDKLWQNCKVILSGHETPGEGEHKIMDYIRYMKSQPDYDPNTRHCL  120
            L E L+ F+  KISTD LWQ C VILSG E PGEGEHKIMDYIRYMK+QPDYDPNTRHCL
Sbjct  142  LQEGLRAFLKTKISTDPLWQRCTVILSGQEAPGEGEHKIMDYIRYMKTQPDYDPNTRHCL  201

Query  121  YGLDADLIMLGLCTHEPHFSLLREEV----------------------------------  146
            YGLDADLI+LGLCTHE HF +LREEV                                  
Sbjct  202  YGLDADLIILGLCTHELHFVVLREEVKFGRNVKRTSVEETRFFLLHLGLLREYLELEFDA  261

Query  147  ------------------LMGFLVGNDFIPHLPLMHIHEGALPVLYQAYIAVLPSLDGYI  188
                              LMGFLVGNDFIPHLP +HI   ALP+LY+ YI + P+L G I
Sbjct  262  LRTDEHKLDIAQLIDDWVLMGFLVGNDFIPHLPCLHISSNALPLLYRTYIGIYPTLGGNI  321

Query  189  NESGTLNLERFQKYMEKLSEYDVEQFQETLADLKFFEGKTGRRPNENKRHSYKTNGVSDK  248
            NE+G LNL R Q ++  L+E +++ F+E   DLK+   K+     +    +   N  SD 
Sbjct  322  NENGKLNLRRLQIFISALTEVELDHFKEHADDLKYMNNKSEAFDMDVGEITESQNLDSD-  380

Query  249  SELQALINSTNSMYISSDEDDSDASDIDQKSVML-EFSEHKKSYYMTKLEYHSVDSEVLR  307
              L ALIN +  +Y    E+D    +    +V+L EF  +K+++Y  K +    D E++ 
Sbjct  381  --LGALINKSMLLYDDDSEEDCSDEN----AVLLKEFQNYKRNFYRNKFKRDPND-ELIE  433

Query  308  IQAEGYVRAIQWNLNYYYNGVCSWSWYYPHNYAPYISDINNFSNLKLDFDMGKPFLPFEQ  367
                 YV A+QW L+YYY GV SW WYYP +Y P+ISD+ N   +++ F MG PFLPF+Q
Sbjct  434  ELCHHYVNALQWVLDYYYRGVQSWDWYYPFHYTPFISDLKNIEQVEIAFHMGTPFLPFQQ  493

Query  368  LLAVLPAASKNLLPEPYHHLMVDANSPIIDYYPRDFKTDLNGKKQEWEAVVLIPFIDETT  427
            LLAVLPAAS  LLP  YH LM+   SP+ ++YP +F++DLNGKK +WEAVVLIPFIDE  
Sbjct  494  LLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGR  553

Query  428  LLKAMKPRNAQLTEEESNRNSHGPMFTHTYTGEDLGEYQAPEYFPGISNNHAVVVAIDRE  487
            LL AM P  AQL+ EE  RN HGPM+ + Y+    G   A      +   +   VA    
Sbjct  554  LLAAMLPCEAQLSLEERERNRHGPMYVYKYSTVAQGPMPAYPPLRALPVLYCTEVAKWSH  613

Query  488  EIQVERHKLVKGLCPGVMLDVFFPGFPTLKHIKYTYFMHKNRTVVFEHPSRGDSMMVKLV  547
            EI V     V    P     VFFPGFPT++H+ + + +  +R  VFE  SR  ++++K  
Sbjct  614  EIAVNLPYSVCIELPNAARTVFFPGFPTMQHLPFDFELRNDRVKVFEQVSRNQNIVLKPR  673

Query  548  HSETP-SVEEIAKQILGKSIFVSWPHLCEARVVAVSNREVYSRVLDNASSSDCDSNDASK  606
              +   ++  +A Q LGK I V WPHL +A VV V+ R+          S     ND+ +
Sbjct  674  KRQLEDTLTAVASQYLGKVIHVGWPHLVKAIVVRVATRD------QRVDSEGITLNDSRR  727

Query  607  F  607
            F
Sbjct  728  F  728


>Q9VWI1_DROME unnamed protein product
Length=1612

 Score = 559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/661 (47%), Positives = 392/661 (59%), Gaps = 69/661 (10%)

Query  1    MAVDGVAPRAKMNQQRGRRFRSAKEAEVLEKKAKESGEELPSEERFDSNCITPGTVFMAR  60
            ++VDGVAPRAKMNQQR RRFR+A+EAE  E KA + GE L   ERFDSNCITPGT FM R
Sbjct  83   LSVDGVAPRAKMNQQRSRRFRTAREAEQQEAKAAQRGE-LREHERFDSNCITPGTEFMVR  141

Query  61   LHEQLKYFVVFKISTDKLWQNCKVILSGHETPGEGEHKIMDYIRYMKSQPDYDPNTRHCL  120
            L E L+ F+  KISTD LWQ C VILSG E PGEGEHKIMDYIRYMK+QPDYDPNTRHCL
Sbjct  142  LQEGLRAFLKTKISTDPLWQRCTVILSGQEAPGEGEHKIMDYIRYMKTQPDYDPNTRHCL  201

Query  121  YGLDADLIMLGLCTHEPHFSLLREEV----------------------------------  146
            YGLDADLI+LGLCTHE HF +LREEV                                  
Sbjct  202  YGLDADLIILGLCTHELHFVVLREEVKFGRNVKRTSVEETRFFLLHLGLLREYLELEFDA  261

Query  147  ------------------LMGFLVGNDFIPHLPLMHIHEGALPVLYQAYIAVLPSLDGYI  188
                              LMGFLVGNDFIPHLP +HI   ALP+LY+ YI + P+L G I
Sbjct  262  LRTDEHKLDIAQLIDDWVLMGFLVGNDFIPHLPCLHISSNALPLLYRTYIGIYPTLGGNI  321

Query  189  NESGTLNLERFQKYMEKLSEYDVEQFQETLADLKFFEGKTGRRPNENKRHSYKTNGVSDK  248
            NE+G LNL R Q ++  L+E +++ F+E   DLK+   K+     +    +   N  SD 
Sbjct  322  NENGKLNLRRLQIFISALTEVELDHFKEHADDLKYMNNKSEAFDMDVGEITESQNLDSD-  380

Query  249  SELQALINSTNSMYISSDEDDSDASDIDQKSVML-EFSEHKKSYYMTKLEYHSVDSEVLR  307
              L ALIN +  +Y    E+D    +    +V+L EF  +K+++Y  K +    D E++ 
Sbjct  381  --LGALINKSMLLYDDDSEEDCSDEN----AVLLKEFQNYKRNFYRNKFKRDPND-ELIE  433

Query  308  IQAEGYVRAIQWNLNYYYNGVCSWSWYYPHNYAPYISDINNFSNLKLDFDMGKPFLPFEQ  367
                 YV A+QW L+YYY GV SW WYYP +Y P+ISD+ N   +++ F MG PFLPF+Q
Sbjct  434  ELCHHYVNALQWVLDYYYRGVQSWDWYYPFHYTPFISDLKNIEQVEIAFHMGTPFLPFQQ  493

Query  368  LLAVLPAASKNLLPEPYHHLMVDANSPIIDYYPRDFKTDLNGKKQEWEAVVLIPFIDETT  427
            LLAVLPAAS  LLP  YH LM+   SP+ ++YP +F++DLNGKK +WEAVVLIPFIDE  
Sbjct  494  LLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGR  553

Query  428  LLKAMKPRNAQLTEEESNRNSHGPMFTHTYTGEDLGEYQAPEYFPGISNNHAVVVAIDRE  487
            LL AM P  AQL+ EE  RN HGPM+ + Y+    G   A      +   +   VA    
Sbjct  554  LLAAMLPCEAQLSLEERERNRHGPMYVYKYSTVAQGPMPAYPPLRALPVLYCTEVAKWSH  613

Query  488  EIQVERHKLVKGLCPGVMLDVFFPGFPTLKHIKYTYFMHKNRTVVFEHPSRGDSMMVKLV  547
            EI V     V    P     VFFPGFPT++H+ + + +  +R  VFE  SR  ++++K  
Sbjct  614  EIAVNLPYSVCIELPNAARTVFFPGFPTMQHLPFDFELRNDRVKVFEQVSRNQNIVLKPR  673

Query  548  HSETP-SVEEIAKQILGKSIFVSWPHLCEARVVAVSNREVYSRVLDNASSSDCDSNDASK  606
              +   ++  +A Q LGK I V WPHL +A VV V+ R+          S     ND+ +
Sbjct  674  KRQLEDTLTAVASQYLGKVIHVGWPHLVKAIVVRVATRD------QRVDSEGITLNDSRR  727

Query  607  F  607
            F
Sbjct  728  F  728


>E1JJR3_DROME unnamed protein product
Length=1613

 Score = 559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/661 (47%), Positives = 392/661 (59%), Gaps = 69/661 (10%)

Query  1    MAVDGVAPRAKMNQQRGRRFRSAKEAEVLEKKAKESGEELPSEERFDSNCITPGTVFMAR  60
            ++VDGVAPRAKMNQQR RRFR+A+EAE  E KA + GE L   ERFDSNCITPGT FM R
Sbjct  83   LSVDGVAPRAKMNQQRSRRFRTAREAEQQEAKAAQRGE-LREHERFDSNCITPGTEFMVR  141

Query  61   LHEQLKYFVVFKISTDKLWQNCKVILSGHETPGEGEHKIMDYIRYMKSQPDYDPNTRHCL  120
            L E L+ F+  KISTD LWQ C VILSG E PGEGEHKIMDYIRYMK+QPDYDPNTRHCL
Sbjct  142  LQEGLRAFLKTKISTDPLWQRCTVILSGQEAPGEGEHKIMDYIRYMKTQPDYDPNTRHCL  201

Query  121  YGLDADLIMLGLCTHEPHFSLLREEV----------------------------------  146
            YGLDADLI+LGLCTHE HF +LREEV                                  
Sbjct  202  YGLDADLIILGLCTHELHFVVLREEVKFGRNVKRTSVEETRFFLLHLGLLREYLELEFDA  261

Query  147  ------------------LMGFLVGNDFIPHLPLMHIHEGALPVLYQAYIAVLPSLDGYI  188
                              LMGFLVGNDFIPHLP +HI   ALP+LY+ YI + P+L G I
Sbjct  262  LRTDEHKLDIAQLIDDWVLMGFLVGNDFIPHLPCLHISSNALPLLYRTYIGIYPTLGGNI  321

Query  189  NESGTLNLERFQKYMEKLSEYDVEQFQETLADLKFFEGKTGRRPNENKRHSYKTNGVSDK  248
            NE+G LNL R Q ++  L+E +++ F+E   DLK+   K+     +    +   N  SD 
Sbjct  322  NENGKLNLRRLQIFISALTEVELDHFKEHADDLKYMNNKSEAFDMDVGEITESQNLDSD-  380

Query  249  SELQALINSTNSMYISSDEDDSDASDIDQKSVML-EFSEHKKSYYMTKLEYHSVDSEVLR  307
              L ALIN +  +Y    E+D    +    +V+L EF  +K+++Y  K +    D E++ 
Sbjct  381  --LGALINKSMLLYDDDSEEDCSDEN----AVLLKEFQNYKRNFYRNKFKRDPND-ELIE  433

Query  308  IQAEGYVRAIQWNLNYYYNGVCSWSWYYPHNYAPYISDINNFSNLKLDFDMGKPFLPFEQ  367
                 YV A+QW L+YYY GV SW WYYP +Y P+ISD+ N   +++ F MG PFLPF+Q
Sbjct  434  ELCHHYVNALQWVLDYYYRGVQSWDWYYPFHYTPFISDLKNIEQVEIAFHMGTPFLPFQQ  493

Query  368  LLAVLPAASKNLLPEPYHHLMVDANSPIIDYYPRDFKTDLNGKKQEWEAVVLIPFIDETT  427
            LLAVLPAAS  LLP  YH LM+   SP+ ++YP +F++DLNGKK +WEAVVLIPFIDE  
Sbjct  494  LLAVLPAASAKLLPVAYHDLMLLPTSPLAEFYPLEFESDLNGKKHDWEAVVLIPFIDEGR  553

Query  428  LLKAMKPRNAQLTEEESNRNSHGPMFTHTYTGEDLGEYQAPEYFPGISNNHAVVVAIDRE  487
            LL AM P  AQL+ EE  RN HGPM+ + Y+    G   A      +   +   VA    
Sbjct  554  LLAAMLPCEAQLSLEERERNRHGPMYVYKYSTVAQGPMPAYPPLRALPVLYCTEVAKWSH  613

Query  488  EIQVERHKLVKGLCPGVMLDVFFPGFPTLKHIKYTYFMHKNRTVVFEHPSRGDSMMVKLV  547
            EI V     V    P     VFFPGFPT++H+ + + +  +R  VFE  SR  ++++K  
Sbjct  614  EIAVNLPYSVCIELPNAARTVFFPGFPTMQHLPFDFELRNDRVKVFEQVSRNQNIVLKPR  673

Query  548  HSETP-SVEEIAKQILGKSIFVSWPHLCEARVVAVSNREVYSRVLDNASSSDCDSNDASK  606
              +   ++  +A Q LGK I V WPHL +A VV V+ R+          S     ND+ +
Sbjct  674  KRQLEDTLTAVASQYLGKVIHVGWPHLVKAIVVRVATRD------QRVDSEGITLNDSRR  727

Query  607  F  607
            F
Sbjct  728  F  728



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold972-size605373-augustus-gene-5.3-mRNA-1

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K2X8_DROME  unnamed protein product                                 391     5e-136
SEC13_DROME  unnamed protein product                                  153     3e-43 
SEC13_CAEEL  unnamed protein product                                  126     2e-33 


>Q7K2X8_DROME unnamed protein product
Length=354

 Score = 391 bits (1004),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 197/368 (54%), Positives = 257/368 (70%), Gaps = 37/368 (10%)

Query  1    MFEAQSINAEHKDLIHDVAYDYYGQRMATCSSDQFVKVWDQDEQDTWHMTASWKAHSGSV  60
            MF+ + I A+HKD+IHDV +DYYG+RMATCSSDQ VK+WD+D Q  W++T+SWKAHSGS+
Sbjct  1    MFDVEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSI  60

Query  61   WKVTWAHPEFGQVLATCSFDRTAAVWEEIVGEGSVPGERGMRHWVRRTNLVDSRTSVTDV  120
            W+V+WAHPEFGQV+ATCSFDRTA+VWEE++GE         R WVRRT LVDSRTSVTDV
Sbjct  61   WRVSWAHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDV  120

Query  121  KFAPKSLGLLLATCSADGVVRIYEAPDVMNLS-----------------------HTHPP  157
            +FAPK LGLLLAT SADG++RIYEAPD+MNLS                       +    
Sbjct  121  EFAPKYLGLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTYMVTQ  180

Query  158  MLAVGSDDPNQSAGSKVFIYEYSENMRRWNKTESLSAVTNPVHDIAFAPNLGRSFHLLAI  217
            +LA GSD+     G KVF++ YSEN R+  K ++++ +T+PV D+AFAPN GR+FH+LA+
Sbjct  181  LLAAGSDEAATPTG-KVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAV  239

Query  218  AAKDIRIVTLRPQLDSTEAQSGLPKLDVEITAHFDDHYNTVWRVCWNITGTILASSGDDG  277
            A+KD+ IV LR   D+T+    + KLD++ T  F +H   VWRVCWN+  T+L S+GDDG
Sbjct  240  ASKDLYIVNLRGVTDATD----ISKLDIQ-TIKFSEHNCPVWRVCWNMLATMLISTGDDG  294

Query  278  CVRLWKANYLGQWKCVLVLKGDGTQAQSDPATPAVPIPVSVATSTSQGSTTRYYKLGTIS  337
            CVRLW+ NY  QW+C  VLK +G+    +PA P      +   +T+  +T ++YK GTI 
Sbjct  295  CVRLWRMNYNRQWRCAAVLKAEGSGPTYEPAPP------TPTLATTASATAKFYKKGTIG  348

Query  338  NPSHVPWH  345
            N   VPWH
Sbjct  349  N--QVPWH  354


>SEC13_DROME unnamed protein product
Length=356

 Score = 153 bits (386),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/333 (31%), Positives = 152/333 (46%), Gaps = 49/333 (15%)

Query  5    QSINAEHKDLIHDVAYDYYGQRMATCSSDQFVKVWDQDEQDTWHMTASWKAHSGSVWKVT  64
            Q I+ EH+D++H  A D+YG  +ATCSSD  V+++   + +     A  K H G VW+V 
Sbjct  6    QEIDTEHEDMVHHAALDFYGLLLATCSSDGSVRIFHSRKNNK--ALAELKGHQGPVWQVA  63

Query  65   WAHPEFGQVLATCSFDRTAAVWEEIVGEGSVPGERGMRHWVRRTNLVDSRTSVTDVKFAP  124
            WAHP+FG +LA+CS+DR   VW+              R W +     +  +SV  V FAP
Sbjct  64   WAHPKFGNILASCSYDRKVIVWKSTTP----------RDWTKLYEYSNHDSSVNSVDFAP  113

Query  125  KSLGLLLATCSADGVVRI------YEAPDVMNLSHTHPPMLAVGSDDPNQ----------  168
               GL+LA  S+DG V +      Y   D   + + H   +   S  P Q          
Sbjct  114  SEYGLVLACASSDGSVSVLTCNTEYGVWDAKKIPNAHTIGVNAISWCPAQAPDPAFDQRV  173

Query  169  -----------SAGSKVFIYEYSENMRRWNKTESLSAVTNPVHDIAFAPNLGRSFHLLAI  217
                       S G    +  + E+  RW +   L A ++ V D+A+AP++G     +A 
Sbjct  174  TSRSAAVKRLVSGGCDNLVKIWREDNDRWVEEHRLEAHSDWVRDVAWAPSIGLPRSQIAT  233

Query  218  AAKDIRIVTLRPQLDSTEAQSGLPKLDVEITAHFDDHYNTVWRVCWNITGTILASSGDDG  277
            A++D  ++      D +E  S        +   FDD    VW + W+ TG ILA +G D 
Sbjct  234  ASQDRHVIVWSSNADLSEWTS-------TVLHTFDD---AVWSISWSTTGNILAVTGGDN  283

Query  278  CVRLWKANYLGQWKCVLVLKGDGTQAQSDPATP  310
             V LWK N  GQW  +    G   Q++     P
Sbjct  284  NVTLWKENTEGQWIRINYESGTAIQSKQPSHLP  316


>SEC13_CAEEL unnamed protein product
Length=313

 Score = 126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 88/305 (29%), Positives = 141/305 (46%), Gaps = 40/305 (13%)

Query  5    QSINAEHKDLIHDVAYDYYGQRMATCSSDQFVKVWDQDEQDTWHMTASWKAHSGSVWKVT  64
            Q I+ +H+D IHD   + YG R+ATC SD+ VK+++       +  A    HSG VWKV+
Sbjct  6    QRIDTQHRDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVS  65

Query  65   WAHPEFGQVLATCSFDRTAAVWEEIVGEGSVPGERGMRHWVRRTNLVDSRTSVTDVKFAP  124
            WAHP++G +LA+ S+D+   +W E  G            W +         S T V FAP
Sbjct  66   WAHPKYGGLLASASYDKKVIIWNEQQGR-----------WQKAYEWAAHEASTTCVAFAP  114

Query  125  KSLGLLLATCSADGVVRIYEAPDVMN------LSHTHPPML-----AVGSDDPNQ-----  168
               GL+LA+ SADG + I    +  N      +   H   +     A GS DP       
Sbjct  115  HQYGLMLASASADGDIGILRYDNSSNEWISSKIQKCHEQGVNSVCWAPGSADPAAKKRLV  174

Query  169  SAGS--KVFIYEYSENMRRWNKTESLSAVTNPVHDIAFAPNLGRSFHLLAIAAKDIRIVT  226
            SAG+   V I+ + +    W   ++L+  T+ V + A+ P      H +     +  +V 
Sbjct  175  SAGNDKNVKIWAFDDATNEWILEKTLAGHTDFVREAAWCPVTNNGQHTIVSCGMEGNLVL  234

Query  227  LR-PQLDSTEAQSGLPKLDVEITAHFDDHYNTVWRVCWNITGTILASSGDDGCVRLWKAN  285
             R   +++ E ++ L  L+    A +   ++          G+ L+ +GDD  + +W+ N
Sbjct  235  FRTSNIETEEWKAKL--LETAPCALYHSSFSPC--------GSFLSVAGDDNVITIWREN  284

Query  286  YLGQW  290
              GQW
Sbjct  285  LQGQW  289



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold55894-size10662-processed-gene-0.0-mRNA-1

Length=183


***** No hits found *****



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold2382-size463072-augustus-gene-3.10-mRNA-1

Length=841
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q20046_CAEEL  unnamed protein product                                 320     7e-96
Q20531_CAEEL  unnamed protein product                                 38.5    0.031
A8JTM7_DROME  unnamed protein product                                 33.1    1.3  


>Q20046_CAEEL unnamed protein product
Length=897

 Score = 320 bits (820),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 239/802 (30%), Positives = 382/802 (48%), Gaps = 69/802 (9%)

Query  31   CTRNNYFCSRVLKCLPCDSSKNLQPTDDKLTCICN-DKSRIVENSLADFPKCELCPKGQV  89
            CTR  YF    L+C  C ++    P+DD ++C C+ ++  I  N     P CE CP+G +
Sbjct  5    CTRLQYFNRIELRCEICPNTT--IPSDDMMSCKCSKNQIEIFRNGFV--PTCEECPEGTL  60

Query  90   PTFDKQDCIPCLHVRLPANLTICKSCSLQEIEADRHENGSLRKNKT-CISCGPNSIPSSD  148
             + D+  C+ C       N   C  C  Q     R  +G+L  N   C +C      + +
Sbjct  61   SSPDQTGCLNC-------NNGTCH-CPSQSTLIFRDASGNLLTNDAFCGNCASGFYRNDN  112

Query  149  GRSCIPCTSGTLTVSGKNCSCPAASHETVNGVCVARTLLADWPDDKTAYLVETLSLKKVE  208
            G  C  C +    ++  N        +  NGV                         +++
Sbjct  113  GY-CTKCETSCSEMNSTNSDQVYTRIKLQNGV-------------------------EMK  146

Query  209  SLFLKKHLRLAVYLCKLKNVKACQAVANMCAMVLYQSDYKTSPCRLFKDARHIPTTDGGS  268
            S++++ HL     LC  +N+++C+A+ NMC +  ++S    + C L ++ + +      +
Sbjct  147  SIYIENHLSTDAKLCSERNIQSCEAMVNMCVLQNFESGSSLNACGLLENIKRLFNPWQNT  206

Query  269  LPWLFYGEGDAPTVLNRKKIVMKYSLNHHSQNGMLNLTAASYGPDGQFMGLRALPGSFLQ  328
            L  L     D   + N   I  +Y     S      L  A Y  +G F G       FL 
Sbjct  207  LDAL--ATTDDSELENENVIDHQYLFRPDSS---FELFFARYDVNGTFDGFFTSEDIFLH  261

Query  329  LCPGSWHVEDKVLRFGLQFSRTCSVPASQLLAAG-DAQFLDLYLQFW-EGANSVLYALPV  386
             C  S +     L FG ++ + C +  +       + +  ++YL+F  E  +S LY  PV
Sbjct  262  FCDDSLNPFAPFL-FGRRYQKECKIRKATFTDPRLERKLFEVYLKFSDEQGHSKLY--PV  318

Query  387  LVLNAVSR--GEHINKAS-DQSQWQLVRRFFMIDKLIGMKPDQNHPAFVRYVKNIQLRVR  443
             +LN+  R  G+ +N A+ D+++W L RRF++ D    MK D N    +R+   I + V 
Sbjct  319  HILNSAVRVNGQLLNFANKDRNRWVLTRRFYLFDDY-SMKFD-NSSKLMRFAAKIGINV-  375

Query  444  VRGSSEEGRIYPPLIVVEYGELTHEDIHANKLVSLTFSTEYHMDNNFY-YAIEVSVGVLS  502
            V     +G I PP + +EY + T E I  N L  +     YH D++ Y   + +++ ++ 
Sbjct  376  VLQKERDGYINPPYLTIEYDDSTDE-IFENSLEII-----YHKDSSGYDQKLIIALSIII  429

Query  503  ALAVVWAGLETWSVSRRSGQ-STIDLLTLGRVALFSCGHLASVFFCVV-VCACTHSFIFY  560
             +++ W+ L ++S  RR G+ S +D  ++    +     L  VFF +    AC  +F  Y
Sbjct  430  PMSLFWSALCSYSWGRRQGKPSAVDASSILYFFVCEVSILGDVFFVLFGFIACWTTFA-Y  488

Query  561  KGQSTVHSLLPSPAQEQLITSYIISAFVLKGVAVVHMIWHQVSVDIFFIDWERPRARSSV  620
            K Q+ V   + S  QE+ +  Y I++ VLK   ++  +   V  + FFIDWER + R + 
Sbjct  489  KSQTYVLYNMLSYDQEKFLFHYFIASLVLKFFGLLFTMGALVFQETFFIDWERQKLRQTD  548

Query  621  --GTLPPRDASSDPGLQPVSVWRTYFVGNEWNEIQTSRKISLVFQLLCTLFLLEVVGLKY  678
              G    RD       +PV VWRTY + NEWNE+Q  RK SL  Q++  + L+E   +K 
Sbjct  549  EHGMPLSRDLHKSTEAEPVVVWRTYLIANEWNELQQYRKTSLALQVITMILLMEYFQVKN  608

Query  679  WATSDPELHLSPPVYMQHSLHSMTCRFAVGVLVYLLVYVMQWLFMVVIYERYIKNELHSF  738
            +A  +PE           +L ++    AV + VYL + ++Q L  V+I ER + +  H+F
Sbjct  609  YALVEPEFE-RDAFDSSTTLSTLASSLAVTIFVYLSLALLQVLVRVLIVERIVTDPFHNF  667

Query  739  VDICSMSNISVFIMAWENYGFYIHGRSAHGFADTDMQTMLRQLQREEEDLCGHRGLLPGS  798
            VD+CS+SNISV  +    YG+YIHGRS HG  D  M  M   LQRE  +LCG RGL PGS
Sbjct  668  VDLCSLSNISVLSLTHSLYGYYIHGRSVHGKGDAGMSEMNEFLQRERNNLCGFRGLEPGS  727

Query  799  DHQTFEMAVPFQLRGYYRKVIS  820
            + QTF + +P   R  Y ++ +
Sbjct  728  ELQTFTVNLPNLFRSKYDEIFA  749


>Q20531_CAEEL unnamed protein product
Length=3514

 Score = 38.5 bits (88),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 72/189 (38%), Gaps = 20/189 (11%)

Query  80    KCELCPKGQV-PTFDKQDCIPCLHVRLPANLTICKSCSLQEIEADRHENGSLRKNKTCIS  138
             +CELCP G+  P   + +C  C   ++ A+         ++     H+  SL  +  C++
Sbjct  3090  ECELCPIGEYQPLTARTECFKCAPGQITASEGAISEGECKDNCPPGHQYDSLTSD--CVT  3147

Query  139   CGPNSI-PSSDGRSCIPCTSGTLTVSGKNCS-------CPAASHETVNGVCVARTLLADW  190
             CG     PS+    CIPC  G  T+S    S       CP     + +GVC    +    
Sbjct  3148  CGYGYYQPSAGAFECIPCGIGKTTLSEFATSEDECRDECPDGEQLSASGVCQPCQIGTYR  3207

Query  191   PDDKTAYLVETLSLKKVESLFLKKHLRLAVYLCK-----LKNVKACQAVANMCAMVLYQS  245
                +    V        E+    +  +     CK     +K  K CQ     C    +Q+
Sbjct  3208  SRGENKKCVACPPGTTTEATMSTRREQCNTPKCKPGQFLVKETKNCQ----FCPRGTFQN  3263

Query  246   DYKTSPCRL  254
             + + S C+L
Sbjct  3264  EEQESTCKL  3272


>A8JTM7_DROME unnamed protein product
Length=4769

 Score = 33.1 bits (74),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 54/233 (23%), Positives = 84/233 (36%), Gaps = 64/233 (27%)

Query  18    YCGEVQPYADVRECTRNNYFCSRVLKCLPCDSSKNLQ------PTDDKLT--CICNDKSR  69
             Y  EVQ  AD + C RNN  C ++   +P  +S          P+  +L   C C    R
Sbjct  1068  YSHEVQRIADTQPCHRNNGGCQKICFAVPIGASNGTDGVTTSSPSFGRLQSRCSCPYGER  1127

Query  70    IVENSLADFPK------CELCPKGQVPTFDKQDCIP--------------------CLHV  103
             + ++ ++  P        + CP     T + Q CIP                    C   
Sbjct  1128  LADDQVSCIPDPSAEPPVQPCPNSWDFTCNNQRCIPKSWLCDGDDDCLDNSDEEQNCTKP  1187

Query  104   RLPANLTICKS--CSLQEIEADRHEN-GSLRKNKTC--ISCGPNSIPSSDGRSCIP----  154
                +N   C+S  C  Q    D+  + G     + C  ++CG +    ++GR CIP    
Sbjct  1188  TCGSNEFQCRSGRCIPQNFRCDQENDCGDNSDEQECGNVTCGTSQFACANGR-CIPNMWK  1246

Query  155   CTS----GTLTVSGKNC----------SCPAASHETVNGVCVARTLLADWPDD  193
             C S    G  +  G  C          +CP   H      C+ ++ + D  DD
Sbjct  1247  CDSENDCGDSSDEGDFCAEKTCAYFQFTCPRTGH------CIPQSWVCDGDDD  1293



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold2215-size378045-augustus-gene-2.5-mRNA-1

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I206_PLAF7  unnamed protein product                                 36.6    0.024
NEMF_DROME  unnamed protein product                                   32.7    0.50 
Q8IBD1_PLAF7  unnamed protein product                                 32.3    0.63 


>Q8I206_PLAF7 unnamed protein product
Length=428

 Score = 36.6 bits (83),  Expect = 0.024, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 43/87 (49%), Gaps = 2/87 (2%)

Query  4    GKSEKVMSVGKSEKDISVGK-SEVMSVGKSEKDISVGKSEKDTSVGKSEKDTSVG-KSEV  61
            GK E+V   GK E+    GK  EV   GK E+    GK E+    GK E+    G K EV
Sbjct  325  GKKEEVKQEGKKEEVKQEGKKEEVKQEGKKEEVKQEGKKEEVKQGGKKEEVKQGGKKEEV  384

Query  62   MSVGKSEKVMSVGKSEKVVSVGKSEVI  88
               GK E+V   GK E+V   GK E +
Sbjct  385  KQGGKKEEVKQGGKKEEVKQGGKKEEV  411


>NEMF_DROME unnamed protein product
Length=992

 Score = 32.7 bits (73),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 80/191 (42%), Gaps = 34/191 (18%)

Query  128  VDEEISSDEGIPIDVGILVDERISIDKILTDAQNDVTKLKSFIASVSNRIEKGA------  181
            VDE  S+ E   ID+  L  ER ++ K L++ +ND  K    +  V +   K A      
Sbjct  326  VDEFYSTQESQKIDMKTLQQEREALKK-LSNVKNDHAKRLEELTKVQDVDRKKAELITSN  384

Query  182  AGVIRNAYGAFDKAAAQRL---------QHGGAVGSHVSECIDSLKGSVNNDSLVRSRGV  232
              ++ NA  A   A A +L         +   A G  V+  I  LK   N+ SL+ S   
Sbjct  385  QSLVDNAIRAVQSAIASQLSWPDIHELVKEAQANGDAVASSIKQLKLETNHISLMLSDPY  444

Query  233  GTCITS----------EVDSALS-------DVETLLSAAQSAERDIDAARAAL-SACDKI  274
                            +VD ALS         +   SAAQ  ++ +DA++ AL SA  K 
Sbjct  445  DNDEDDDLKDPEVTVVDVDLALSAWANARRYYDMKRSAAQKEKKTVDASQKALKSAERKT  504

Query  275  KNVLKKVECVA  285
            +  LK+V  ++
Sbjct  505  QQTLKEVRTIS  515


>Q8IBD1_PLAF7 unnamed protein product
Length=675

 Score = 32.3 bits (72),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 36/50 (72%), Gaps = 3/50 (6%)

Query  18   DISVGKSEVMSVGKSEKDISVGKSEKDTSVGKSEKDTSVGKSEVMSVGKS  67
            D++VGK+E ++V K+E  ++VGK+E D +V K+E D +V K+  ++  K+
Sbjct  463  DVNVGKTEALNVAKTEG-LNVGKTE-DLNVAKTE-DLNVAKTADLNAEKT  509



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold1147-size1112965-processed-gene-8.0-mRNA-1

Length=365
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O77375_PLAF7  unnamed protein product                                 60.8    9e-10
Q9VJD7_DROME  unnamed protein product                                 59.3    2e-09
RPB1_DROME  unnamed protein product                                   49.7    3e-06


>O77375_PLAF7 unnamed protein product
Length=2457

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 31/114 (27%), Positives = 43/114 (38%), Gaps = 11/114 (10%)

Query  35    APGYPPQALSYPAQASGFQPQVPG-----------YPAKAPGYPQQAPGYPPQALSYPAQ  83
             +P Y P + +Y A  + + P  P            Y   +P Y   +P Y P +  Y   
Sbjct  2246  SPSYSPTSPTYNANNAYYSPTSPKNQNDQMNVNSQYNVMSPVYSVTSPKYSPTSPKYSPT  2305

Query  84    VPGYPAKAPGYPQQAPGYSPQDAGFQSQAPGYPQQVPAYKPHIPGSHPQSRQGQ  137
              P Y   +P Y   +P YSP    +   +P Y    P Y P  P   P S   Q
Sbjct  2306  SPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPVAQ  2359


 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 38/165 (23%), Positives = 59/165 (36%), Gaps = 16/165 (10%)

Query  15    SGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAKAPGYPQQAPGYP  74
             S +    P Y   +P Y   +P Y P +  Y   +  + P  P Y   +P Y   +P Y 
Sbjct  2279  SQYNVMSPVYSVTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYS  2338

Query  75    PQALSYPAQVPGYPAKAP-----------GYPQQAPGYSPQDAGFQSQAPGYPQQ--VPA  121
             P +  Y    P Y   +P            Y   +P +SP    +   +P Y +   V A
Sbjct  2339  PTSPKYSPTSPKYSPTSPVAQNIASPNYSPYSITSPKFSPTSPAYSISSPVYDKSGVVNA  2398

Query  122   YKPHIPG---SHPQSRQGQLNDFTEVHVDQPGLLIQPGEDDTFGP  163
             ++P  P      P   +  + D       Q   + +   DD F P
Sbjct  2399  HQPMSPAYILQSPVQIKQNVQDANMFSPIQQAHVDEAKNDDPFSP  2443


 Score = 58.5 bits (140),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/114 (25%), Positives = 43/114 (38%), Gaps = 3/114 (3%)

Query  14    ASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAKAPGYPQQAPGY  73
             +  + P  P Y A    Y   +P      ++  +Q   +    P Y   +P Y   +P Y
Sbjct  2246  SPSYSPTSPTYNANNAYYSPTSPKNQNDQMNVNSQ---YNVMSPVYSVTSPKYSPTSPKY  2302

Query  74    PPQALSYPAQVPGYPAKAPGYPQQAPGYSPQDAGFQSQAPGYPQQVPAYKPHIP  127
              P +  Y    P Y   +P Y   +P YSP    +   +P Y    P Y P  P
Sbjct  2303  SPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSP  2356


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 40/103 (39%), Gaps = 6/103 (6%)

Query  3     YSQQAQGFQPQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSY-PAQASGFQPQVPGYPA  61
             YS  +  + P +  + P  P Y   +P Y   +P Y P +  Y P          P Y  
Sbjct  2309  YSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPKYSPTSPVAQNIASPNYSP  2368

Query  62    KAPGYPQQAPGYPPQALSYPAQ-----VPGYPAKAPGYPQQAP  99
              +   P+ +P  P  ++S P       V  +   +P Y  Q+P
Sbjct  2369  YSITSPKFSPTSPAYSISSPVYDKSGVVNAHQPMSPAYILQSP  2411


>Q9VJD7_DROME unnamed protein product
Length=494

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 40/106 (38%), Gaps = 0/106 (0%)

Query  2    TYSQQAQGFQPQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPA  61
            T +++    +P   G+     GYP    GYP    GYP     YP+   G+     GYP 
Sbjct  112  TNNERNPATEPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPV  171

Query  62   KAPGYPQQAPGYPPQALSYPAQVPGYPAKAPGYPQQAPGYSPQDAG  107
               GYP    GYP     YP    G P    G P    G    + G
Sbjct  172  NNGGYPANNGGYPANNGGYPTTNVGNPTNNGGNPTTNFGNPTNNGG  217


 Score = 58.9 bits (141),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 38/99 (38%), Gaps = 0/99 (0%)

Query  18   QPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAKAPGYPQQAPGYPPQA  77
            +P   GY     GYP    GYP     YP+   G+     GYP    GYP    GYP   
Sbjct  121  EPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANN  180

Query  78   LSYPAQVPGYPAKAPGYPQQAPGYSPQDAGFQSQAPGYP  116
              YPA   GYP    G P    G    + G  +   G P
Sbjct  181  GGYPANNGGYPTTNVGNPTNNGGNPTTNFGNPTNNGGNP  219


 Score = 56.2 bits (134),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 36/99 (36%), Gaps = 0/99 (0%)

Query  9    GFQPQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAKAPGYPQ  68
            G+     G+     GYP    GYP    GYP     YP    G+     GYPA   GYP 
Sbjct  126  GYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGYPA  185

Query  69   QAPGYPPQALSYPAQVPGYPAKAPGYPQQAPGYSPQDAG  107
               GYP   +  P    G P    G P    G    + G
Sbjct  186  NNGGYPTTNVGNPTNNGGNPTTNFGNPTNNGGNPTTNVG  224


 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 36/100 (36%), Gaps = 0/100 (0%)

Query  3    YSQQAQGFQPQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAK  62
            Y+    G+     G+     GYP+   GYP    GYP     YP    G+     GYPA 
Sbjct  127  YTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANNGGYPAN  186

Query  63   APGYPQQAPGYPPQALSYPAQVPGYPAKAPGYPQQAPGYS  102
              GYP    G P      P    G P    G P    G S
Sbjct  187  NGGYPTTNVGNPTNNGGNPTTNFGNPTNNGGNPTTNVGSS  226


 Score = 52.0 bits (123),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 33/90 (37%), Gaps = 0/90 (0%)

Query  29   PGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQVPGYP  88
            P   ++ P   P    Y     G+     GYP    GYP    GYP     YP    GYP
Sbjct  111  PTNNERNPATEPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYP  170

Query  89   AKAPGYPQQAPGYSPQDAGFQSQAPGYPQQ  118
                GYP    GY   + G+ +   G P  
Sbjct  171  VNNGGYPANNGGYPANNGGYPTTNVGNPTN  200


 Score = 49.3 bits (116),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/91 (31%), Positives = 36/91 (40%), Gaps = 6/91 (7%)

Query  53   QPQVPGYPAKAPGYPQQAPGYPPQALSYPAQVPGYPAKAPGYPQQAPGYSPQDAGFQSQA  112
            +P   GY     GYP    GYP     YP+   GYP+   GYP    GY   + G+ +  
Sbjct  121  EPNNGGYTTPNGGYPVNNGGYPVNNGGYPSNNGGYPSNNGGYPVNNGGYPVNNGGYPANN  180

Query  113  PGYPQQVPAY------KPHIPGSHPQSRQGQ  137
             GYP     Y       P   G +P +  G 
Sbjct  181  GGYPANNGGYPTTNVGNPTNNGGNPTTNFGN  211


>RPB1_DROME unnamed protein product
Length=1887

 Score = 49.7 bits (117),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/112 (26%), Positives = 42/112 (38%), Gaps = 14/112 (13%)

Query  12    PQASGFQPQVPGYPAKAPGYPQQAP-------------GYPPQALSYPAQASGFQPQVPG  58
             P +  + P  P Y   +P Y   +P              Y P   +Y A +  + P +  
Sbjct  1772  PGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSI  1831

Query  59    YPAKAPGYPQQAPGYPPQALSYPAQVPGYPAKAPG-YPQQAPGYSPQDAGFQ  109
             Y   +  Y   +P Y P A +Y    P Y   AP  Y   +P YSP    F+
Sbjct  1832  YSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPTFE  1883


 Score = 49.7 bits (117),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 37/164 (23%), Positives = 51/164 (31%), Gaps = 37/164 (23%)

Query  3     YSQQAQGFQPQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQASGFQPQV------  56
             YS  +  + P +  + P  P Y   +P Y   +P Y P + +Y      + P        
Sbjct  1706  YSPTSPSYSPTSPNYTPVTPSYSPTSPNY-SASPQYSPASPAYSQTGVKYSPTSPTYSPP  1764

Query  57    -------PGYPAKAPGYPQQAPG-----------------------YPPQALSYPAQVPG  86
                    PG P   PG PQ +P                        Y P   +Y A  P 
Sbjct  1765  SPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPR  1824

Query  87    YPAKAPGYPQQAPGYSPQDAGFQSQAPGYPQQVPAYKPHIPGSH  130
             Y      Y   +  YSP    +   A  Y    P Y P  P  +
Sbjct  1825  YSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHY  1868


 Score = 39.7 bits (91),  Expect = 0.004, Method: Composition-based stats.
 Identities = 34/146 (23%), Positives = 45/146 (31%), Gaps = 44/146 (30%)

Query  24    YPAKAPGYPQQAPGYPPQALSYPAQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSYPAQ  83
             Y   +P Y   +P Y P   SY        P  P Y A +P Y   +P Y    + Y   
Sbjct  1706  YSPTSPSYSPTSPNYTPVTPSY-------SPTSPNYSA-SPQYSPASPAYSQTGVKYSPT  1757

Query  84    V-------------PGYPAKAPGYPQQAPG-----------------------YSPQDAG  107
                           PG P   PG PQ +P                        YSP  + 
Sbjct  1758  SPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGST  1817

Query  108   FQSQAPGYPQQVPAYKPHIPGSHPQS  133
             + + +P Y   +  Y P      P S
Sbjct  1818  YSATSPRYSPNMSIYSPSSTKYSPTS  1843


 Score = 38.1 bits (87),  Expect = 0.011, Method: Composition-based stats.
 Identities = 19/68 (28%), Positives = 28/68 (41%), Gaps = 1/68 (1%)

Query  2     TYSQQAQGFQPQASGFQPQVPGYPAKAPGYPQQAPGYPPQALSY-PAQASGFQPQVPGYP  60
             TYS  +  + P  S + P    Y   +P Y   A  Y P +  Y P   S + P  P Y 
Sbjct  1817  TYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYS  1876

Query  61    AKAPGYPQ  68
               +P + +
Sbjct  1877  PSSPTFEE  1884



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold9116-size57979-processed-gene-0.0-mRNA-1

Length=613
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KG94_DROME  unnamed protein product                             79.7    1e-15
Q8SY21_DROME  unnamed protein product                                 79.7    1e-15
Q9VGJ6_DROME  unnamed protein product                                 79.7    1e-15


>A0A0B4KG94_DROME unnamed protein product
Length=415

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 138/285 (48%), Gaps = 34/285 (12%)

Query  51   KRVAEIAVRNLTAAGENYGSLMLSVDAILE----SGEKLPMVAKKFPRSEYAQKMFQSPL  106
            K++    +      GENY +L+L  +  LE    S + +  +AK  P S   + +  S  
Sbjct  34   KKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENV-ASWK  92

Query  107  SMLKEIDMYEAVSPELDRIQEEAGIPPSERLHVLCACPGARLSLKDKEQVQLADKDSVLL  166
               KE + Y    PE +++ ++AG   S          G R     + Q++L D+  +++
Sbjct  93   VFYKERNTYGQYIPEFEQMYKDAGKKISF---------GPRYY---ESQIELDDE--LIV  138

Query  167  LENLVARGYATVDRTVGLDLRHTEFTLKHLARFH-ATAIAIKLKK--PQVFKDTVLRACT  223
            LE+L  RG+  VDR  GLD++HTE TL+ LA+FH A+A+  +LK   P+ +   +   C+
Sbjct  139  LEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNL---CS  195

Query  224  PFKIIAKKREEFEEIQRIFLEKLRKIPVCE-RHIDSIRKVFEKDLEYKYSDHFSTPQEPF  282
               ++   +E  E   + +++     P+ +  H+ +  + +    +  +       +  F
Sbjct  196  ---VVDSLKELRENQLKAYIDAF---PLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEF  249

Query  283  ATILHSDFWSNNMMFKYSDETGDEPIDFKIVDFQTTKYESPVRTM  327
              + H D W NN+M++Y DE G +  +   VD Q +++ SP + +
Sbjct  250  RVLNHGDAWCNNIMYQY-DEAG-KLAEVNFVDLQMSRFSSPAQDL  292


 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/280 (23%), Positives = 134/280 (48%), Gaps = 44/280 (16%)

Query  346  QEVVSYEATNLTAAGDNYGSIMVAVDVALQ----SGKALNIVAKMIPESEVVQHHFQSHL  401
            +++ S+        G+NY ++++  +  L+    S ++++ +AK++P S   + +  S  
Sbjct  34   KKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGN-RENVASWK  92

Query  402  SMRKEVDVYLLVSPEFDKIQEEHSVPSSERLHTFCHCPGARLTLQG-YDDRPLADEDSVL  460
               KE + Y    PEF+++ ++                G +++    Y +  +  +D ++
Sbjct  93   VFYKERNTYGQYIPEFEQMYKD---------------AGKKISFGPRYYESQIELDDELI  137

Query  461  LLENLKVQGYRVADRVLGQDLTHAELVMTDLAKFH-ATALAIKLKK--PDVFRSKIMKAC  517
            +LE+L  +G+R  DR  G D+ H E  +  LA+FH A+A+  +LK   P+ +   +    
Sbjct  138  VLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVV  197

Query  518  DAIKISWLTKEKDEIRTRTYLESLRVIPICEQNMSFLKARMKQYVDYSHSDEIRTTTEP-  576
            D++      KE  E + + Y+++    P+ +   S L   ++ Y   S +D++  +  P 
Sbjct  198  DSL------KELRENQLKAYIDAF---PLYD--ASHLTNDVQAYG--SQADDMFQSFAPK  244

Query  577  ----FATMVHYDLWTNNMMFRYKSETDDNPVDLKFVDFQV  612
                F  + H D W NN+M++Y  +      ++ FVD Q+
Sbjct  245  IEGEFRVLNHGDAWCNNIMYQY--DEAGKLAEVNFVDLQM  282


>Q8SY21_DROME unnamed protein product
Length=415

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 138/285 (48%), Gaps = 34/285 (12%)

Query  51   KRVAEIAVRNLTAAGENYGSLMLSVDAILE----SGEKLPMVAKKFPRSEYAQKMFQSPL  106
            K++    +      GENY +L+L  +  LE    S + +  +AK  P S   + +  S  
Sbjct  34   KKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENV-ASWK  92

Query  107  SMLKEIDMYEAVSPELDRIQEEAGIPPSERLHVLCACPGARLSLKDKEQVQLADKDSVLL  166
               KE + Y    PE +++ ++AG   S          G R     + Q++L D+  +++
Sbjct  93   VFYKERNTYGQYIPEFEQMYKDAGKKISF---------GPRYY---ESQIELDDE--LIV  138

Query  167  LENLVARGYATVDRTVGLDLRHTEFTLKHLARFH-ATAIAIKLKK--PQVFKDTVLRACT  223
            LE+L  RG+  VDR  GLD++HTE TL+ LA+FH A+A+  +LK   P+ +   +   C+
Sbjct  139  LEDLGKRGFRNVDRKNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNL---CS  195

Query  224  PFKIIAKKREEFEEIQRIFLEKLRKIPVCE-RHIDSIRKVFEKDLEYKYSDHFSTPQEPF  282
               ++   +E  E   + +++     P+ +  H+ +  + +    +  +       +  F
Sbjct  196  ---VVDSLKELRENQLKAYIDAF---PLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEF  249

Query  283  ATILHSDFWSNNMMFKYSDETGDEPIDFKIVDFQTTKYESPVRTM  327
              + H D W NN+M++Y DE G +  +   VD Q +++ SP + +
Sbjct  250  RVLNHGDAWCNNIMYQY-DEAG-KLAEVNFVDLQMSRFSSPAQDL  292


 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 64/280 (23%), Positives = 134/280 (48%), Gaps = 44/280 (16%)

Query  346  QEVVSYEATNLTAAGDNYGSIMVAVDVALQ----SGKALNIVAKMIPESEVVQHHFQSHL  401
            +++ S+        G+NY ++++  +  L+    S ++++ +AK++P S   + +  S  
Sbjct  34   KKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGN-RENVASWK  92

Query  402  SMRKEVDVYLLVSPEFDKIQEEHSVPSSERLHTFCHCPGARLTLQG-YDDRPLADEDSVL  460
               KE + Y    PEF+++ ++                G +++    Y +  +  +D ++
Sbjct  93   VFYKERNTYGQYIPEFEQMYKD---------------AGKKISFGPRYYESQIELDDELI  137

Query  461  LLENLKVQGYRVADRVLGQDLTHAELVMTDLAKFH-ATALAIKLKK--PDVFRSKIMKAC  517
            +LE+L  +G+R  DR  G D+ H E  +  LA+FH A+A+  +LK   P+ +   +    
Sbjct  138  VLEDLGKRGFRNVDRKNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVV  197

Query  518  DAIKISWLTKEKDEIRTRTYLESLRVIPICEQNMSFLKARMKQYVDYSHSDEIRTTTEP-  576
            D++      KE  E + + Y+++    P+ +   S L   ++ Y   S +D++  +  P 
Sbjct  198  DSL------KELRENQLKAYIDAF---PLYD--ASHLTNDVQAYG--SQADDMFQSFAPK  244

Query  577  ----FATMVHYDLWTNNMMFRYKSETDDNPVDLKFVDFQV  612
                F  + H D W NN+M++Y  +      ++ FVD Q+
Sbjct  245  IEGEFRVLNHGDAWCNNIMYQY--DEAGKLAEVNFVDLQM  282


>Q9VGJ6_DROME unnamed protein product
Length=449

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 138/285 (48%), Gaps = 34/285 (12%)

Query  51   KRVAEIAVRNLTAAGENYGSLMLSVDAILE----SGEKLPMVAKKFPRSEYAQKMFQSPL  106
            K++    +      GENY +L+L  +  LE    S + +  +AK  P S   + +  S  
Sbjct  68   KKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGNRENV-ASWK  126

Query  107  SMLKEIDMYEAVSPELDRIQEEAGIPPSERLHVLCACPGARLSLKDKEQVQLADKDSVLL  166
               KE + Y    PE +++ ++AG   S          G R     + Q++L D+  +++
Sbjct  127  VFYKERNTYGQYIPEFEQMYKDAGKKISF---------GPRYY---ESQIELDDE--LIV  172

Query  167  LENLVARGYATVDRTVGLDLRHTEFTLKHLARFH-ATAIAIKLKK--PQVFKDTVLRACT  223
            LE+L  RG+  VDR  GLD++HTE TL+ LA+FH A+A+  +LK   P+ +   +   C+
Sbjct  173  LEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNL---CS  229

Query  224  PFKIIAKKREEFEEIQRIFLEKLRKIPVCE-RHIDSIRKVFEKDLEYKYSDHFSTPQEPF  282
               ++   +E  E   + +++     P+ +  H+ +  + +    +  +       +  F
Sbjct  230  ---VVDSLKELRENQLKAYIDAF---PLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEF  283

Query  283  ATILHSDFWSNNMMFKYSDETGDEPIDFKIVDFQTTKYESPVRTM  327
              + H D W NN+M++Y DE G +  +   VD Q +++ SP + +
Sbjct  284  RVLNHGDAWCNNIMYQY-DEAG-KLAEVNFVDLQMSRFSSPAQDL  326


 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/280 (23%), Positives = 133/280 (48%), Gaps = 44/280 (16%)

Query  346  QEVVSYEATNLTAAGDNYGSIMVAVDVALQ----SGKALNIVAKMIPESEVVQHHFQSHL  401
            +++ S+        G+NY ++++  +  L+    S ++++ +AK++P S   + +  S  
Sbjct  68   KKIKSFRLEPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILPNSGN-RENVASWK  126

Query  402  SMRKEVDVYLLVSPEFDKIQEEHSVPSSERLHTFCHCPGARLTLQG-YDDRPLADEDSVL  460
               KE + Y    PEF+++ ++                G +++    Y +  +  +D ++
Sbjct  127  VFYKERNTYGQYIPEFEQMYKD---------------AGKKISFGPRYYESQIELDDELI  171

Query  461  LLENLKVQGYRVADRVLGQDLTHAELVMTDLAKFH-ATALAIKLKK--PDVFRSKIMKAC  517
            +LE+L  +G+R  DR  G D+ H E  +  LA+FH A+A+  +LK   P+ +   +    
Sbjct  172  VLEDLGKRGFRNVDRQNGLDIQHTEATLEKLAQFHAASAVRFELKGSYPEEYNQNLCSVV  231

Query  518  DAIKISWLTKEKDEIRTRTYLESLRVIPICEQNMSFLKARMKQYVDYSHSDEIRTTTEP-  576
            D++      KE  E + + Y+++  +      + S L   ++ Y   S +D++  +  P 
Sbjct  232  DSL------KELRENQLKAYIDAFPLY-----DASHLTNDVQAYG--SQADDMFQSFAPK  278

Query  577  ----FATMVHYDLWTNNMMFRYKSETDDNPVDLKFVDFQV  612
                F  + H D W NN+M++Y  +      ++ FVD Q+
Sbjct  279  IEGEFRVLNHGDAWCNNIMYQY--DEAGKLAEVNFVDLQM  316



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold4724-size192311-processed-gene-0.5-mRNA-1

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RZ8_DROME  unnamed protein product                                 248     5e-77
A1Z8L3_DROME  unnamed protein product                                 249     2e-76
Q9VTX2_DROME  unnamed protein product                                 157     2e-42


>Q95RZ8_DROME unnamed protein product
Length=567

 Score = 248 bits (632),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 182/303 (60%), Gaps = 28/303 (9%)

Query  64   DYTTVYQLVRHEDQRTPEDFFQHAAMAVFLFRCLQLGGYFGQSRAGGDRTLTADEQFLGG  123
            D+  V QL RH+ +R P +FFQH  MA FL  CL+ GGYFG      + ++      +  
Sbjct  283  DFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSI------ICS  336

Query  124  LLLRHLQLVQFNSHGVAELN-LAACGKPHTGESTVIGAGLYPTLALFNHSCELNVGKYFR  182
            L+LR LQ +QFN+H VAEL+  ++ G+    +S  IG  +YPTLALFNHSC+  V +YFR
Sbjct  337  LVLRSLQFIQFNTHEVAELHKFSSSGR---EKSIFIGGAIYPTLALFNHSCDPGVVRYFR  393

Query  183  GTCVVVRMAKTVLAGEMVAENYGPIFTQTVLAGEMVADNYGQIFTQVQRDERRSTLQERY  242
            GT + +   + + AG  + ENYGP++                  TQ +R ER++ L++ Y
Sbjct  394  GTTIHINSVRPIEAGLPINENYGPMY------------------TQDERSERQARLKDLY  435

Query  243  WFRCQCRPCEEDWPLLKDLDPRFVQFRCGASSSCRAVIRVPVDTLDFIVQCPSCGSYMNI  302
            WF C C  C ++WP   DL    ++FRC A ++C AVI VP    DF+V+C +CG   NI
Sbjct  436  WFECSCDACIDNWPKFDDLPRDVIRFRCDAPNNCSAVIEVPPSCNDFMVKCVTCGEITNI  495

Query  303  MKGLKTVQETDKMFQAASRLMESDWAPEALVKFLEVLRLLDKVLVLPFPDYHLCQQAVHY  362
            +KGLK +Q+T+ M + A RL E+   P+AL KF++++R++ +VL  PFPD+   QQ +  
Sbjct  496  LKGLKVMQDTEMMTRTAKRLYETGEYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHLKD  555

Query  363  CIL  365
            C L
Sbjct  556  CFL  558


>A1Z8L3_DROME unnamed protein product
Length=660

 Score = 249 bits (635),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/303 (41%), Positives = 182/303 (60%), Gaps = 28/303 (9%)

Query  64   DYTTVYQLVRHEDQRTPEDFFQHAAMAVFLFRCLQLGGYFGQSRAGGDRTLTADEQFLGG  123
            D+  V QL RH+ +R P +FFQH  MA FL  CL+ GGYFG      + ++      +  
Sbjct  376  DFRRVAQLERHQGERQPSNFFQHVLMARFLTNCLRAGGYFGSEPKPDEVSI------ICS  429

Query  124  LLLRHLQLVQFNSHGVAELN-LAACGKPHTGESTVIGAGLYPTLALFNHSCELNVGKYFR  182
            L+LR LQ +QFN+H VAEL+  ++ G+    +S  IG  +YPTLALFNHSC+  V +YFR
Sbjct  430  LVLRSLQFIQFNTHEVAELHKFSSSGR---EKSIFIGGAIYPTLALFNHSCDPGVVRYFR  486

Query  183  GTCVVVRMAKTVLAGEMVAENYGPIFTQTVLAGEMVADNYGQIFTQVQRDERRSTLQERY  242
            GT + +   + + AG  + ENYGP++                  TQ +R ER++ L++ Y
Sbjct  487  GTTIHINSVRPIEAGLPINENYGPMY------------------TQDERSERQARLKDLY  528

Query  243  WFRCQCRPCEEDWPLLKDLDPRFVQFRCGASSSCRAVIRVPVDTLDFIVQCPSCGSYMNI  302
            WF C C  C ++WP   DL    ++FRC A ++C AVI VP    DF+V+C +CG   NI
Sbjct  529  WFECSCDACIDNWPKFDDLPRDVIRFRCDAPNNCSAVIEVPPSCNDFMVKCVTCGEITNI  588

Query  303  MKGLKTVQETDKMFQAASRLMESDWAPEALVKFLEVLRLLDKVLVLPFPDYHLCQQAVHY  362
            +KGLK +Q+T+ M + A RL E+   P+AL KF++++R++ +VL  PFPD+   QQ +  
Sbjct  589  LKGLKVMQDTEMMTRTAKRLYETGEYPKALAKFVDLIRIMYEVLAPPFPDFCESQQHLKD  648

Query  363  CIL  365
            C L
Sbjct  649  CFL  651


>Q9VTX2_DROME unnamed protein product
Length=663

 Score = 157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 157/295 (53%), Gaps = 22/295 (7%)

Query  70   QLVRHEDQRTPEDFFQHAAMAVFLFRCLQLGGYFGQSRAGGDRTLTADEQFLGGLLLRHL  129
             L  HE+ R P+D+ + A M+ FL R LQ   YFG+ +  G    TA E  +   LL  L
Sbjct  379  HLCSHEEDRQPDDYLRRALMSGFLLRILQKSLYFGRRKTEGVNP-TAVELQVATALLGLL  437

Query  130  QLVQFNSHGVAELNLAACGKPHTGESTVIGAGLYPTLALFNHSCELNVGKYFRGTCVVVR  189
            Q++Q+N+H + +  +    +    ++  + AGLY T + FNH C  +   +F G  +V+ 
Sbjct  438  QVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFVGKKLVLT  497

Query  190  MAKTVLAGEMVAENYGPIFTQTVLAGEMVADNYGQIFTQVQRDERRSTLQERYWFRCQCR  249
              +   A E+VA NYGPIF +  L                   ER+ +L+ RY F C C 
Sbjct  498  ATRPHRANELVAVNYGPIFIKNNL------------------KERQRSLRGRYSFSCSCM  539

Query  250  PCEEDWPLLKDLDPRFVQFRCGASSSCRAVIRVPVDTLDFIVQCPSCGSYMNIMKGLKTV  309
             C+E+WPLL+ LD + V+F C  S++C  +++ P D L   V+CP C   +++ + +  +
Sbjct  540  ACQENWPLLQKLDKQ-VRFWC-TSANCSNLLKFPKD-LAKDVRCPRCRKNISLKESVAKM  596

Query  310  QETDKMFQAASRLMESDWAPEALVKFLEVLRLLDKVLVLPFPDYHLCQQAVHYCI  364
             + +++++ A+R ME+    EA+  F E L +  +V  LP  D  + QQ++H C+
Sbjct  597  IKIEELYREAARAMEAQKTVEAIELFKESLDMFFQVAALPHKDTIVAQQSLHKCL  651



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold6136-size169589-processed-gene-0.4-mRNA-1

Length=1280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP4G1_DROME  unnamed protein product                                  280     3e-82
CP4E2_DROME  unnamed protein product                                  241     8e-69
CP4E3_DROME  unnamed protein product                                  236     6e-67


>CP4G1_DROME unnamed protein product
Length=556

 Score = 280 bits (717),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 182/555 (33%), Positives = 294/555 (53%), Gaps = 28/555 (5%)

Query  745   EEMEQHCARVCVCASSCVLKHSAMSSYWLVCLVPLLVAVALLVRFR-TSRYYRLLSKLPG  803
             E +++   +    +S+ VL  S M    L  LV  LVA+AL   +R  SR YR+++ +P 
Sbjct  4     EVVQETLQQAASSSSTTVLGFSPM----LTTLVGTLVAMALYEYWRRNSREYRMVANIPS  59

Query  804   PRGLPLIGNLLSVLAHTNC-ILDYIMKIRNEYGLIYVSWMGPNALVLLCDPRDIEIVLNS  862
             P  LP++G        +N  IL   +   N+YG    +W+G   LV L +P DIE++L+ 
Sbjct  60    PPELPILGQAHVAAGLSNAEILAVGLGYLNKYGETMKAWLGNVLLVFLTNPSDIELILSG  119

Query  863   NECLSKPAPYRIVELLTGYSVLTARREDWKRYRKIMLSSFSSQTVATFVPTFNEKAK-VL  921
             ++ L+K   YR  +   G  +L +    W+ +RK++  +F    + +FVPTF + +K V+
Sbjct  120   HQHLTKAEEYRYFKPWFGDGLLISNGHHWRHHRKMIAPTFHQSILKSFVPTFVDHSKAVV  179

Query  922   ARVIRNRADRREFDILSTMMVCTLDIVTDTSLGVNMNLLDENRVEVAESFHIIRDVLFSA  981
             AR+       + FD+   M   T+DI+  T++GV          E A++   + D++   
Sbjct  180   ARMGLEAG--KSFDVHDYMSQTTVDILLSTAMGVKKLPEGNKSFEYAQAVVDMCDIIHKR  237

Query  982   FMRPWYWVPSLLKKTPSYKK--------IVSDIQTLWDFADNIIARKLLSLEKSNASVCR  1033
              ++  Y + S+ K T   +K        +    + + D  +N        +E+ +  V  
Sbjct  238   QVKLLYRLDSIYKFTKLREKGDRMMNIILGMTSKVVKDRKENFQEESRAIVEEISTPVAS  297

Query  1034  RPSSQ-ENLDHALET-------PKKYLGFLDHVISCMRSQSDLLTSTELKDNTATVIISG  1085
              P+S+ E L   L+         K+ L  LD ++   ++        ++ D   T++  G
Sbjct  298   TPASKKEGLRDDLDDIDENDVGAKRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEG  357

Query  1086  MDTSSIVMSAVLMLLGLHQDVQRKVVTEMGEIFGDDMHREVTVDDIRQMMYLEQVINETM  1145
              DT+S   S  L ++G+H+D+Q KV  E   IFGD+M R+ T  D  +M YLE+VI ET+
Sbjct  358   HDTTSAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETL  417

Query  1146  RLYPPGPAVMRVAEEEVSLTQ--YTIPKGTIIMLPIYVVHRNTEIFPDPEKFDPDRFSPE  1203
             RLYPP P + R  + ++ L    YT+PKGT +++  Y VHR  +I+P+P KFDPD F PE
Sbjct  418   RLYPPVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPE  477

Query  1204  KCASRHPYSFIPFLSGRRMCIGKKYAYVQMKTLLSTLLRNYEVLPCCSREEIEQVQFKIT  1263
             + A+RH YSFIPF +G R C+G+KYA +++K LLST++RNY ++     E   ++Q  I 
Sbjct  478   RMANRHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNY-IVHSTDTEADFKLQADII  536

Query  1264  LNFINGCKVKLTPRK  1278
             L   NG  V L  R+
Sbjct  537   LKLENGFNVSLEKRQ  551


 Score = 259 bits (661),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 160/501 (32%), Positives = 271/501 (54%), Gaps = 29/501 (6%)

Query  259  LVCLVPLLVAVALLVRFR-TRRYYRLLSKVPGPRGLPLIGILLPVLAHTNC-IIEYLMKL  316
            L  LV  LVA+AL   +R   R YR+++ +P P  LP++G        +N  I+   +  
Sbjct  28   LTTLVGTLVAMALYEYWRRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGY  87

Query  317  RDDYGLIYSGWLGPYAGVLLCDPRDYEIVLNRNECLSKPAPYRILELCFGYSAITARRED  376
             + YG     WLG    V L +P D E++L+ ++ L+K   YR  +  FG   + +    
Sbjct  88   LNKYGETMKAWLGNVLLVFLTNPSDIELILSGHQHLTKAEEYRYFKPWFGDGLLISNGHH  147

Query  377  WKRYRKVMHSSFSSQTVATFIPTFNEKAK-VLARVIRNRADRRKFDILSTMMLCTLDIVT  435
            W+ +RK++  +F    + +F+PTF + +K V+AR+       + FD+   M   T+DI+ 
Sbjct  148  WRHHRKMIAPTFHQSILKSFVPTFVDHSKAVVARMGLEAG--KSFDVHDYMSQTTVDILL  205

Query  436  DTSLGVNMNLLDENRVELAESFHIIRDVLFSAIIRPWYWVPTLFKKTPSYNK------ML  489
             T++GV          E A++   + D++    ++  Y + +++K T    K      ++
Sbjct  206  STAMGVKKLPEGNKSFEYAQAVVDMCDIIHKRQVKLLYRLDSIYKFTKLREKGDRMMNII  265

Query  490  SGL--QTLWDFADNVIAQKLLSHEKSNSSVCRRPASQEDFDQAPET--------PKKYLG  539
             G+  + + D  +N   +     E+ ++ V   PAS+++  +             K+ L 
Sbjct  266  LGMTSKVVKDRKENFQEESRAIVEEISTPVASTPASKKEGLRDDLDDIDENDVGAKRRLA  325

Query  540  FMDHVISCMRSQSDLLTRTELKDNTVTVIIGGMDTASIVMSAVLMLLGLHQDVQRKVDVQ  599
             +D ++   ++        ++ D   T++  G DT S   S  L ++G+H+D+Q KV  +
Sbjct  326  LLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQAKVFAE  385

Query  600  RKVVTELGEIFGDDMHREVTADDLRKMTYLEQVINETMRLYPPIPGVARIAEEEVSLTQ-  658
            +K       IFGD+M R+ T  D  +M YLE+VI ET+RLYPP+P +AR  + ++ L   
Sbjct  386  QKA------IFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASG  439

Query  659  -YTIPKGTFIVLPIYIMHRNPELFPDPEKFDPDRFSPEKCASRHPYSFIPFLSGRRMCMG  717
             YT+PKGT +++  Y +HR P+++P+P KFDPD F PE+ A+RH YSFIPF +G R C+G
Sbjct  440  PYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVG  499

Query  718  KKYAYVQMKTLLSTLLRNYEV  738
            +KYA +++K LLST++RNY V
Sbjct  500  RKYAMLKLKVLLSTIVRNYIV  520


 Score = 167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 121/189 (64%), Gaps = 2/189 (1%)

Query  64   KKYLGFMDHVISCMRSQSDLLTRIELKDNTVTVIIGGMDTSSIVMSTVLMLLGLHQDVQR  123
            K+ L  +D ++   ++        ++ D   T++  G DT+S   S  L ++G+H+D+Q 
Sbjct  321  KRRLALLDAMVEMAKNPDIEWNEKDIMDEVNTIMFEGHDTTSAGSSFALCMMGIHKDIQA  380

Query  124  KVVTELGEIFGNDMHREVTADDLRQMMYLEQVINETMRLYPPLPGVMRVAEEEVSLTQ--  181
            KV  E   IFG++M R+ T  D  +M YLE+VI ET+RLYPP+P + R  + ++ L    
Sbjct  381  KVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLYPPVPLIARRLDYDLKLASGP  440

Query  182  YTIPKGTIIVLPIYIVHRNPEIFPDPVKFDPDRFSPENCARRHPYSFIPFLSGRRMCMGK  241
            YT+PKGT +++  Y VHR P+I+P+P KFDPD F PE  A RH YSFIPF +G R C+G+
Sbjct  441  YTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMANRHYYSFIPFSAGPRSCVGR  500

Query  242  KYAYVQMKI  250
            KYA +++K+
Sbjct  501  KYAMLKLKV  509


>CP4E2_DROME unnamed protein product
Length=526

 Score = 241 bits (616),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 148/485 (31%), Positives = 256/485 (53%), Gaps = 26/485 (5%)

Query  771   YWLVCLVPLLVAVALLVRFRTSRYYRLLSKLPGPRGLPLIGNLLSVLAHTNCILDYIMKI  830
             Y  + L  LLVA   L  FR  R   +L+K  GPRGLPL+GN   +  + + ILD +   
Sbjct  6     YIFLALPLLLVAYLELSTFRRRR---VLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSW  62

Query  831   RNEYGL-IYVSWMGPNALVLLCDPRDIEIVLNSNECLSKPAPYRIVELLTGYSVLTARRE  889
              ++YG   +V W+G  + VL+   + +E +L+S   ++K   Y++     G  +LT+   
Sbjct  63    WHQYGKDNFVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLGLLTSTGS  122

Query  890   DWKRYRKIMLSSFSSQTVATFVPTFNEKAKVLARVIRN-RADRREFDILSTMMVCTLDIV  948
              W ++RK++  +F    +  F    NE +    + ++   A    FD        TLD++
Sbjct  123   KWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVI  182

Query  949   TDTSLGVNMNLLDENRVEVAESFHIIRDVLFSAFMRPWYWVPS---LLKKTPSYKKIVSD  1005
              DT++GV++N ++     + ++F   +D+ ++  MR ++ +     L +  P Y      
Sbjct  183   CDTAMGVSINAMENRSSSIVQAF---KDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRT  239

Query  1006  IQTLWDFADNIIARKLLSLEKSNASVCRRPSSQENLDHALETPKKYLGFLDHVISCMRSQ  1065
             ++TL DF + IIA+++ + +    S           +   E  +K + FLD ++S     
Sbjct  240   LKTLQDFTNEIIAKRIEAHKSGAVST----------NAGDEFTRKKMAFLDTLLSST-ID  288

Query  1066  SDLLTSTELKDNTATVIISGMDTSSIVMSAVLMLLGLHQDVQRKVVTEMGEIFGD-DMHR  1124
                L S EL +  +T +  G DT++  +S  + LL  HQD QRK+  E  E+ G+ ++ R
Sbjct  289   GRPLNSKELYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGR  348

Query  1125  EVTVDDIRQMMYLEQVINETMRLYPPGPAVMRVAEEEVSLTQYTIPKGTIIMLPIYVVHR  1184
             + T  +I QM YL+  I E  R+YP  P + R  E++  +    +PKGT + L + ++  
Sbjct  349   DATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGY  408

Query  1185  NTEIFPDPEKFDPDRFSPEKCASRHPYSFIPFLSGRRMCIGKKYAYVQMKTLLSTLLRNY  1244
             N ++F DP KF P+RF  EK     P+ ++PF +G R CIG+K+A +++KT++S ++RN+
Sbjct  409   NEKVFKDPHKFRPERFELEKPG---PFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNF  465

Query  1245  EVLPC  1249
             EVLP 
Sbjct  466   EVLPA  470


 Score = 221 bits (563),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 255/491 (52%), Gaps = 32/491 (7%)

Query  257  YWLVCLVPLLVAVALLVRFRTRRYYRLLSKVPGPRGLPLIGILLPVLAHTNCIIEYLMKL  316
            Y  + L  LLVA   L  FR RR   +L+K  GPRGLPL+G    +  + + I++ +   
Sbjct  6    YIFLALPLLLVAYLELSTFRRRR---VLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSW  62

Query  317  RDDYGL-IYSGWLGPYAGVLLCDPRDYEIVLNRNECLSKPAPYRILELCFGYSAITARRE  375
               YG   +  W+G Y+ VL+   +  E +L+    ++K   Y++     G   +T+   
Sbjct  63   WHQYGKDNFVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLGLLTSTGS  122

Query  376  DWKRYRKVMHSSFSSQTVATFIPTFNEKAKVLARVIRN-RADRRKFDILSTMMLCTLDIV  434
             W ++RK++  +F    +  F    NE +    + ++   A    FD        TLD++
Sbjct  123  KWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVI  182

Query  435  TDTSLGVNMNLLDENRVELAESFHIIRDVLFSAIIRPWYWVPT---LFKKTPSYNKMLSG  491
             DT++GV++N ++     + ++F   +D+ ++  +R ++ +     L++  P Y      
Sbjct  183  CDTAMGVSINAMENRSSSIVQAF---KDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRT  239

Query  492  LQTLWDFADNVIAQKLLSHEKSNSSVCRRPASQEDFDQAPETPKKYLGFMDHVISCMRSQ  551
            L+TL DF + +IA+++ +H+    S           +   E  +K + F+D ++S     
Sbjct  240  LKTLQDFTNEIIAKRIEAHKSGAVST----------NAGDEFTRKKMAFLDTLLSSTIDG  289

Query  552  SDLLTRTELKDNTVTVIIGGMDTASIVMSAVLMLLGLHQDVQRKVDVQRKVVTELGEIFG  611
              L ++ EL +   T +  G DT +  +S  + LL  HQD QRK+  +++      E+ G
Sbjct  290  RPLNSK-ELYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQR------EVMG  342

Query  612  D-DMHREVTADDLRKMTYLEQVINETMRLYPPIPGVARIAEEEVSLTQYTIPKGTFIVLP  670
            + ++ R+ T  ++ +M YL+  I E  R+YP +P + R  E++  +    +PKGT + L 
Sbjct  343  NSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKDYVIDGDLVPKGTTLNLG  402

Query  671  IYIMHRNPELFPDPEKFDPDRFSPEKCASRHPYSFIPFLSGRRMCMGKKYAYVQMKTLLS  730
            + ++  N ++F DP KF P+RF  EK     P+ ++PF +G R C+G+K+A +++KT++S
Sbjct  403  LVMLGYNEKVFKDPHKFRPERFELEKPG---PFEYVPFSAGPRNCIGQKFALLEIKTVVS  459

Query  731  TLLRNYEVLPC  741
             ++RN+EVLP 
Sbjct  460  KIIRNFEVLPA  470


 Score = 122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 111/193 (58%), Gaps = 5/193 (3%)

Query  58   SGAETPKKYLGFMDHVISCMRSQSDLLTRIELKDNTVTVIIGGMDTSSIVMSTVLMLLGL  117
            +G E  +K + F+D ++S       L ++ EL +   T +  G DT++  +S  + LL  
Sbjct  267  AGDEFTRKKMAFLDTLLSSTIDGRPLNSK-ELYEEVSTFMFEGHDTTTSGVSFAVYLLSR  325

Query  118  HQDVQRKVVTELGEIFGN-DMHREVTADDLRQMMYLEQVINETMRLYPPLPGVMRVAEEE  176
            HQD QRK+  E  E+ GN ++ R+ T  ++ QM YL+  I E  R+YP +P + R  E++
Sbjct  326  HQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKD  385

Query  177  VSLTQYTIPKGTIIVLPIYIVHRNPEIFPDPVKFDPDRFSPENCARRHPYSFIPFLSGRR  236
              +    +PKGT + L + ++  N ++F DP KF P+RF  E      P+ ++PF +G R
Sbjct  386  YVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPG---PFEYVPFSAGPR  442

Query  237  MCMGKKYAYVQMK  249
             C+G+K+A +++K
Sbjct  443  NCIGQKFALLEIK  455


>CP4E3_DROME unnamed protein product
Length=526

 Score = 236 bits (601),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 138/466 (30%), Positives = 248/466 (53%), Gaps = 22/466 (5%)

Query  790   RTSRYYRLLSKLPGPRGLPLIGNLLSVLAHTNCILDYIMKIRNEYGLI-YVSWMGPNALV  848
             + S+  +LL +  GP  +P++GN   +  +   IL        +YG   ++ W+G ++ +
Sbjct  22    KASQRRQLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDWWYDYGKDNFLFWIGYSSHI  81

Query  849   LLCDPRDIEIVLNSNECLSKPAPYRIVELLTGYSVLTARREDWKRYRKIMLSSFSSQTVA  908
             ++ +P+ +E +LNS + + K   Y ++    G+ +LT+    W ++RK++  SF    + 
Sbjct  82    VMTNPKQLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQ  141

Query  909   TFVPTFNEK-AKVLARVIRNRADRREFDILSTMMVCTLDIVTDTSLGVNMNLLDENRVEV  967
              F    NE  AK + ++ +  A     D        TLD++ DT++GV +N +++    +
Sbjct  142   DFHEVMNENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSI  201

Query  968   AESFHIIRDVLFSAFMR---PWYWVPSLLKKTPSYKKIVSDIQTLWDFADNIIARKLLSL  1024
              ++F   RD+ ++  MR   P+     +   TP +      ++TL DF  +II +++ +L
Sbjct  202   VQAF---RDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYAL  258

Query  1025  EKSNASVCRRPSSQENLDHALETPKKYLGFLDHVISCMRSQSDLLTSTELKDNTATVIIS  1084
             +           S+E  DH    P+K + FLD ++S        LT  E+ +  +T +  
Sbjct  259   QNG--------GSKE--DHDPSLPRKKMAFLDTLLSST-IDGRPLTRQEIYEEVSTFMFE  307

Query  1085  GMDTSSIVMSAVLMLLGLHQDVQRKVVTEMGEIFGDDMHREVTVDDIRQMMYLEQVINET  1144
             G DT++  +S  + LL  H DVQRK+  E  E+ G DM+R V+  +I +M YL+  I E 
Sbjct  308   GHDTTTSGVSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEA  367

Query  1145  MRLYPPGPAVMRVAEEEVSLTQYTIPKGTIIMLPIYVVHRNTEIFPDPEKFDPDRFSPEK  1204
              R+YP  P + R  +++  +    +PKGT + L + ++  N  IF DP  F P+RF  EK
Sbjct  368   QRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEK  427

Query  1205  CASRHPYSFIPFLSGRRMCIGKKYAYVQMKTLLSTLLRNYEVLPCC  1250
              A   P+ ++PF +G R CIG+K+A +++KT++S ++R++EVLP  
Sbjct  428   PA---PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAV  470


 Score = 219 bits (557),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 133/466 (29%), Positives = 241/466 (52%), Gaps = 28/466 (6%)

Query  282  RLLSKVPGPRGLPLIGILLPVLAHTNCIIEYLMKLRDDYGLI-YSGWLGPYAGVLLCDPR  340
            +LL +  GP  +P++G    +  +   I+        DYG   +  W+G  + +++ +P+
Sbjct  28   QLLKEFNGPTPVPILGNANRIGKNPAEILSTFFDWWYDYGKDNFLFWIGYSSHIVMTNPK  87

Query  341  DYEIVLNRNECLSKPAPYRILELCFGYSAITARREDWKRYRKVMHSSFSSQTVATFIPTF  400
              E +LN  + + K   Y +L    G+  +T+    W ++RK++  SF    +  F    
Sbjct  88   QLEYILNSQQLIQKSTIYDLLHPWLGHGLLTSFGSKWHKHRKMITPSFHFNILQDFHEVM  147

Query  401  NEK-AKVLARVIRNRADRRKFDILSTMMLCTLDIVTDTSLGVNMNLLDENRVELAESFHI  459
            NE  AK + ++ +  A     D        TLD++ DT++GV +N +++    + ++F  
Sbjct  148  NENSAKFMTQLKKASAGDTIIDFQEHANYLTLDVICDTAMGVPINAMEQRDSSIVQAF--  205

Query  460  IRDVLFSAIIR---PWYWVPTLFKKTPSYNKMLSGLQTLWDFADNVIAQKLLSHEKSNSS  516
             RD+ ++  +R   P+     +F  TP ++     L+TL DF  ++I +++ +       
Sbjct  206  -RDMCYNINMRAFHPFKRSNRVFSLTPEFSAYQKTLKTLQDFTYDIIEKRVYA-------  257

Query  517  VCRRPASQEDFDQAPETPKKYLGFMDHVISCMRSQSDLLTRTELKDNTVTVIIGGMDTAS  576
              +   S+ED D  P  P+K + F+D ++S        LTR E+ +   T +  G DT +
Sbjct  258  -LQNGGSKEDHD--PSLPRKKMAFLDTLLSST-IDGRPLTRQEIYEEVSTFMFEGHDTTT  313

Query  577  IVMSAVLMLLGLHQDVQRKVDVQRKVVTELGEIFGDDMHREVTADDLRKMTYLEQVINET  636
              +S  + LL  H DVQRK+        E  E+ G DM+R V+  ++ KM YL+  I E 
Sbjct  314  SGVSFSVYLLSRHPDVQRKL------YREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEA  367

Query  637  MRLYPPIPGVARIAEEEVSLTQYTIPKGTFIVLPIYIMHRNPELFPDPEKFDPDRFSPEK  696
             R+YP +P + R  +++  +    +PKGT + L + ++  N  +F DP  F P+RF  EK
Sbjct  368  QRVYPSVPFIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEK  427

Query  697  CASRHPYSFIPFLSGRRMCMGKKYAYVQMKTLLSTLLRNYEVLPCC  742
             A   P+ ++PF +G R C+G+K+A +++KT++S ++R++EVLP  
Sbjct  428  PA---PFEYLPFSAGPRNCIGQKFALLELKTVISKVVRSFEVLPAV  470


 Score = 126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/202 (34%), Positives = 115/202 (57%), Gaps = 10/202 (5%)

Query  54   ALRASGAET------PKKYLGFMDHVISCMRSQSDLLTRIELKDNTVTVIIGGMDTSSIV  107
            AL+  G++       P+K + F+D ++S        LTR E+ +   T +  G DT++  
Sbjct  257  ALQNGGSKEDHDPSLPRKKMAFLDTLLSST-IDGRPLTRQEIYEEVSTFMFEGHDTTTSG  315

Query  108  MSTVLMLLGLHQDVQRKVVTELGEIFGNDMHREVTADDLRQMMYLEQVINETMRLYPPLP  167
            +S  + LL  H DVQRK+  E  E+ G+DM+R V+  ++ +M YL+  I E  R+YP +P
Sbjct  316  VSFSVYLLSRHPDVQRKLYREQCEVMGHDMNRSVSFQEIAKMKYLDLFIKEAQRVYPSVP  375

Query  168  GVMRVAEEEVSLTQYTIPKGTIIVLPIYIVHRNPEIFPDPVKFDPDRFSPENCARRHPYS  227
             + R  +++  +    +PKGT + L + ++  N  IF DP  F P+RF  E  A   P+ 
Sbjct  376  FIGRYCDKDYDINGSIVPKGTTLNLALILLGYNDRIFKDPHHFRPERFEEEKPA---PFE  432

Query  228  FIPFLSGRRMCMGKKYAYVQMK  249
            ++PF +G R C+G+K+A +++K
Sbjct  433  YLPFSAGPRNCIGQKFALLELK  454



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold2-size3895397-processed-gene-25.0-mRNA-1

Length=238
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4QGN0_LEIMA  unnamed protein product                                 32.0    0.46 
O17617_CAEEL  unnamed protein product                                 28.9    4.6  
A0A0B4KG69_DROME  unnamed protein product                             28.9    5.3  


>Q4QGN0_LEIMA unnamed protein product
Length=497

 Score = 32.0 bits (71),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 6/104 (6%)

Query  59   FYKRDAENLETPGKTRRKKRVKGVGDVDNFTCGLICRIIYRMYETGFPSKTWQDGTTYTC  118
             ++R+ + + T  K R +   + +G V   +C  +   +Y       P +  Q       
Sbjct  369  LHRREYDEIFTGMKERAELLARELGAVRGLSCQPVEGAMYAFPRIVLPERYAQRN-----  423

Query  119  KRRNLDQGKRFIVLDAGSEQGFVKDAGIVFAPGSNLGDYHGTMN  162
            +  N  +G++ + LDA      ++ +GIV  PGS  G   GT++
Sbjct  424  EELNAKEGRQ-LALDARWALELLESSGIVVVPGSGFGQEPGTLH  466


>O17617_CAEEL unnamed protein product
Length=421

 Score = 28.9 bits (63),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 14/66 (21%), Positives = 34/66 (52%), Gaps = 7/66 (11%)

Query  105  FPSKTWQDGTTYTCKRRNLDQGKRFIVLDAGSEQGFVKDAGIVFAPGSNLGDYHGTMNGE  164
            FP+  + +   Y+  +++  Q  ++ + D  +E GF++       P +N+  Y G+ + +
Sbjct  10   FPANQYVNAGQYSPLQQSFSQNSQYDLFDGFAEFGFLEQ-----VPATNM--YSGSQSTQ  62

Query  165  MFEKWL  170
            M + +L
Sbjct  63   MEQNYL  68


>A0A0B4KG69_DROME unnamed protein product
Length=945

 Score = 28.9 bits (63),  Expect = 5.3, Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 7/50 (14%)

Query  31   RAKRRREISKEQTGAGKETK-------GKEMKGDPFYKRDAENLETPGKT  73
            R+  +++ +K  TG+GKETK       GK  + D   +++ +  E P KT
Sbjct  679  RSSSQQKPTKGNTGSGKETKSTVKEHKGKSKQNDKTLEKNTDKTEKPDKT  728



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold77-size1526962-augustus-gene-14.4-mRNA-1

Length=161
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4QAU5_LEIMA  unnamed protein product                                 29.6    1.1  
Q95RQ1_DROME  unnamed protein product                                 29.3    1.7  
TENM_DROME  unnamed protein product                                   28.5    3.0  


>Q4QAU5_LEIMA unnamed protein product
Length=600

 Score = 29.6 bits (65),  Expect = 1.1, Method: Composition-based stats.
 Identities = 22/82 (27%), Positives = 32/82 (39%), Gaps = 8/82 (10%)

Query  62   ETLVCQRESMSPDPCVGPMGGVPCGSSGKCAASGVCCTP-----GAANLVEGLRELRIAI  116
            E    Q+E  S      P   +P   SG+C+ +    TP      + +L   L +   A 
Sbjct  239  EARAMQQERCSAGAVATPTAALPVEDSGRCSIAPFAETPKSVAGASCHLSHNLDD---AA  295

Query  117  RRMDARNVAHVKPLCVIFMHRR  138
              MDA    H  PL  +F  +R
Sbjct  296  DNMDAEYFDHAVPLRFLFSRKR  317


>Q95RQ1_DROME unnamed protein product
Length=512

 Score = 29.3 bits (64),  Expect = 1.7, Method: Composition-based stats.
 Identities = 11/33 (33%), Positives = 15/33 (45%), Gaps = 0/33 (0%)

Query  68   RESMSPDPCVGPMGGVPCGSSGKCAASGVCCTP  100
            RE+   D C+ P+    C + G C A   C  P
Sbjct  319  RENPRSDSCMKPICSARCQNGGNCTAPSTCSCP  351


>TENM_DROME unnamed protein product
Length=2731

 Score = 28.5 bits (62),  Expect = 3.0, Method: Composition-based stats.
 Identities = 23/89 (26%), Positives = 31/89 (35%), Gaps = 19/89 (21%)

Query  14   CPKG--GKRSLVHGKDALRQCPRCGPAKMGHCYGDNICCGVEIGCLVATPETLVCQRESM  71
            C KG  G       +DAL+  P C     GH            G      +T  C+ +  
Sbjct  628  CKKGWKGPDCATMDQDALQCLPDCS----GH------------GTFDLDTQTCTCEAK-W  670

Query  72   SPDPCVGPMGGVPCGSSGKCAASGVCCTP  100
            S D C   +  + CG  G+C      C P
Sbjct  671  SGDDCSKELCDLDCGQHGRCEGDACACDP  699



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold4562-size199247-augustus-gene-0.6-mRNA-1

Length=184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q52V24_ASTLP  unnamed protein product                                 90.9    1e-22
Q960G6_DROME  unnamed protein product                                 88.2    2e-20
Q9VSU2_DROME  unnamed protein product                                 88.2    2e-20


>Q52V24_ASTLP unnamed protein product
Length=237

 Score = 90.9 bits (224),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 85/161 (53%), Gaps = 11/161 (7%)

Query  27   LAEIIEHPGFKYDGDIPVNDVSLLKTTTAITFTNSVKAVTLAPANLVLSAGSVVRLVGWG  86
            +++II H  F Y+  +  ND+SLLK + ++TF ++V  + L P     + G V+ + GWG
Sbjct  79   VSKIILHENFDYN--LLDNDISLLKLSGSLTFNDNVAPIAL-PEQGHTATGDVI-VTGWG  134

Query  87   ISSIYGKPEANLREVPLATLSDKVCSQHYGT---VAGTFCAGTENGGKGSCDGDLGGPLI  143
             +S  G     L++V +  +SD+ C   YG    +    CAG   GGK SC GD GGPL 
Sbjct  135  TTSEGGNTPDVLQKVTVPLVSDEDCRADYGADEILDSMICAGVPEGGKDSCQGDSGGPLA  194

Query  144  YDGK----QAGLLSWGNSCGRKGMLDGYTSVAHFRDWIKTK  180
                     AG++SWG  C R G    YT V++  DWIK  
Sbjct  195  ASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIKAN  235


>Q960G6_DROME unnamed protein product
Length=2409

 Score = 88.2 bits (217),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 63/183 (34%), Positives = 88/183 (48%), Gaps = 14/183 (8%)

Query  11    WVRVGSTDSSIGVKHDLAEIIE----HPGFKYDGDIPVNDVSLLKTTTAITFTNSVKAVT  66
             +VRVG   ++I    ++   IE    H  F+  G    ND++L+   T + F++ V+ + 
Sbjct  2220  FVRVGDHYANIAESSEVDSFIENWYLHENFR-KGTHMNNDIALVVLKTPLKFSDYVQPIC  2278

Query  67    LAPANLVLSAGSVVRLVGWG-ISSIYGKPEANLREVPLATLSDKVCSQH--YGTV--AGT  121
             L   N  L       + GWG I S    P   L    L  L+D VC Q   YG+    G 
Sbjct  2279  LPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGM  2338

Query  122   FCAGTENGGKGSCDGDLGGPLIY---DGKQA-GLLSWGNSCGRKGMLDGYTSVAHFRDWI  177
             FCAG+ +    +C+GD GGPL+    DG+   GL+SWG  CG K     Y  V H+ DWI
Sbjct  2339  FCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWI  2398

Query  178   KTK  180
               K
Sbjct  2399  YEK  2401


>Q9VSU2_DROME unnamed protein product
Length=2792

 Score = 88.2 bits (217),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 63/183 (34%), Positives = 88/183 (48%), Gaps = 14/183 (8%)

Query  11    WVRVGSTDSSIGVKHDLAEIIE----HPGFKYDGDIPVNDVSLLKTTTAITFTNSVKAVT  66
             +VRVG   ++I    ++   IE    H  F+  G    ND++L+   T + F++ V+ + 
Sbjct  2603  FVRVGDHYANIAESSEVDSFIENWYLHENFR-KGTHMNNDIALVVLKTPLKFSDYVQPIC  2661

Query  67    LAPANLVLSAGSVVRLVGWG-ISSIYGKPEANLREVPLATLSDKVCSQH--YGTV--AGT  121
             L   N  L       + GWG I S    P   L    L  L+D VC Q   YG+    G 
Sbjct  2662  LPDKNAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGM  2721

Query  122   FCAGTENGGKGSCDGDLGGPLIY---DGKQA-GLLSWGNSCGRKGMLDGYTSVAHFRDWI  177
             FCAG+ +    +C+GD GGPL+    DG+   GL+SWG  CG K     Y  V H+ DWI
Sbjct  2722  FCAGSMDESVDACEGDSGGPLVCSDDDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWI  2781

Query  178   KTK  180
               K
Sbjct  2782  YEK  2784



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold604-size751320-processed-gene-6.2-mRNA-1

Length=1017
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBIQP_DROME  unnamed protein product                                  1179    0.0  
Q383T7_TRYB2  unnamed protein product                                 1167    0.0  
Q9W418_DROME  unnamed protein product                                 1032    0.0  


>UBIQP_DROME unnamed protein product
Length=763

 Score = 1179 bits (3050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/608 (99%), Positives = 600/608 (99%), Gaps = 0/608 (0%)

Query  407   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
             MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  1     MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  467   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  527   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
             FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  121   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  180

Query  587   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  647   ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
             ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  241   ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300

Query  707   LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
             LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  301   LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360

Query  767   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
             SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  361   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  420

Query  827   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
             QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  421   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  480

Query  887   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  946
             NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  481   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  540

Query  947   TGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  1006
             TGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
Sbjct  541   TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  600

Query  1007  LVLRLRGG  1014
             LVLRLRGG
Sbjct  601   LVLRLRGG  608


 Score = 1179 bits (3050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/608 (99%), Positives = 600/608 (99%), Gaps = 0/608 (0%)

Query  407   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
             MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  77    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  136

Query  467   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  137   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  196

Query  527   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
             FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  197   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  256

Query  587   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  647   ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
             ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  317   ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  376

Query  707   LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
             LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  377   LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  436

Query  767   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
             SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  437   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  496

Query  827   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
             QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  497   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  556

Query  887   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  946
             NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  557   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  616

Query  947   TGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  1006
             TGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
Sbjct  617   TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  676

Query  1007  LVLRLRGG  1014
             LVLRLRGG
Sbjct  677   LVLRLRGG  684


 Score = 1179 bits (3050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/608 (99%), Positives = 600/608 (99%), Gaps = 0/608 (0%)

Query  407   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
             MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  153   MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  212

Query  467   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  213   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  272

Query  527   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
             FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  273   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  332

Query  587   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  333   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  392

Query  647   ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
             ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  393   ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  452

Query  707   LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
             LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  453   LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  512

Query  767   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
             SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  513   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  572

Query  827   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
             QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  573   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  632

Query  887   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  946
             NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  633   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  692

Query  947   TGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  1006
             TGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH
Sbjct  693   TGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  752

Query  1007  LVLRLRGG  1014
             LVLRLRGG
Sbjct  753   LVLRLRGG  760


 Score = 1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/534 (99%), Positives = 527/534 (99%), Gaps = 0/534 (0%)

Query  407  MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  229  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  288

Query  467  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  289  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  348

Query  527  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  349  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  408

Query  587  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  409  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  468

Query  647  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  469  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  528

Query  707  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  529  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  588

Query  767  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  589  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  648

Query  827  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  649  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  708

Query  887  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ  940
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG+Q
Sbjct  709  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIQ  762


>Q383T7_TRYB2 unnamed protein product
Length=685

 Score = 1167 bits (3018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/608 (96%), Positives = 600/608 (99%), Gaps = 0/608 (0%)

Query  407   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
             MQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYN
Sbjct  1     MQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  60

Query  467   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
             IQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61    IQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  527   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
             FAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKA
Sbjct  121   FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKA  180

Query  587   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
             KIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181   KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  647   ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
             I LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLR
Sbjct  241   IALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLR  300

Query  707   LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
             LRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL
Sbjct  301   LRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTL  360

Query  767   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
             +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQ
Sbjct  361   ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQ  420

Query  827   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
             QRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIE
Sbjct  421   QRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIE  480

Query  887   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  946
             NVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  481   NVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  540

Query  947   TGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  1006
             TGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLH
Sbjct  541   TGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLH  600

Query  1007  LVLRLRGG  1014
             LVLRLRGG
Sbjct  601   LVLRLRGG  608


 Score = 1167 bits (3018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/608 (96%), Positives = 600/608 (99%), Gaps = 0/608 (0%)

Query  407   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
             MQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYN
Sbjct  77    MQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYN  136

Query  467   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
             IQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  137   IQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLI  196

Query  527   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
             FAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKA
Sbjct  197   FAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKA  256

Query  587   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
             KIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257   KIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  647   ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
             I LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLR
Sbjct  317   IALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLR  376

Query  707   LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
             LRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL
Sbjct  377   LRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTL  436

Query  767   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
             +DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIENVKAKIQDKEGIPPDQ
Sbjct  437   ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIENVKAKIQDKEGIPPDQ  496

Query  827   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
             QRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI LEVEASDTIE
Sbjct  497   QRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIALEVEASDTIE  556

Query  887   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL  946
             NVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  557   NVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  616

Query  947   TGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLH  1006
             TGKTI LEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE+GRTL+DYNIQKESTLH
Sbjct  617   TGKTIALEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLH  676

Query  1007  LVLRLRGG  1014
             LVLRLRGG
Sbjct  677   LVLRLRGG  684


>Q9W418_DROME unnamed protein product
Length=534

 Score = 1032 bits (2669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/534 (98%), Positives = 526/534 (99%), Gaps = 0/534 (0%)

Query  483   MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  542
             MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  1     MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  543   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  602
             IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61    IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  603   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  662
             FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  121   FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  180

Query  663   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  722
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  723   ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  782
             ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  241   ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300

Query  783   LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  842
             LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  301   LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360

Query  843   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  902
             SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  361   SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  420

Query  903   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  962
             QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  421   QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  480

Query  963   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGNV  1016
             NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG +
Sbjct  481   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAI  534


 Score = 1032 bits (2668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 525/532 (99%), Positives = 525/532 (99%), Gaps = 0/532 (0%)

Query  407  MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  466
            MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  467  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  526
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  527  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  586
            FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKA
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  180

Query  587  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  646
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  647  ITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  706
            ITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
Sbjct  241  ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR  300

Query  707  LRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  766
            LRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL
Sbjct  301  LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL  360

Query  767  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQ  826
            SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQ
Sbjct  361  SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ  420

Query  827  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIE  886
            QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIE
Sbjct  421  QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE  480

Query  887  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  938
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
Sbjct  481  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  532



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold3717-size245155-augustus-gene-1.3-mRNA-1

Length=187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E0A9E1_DROME  unnamed protein product                                 67.4    3e-13
Q7KTN8_DROME  unnamed protein product                                 67.4    3e-13
A0A0S0WN65_DROME  unnamed protein product                             67.4    4e-13


>E0A9E1_DROME unnamed protein product
Length=1732

 Score = 67.4 bits (163),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 64/121 (53%), Gaps = 2/121 (2%)

Query  63    SGYPHWQMGIYG-YTQLVTLLLC-AGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGA  120
             +GY    +  +G +  +V LLL  +   +   DR   T L+ AA  G  Q+ ++LL +GA
Sbjct  1009  NGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGA  1068

Query  121   NVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQY  180
              +NA D  G+TPL  AA   HL  VKLL +AGA        G  A++FA   GH  V +Y
Sbjct  1069  EINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRY  1128

Query  181   L  181
             L
Sbjct  1129  L  1129


 Score = 50.1 bits (118),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  74   GYTQLVTLLLC-AGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTP  132
            G+T LV  L+      ID+      T L+ AA+ G  ++ Q+LL  GAN++A D+LG  P
Sbjct  737  GFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKP  796

Query  133  LMEAADRDHLVTVKLLVQAGAD-TTLTNRGGSNALYFAKVRGHTAVQQYLEQL  184
            +  AA  ++    KL +Q        T++ G+   + A ++G   V + L + 
Sbjct  797  IHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKF  849


 Score = 43.5 bits (101),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 3/97 (3%)

Query  89   IDLPDRETNTLLYGAASGGSNQIAQMLLS--RGANVNAMDNL-GFTPLMEAADRDHLVTV  145
            ++   ++ NT  + AA  GS ++ + L+   R   ++A + L   TPL  AA+  H   V
Sbjct  820  VNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVV  879

Query  146  KLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYLE  182
            K LV+AGA  T  N+ G  A++ A   GH  V   L+
Sbjct  880  KALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLK  916


 Score = 41.6 bits (96),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 3/111 (3%)

Query  74    GYTQLVTLLL-CAGMPIDLPDRETN-TLLYGAASGGSNQIAQMLLSRGANV-NAMDNLGF  130
             G   +V LLL  AG+ +D    E     L+ A  GG   +  +LLSR A +  + D  G 
Sbjct  986   GNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGR  1045

Query  131   TPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYL  181
             T L  AA   H+  V++L+  GA+   T+R G   L+ A   GH  V + L
Sbjct  1046  TGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL  1096


 Score = 40.4 bits (93),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (46%), Gaps = 3/118 (3%)

Query  71    GIYGYTQLVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGF  130
              ++G+ Q+V +LL  G  I+  DR   T L+ AA  G  ++ ++L   GA+  +  N G 
Sbjct  1052  AMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGC  1111

Query  131   TPLMEAADRDHLVTVKLLVQAGADT---TLTNRGGSNALYFAKVRGHTAVQQYLEQLP  185
               +  AA   H   ++ L+    DT       R   N +  +K   +  +Q+++   P
Sbjct  1112  AAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSP  1169


 Score = 35.0 bits (79),  Expect = 0.034, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query  77   QLVTLLLCAGMPIDLPDRET-NTLLYGAASGGSNQIAQMLLSR------GANVNAMDNLG  129
            Q+V +LL  G  + L  +    T  +  A  G+N +   ++S          +N   ++G
Sbjct  601  QIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVG  660

Query  130  FTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAV  177
            +TPL+ A  R H+  V  L+   A   + +  G +AL+ A  RG+  V
Sbjct  661  WTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHV  708


 Score = 33.5 bits (75),  Expect = 0.099, Method: Compositional matrix adjust.
 Identities = 25/98 (26%), Positives = 46/98 (47%), Gaps = 1/98 (1%)

Query  78   LVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAA  137
            +V +L+  G  +D  + E  T L+ AA+ G   + +      A+ +  DN   TP+  AA
Sbjct  283  MVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAA  342

Query  138  DRDHLVTVKLLV-QAGADTTLTNRGGSNALYFAKVRGH  174
            +  H   +++L  +  A      + GS  ++ A + GH
Sbjct  343  ENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGH  380


 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (42%), Gaps = 10/181 (6%)

Query  15   LEQLVQQLNNTVLQYSGSRD----WQAL---CKGLDAEMDHSSGAYGELKDMFKYSGYPH  67
            L +++  +N T +Q + +R     W  L   C     E+ ++  A     D+F   G   
Sbjct  637  LMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSA  696

Query  68   WQMGI-YGYTQLVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLS-RGANVNAM  125
              +    GY  +   LL     I+   R   T L+ AA  G   + + L+    A ++ +
Sbjct  697  LHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDIL  756

Query  126  DNLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQ-YLEQL  184
                 TPL  AA    +   +LL++ GA+   T+  G   ++ A    ++ V + +L+Q 
Sbjct  757  TLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH  816

Query  185  P  185
            P
Sbjct  817  P  817


 Score = 28.9 bits (63),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query  94   RETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGA  153
            RET  L   A     ++ A MLL  GA+ N   +   TP+  AA   +L T+  L++   
Sbjct  468  RET-PLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEG  526

Query  154  DTTLTNRGGSNALYFAKVRGHTAVQQYL  181
            D    +  G   L+ A    H  + ++L
Sbjct  527  DPLYKSNTGETPLHMACRACHPDIVRHL  554


 Score = 27.7 bits (60),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 0/55 (0%)

Query  127  NLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYL  181
            N G TPLM A   +    +  +++ GAD    N    N L+ A +     V + L
Sbjct  125  NTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLL  179


>Q7KTN8_DROME unnamed protein product
Length=1735

 Score = 67.4 bits (163),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 2/121 (2%)

Query  63    SGYPHWQMGIYG-YTQLVTLLLCAGMPI-DLPDRETNTLLYGAASGGSNQIAQMLLSRGA  120
             +GY    +  +G +  +V LLL     +    DR   T L+ AA  G  Q+ ++LL +GA
Sbjct  1009  NGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGA  1068

Query  121   NVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQY  180
              +NA D  G+TPL  AA   HL  VKLL +AGA        G  A++FA   GH  V +Y
Sbjct  1069  EINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRY  1128

Query  181   L  181
             L
Sbjct  1129  L  1129


 Score = 50.1 bits (118),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  74   GYTQLVTLLLC-AGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTP  132
            G+T LV  L+      ID+      T L+ AA+ G  ++ Q+LL  GAN++A D+LG  P
Sbjct  737  GFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKP  796

Query  133  LMEAADRDHLVTVKLLVQAGAD-TTLTNRGGSNALYFAKVRGHTAVQQYLEQL  184
            +  AA  ++    KL +Q        T++ G+   + A ++G   V + L + 
Sbjct  797  IHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKF  849


 Score = 43.5 bits (101),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 3/97 (3%)

Query  89   IDLPDRETNTLLYGAASGGSNQIAQMLLS--RGANVNAMDNL-GFTPLMEAADRDHLVTV  145
            ++   ++ NT  + AA  GS ++ + L+   R   ++A + L   TPL  AA+  H   V
Sbjct  820  VNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVV  879

Query  146  KLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYLE  182
            K LV+AGA  T  N+ G  A++ A   GH  V   L+
Sbjct  880  KALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLK  916


 Score = 41.6 bits (96),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 3/111 (3%)

Query  74    GYTQLVTLLL-CAGMPIDLPDRETN-TLLYGAASGGSNQIAQMLLSRGANV-NAMDNLGF  130
             G   +V LLL  AG+ +D    E     L+ A  GG   +  +LLSR A +  + D  G 
Sbjct  986   GNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGR  1045

Query  131   TPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYL  181
             T L  AA   H+  V++L+  GA+   T+R G   L+ A   GH  V + L
Sbjct  1046  TGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL  1096


 Score = 40.4 bits (93),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (46%), Gaps = 3/118 (3%)

Query  71    GIYGYTQLVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGF  130
              ++G+ Q+V +LL  G  I+  DR   T L+ AA  G  ++ ++L   GA+  +  N G 
Sbjct  1052  AMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGC  1111

Query  131   TPLMEAADRDHLVTVKLLVQAGADT---TLTNRGGSNALYFAKVRGHTAVQQYLEQLP  185
               +  AA   H   ++ L+    DT       R   N +  +K   +  +Q+++   P
Sbjct  1112  AAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSP  1169


 Score = 35.0 bits (79),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query  77   QLVTLLLCAGMPIDLPDRET-NTLLYGAASGGSNQIAQMLLSR------GANVNAMDNLG  129
            Q+V +LL  G  + L  +    T  +  A  G+N +   ++S          +N   ++G
Sbjct  601  QIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVG  660

Query  130  FTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAV  177
            +TPL+ A  R H+  V  L+   A   + +  G +AL+ A  RG+  V
Sbjct  661  WTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHV  708


 Score = 33.5 bits (75),  Expect = 0.098, Method: Compositional matrix adjust.
 Identities = 25/98 (26%), Positives = 46/98 (47%), Gaps = 1/98 (1%)

Query  78   LVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAA  137
            +V +L+  G  +D  + E  T L+ AA+ G   + +      A+ +  DN   TP+  AA
Sbjct  283  MVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAA  342

Query  138  DRDHLVTVKLLV-QAGADTTLTNRGGSNALYFAKVRGH  174
            +  H   +++L  +  A      + GS  ++ A + GH
Sbjct  343  ENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGH  380


 Score = 33.1 bits (74),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (42%), Gaps = 10/181 (6%)

Query  15   LEQLVQQLNNTVLQYSGSRD----WQAL---CKGLDAEMDHSSGAYGELKDMFKYSGYPH  67
            L +++  +N T +Q + +R     W  L   C     E+ ++  A     D+F   G   
Sbjct  637  LMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSA  696

Query  68   WQMGI-YGYTQLVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLS-RGANVNAM  125
              +    GY  +   LL     I+   R   T L+ AA  G   + + L+    A ++ +
Sbjct  697  LHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDIL  756

Query  126  DNLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQ-YLEQL  184
                 TPL  AA    +   +LL++ GA+   T+  G   ++ A    ++ V + +L+Q 
Sbjct  757  TLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH  816

Query  185  P  185
            P
Sbjct  817  P  817


 Score = 28.9 bits (63),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query  94   RETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGA  153
            RET  L   A     ++ A MLL  GA+ N   +   TP+  AA   +L T+  L++   
Sbjct  468  RET-PLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEG  526

Query  154  DTTLTNRGGSNALYFAKVRGHTAVQQYL  181
            D    +  G   L+ A    H  + ++L
Sbjct  527  DPLYKSNTGETPLHMACRACHPDIVRHL  554


 Score = 27.7 bits (60),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 0/55 (0%)

Query  127  NLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYL  181
            N G TPLM A   +    +  +++ GAD    N    N L+ A +     V + L
Sbjct  125  NTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLL  179


>A0A0S0WN65_DROME unnamed protein product
Length=1755

 Score = 67.4 bits (163),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 2/121 (2%)

Query  63    SGYPHWQMGIYG-YTQLVTLLLCAGMPI-DLPDRETNTLLYGAASGGSNQIAQMLLSRGA  120
             +GY    +  +G +  +V LLL     +    DR   T L+ AA  G  Q+ ++LL +GA
Sbjct  1009  NGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGRTGLHIAAMHGHIQMVEILLGQGA  1068

Query  121   NVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQY  180
              +NA D  G+TPL  AA   HL  VKLL +AGA        G  A++FA   GH  V +Y
Sbjct  1069  EINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGCAAIWFAASEGHNEVLRY  1128

Query  181   L  181
             L
Sbjct  1129  L  1129


 Score = 50.1 bits (118),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 2/113 (2%)

Query  74   GYTQLVTLLLC-AGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTP  132
            G+T LV  L+      ID+      T L+ AA+ G  ++ Q+LL  GAN++A D+LG  P
Sbjct  737  GFTHLVKFLIKDHNAVIDILTLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKP  796

Query  133  LMEAADRDHLVTVKLLVQAGAD-TTLTNRGGSNALYFAKVRGHTAVQQYLEQL  184
            +  AA  ++    KL +Q        T++ G+   + A ++G   V + L + 
Sbjct  797  IHVAAQNNYSEVAKLFLQQHPSLVNATSKDGNTCAHIAAMQGSVKVIEELMKF  849


 Score = 43.5 bits (101),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 3/97 (3%)

Query  89   IDLPDRETNTLLYGAASGGSNQIAQMLLS--RGANVNAMDNL-GFTPLMEAADRDHLVTV  145
            ++   ++ NT  + AA  GS ++ + L+   R   ++A + L   TPL  AA+  H   V
Sbjct  820  VNATSKDGNTCAHIAAMQGSVKVIEELMKFDRSGVISARNKLTDATPLQLAAEGGHADVV  879

Query  146  KLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYLE  182
            K LV+AGA  T  N+ G  A++ A   GH  V   L+
Sbjct  880  KALVRAGASCTEENKAGFTAVHLAAQNGHGQVLDVLK  916


 Score = 41.6 bits (96),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 3/111 (3%)

Query  74    GYTQLVTLLL-CAGMPIDLPDRETN-TLLYGAASGGSNQIAQMLLSRGANV-NAMDNLGF  130
             G   +V LLL  AG+ +D    E     L+ A  GG   +  +LLSR A +  + D  G 
Sbjct  986   GNENVVRLLLNSAGVQVDAATIENGYNPLHLACFGGHMSVVGLLLSRSAELLQSQDRNGR  1045

Query  131   TPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYL  181
             T L  AA   H+  V++L+  GA+   T+R G   L+ A   GH  V + L
Sbjct  1046  TGLHIAAMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLL  1096


 Score = 40.4 bits (93),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 54/118 (46%), Gaps = 3/118 (3%)

Query  71    GIYGYTQLVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGF  130
              ++G+ Q+V +LL  G  I+  DR   T L+ AA  G  ++ ++L   GA+  +  N G 
Sbjct  1052  AMHGHIQMVEILLGQGAEINATDRNGWTPLHCAAKAGHLEVVKLLCEAGASPKSETNYGC  1111

Query  131   TPLMEAADRDHLVTVKLLVQAGADT---TLTNRGGSNALYFAKVRGHTAVQQYLEQLP  185
               +  AA   H   ++ L+    DT       R   N +  +K   +  +Q+++   P
Sbjct  1112  AAIWFAASEGHNEVLRYLMNKEHDTYGLMEDKRFVYNLMVVSKNHNNKPIQEFVLVSP  1169


 Score = 34.7 bits (78),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 29/108 (27%), Positives = 50/108 (46%), Gaps = 7/108 (6%)

Query  77   QLVTLLLCAGMPIDLPDRET-NTLLYGAASGGSNQIAQMLLSR------GANVNAMDNLG  129
            Q+V +LL  G  + L  +    T  +  A  G+N +   ++S          +N   ++G
Sbjct  601  QIVRMLLENGADVTLQTKTALETAFHYCAVAGNNDVLMEMISHMNPTDIQKAMNRQSSVG  660

Query  130  FTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAV  177
            +TPL+ A  R H+  V  L+   A   + +  G +AL+ A  RG+  V
Sbjct  661  WTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSALHLAAERGYLHV  708


 Score = 33.5 bits (75),  Expect = 0.10, Method: Compositional matrix adjust.
 Identities = 25/98 (26%), Positives = 46/98 (47%), Gaps = 1/98 (1%)

Query  78   LVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAA  137
            +V +L+  G  +D  + E  T L+ AA+ G   + +      A+ +  DN   TP+  AA
Sbjct  283  MVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASASIADNQDRTPMHLAA  342

Query  138  DRDHLVTVKLLV-QAGADTTLTNRGGSNALYFAKVRGH  174
            +  H   +++L  +  A      + GS  ++ A + GH
Sbjct  343  ENGHAHVIEILADKFKASIFERTKDGSTLMHIASLNGH  380


 Score = 33.5 bits (75),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (42%), Gaps = 10/181 (6%)

Query  15   LEQLVQQLNNTVLQYSGSRD----WQAL---CKGLDAEMDHSSGAYGELKDMFKYSGYPH  67
            L +++  +N T +Q + +R     W  L   C     E+ ++  A     D+F   G   
Sbjct  637  LMEMISHMNPTDIQKAMNRQSSVGWTPLLIACHRGHMELVNNLLANHARVDVFDTEGRSA  696

Query  68   WQMGI-YGYTQLVTLLLCAGMPIDLPDRETNTLLYGAASGGSNQIAQMLLS-RGANVNAM  125
              +    GY  +   LL     I+   R   T L+ AA  G   + + L+    A ++ +
Sbjct  697  LHLAAERGYLHVCDALLTNKAFINSKSRVGRTALHLAAMNGFTHLVKFLIKDHNAVIDIL  756

Query  126  DNLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQ-YLEQL  184
                 TPL  AA    +   +LL++ GA+   T+  G   ++ A    ++ V + +L+Q 
Sbjct  757  TLRKQTPLHLAAASGQMEVCQLLLELGANIDATDDLGQKPIHVAAQNNYSEVAKLFLQQH  816

Query  185  P  185
            P
Sbjct  817  P  817


 Score = 28.9 bits (63),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 1/88 (1%)

Query  94   RETNTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGA  153
            RET  L   A     ++ A MLL  GA+ N   +   TP+  AA   +L T+  L++   
Sbjct  468  RET-PLHIAARVKDGDRCALMLLKSGASPNLTTDDCLTPVHVAARHGNLATLMQLLEDEG  526

Query  154  DTTLTNRGGSNALYFAKVRGHTAVQQYL  181
            D    +  G   L+ A    H  + ++L
Sbjct  527  DPLYKSNTGETPLHMACRACHPDIVRHL  554


 Score = 27.7 bits (60),  Expect = 6.9, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 24/55 (44%), Gaps = 0/55 (0%)

Query  127  NLGFTPLMEAADRDHLVTVKLLVQAGADTTLTNRGGSNALYFAKVRGHTAVQQYL  181
            N G TPLM A   +    +  +++ GAD    N    N L+ A +     V + L
Sbjct  125  NTGMTPLMYATKDNKTAIMDRMIELGADVGARNNDNYNVLHIAAMYSREDVVKLL  179


 Score = 27.3 bits (59),  Expect = 9.7, Method: Compositional matrix adjust.
 Identities = 21/85 (25%), Positives = 36/85 (42%), Gaps = 0/85 (0%)

Query  97   NTLLYGAASGGSNQIAQMLLSRGANVNAMDNLGFTPLMEAADRDHLVTVKLLVQAGADTT  156
            +T L+ AA      + ++L+  G NV+  +  G TPL  AA       +K      A  +
Sbjct  269  DTALHLAARRRDVDMVRILVDYGTNVDTQNGEGQTPLHIAAAEGDEALLKYFYGVRASAS  328

Query  157  LTNRGGSNALYFAKVRGHTAVQQYL  181
            + +      ++ A   GH  V + L
Sbjct  329  IADNQDRTPMHLAAENGHAHVIEIL  353



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold5772-size147102-augustus-gene-0.6-mRNA-1

Length=242
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38AX7_TRYB2  unnamed protein product                                 28.5    5.1  
PKD1_CAEEL  unnamed protein product                                   28.5    6.9  


>Q38AX7_TRYB2 unnamed protein product
Length=512

 Score = 28.5 bits (62),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query  123  LSGQCTK-GWSVPTRGEVITVKAAEVNGFGKGSDGALQSRTGSDKLGAAL  171
            L G C + GW +PTR +V T+         +G D    ++TGS K GA +
Sbjct  51   LIGACKEAGWRMPTRIQVATIPVV-----SEGRDIIGVAQTGSGKTGAYV  95


>PKD1_CAEEL unnamed protein product
Length=3284

 Score = 28.5 bits (62),  Expect = 6.9, Method: Composition-based stats.
 Identities = 17/39 (44%), Positives = 24/39 (62%), Gaps = 2/39 (5%)

Query  30    VTPEFQKFVAKHLAHVIDKTLKEVERTSPADENAVETGS  68
             VT  FQK +AK+LA+ +  TL  +E T  A   A+ TG+
Sbjct  1887  VTKMFQKNIAKNLANQLASTLDTLENTLAA--RAIATGN  1923



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold2581-size686377-augustus-gene-1.6-mRNA-1

Length=708
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EXOC5_DROME  unnamed protein product                                  830     0.0  
EXOC5_DICDI  unnamed protein product                                  154     1e-38
Q57XD1_TRYB2  unnamed protein product                                 39.3    0.012


>EXOC5_DROME unnamed protein product
Length=710

 Score = 830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/705 (56%), Positives = 539/705 (76%), Gaps = 8/705 (1%)

Query  2    QEPFDPEEFVERLAWRTLGGTREDGVGGQFDAVLLHDTFLQAIKDLQLLQERQQKKCERL  61
            QEPF+  EF+ERL WRT     E      F  V LHDTF+Q IKDL++LQE+QQ KCERL
Sbjct  11   QEPFEVGEFIERLTWRT---NNELQNSEDFHPVALHDTFIQTIKDLKILQEKQQSKCERL  67

Query  62   EIMCREEENGNWQNISQLQERNKYSMSMFQELDERINYVAAKVIHLGDQLESVNTPRSRA  121
            E   R+E+  + + I++LQER++ ++ +F +LDE+IN VA K++HLG+QLE+VNTPRSR+
Sbjct  68   EESLRQEKESHAKKIAKLQERHQTAIDVFGQLDEKINSVAGKIMHLGEQLENVNTPRSRS  127

Query  122  VEAQKLMNYFAEFLSPGPLLT-EVFTDKRQIDEAADIIQKLHLIAQELPSGKFEKAKRKI  180
            VEAQKL+N+ +EFL+ GP++  ++F D  ++ EAAD+IQKL+ I+Q+LP G F ++KRKI
Sbjct  128  VEAQKLLNFMSEFLAAGPVIVNDIFADAARLSEAADVIQKLYAISQDLPPGNFAESKRKI  187

Query  181  AMKYDEIERSLIEEFVKAHRSVDKSRMKEIASILSHFKGYSQCVDAFIEQSQMGAFTGKD  240
              KYDE+ER LIEEF  A +S D  RMK +A ILS FKGY+QCVDA+IEQSQM  ++GKD
Sbjct  188  EKKYDEVERRLIEEFATAQKSEDIERMKTLAQILSQFKGYTQCVDAYIEQSQMQPYSGKD  247

Query  241  VFKDVIPLCQKNFAVMKEVFSNPEQVMAKYVLNIYHLKLQKFIESSLLDRSDADKYLRSL  300
            +F  ++PLC+ ++ ++++VF+NP+QVM+K++LNIY LKL ++  + L D+ D +KYLR+L
Sbjct  248  IFIGIVPLCKHHYEIIQKVFANPQQVMSKFILNIYQLKLHQYAMTKLEDKKDEEKYLRTL  307

Query  301  YDLYLRTVNLSNELSHFDMGNDNTYLSKLTRNIFHKYLDSYISVEIKCLREKCVAILQKY  360
            Y+LY RT+ LS +L  +    D+  L KLT+ IF K+L  Y  +E KCL  KC   L+K+
Sbjct  308  YELYSRTLKLSTDLQIYMSTIDDDLLQKLTQQIFIKHLAGYAEMETKCLTAKCSTELEKF  367

Query  361  YESKNHQKKQLHTGGFQDLRRDLQAVIGTRANLNIAQIENYGGETFLSEEVAIALLQESK  420
            Y SK HQK    T GF   RR+++ +I TRAN+NIA IE+YGGETFLSEE+AI +LQE+K
Sbjct  368  YASKKHQKTAT-TKGF---RRNMEVLIATRANINIAAIEDYGGETFLSEELAINMLQEAK  423

Query  421  MAFKRCQLLSGQSDLPGNALQLLEALLHFLIVEHVDYALELGLQSVPIPENKTPPQVYFF  480
             + KRC+LLS +++LPGNA++L + LL FL+ EHVDYALELGLQ+VP+ E +  PQ+YFF
Sbjct  424  ASLKRCRLLSNETELPGNAIKLNDILLRFLMHEHVDYALELGLQAVPLAEGRVFPQLYFF  483

Query  481  DVVRQCNAVVHLLEKQFNDSLVPLVVSTPKHGDCLQKKKYLLEQIEFKLDTGLDRSINAI  540
            DVV++ N +VHLL+K  + S++P V +TPK+ D + KK+ L+EQIE KLD GLDRSI+A+
Sbjct  484  DVVQKTNIIVHLLDKLCHTSVIPCVSNTPKYSDYVFKKRILMEQIETKLDQGLDRSISAV  543

Query  541  VSWVKIYLQLEQKKTDFKPETDTDTLASPACLSVVQYTGMTVERIRESLDGKNVESLMME  600
            + WVK+YLQ EQKKTD+KPETD DT++S ACL VVQ     + +I++ +DG+N+++++ E
Sbjct  544  IGWVKVYLQYEQKKTDYKPETDVDTISSAACLQVVQNLQPVIVQIKKCVDGENLQNVLTE  603

Query  601  LGIRFHRVIYEHMQQFQYNSAGAMCAICDVNEYRKCVKEFKVPLVNTLFDTLHALCNLLL  660
             G R HRVIY+H+Q  Q+N+AGAMCAICDVNEYRKC++E   PLV  LFD LHALCNLLL
Sbjct  604  FGTRLHRVIYDHLQTMQFNTAGAMCAICDVNEYRKCIRELDSPLVTQLFDILHALCNLLL  663

Query  661  VKPENLKQVCTGDQLTGLDRSILLNFIQLRADYKTQKLANSLKGL  705
            VKP+NL++VCTGD L  LD+S++  FIQLR D++  K  N LKG+
Sbjct  664  VKPQNLQEVCTGDTLNYLDKSVVRQFIQLRTDFRIIKNTNYLKGI  708


>EXOC5_DICDI unnamed protein product
Length=978

 Score = 154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 171/744 (23%), Positives = 324/744 (44%), Gaps = 91/744 (12%)

Query  5    FDPEEFVERLAWRTLGGTREDGVGGQFDAVLLHDTFLQAIKDLQLLQERQQKKCERLEIM  64
            F    FVE L  R L   +    G  F+    +  FL     L  L+    ++ + L   
Sbjct  267  FSHVTFVEDLT-RKLVNDQMGADGLHFEPAPFNQLFLNTQLQLSQLESNIDRRLDDLAEE  325

Query  65   CREEENGNWQNISQLQERNKYSMSMFQELDERINYVAAKVIHLGDQLESVNTPRSRAVEA  124
            C +      + +  L    +     F++L++ +N +  K +H GD+L+SVN  + +A  A
Sbjct  326  CNDFSYDYKRKLQDLTGSYQECFQHFKKLEKGVNTIGTKAVHFGDELDSVNQQKVKAQGA  385

Query  125  QKLMNYFAEFLSPGPLLTE---------VFTDKRQIDEAADIIQKLHLIAQELP--SGKF  173
              L+NY  E  S G    E         +FT+  +I E A +++KL  +++++   SG F
Sbjct  386  LSLINYLLELNSVGASSEENGGITKRSDIFTNSDRIHELAHLVKKLSSVSEDIKEISG-F  444

Query  174  EKAKRKIAMKYDEIERSLIEEFVKAHRSVDKSRMKEIASILSHFKGYSQCVDAFIEQSQM  233
            ++ K +     + +E  L+ +F +A    D  +MK+ A+ L  F G  +C   +I++ +M
Sbjct  445  KQGKLETESISNSLENDLLNQFERAAERNDYDKMKQCATTLHGFNGGERCRSRYIQKLKM  504

Query  234  GAFTGKDVFK-----------------------------DVIPLCQKNFAVMKEVFSNPE  264
              F   D F+                             D++        V++ VF N  
Sbjct  505  --FFDIDSFRKDENLANNITKRLIRGNNIVDTRFEIFYTDILKDVSHEQMVIQNVFVNQT  562

Query  265  QVMAKYVLNIYHLKLQKFIESSL-LDRSDADKYLRSLYDLYLRTVNL-SNELSHFDM-GN  321
              MA  ++ ++  +++ FIE+ L L+ ++   +L++++  +  T  L  + L  + + G 
Sbjct  563  SAMAMLIIRLFEQRVRLFIENVLSLESNNVSMFLQTVHYAFNSTKKLLVDPLQSYGIVGV  622

Query  322  DNTYLSKLTRNIFHKYLDSYISVEIKCLREKCVAILQKYYESKNHQKKQLHTGGFQDLRR  381
            D   L++L  +IF++Y + YI  E   L    V++ Q     +  + + L          
Sbjct  623  D---LNQLLNSIFYQYQEGYIQKETTYL----VSLFQSNVVEECERLQTLD---------  666

Query  382  DLQAVIGTRANLNIAQIENYGGETFLSEEVAIALLQESKMAFKRCQLLSGQSDLPGNALQ  441
                    R ++ +        E  L+ E+    +Q+++ A  R   LS  + L  N   
Sbjct  667  --------RYSMYL--------EDGLNPEITQMFVQQTENALTRSYTLSLDNILADNIKT  710

Query  442  LLEALLHFLIVEHVDYALELGLQSVPIPENKTPPQV--------YFFDVVRQCNAVVHLL  493
            +   +L +L  ++  + L   ++   IP + +              F VV   N +V  +
Sbjct  711  IFFLMLEYLFEKYSMFVLNKYIELPMIPSSSSNVDTKSIQDSISQLFRVVLSINQIVGQI  770

Query  494  EKQFNDSLVPLV-VSTPKHGDCLQKKKYLLEQIEFKLDTGLDRSINAIVSWVKIYLQLEQ  552
            +  F   ++P +  S      C  +  + +  +E  ++TGL+ S+  ++  ++  L L Q
Sbjct  771  QSMFQVFVLPHIQTSMIVQSQCSDQLYFNISSLENTINTGLENSLTTMIQLIEKTL-LPQ  829

Query  553  KKTDFKPETDTDTLASPACLSVVQYTGMTVERIRESLDGKNVESLMMELGIRFHRVIYEH  612
             + D+  + D D   +  C SV++      +  + +L GKN    + ELG++   V   H
Sbjct  830  GRNDYLID-DYDNSVTDTCASVIKLIQSFYDMAKINLQGKNFHIYVEELGLKSQFVFINH  888

Query  613  MQQFQYNSA-GAMCAICDVNEYRKCVKEFKVPLVNTLFDTLHALCNLLLVKPENLKQVCT  671
             ++F+     G +  + D+ EYR   K+FK   V+  F+ L  +  L LV PEN K V  
Sbjct  889  FKKFKIGQGIGTLKLMRDLTEYRNLSKQFKSQKVDDAFELLFEISKLHLVNPENFKLVIE  948

Query  672  GDQLTGLDRSILLNFIQLRADYKT  695
            G  LT + +  L+ FI+ R+D+K+
Sbjct  949  GGALTRMSKQDLIIFIKQRSDFKS  972


>Q57XD1_TRYB2 unnamed protein product
Length=1113

 Score = 39.3 bits (90),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 28/109 (26%), Positives = 52/109 (48%), Gaps = 7/109 (6%)

Query  590   DGKNVESLMMELGIRFHRVIYEHMQQFQYNSAGAMCAICDVNEYRKCVKEF-KVP-----  643
             DG    S +  +G+  +R I  H++ F  +  GA+    DV  Y + +    +VP     
Sbjct  996   DG-GASSFVRTVGVCLYRGISIHLKGFSVSDRGALVYKRDVTAYVEAMAPLTRVPGLDGA  1054

Query  644   LVNTLFDTLHALCNLLLVKPENLKQVCTGDQLTGLDRSILLNFIQLRAD  692
             +++ LF  L    +LL++ P+++K V     L  L     + F+++R D
Sbjct  1055  VIDVLFRLLKETASLLIMPPDHIKGVWDTGLLRLLSHDEKVQFVKMRVD  1103



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold2098-size394917-augustus-gene-1.2-mRNA-1

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VR44_DROME  unnamed protein product                                 32.0    0.54 
A4UVK0_CAEEL  unnamed protein product                                 29.3    2.9  
G5ED27_CAEEL  unnamed protein product                                 28.9    7.1  


>Q9VR44_DROME unnamed protein product
Length=493

 Score = 32.0 bits (71),  Expect = 0.54, Method: Compositional matrix adjust.
 Identities = 20/69 (29%), Positives = 34/69 (49%), Gaps = 6/69 (9%)

Query  58   NVLTVVGFKPGYALDHNITSLTAE------KKDGNTTLMKSTSACDSLVKDDGCPVFKDT  111
            N+LT++GF   YAL  N+T    +          N TL+ +++A +S    DG  V+++ 
Sbjct  23   NLLTMLGFMLNYALRVNLTIAIVDMVRPNVTSAVNATLVGNSTAANSTASPDGVDVYEER  82

Query  112  MQVYPFQVN  120
                 +Q N
Sbjct  83   FPWDSYQTN  91


>A4UVK0_CAEEL unnamed protein product
Length=212

 Score = 29.3 bits (64),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 45/110 (41%), Gaps = 16/110 (15%)

Query  165  PCPGFPEFEFVQIADCVDEC----SVPVGTNVLTVVGFKPRHSITSLTAEKKDGNTTLMK  220
            PCP    +  V    C  EC    S P+  ++L +    P   I +LTA  K G   L  
Sbjct  76   PCPA--NYSLVDDRYCEPECENCTSTPIQVHMLAIPSGLPISHIATLTAYDKSGR-VLND  132

Query  221  STSACDSLVKDDGCPVYKDTLQVYPYHVNATED-----VSTRIMLVGVVH  265
            +T A    + D G P+ +  +   P+ + A +       + R++  G  H
Sbjct  133  TTYA----ISDTGAPLARGRMTSGPFTIKAVKRGHAQVWTNRVLAAGDHH  178


>G5ED27_CAEEL unnamed protein product
Length=5175

 Score = 28.9 bits (63),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 45/110 (41%), Gaps = 16/110 (15%)

Query  165   PCPGFPEFEFVQIADCVDEC----SVPVGTNVLTVVGFKPRHSITSLTAEKKDGNTTLMK  220
             PCP    +  V    C  EC    S P+  ++L +    P   I +LTA  K G   L  
Sbjct  5039  PCPA--NYSLVDDRYCEPECENCTSTPIQVHMLAIPSGLPISHIATLTAYDKSGR-VLND  5095

Query  221   STSACDSLVKDDGCPVYKDTLQVYPYHVNATED-----VSTRIMLVGVVH  265
             +T A    + D G P+ +  +   P+ + A +       + R++  G  H
Sbjct  5096  TTYA----ISDTGAPLARGRMTSGPFTIKAVKRGHAQVWTNRVLAAGDHH  5141



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold842-size656074-augustus-gene-4.3-mRNA-1

Length=174
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UQ2_TRYB2  unnamed protein product                                 32.0    0.26 
BAB1_DROME  unnamed protein product                                   29.6    1.6  
FKH_DROME  unnamed protein product                                    28.9    2.1  


>Q57UQ2_TRYB2 unnamed protein product
Length=1110

 Score = 32.0 bits (71),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 8/50 (16%)

Query  122  VFSRYILHPQVGA--------CFSSICSPLFQRLTGVTLSVHPEVVMRLQ  163
             + RY++ PQ GA        C+SSI  P + + TGV  + + E   R Q
Sbjct  10   TYLRYVVGPQGGAVASNGSLSCYSSITRPSYAKSTGVAKTTYSERNNRNQ  59


>BAB1_DROME unnamed protein product
Length=977

 Score = 29.6 bits (65),  Expect = 1.6, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 14/24 (58%), Gaps = 0/24 (0%)

Query  138  SICSPLFQRLTGVTLSVHPEVVMR  161
            S CSP FQ L   T   HP V+MR
Sbjct  146  SACSPYFQTLLAETPCQHPIVIMR  169


>FKH_DROME unnamed protein product
Length=510

 Score = 28.9 bits (63),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 22/45 (49%), Gaps = 0/45 (0%)

Query  129  HPQVGACFSSICSPLFQRLTGVTLSVHPEVVMRLQLGILKQNVKM  173
            HP +   + S   PL Q  +G T S HP  + RL     K ++KM
Sbjct  424  HPSLITDYHSSMHPLKQEPSGYTPSSHPFSINRLLPTESKADIKM  468



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= augustus-scaffold6700-size113373-processed-gene-0.1-mRNA-1

Length=109
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDG0_DROME  unnamed protein product                                 28.9    1.00 
A0A0B4KHJ4_DROME  unnamed protein product                             28.9    1.00 
BRM_DROME  unnamed protein product                                    27.7    2.2  


>Q9VDG0_DROME unnamed protein product
Length=4486

 Score = 28.9 bits (63),  Expect = 1.00, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 20/33 (61%), Gaps = 5/33 (15%)

Query  61    WKRYSGHLWKWLDDREDSKRTEYLLKPGRAASP  93
             ++RYS   + WLDDRE+    EY L+ GR   P
Sbjct  1005  FERYS---YLWLDDREEC--MEYFLEYGRMLDP  1032


>A0A0B4KHJ4_DROME unnamed protein product
Length=4496

 Score = 28.9 bits (63),  Expect = 1.00, Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 20/33 (61%), Gaps = 5/33 (15%)

Query  61    WKRYSGHLWKWLDDREDSKRTEYLLKPGRAASP  93
             ++RYS   + WLDDRE+    EY L+ GR   P
Sbjct  1005  FERYS---YLWLDDREEC--MEYFLEYGRMLDP  1032


>BRM_DROME unnamed protein product
Length=1638

 Score = 27.7 bits (60),  Expect = 2.2, Method: Composition-based stats.
 Identities = 12/31 (39%), Positives = 15/31 (48%), Gaps = 0/31 (0%)

Query  69   WKWLDDREDSKRTEYLLKPGRAASPGVPEEA  99
            W W+DD EDS  +    KP     P   E+A
Sbjct  686  WDWIDDEEDSCGSNDDHKPKVEEQPTATEDA  716



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold1565-size666251-augustus-gene-2.3-mRNA-1

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SPART_DROME  unnamed protein product                                  265     2e-82
Q386I2_TRYB2  unnamed protein product                                 30.0    5.4  


>SPART_DROME unnamed protein product
Length=553

 Score = 265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 166/503 (33%), Positives = 257/503 (51%), Gaps = 57/503 (11%)

Query  2    AYAKYEAGLFVIDSALGMCRECPEDPDMT---WEKAHVMVQKMAKTKKEVLCRLADLQCQ  58
            A   YE  L +I+   G+    P   D     W  A  ++QK+   + E+  RL  L+ Q
Sbjct  41   AIVAYELALRMIEDTFGIPVGLPNKIDTVQAEWNDACALIQKLKSAETELRYRLKVLRSQ  100

Query  59   PEQ------------------PQPP----PPSYEEAVSSASSSNSHEPHTYKELGDALQD  96
             +                    +PP     PS +  +++AS +    P TY+EL   L++
Sbjct  101  KQSIDDSAVEATEESRAEMDTKRPPLLAENPSTQYGIANASGA----PKTYRELAAGLRE  156

Query  97   LRVQTEAQTAQVLFLHNDVKVYFISPDGTVTSTSRPDTLRIIQLQDTGENTPRG---YLQ  153
            L    +A+          VK+Y I   G+VT+ S   T+ ++     G+        ++Q
Sbjct  157  LLAVRDAKVLLDELFRAQVKMYRIEASGSVTTISGSSTMSLVMCTVGGKWKYLSGIYFIQ  216

Query  154  V--------GNWIYPLVPEVSPCFATEFGAFVFPDL--QSDVEAVGIILPEEAD------  197
                     G W+YPLVP ++ C+ TE+GAF+FPD+  Q    A G++L +E        
Sbjct  217  CSMPNEGTAGIWLYPLVPSITNCYQTEYGAFIFPDMECQQPGNAFGLMLTKEGQTSRTED  276

Query  198  --EAVYELLDDILHGVASSAVGGKVLRKGLP---RSGMWKRRRSTASTISQRIVQGAGYI  252
              E + +   D+L  V    + G V++   P   R+G+     S +  +S+ IV  A +I
Sbjct  277  ELEDLQQFFLDLLEAV----LAGTVVQLKSPTSQRAGLASDTVSGSEQVSRHIVSAADFI  332

Query  253  SQGLVWTAQRVGDFINYGTPKIMERLTPVSQPTTVNPRVSHGLQVAKDVTGTVVNVTGQM  312
            +  LV  A++ G F+   TP I+ ++TP S    V   V   ++VA+ VT     +TG +
Sbjct  333  ASNLVRGAEKTGGFMLRSTPYIISKMTPASMDAQVPSSVQTSVEVAQKVTHAAAGMTGWI  392

Query  313  AYAIGSATMSLGRFLAPHIQRQGTRLLSHTLNLSEQESSRKVDGVLEVAAGAVEGFSTVY  372
            A  +G+A+M++GR+LAPHIQ QG++LL         E++  ++G + +AAGAVEG STV+
Sbjct  393  AGKVGTASMAVGRYLAPHIQEQGSKLLQKGFGYDTSEANSTMEGAMTIAAGAVEGVSTVF  452

Query  373  DGLETSAGILGTNLSNNTVKIVAHKYGYPAADAADDTLHAVGNIYAASRNVRGFTPKGLI  432
            DGLETSA ILG++LS N+VKI+ HKYG    + A  T   VGN++  S+NV   TPKG+ 
Sbjct  453  DGLETSAKILGSSLSENSVKIIEHKYGQQTGNLASGTFDTVGNVFVVSQNVNYITPKGIA  512

Query  433  KTTAKSAGKAVVEDYRTSFRDKQ  455
            K   K  G+AVV DY+   R  +
Sbjct  513  KKMVKRTGEAVVSDYKRDLRKSE  535


>Q386I2_TRYB2 unnamed protein product
Length=1501

 Score = 30.0 bits (66),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (68%), Gaps = 5/31 (16%)

Query  136  RIIQLQDTGENTPRGYLQVGNWIYPLVPEVS  166
            R++QL+D  + TPR  LQVG+     VPE++
Sbjct  473  RLLQLEDVIKKTPRAALQVGS-----VPELN  498



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


Query= maker-scaffold2246-size380338-augustus-gene-1.2-mRNA-1

Length=1571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MED1_DROME  unnamed protein product                                   411     2e-119


>MED1_DROME unnamed protein product
Length=1475

 Score = 411 bits (1056),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 227/524 (43%), Positives = 329/524 (63%), Gaps = 25/524 (5%)

Query  2    NAVGTETGQCSGV----DKTKVWQMELLMEKLRSKA-GQFKSLVETAKTLRMQLLEKRYS  56
            NA  + TG  S +    +K K  Q E +MEKLR+K   + KS  E  K++RM  +EK Y 
Sbjct  5    NAKSSGTGFGSHIPSIEEKNKQIQQETMMEKLRAKYRNKPKSYEEIKKSVRMYFIEKHYP  64

Query  57   VDSVERSQLQKCLDTLQHSIKVTTLQGMVERLESVSRQLGLKFMAGPSGFDWFISSDMFY  116
            +D + ++ LQ  LD LQH IKVT+  G+VERLES+SRQLGLKFM        FIS+DMFY
Sbjct  65   LDPLCKATLQSALDKLQHYIKVTSRHGLVERLESLSRQLGLKFMEDQQLL--FISTDMFY  122

Query  117  LEVVLEPSGSVKDVKISHEGKVEQQSCEELVACLSRGDFADFTAQLEGLASIYQLNAEKK  176
            +E++L+ +GS+ DVK+ HE K+EQQS  ELVACL  GDFADFT QLEGL+SIYQLNAE K
Sbjct  123  VEILLDAAGSLSDVKVHHECKIEQQS-SELVACLKSGDFADFTVQLEGLSSIYQLNAEPK  181

Query  177  VKCKAFSALQSLEGDLATLAQIQL--FIKEPFNMVHKSPVGILEKRKGGHAMRLTYLVQP  234
            VK KAF ALQ++E D+ +L Q+ L     + ++++  S VG++  R+GGH MRLTY   P
Sbjct  182  VKKKAFVALQAMETDIQSLYQLHLQGHSGDSYSLMTSSSVGLVLPRRGGHPMRLTYFCPP  241

Query  235  YDLLDQKNKVLL-PLSVEEVTSKSLGYSVEVCMESSSSHKLQTVPLIS-VSPSPNGKNSP  292
              L +   K+     ++++V   S G S  + +E SS++KLQT+P ++ V  +  G   P
Sbjct  242  LHLPEGDPKLASGDFTIDQVMRSSYGLSATINLEGSSANKLQTLPTVTLVRDAQTGLEVP  301

Query  293  CYASVTTAGSAALPAYFVLRLNKPMPMSLALVRRIQQVTEIECGDVLS-----PHPLLSL  347
             YA +    S  +PA FVLRLNKPMP+ L  ++ +     +   D ++     P  +L+L
Sbjct  302  TYAQLNQNNSLLMPATFVLRLNKPMPVCLESLKALG----LPGLDSVATPPGPPTTVLNL  357

Query  348  VTQHASAGQLDCANNRGLFVSLPDQNHCYFMTETKTLDGILVTSIPFTHPSHVPQILAFL  407
            + Q AS  Q      RGL+V+LP + HCYF T+ + L G LV+S+PFT P+ VP+I+AFL
Sbjct  358  IVQTASK-QAIKNTQRGLYVNLPKETHCYFFTDNRKLQGTLVSSLPFTEPAQVPRIVAFL  416

Query  408  RQQALFNVLVASCIRPTSRQ--DFENVIMFEVTALSWQQLSVSFEHPLEETMTTAELDLT  465
            ++QALF  L+ASC+R   +Q  D ++ ++ EVTA+S+ Q++V  +HP EE++ T +  L 
Sbjct  417  KKQALFYTLLASCVREQQKQYNDMDSTVILEVTAVSFNQITVELQHPYEESLATVDFLLE  476

Query  466  DIGNLRCKVYGSGVDSGATPDDISKVLQRCWSIPVTMRSLIRTW  509
            D G   C VY    +       +++  ++  SIP+ +  L++ W
Sbjct  477  D-GQPTCSVYCLTNEYELLSQKLTRTARKVVSIPMVIYKLLKCW  519


 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 49/87 (56%), Gaps = 23/87 (26%)

Query  1055  VTDSGKNSEYMVK-HSLDGIKITIN--------------------KTRTKDSKSGTARSS  1093
             +  +G ++EYMVK  S +G+K+TIN                    + + K S SG A S 
Sbjct  1160  INPAGASTEYMVKPSSQEGLKLTINKTGSSKSSGTGSGSSSSSGLQAKAKSSSSG-ATSF  1218

Query  1094  SSCTGTGSPKTHTGLKPGVNSGPASKK  1120
             +  TG+ + K HTGLKPGVNSGPASKK
Sbjct  1219  AGSTGS-TKKQHTGLKPGVNSGPASKK  1244



Lambda      K        H
   0.319    0.135    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7535626452


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 22, 2022  11:34 AM
  Number of letters in database: 17,182,648
  Number of sequences in database:  25,198



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,198 sequences; 17,182,648 total letters



Query= maker-scaffold19015-size18479-augustus-gene-0.1-mRNA-1

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D3YT50_CAEEL  unnamed protein product                                 29.6    1.2  
SIR2_CAEEL  unnamed protein product                                   29.6    1.2  


>D3YT50_CAEEL unnamed protein product
Length=577

 Score = 29.6 bits (65),  Expect = 1.2, Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 36/88 (41%), Gaps = 18/88 (20%)

Query  85   VTLVVLVGGALTMALCTLTPLC-----------KLKLP------ELLGSSAARTSADQLA  127
            V L+V++G +L +    L P C           +  LP      ELLG+       D   
Sbjct  290  VDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGN-CDDIIRDICF  348

Query  128  ALTALFTEATAKYSTLQEQQSSRQQQLP  155
            +L   FTE    Y ++ EQQ   + Q P
Sbjct  349  SLGGSFTELITSYDSIMEQQGKTKSQKP  376


>SIR2_CAEEL unnamed protein product
Length=607

 Score = 29.6 bits (65),  Expect = 1.2, Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 36/88 (41%), Gaps = 18/88 (20%)

Query  85   VTLVVLVGGALTMALCTLTPLC-----------KLKLP------ELLGSSAARTSADQLA  127
            V L+V++G +L +    L P C           +  LP      ELLG+       D   
Sbjct  320  VDLIVVIGSSLKVRPVALIPHCVDKNVPQILINRESLPHYNADIELLGN-CDDIIRDICF  378

Query  128  ALTALFTEATAKYSTLQEQQSSRQQQLP  155
            +L   FTE    Y ++ EQQ   + Q P
Sbjct  379  SLGGSFTELITSYDSIMEQQGKTKSQKP  406



Lambda      K        H
   0.321    0.132    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1007354448


Query= maker-scaffold2800-size319359-augustus-gene-0.1-mRNA-1

Length=1228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EIF3A_DROME  unnamed protein product                                  1027    0.0   
EIF3A_CAEEL  unnamed protein product                                  488     4e-153
Q584T3_TRYB2  unnamed protein product                                 47.4    8e-05 


>EIF3A_DROME unnamed protein product
Length=1140

 Score = 1027 bits (2656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/780 (68%), Positives = 635/780 (81%), Gaps = 16/780 (2%)

Query  1    LDTLYEVFRNKKWAYSWSESVLEPIMFKYLDLCVELKKSHIAKEGLFQYRNMFQSVNVSS  60
            LDTL EVFRNK+W Y++SE+V+EP+MFKYL LCVELKKSHIAKEGLFQYRNMFQ VNV+S
Sbjct  28   LDTLQEVFRNKRWNYAYSETVIEPLMFKYLYLCVELKKSHIAKEGLFQYRNMFQLVNVNS  87

Query  61   LENVIRGYLRTAEERTEAAREQSQQAV--IDIDDLDMLATPESLLLSAVSGEDAQDRSDR  118
            LENVIRGYL+ AEE TEAA+ QS  AV  +++DDLD +ATPES+L+SAV GEDAQDRSDR
Sbjct  88   LENVIRGYLKMAEEHTEAAQAQSSAAVAVLELDDLDNIATPESILMSAVCGEDAQDRSDR  147

Query  119  TILTPWVKFLWESYCQCLELLRTNAHVENLYHDIGRMAFAFCLKYGRKTEFRKLCDKLRK  178
            TIL PWVKFLWESYCQCLELLR N H E LYHDI RMAF FCLKY RK+EFR+LCDKLRK
Sbjct  148  TILLPWVKFLWESYCQCLELLRVNTHCEALYHDIARMAFQFCLKYNRKSEFRRLCDKLRK  207

Query  179  HLEDISKLPAQAVNVSIHRPETQQLNLDTRLVQLDSAIQMELWQEAYKAIEDIHGLMNLS  238
            HLEDI K   Q   VSI++ ETQQL LDTRL  LDSAIQMELWQEAYKAIEDIHGLM LS
Sbjct  208  HLEDICKSSNQTTGVSINKVETQQLCLDTRLYLLDSAIQMELWQEAYKAIEDIHGLMALS  267

Query  239  KKLPVPKTMANYYQKLAMVFWKAGNYLFHAAALFKLFQLSKEMKKNITPEELQRMACRVL  298
            KK PVPKTMANYYQKLAMVF KAGN LFHAAAL KLFQL++E+KKN+T ++LQRMA  VL
Sbjct  268  KKTPVPKTMANYYQKLAMVFSKAGNQLFHAAALLKLFQLTRELKKNLTKDDLQRMAAHVL  327

Query  299  LATLSIPLPSAHPEFDRFIETDKSPLEKAQRLAILLGLSQPPTRASLLRDIVRLNVVSLA  358
            LATLSIPLPSAHPEFDRFIE DKSPLEKAQ+LA+LLGL QPPTR SL+R++VRLNV  L 
Sbjct  328  LATLSIPLPSAHPEFDRFIEADKSPLEKAQKLAVLLGLPQPPTRVSLIREVVRLNVPQLV  387

Query  359  SPQLQELYLWLEVEFHPLLLCKRVNEVTQRLAEEDG---APLQQYVRALQDVTLVRLIRQ  415
            S   + LY WLEV+F+PL LCKR+  +   +  E+G   A L  Y+++L+DVT++RLIRQ
Sbjct  388  SEDFRNLYNWLEVDFNPLNLCKRIQSIVDFI--ENGPENALLTPYIQSLKDVTIMRLIRQ  445

Query  416  VSQVYQTVRMDRFMELAVFATPFHLERLLVDCVRHNDMQIRIDHGSRCINFGMDLSESQR  475
            +SQVY++++  R ++LA F   F LE+LLV+ VRHNDMQIRIDH    I FG DL+ESQR
Sbjct  446  ISQVYESIKFQRLLQLASFCNIFELEKLLVESVRHNDMQIRIDHQKNSIYFGTDLTESQR  505

Query  476  EDHPEGPTLQSMPSEQVRSQLINMACVLHKAMNCINPTKKRIEREKLRAQMVQHYHETKN  535
            E  P+GP LQSMPSEQ+RSQL+NM+ VL +A++ + P ++R +R KLR QMV HYHE K+
Sbjct  506  EYRPDGPALQSMPSEQIRSQLVNMSTVLTRAVSIVYPNRERDQRAKLRNQMVNHYHEIKD  565

Query  536  REHQRILARHKIIEDRKEYLERLNTVRICEGKCCLQEEEEARRLEELARQQMLAEQKRLE  595
            REHQRIL R KIIEDRKEY+E+ N           +EEEEARR EE +R+  LAEQKRLE
Sbjct  566  REHQRILQRQKIIEDRKEYIEKQNNA---------REEEEARRQEEESRKAKLAEQKRLE  616

Query  596  QEREERERKRQENEIQQIKDRHLKEKMQQISQTSHGQKILKKLDEDDIKKLDAEQIAARE  655
            QE+EERERKR +NEIQ I+++ LKEK+QQISQT+HG+K+L KLDE+ IKKLDAEQIA RE
Sbjct  617  QEQEERERKRHQNEIQAIREKSLKEKVQQISQTAHGKKMLSKLDEEGIKKLDAEQIAKRE  676

Query  656  AEELQKEKRELMQKLKTQEKKVDYFERAKRVEEVPLLQKSFEEKQVQDRKFWEQQETERI  715
            +EELQ+E +EL  KLK+QEKK+DYFERAKR+EE+PL +K   EKQV+D++FWE  E  RI
Sbjct  677  SEELQREAKELQSKLKSQEKKIDYFERAKRLEEIPLFEKYLAEKQVKDKEFWEATEKTRI  736

Query  716  QLLVEERELAVQHRERLARMQEDKEAFLEKLRAERRTLYMDKLNEFEKMLEEEREKRLAE  775
            +  + ER+ AV  +ERL RM  D++ FLE L+ ER +LY++KL +FE  LE ER+KRLA+
Sbjct  737  ENAIAERKDAVAQQERLKRMYPDRDEFLEALKKERASLYVEKLKKFEAALEAERKKRLAD  796


 Score = 35.8 bits (81),  Expect = 0.25, Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 104/276 (38%), Gaps = 52/276 (19%)

Query  980   DRDGGR--SFDRDSGRAGGFGRDRDIVRGGFER-DRDGRS---GFDRDREGG----RGFD  1029
             DRD  R    DR S   GG    R       ER DR G     G +R   GG    RG +
Sbjct  889   DRDTWRPRGGDRPSASNGGSSEWRRAAPAASERNDRGGERIERGGERIERGGERLERGGE  948

Query  1030  R-DRDGGRDRDGGRGFDRDSGRGGFDRDRDSGRRGFERDSGRGGFDRDREGGRGMDRDRE  1088
             R +R G RDR    G D  S R    R+ DS R    +DSG     RD +  RG +RDR+
Sbjct  949   RIERGGDRDRKDNEGAD-SSWR--VRREPDSQRAAAPKDSG-APQSRDDKWRRGGERDRD  1004

Query  1089  GGRGGFDREGGRGGFDRDTG---------RGGFER-------DRPSERSSGSAAMGSWRS  1132
                 G  R+   G                RGGF R       D P +R +G    G+WR 
Sbjct  1005  FRIDGARRDRDDGPRRDRDDGPRRDRDDERGGFRRADGARRTDEP-QRETG----GNWRD  1059

Query  1133  KPAEPEADDSRRRADERRP-TAAPVRAPVKDSGPPRRIPPGPDDRRQDAPPVEDKKRDER  1191
              P    AD   RR  ERR       R   + S P      G     + AP         R
Sbjct  1060  APR--HADRETRRPAERRDRDVRETRGDQRGSAPKEAASGGVGGNWRTAPAT-------R  1110

Query  1192  EKLPQKDEDMQQTPQQAIPAGGEEGEDGNWQKVSRR  1227
             E+ P    D  Q  +       + G+DG W  V RR
Sbjct  1111  EEKPAAKRDQAQEKE------NKAGDDGEWTSVKRR  1140


>EIF3A_CAEEL unnamed protein product
Length=1076

 Score = 488 bits (1256),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 310/802 (39%), Positives = 463/802 (58%), Gaps = 35/802 (4%)

Query  1    LDTLYEVF---RNKKWAYSWSESVLEPIMFKYLDLCVELKKSHIAKEGLFQYRNMFQSVN  57
            LDTL++     R+K+W      +V E IM K+++LCV+LKK H+AK+ LFQY+ + Q +N
Sbjct  29   LDTLHDTIKARRHKQWT-----TVHEQIMIKHMELCVDLKKQHLAKDALFQYKALTQQIN  83

Query  58   VSSLENVIRGYLRTAEERTEAAREQSQQAVIDIDDLDMLATPESLLLSAVSGEDAQDRSD  117
            V SLE V+  +L+ AE+RTE A++QS + V +I DLD    PE LLL+ VSG  AQDR D
Sbjct  84   VKSLETVVVHFLKLAEQRTEDAQKQSIEKVEEIGDLDQGDVPERLLLAVVSGAAAQDRMD  143

Query  118  RTILTPWVKFLWESYCQCLELLRTNAHVENLYHDIGRMAFAFCLKYGRKTEFRKLCDKLR  177
            RT+L PW++FLW+SY  CLELLR NA VE LYH I R +F FCL+Y R+TEFRKLCD LR
Sbjct  144  RTVLAPWLRFLWDSYRNCLELLRNNAQVEQLYHTISRHSFTFCLRYQRRTEFRKLCDLLR  203

Query  178  KHLEDISKLP-AQAVN---VSIHRPETQQLNLDTRLVQLDSAIQMELWQEAYKAIEDIHG  233
             HL  I K   A  VN   V +  PE+  L  DTRL+QLD+AIQMELWQEAYK+ ED+HG
Sbjct  204  MHLNQIQKHQYAPNVNSFRVKLTSPESLGLMQDTRLIQLDTAIQMELWQEAYKSAEDVHG  263

Query  234  LMNLS----KKLPVPKTMANYYQKLAMVFWKAGNYLFHAAALFKLFQLSKEMKKNITPEE  289
            +M LS    K+   P +  NYY KLA+VFWKAGN LFHAAAL + F + K+MKK+ T +E
Sbjct  264  MMQLSKDKDKRTVKPASYVNYYDKLALVFWKAGNSLFHAAALLQKFIIYKDMKKSFTQDE  323

Query  290  LQRMACRVLLATLSIPLPSAHP-EFDRFIETDKSPLEKAQRLAILLGLSQPPTRASLLRD  348
             Q  A RVLLATLSIP  S  P +  R ++ +   +   + L+ LL L   PT+  +L++
Sbjct  324  AQEQATRVLLATLSIPEGSDSPSDLSRNLDIEDQHVANMRLLSNLLRLPIAPTKNGILKE  383

Query  349  IVRLNVVSLASPQLQELYLWLEVEFHPLLLCKRVNEVTQRLAEEDGAPLQQYVRALQDVT  408
              R+ V   A    ++LY  LE  F PL + K V  V   +   D     QYV +LQ V 
Sbjct  384  AARIGVPEAAGQTAKDLYKLLESNFSPLKVAKDVQSVLDTVTRPDHL---QYVESLQAVA  440

Query  409  LVRLIRQVSQVYQTVRMDRFMELAVFATPFHLERLLVDCVRHNDMQIRIDHGSRCINFG-  467
             V+ ++QVS +Y+ +  +R  ++  F +   LERL+V+  +H  ++ ++DH + C+ FG 
Sbjct  441  AVKALKQVSVIYEAISWERIRKIIPFYSDLALERLVVEASKHRIVKAQLDHRADCVRFGS  500

Query  468  --MDLSESQRE-DHPEGPTL--QSMPSEQVRSQLINMACVLHKAMNCINPTKKRIEREKL  522
                L+    E D+ EG T     +  E VR+ L  M   L   +  ++  K+R E  K 
Sbjct  501  SDATLAGGVDECDNNEGFTGDDTQLGVEGVRNHLEAMYTRLRGLVEGLDAEKRRKEILKK  560

Query  523  RAQMVQHYHETKNREHQRILARHKIIEDRKEYLERLNTVRICEGKCCLQEEEEARRLEEL  582
                V  Y + +  E +RI  R K++E+ KE  ER+   +         + EEA R EE+
Sbjct  561  IEGQVTSYEKNRPTEIERIHRRKKMLENYKENWERVKAEKTAAAATEQAKREEAARAEEM  620

Query  583  ARQQMLAEQKRLEQEREERERKRQENEIQQIKDRHLKEKMQQISQTSHGQKILKKLDEDD  642
                     KRL+++ +E ERKR++ E  +I+ +  ++++ ++ Q +  Q+I+K+   + 
Sbjct  621  ---------KRLDEQNKESERKRKQAEQDEIQKKIKQDQLYKMQQNAIYQEIIKEKGLEQ  671

Query  643  IKKLDAEQIAAREAEELQKEKRELMQKLKTQEKKVDYFERAKRVEEVPLLQKSFEEKQVQ  702
             + +D EQ+   + E L KE+ E  ++L+ QEK  D+  RA  +EE+   +     +  +
Sbjct  672  FRDMDPEQVLREQRERLDKERAETQRRLQQQEKNFDHHVRALHLEELNERRAVMNMRLSE  731

Query  703  DRKFWEQQETERIQLLVEERELAVQHRERLARMQEDKEAFLEKLRAERRTLYMDKLNEFE  762
              K  +  E  RI   +   +  V+      ++++    ++E ++ + +     KL++++
Sbjct  732  APKLHDLYEEARIAKEIAAHDSHVKLWGMWDQVRDATFDWVESVKIDNQETLEKKLSDWQ  791

Query  763  KMLEEEREKRLAERKLKRKEER  784
              LE  R  RLAER   RK++R
Sbjct  792  AKLEAVRNNRLAERAEDRKKKR  813


>Q584T3_TRYB2 unnamed protein product
Length=775

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 116/249 (47%), Gaps = 27/249 (11%)

Query  933   RDPEVKGDASSWR-RGGD-ADKDKDLGKETERDG-GGRA-FSDRDRRVGFDDRDGG--RS  986
             R+ + +G    W  RGG   D  +D G +   D  GGR  + DR  + G + RD G  R+
Sbjct  24    RNYDNRGGRGEWGDRGGQRGDNQRDYGDQRNYDNRGGRGEWGDRGGQRGDNQRDYGDQRN  83

Query  987   FDRDSGRAGGFGRDRDIVRGGFERDRDGRSGFDRDREGGRGFDRDRDGGRD---RDGG--  1041
             +D   GR G +G DR   RG  +RD   +  +  D  GGRG   DR G R    RD G  
Sbjct  84    YDNRGGR-GEWG-DRGGQRGDNQRDYGDQRNY--DNRGGRGEWGDRGGQRGDNQRDYGDQ  139

Query  1042  RGFDRDSGRGGFDRDRDSGRRGFERDSGRGGFDRDREGGRGMDRDREGGRG----GFDRE  1097
             R +D   GRG +  DR   R   +RD G    + D  GGRG   DR G RG     +D  
Sbjct  140   RNYDNRGGRGEWG-DRGGQRGDNQRDYGD-QRNYDNRGGRGEWGDRGGQRGDNQRNYDNR  197

Query  1098  GGRGGF-DRDTGRGGFERDRPSE---RSSGSAAMGSWRSKPAEPEADDSRRRADERRPTA  1153
             GGRG + DR   RGG +RD  ++   R+     +G  RS      A D+  RA + R + 
Sbjct  198   GGRGEWGDRGGQRGGNQRDNSNQFGYRNERDGGIGRQRSARDNFGAHDN--RASDERGST  255

Query  1154  APVRAPVKD  1162
              P    V D
Sbjct  256   DPAVGEVFD  264



Lambda      K        H
   0.321    0.132    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1007354448


Query= maker-scaffold1755-size453082-augustus-gene-1.3-mRNA-1

Length=1307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SDK_DROME  unnamed protein product                                    1566    0.0  
A0A0B4K827_DROME  unnamed protein product                             277     1e-75
Q0E9K1_DROME  unnamed protein product                                 275     9e-75


>SDK_DROME unnamed protein product
Length=2224

 Score = 1566 bits (4054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/1336 (58%), Positives = 963/1336 (72%), Gaps = 92/1336 (7%)

Query  6     GFPQPKYKWLKDGEALGDFTSDRYYKIISTTRKDTGSYQCIAENDVGSIFSKKIHVTVAY  65
             G+PQP Y+WLKDG  +GDF+S ++Y+  ST R+D GSYQCIA ND GSIFS+K  V VAY
Sbjct  99    GYPQPTYRWLKDGVPVGDFSSSQFYRFHSTRREDAGSYQCIARNDAGSIFSEKSDVVVAY  158

Query  66    MGVFQDQSERTATVPAGQAAVLELPAIESDPPPLVTWQTADSDSLPYSHKFAQTVDNRLV  125
             MG+F++ +E   TV +G  A+ ++P IES P P V WQ+ D   L Y  K+A T  N+L+
Sbjct  159   MGIFENTTEGRLTVISGHPAIFDMPPIESIPVPSVMWQSEDG-PLNYDIKYAFTHANQLI  217

Query  126   VLAADKSDENAYRARATNTQLGKEENSAFIRLVVSGNVSREVAPEIIVKPRDMHIEKGQA  185
             +L+AD++D   YRA+A NTQLGKEE+SAF+ L VSG+   EVAPEIIV+P+D+ ++ G  
Sbjct  218   ILSADENDRKGYRAKAINTQLGKEESSAFVHLNVSGDPYIEVAPEIIVRPQDVKVKVGTG  277

Query  186   SAQLQCIANARPLHVLETLWLKDDILIDHAGIDYSFDDPWNRTLSLLGTNTTHTGSYKCQ  245
               +LQCIANARPLH LETLWLKD + ++ AG+ ++ +DPWNRTL+LL  N++H+G Y CQ
Sbjct  278   VVELQCIANARPLHELETLWLKDGLAVETAGVRHTLNDPWNRTLALLQANSSHSGEYTCQ  337

Query  246   ARLRSGGFSVATASANVIILEKPSFNTNLRIETLGEYRSTLSLPCQVVGVPKPNIVWFRD  305
              RLRSGG+   +ASA + ILE P F T +R ET GE+   + L C VVG P P + WFR+
Sbjct  338   VRLRSGGYPAVSASARLQILEPPLFFTPMRAETFGEFGGQVQLTCDVVGEPTPQVKWFRN  397

Query  306   TERVETISGNRFSVAEDGSLEIKSLRMEDSGMFQCLAANEAGEGSIYTWLKVKTKICYRF  365
              E V+                               A  E+G                R+
Sbjct  398   AESVD-------------------------------AHIESG----------------RY  410

Query  366   SVAEDGSLEIKSLRMEDSGMFQCLAANEAGEGSIYTWLKVKTSTPVIEVPPQNLTVLDGK  425
             ++  D +L IK L ++D+ MFQCLA NEAGE S  TWL+VKTS P++E+PPQN+T LDGK
Sbjct  411   TLNTDNTLVIKKLILDDAAMFQCLAINEAGENSASTWLRVKTSAPIMELPPQNVTALDGK  470

Query  426   DATISCRAVGAPTPNVSWTYQDGNPVELSGRVQVLEQGDLLLAAVRETDAGKYTCLRMNE  485
             DATISCRAVG+P PN++W Y +   V++S RVQ+LE GDLL++ +R  DAG Y C+R NE
Sbjct  471   DATISCRAVGSPNPNITWIYNETQLVDISSRVQILESGDLLISNIRSVDAGLYICVRANE  530

Query  486   AGNDSASGYVSVLVRTQIIQPPVDTRVLLGQTATLQCKVSSDPSVPYKISWQRNNED-ID  544
             AG+     Y+SVLVRTQIIQPPVDT VLLG TATLQCKVSSDPSVPY I W R  +    
Sbjct  531   AGSVKGEAYLSVLVRTQIIQPPVDTTVLLGLTATLQCKVSSDPSVPYNIDWYREGQSSTP  590

Query  545   TSSTQRINIQEDGTLEIRAVRASDVADYTCSVMSSGGNETRSARLSVVELPYAPVNVHAS  604
              S++QRI +Q DG LEI+AVRASDV  Y C V S GGNETR+ARLSV+ELP+ P NV   
Sbjct  591   ISNSQRIGVQADGQLEIQAVRASDVGSYACVVTSPGGNETRAARLSVIELPFPPSNVKVE  650

Query  605   RLESASQRAVNVSWTPGFDGNSPVLKFIVQKREVGDL----GPIADPLPNWVTELSNVSA  660
             RL    QR++NVSWTPGFDGNSP+ KFI+Q+REV +L    GP+ DPL NW+TELSNVSA
Sbjct  651   RLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPLLNWITELSNVSA  710

Query  661   QQRWVLLTHLKAATSYQFRVSAVNSVGEGSASDSSNIVALPQEPPSGPPLGLVGSARSLS  720
              QRW+LL +LKAAT YQFRVSAVN VGEGS S+ SN+V LPQE PSGPP+G VGSARS+S
Sbjct  711   DQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPPVGFVGSARSMS  770

Query  721   EIITQWQPPQEELRNGQILGYAMRYKLYGYESSPWTYQNITNEAQRTFLIKDLITWKDYI  780
             EIITQWQPP EE RNGQILGY +RY+L+GY + PW+YQNITNEAQR FLI++LITWKDYI
Sbjct  771   EIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFLIQELITWKDYI  830

Query  781   IQIAAYNNMGVGVFSDGVKIKTKEGVPEAAPSNVRAEALNSTAVQVWWEPPNPQKINGIN  840
             +QIAAYNNMGVGV+++G KIKTKEGVPEA P+NV+ EA+NSTA +  W PPNPQ+INGIN
Sbjct  831   VQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWTPPNPQQINGIN  890

Query  841   QGYKLQAWKS---DPATEEEDAVAIAVPPSLLDPLAEQSAVMAGLEKYTEYNVTVLCFTN  897
             QGYK+QAW+    D    + +     VPPSL+DPLAEQ+A++ GLEK+TEYN++VLCFT+
Sbjct  891   QGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCFTD  950

Query  898   PGDGRRSEPALVRTDEDLPDEVGSLQFDDISDRAVKVIWTPPKQVNGILRGYQLKYMVKD  957
             PGDG  S    V T +D+PDEV  L FDD+SDR+VKV+W PP+  NGIL GY ++Y VKD
Sbjct  951   PGDGVASSQVAVMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPRASNGILTGYTVRYQVKD  1010

Query  958   HPETIRVENLTSETLSIMVNSLQATTHYRFEISAWTSVGVGPPRVATIQSGIEPVLPSPP  1017
              P+T++  NLT++   + VN LQATTHY FEI AWT VG G P+ ATIQSG+EPVLP  P
Sbjct  1011  RPDTLKSFNLTADDTELTVNQLQATTHYWFEIVAWTRVGSGIPKTATIQSGVEPVLPHAP  1070

Query  1018  TKLAVSNIEAFSVVLQFTPGFDGNSSITKWVAEAQTARNATWFVVVEVSDPDATTLVVGG  1077
             T LA+SNIEAFSVVLQFTPGFDGNSSITKW  E QTARN TWF + E++DPDA TL V G
Sbjct  1071  TALALSNIEAFSVVLQFTPGFDGNSSITKWKVEGQTARNMTWFTICEINDPDAETLTVTG  1130

Query  1078  LVPFTLYKLRIIS----------------------------NECHRAASSLDHEETNYPL  1109
             LVPFT Y+LR+ +                            N   RA S+        PL
Sbjct  1131  LVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQARPKHPPFNVTVRAMSAQQLRVRWIPL  1190

Query  1110  QQVEWFGNPRGYNISYREVGKEK------VHCVRIEDHTANSHVLEKLEEFAQYEILVQA  1163
             QQ EW+GNPRGYNISY+++ K           V IEDHTANSHVL+ LEE+  YE+ + A
Sbjct  1191  QQTEWYGNPRGYNISYKQLVKTPGTIKYVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNA  1250

Query  1164  FNDVGSSEYSPVAVERTRESVPSFGPMNVEANATSSTTIVVKWGDVPREHQNGIIEGYKV  1223
              NDVG S+ S  AVERTRE+VPS+GP++V+ANATSSTT+VV+WG+VPR+H+NG I+GYKV
Sbjct  1251  CNDVGCSKESDTAVERTREAVPSYGPLDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKV  1310

Query  1224  YYGSHARAFQ--YKNIPNNKSFTTTLTELRKFVHYHIQVLACTRLGGGAPSTPPVSVQTF  1281
             +Y +  R  Q  +K IPNN +FTTTLTEL+K+V YH+QVLA TRLG GA STPP+ VQTF
Sbjct  1311  FYAAADRGQQVLHKTIPNNATFTTTLTELKKYVVYHVQVLAYTRLGNGALSTPPIRVQTF  1370

Query  1282  EDGNTVLSLLTITSVS  1297
             ED   V S ++   VS
Sbjct  1371  EDTPGVPSNVSFPDVS  1386


 Score = 207 bits (526),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 253/1000 (25%), Positives = 409/1000 (41%), Gaps = 149/1000 (15%)

Query  385   MFQCLAANEAGEGSIYTWLKVKTSTPVIEVPPQNLTVLDGKDATISCRAVGAPTP-----  439
             + Q  A N  G G      K+KT   V E PP N+ V         CR    P P     
Sbjct  830   IVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWT-PPNPQQING  888

Query  440   -NVSWTYQ-------DGNPVELSGRVQV--------LEQGDLLLAAVRETDAGKYTCLRM  483
              N  +  Q       DG   ++  R++         L +   +L  + +      + L  
Sbjct  889   INQGYKIQAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILGGLEKFTEYNISVLCF  948

Query  484   NEAGNDSASGYVSVLVRTQIIQPPVDTRVLLGQTATLQCKVSSDPSVPYKISWQ--RNNE  541
              + G+  AS  V+V+    +            +   L     SD SV  K+ W   R + 
Sbjct  949   TDPGDGVASSQVAVMTMDDVPD----------EVTGLHFDDVSDRSV--KVLWAPPRASN  996

Query  542   DIDTSSTQRINIQE-------------DGTLEIRAVRAS-----DVADYTCSVMSSGGNE  583
              I T  T R  +++             D  L +  ++A+     ++  +T   + SG  +
Sbjct  997   GILTGYTVRYQVKDRPDTLKSFNLTADDTELTVNQLQATTHYWFEIVAWT--RVGSGIPK  1054

Query  584   TRSARLSVVE-LPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPVLKFIVQKREVGDLG  642
             T + +  V   LP+AP  +  S +E+ S   V + +TPGFDGNS + K+ V+ +   ++ 
Sbjct  1055  TATIQSGVEPVLPHAPTALALSNIEAFS---VVLQFTPGFDGNSSITKWKVEGQTARNM-  1110

Query  643   PIADPLPNWVT--ELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVGEGSASDSSNIVAL  700
                     W T  E+++  A+   + +T L   T Y+ R+SA N VG    S+++     
Sbjct  1111  -------TWFTICEINDPDAET--LTVTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQT  1161

Query  701   PQEPPSGPPLGLVGSARSLSEIITQWQPPQEELRNGQILGYAMRYKLYGYESSPWTYQN-  759
              Q  P  PP  +   A S  ++  +W P Q+    G   GY + YK      +P T +  
Sbjct  1162  IQARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYK--QLVKTPGTIKYV  1219

Query  760   -----ITNEAQRTFLIKDLITWKDYIIQIAAYNNMGVGVFSDGVKIKTKEGVPEAAPSNV  814
                  I +    + ++  L  W  Y +++ A N++G    SD    +T+E VP   P +V
Sbjct  1220  PRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPSYGPLDV  1279

Query  815   RAEALNSTAVQVWWEPPNPQKINGINQGYKLQAWKSDPATEEEDAVAIAVPPSLLDPLAE  874
             +A A +ST V V W     Q  NG   GYK+    +D     +  +   +P +     A 
Sbjct  1280  QANATSSTTVVVQWGEVPRQHRNGQIDGYKVFYAAAD---RGQQVLHKTIPNN-----AT  1331

Query  875   QSAVMAGLEKYTEYNVTVLCFTNPGDGRRSEPAL-VRTDEDLPDEVGSLQFDDISDRAVK  933
              +  +  L+KY  Y+V VL +T  G+G  S P + V+T ED P    ++ F D+S    +
Sbjct  1332  FTTTLTELKKYVVYHVQVLAYTRLGNGALSTPPIRVQTFEDTPGVPSNVSFPDVSLTMAR  1391

Query  934   VIWTPPKQVNGILRGYQLKYMVKDHPETIRVENLTSETLSIMVNSLQATTHYRFEISAWT  993
             +IW  P   NG +  YQ+ Y +                 +     L    +Y F  +A T
Sbjct  1392  IIWDVPVDPNGKILAYQVTYTLNGSAMLNYSREFPPSDRTFRATELLPGKYYSFSCTAQT  1451

Query  994   SVGVGPPRVA---TIQSGIEPVLPSPPTKLAVSNIEAFSVVLQFTPGFDGNSSITKWVAE  1050
              +G G    A   T  +   P  PS P +++ S I+A  +   +TPG DG + +  +  E
Sbjct  1452  RLGWGKIATALVYTTNNRERPQAPSVP-QISRSQIQAHQITFSWTPGRDGFAPLRYYTVE  1510

Query  1051  AQTARNATWFVVVEVSDPDATTLVVGGLVPFTLYKLRI-ISNECHRAASSLDHEETNY--  1107
              +      W  + E  DP  ++    GL P+  Y+ RI  +N+   +A S +        
Sbjct  1511  MR-ENEGRWQPLPERVDPSLSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLP  1569

Query  1108  -------------------------PLQQVEWFGNPR--GYNISYREVG----------K  1130
                                       L+   W G+    GY I Y+++           K
Sbjct  1570  AAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPK  1629

Query  1131  EKVHCVRIEDHTANSHVLEKLEEFAQYEILVQAFNDVGSSEYSPVAVERTRESVPSFGPM  1190
               VH +       NS VL  L++   YEI+V  FN  G    +P A     E+VP+  P 
Sbjct  1630  TDVHGI-----NENSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPR  1684

Query  1191  NVEANATSSTTIVVKWGDVPREHQNGIIEGYKVYY--------GSHARAFQYK-NIPNNK  1241
              V+A   SST + + W    +  QNG I GYK+YY            R ++ +  + +  
Sbjct  1685  AVDAAPISSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGRKWEEEIEVVSAT  1744

Query  1242  SFTTTLTELRKFVHYHIQVLACTRLGGGAPSTPPVSVQTF  1281
             + + +L  L KF  Y IQ+LA    G G P + P++V+T 
Sbjct  1745  ATSHSLVFLDKFTEYRIQLLAFNPAGDG-PRSAPITVKTL  1783


 Score = 155 bits (393),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 150/519 (29%), Positives = 233/519 (45%), Gaps = 46/519 (9%)

Query  593   ELPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPVLKFIVQKREVGDLGPIADPLPNWV  652
             E P AP     SR +  + + +  SWTPG DG +P+  + V+ RE         PLP  V
Sbjct  1470  ERPQAPSVPQISRSQIQAHQ-ITFSWTPGRDGFAPLRYYTVEMRENEGRW---QPLPERV  1525

Query  653   T-ELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVGEGSASDSSNIV-ALPQEPPSGPPL  710
                LS+ +A         L+   +YQFR+ A N +G  + S  S IV  LP  P  G   
Sbjct  1526  DPSLSSFTA-------VGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLPAAPAVGVG-  1577

Query  711   GLVGSARSLSEIITQWQPPQEELRNGQIL--GYAMRYKLY-----GYESSPWTYQNITNE  763
             GL     + + +  QW   +  L NG     GY + Y+         +S+P T  +  NE
Sbjct  1578  GLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPKTDVHGINE  1637

Query  764   AQRTFLIKDLITWKDYIIQIAAYNNMGVGVFSDGVKIKTKEGVPEAAPSNVRAEALNSTA  823
                + ++ DL   ++Y I +  +N+ G G  +    +   E VP   P  V A  ++ST 
Sbjct  1638  --NSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPRAVDAAPISSTE  1695

Query  824   VQVWWEPPNPQKINGINQGYKL--------QAWKSDPATEEEDAVAIAVPPSLLDPLAEQ  875
             V++ W+PP     NG   GYK+        QA +     EEE  V  A            
Sbjct  1696  VRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGRKWEEEIEVVSAT---------AT  1746

Query  876   SAVMAGLEKYTEYNVTVLCFTNPGDGRRSEPALVRTDEDLPDEVGSLQFDDISDRAVKVI  935
             S  +  L+K+TEY + +L F   GDG RS P  V+T   +P     L+F DI+ ++++V 
Sbjct  1747  SHSLVFLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPSAPLHLRFSDITMQSLEVT  1806

Query  936   WTPPKQVNGILRGYQLKYMVKDHPETI--RVENLTSETLSIMVNSLQATTHYRFEISAWT  993
             W PPK +NG + GY + Y   +  E    +V+   S T ++ V +L+    Y F + A T
Sbjct  1807  WDPPKFLNGEILGYLVTYETTEENEKFSKQVKQKVSNT-TLRVQNLEEEVTYTFTVRAQT  1865

Query  994   SVGVGPPRVATIQSGIEPVLPSPPTKLAVSNIEAFSVVLQFTPGFDGNSSITKWVAEAQT  1053
             SV  GP     + +G +   P  P  L ++   + SV + +  G  G   I  ++ EA+ 
Sbjct  1866  SVDYGPGISENVTTGPQDGSPVAPRDLILTKTLS-SVEMHWINGPSGRGPILGYLIEAKK  1924

Query  1054  ARNATWFVVVEVSDPDATTLVVGG--LVPFTLYKLRIIS  1090
               ++ W  + +          V    L+P T Y  R+I+
Sbjct  1925  RDDSRWTKIEQTRKGMMQDFTVSYHILMPSTAYTFRVIA  1963


 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 167/768 (22%), Positives = 307/768 (40%), Gaps = 87/768 (11%)

Query  571   DYTCSVM--SSGGNETRSARLSVVELPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPV  628
             +Y  SV+  +  G+   S++++V+ +   P  V     +  S R+V V W P    N  +
Sbjct  940   EYNISVLCFTDPGDGVASSQVAVMTMDDVPDEVTGLHFDDVSDRSVKVLWAPPRASNGIL  999

Query  629   LKFIVQKREVGDLGPIADPLPNWVTELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVGE  688
               + V + +V D     D L ++     N++A    + +  L+A T Y F + A   VG 
Sbjct  1000  TGYTV-RYQVKDR---PDTLKSF-----NLTADDTELTVNQLQATTHYWFEIVAWTRVGS  1050

Query  689   GSASDSSNIVALPQEPPSGPPLGLVGSARSLSEIITQWQPP---QEELRNGQILGYAMRY  745
             G    ++    +    P  P    + +  + S ++ Q+ P       +   ++ G   R 
Sbjct  1051  GIPKTATIQSGVEPVLPHAPTALALSNIEAFS-VVLQFTPGFDGNSSITKWKVEGQTARN  1109

Query  746   KLYGYESSPWTYQNITNEAQRTFLIKDLITWKDYIIQIAAYNNMGVGVFSDGVK-IKTKE  804
               +      +T   I +    T  +  L+ +  Y ++++A N +G    S+  K  +T +
Sbjct  1110  MTW------FTICEINDPDAETLTVTGLVPFTQYRLRLSASNVVGSSKPSEATKDFQTIQ  1163

Query  805   GVPEAAPSNVRAEALNSTAVQVWWEPPNPQKINGINQGYKL--QAWKSDPATEEEDAVAI  862
               P+  P NV   A+++  ++V W P    +  G  +GY +  +     P T +      
Sbjct  1164  ARPKHPPFNVTVRAMSAQQLRVRWIPLQQTEWYGNPRGYNISYKQLVKTPGTIK------  1217

Query  863   AVPPSL-LDPLAEQSAVMAGLEKYTEYNVTVLCFTNPGDGRRSEPALVRTDEDLPDEVGS  921
              VP S+ ++     S V+  LE++T Y V +    + G  + S+ A+ RT E +P   G 
Sbjct  1218  YVPRSVVIEDHTANSHVLDSLEEWTLYEVKMNACNDVGCSKESDTAVERTREAVPS-YGP  1276

Query  922   L--QFDDISDRAVKVIW--TPPKQVNGILRGYQLKYMVKDHPETIRVENL-TSETLSIMV  976
             L  Q +  S   V V W   P +  NG + GY++ Y   D  + +  + +  + T +  +
Sbjct  1277  LDVQANATSSTTVVVQWGEVPRQHRNGQIDGYKVFYAAADRGQQVLHKTIPNNATFTTTL  1336

Query  977   NSLQATTHYRFEISAWTSVGVG-----PPRVATIQSGIEPVLPSPPTKLAVSNIEAFSVV  1031
               L+    Y  ++ A+T +G G     P RV T +       P  P+ ++  ++      
Sbjct  1337  TELKKYVVYHVQVLAYTRLGNGALSTPPIRVQTFED-----TPGVPSNVSFPDVSLTMAR  1391

Query  1032  LQFTPGFDGNSSITKWVAEAQTARNATWFVVVEVSDPDATTLVVGGLVPFTLYKLRIISN  1091
             + +    D N  I  +     T   +          P   T     L+P   Y     + 
Sbjct  1392  IIWDVPVDPNGKILAYQV-TYTLNGSAMLNYSREFPPSDRTFRATELLPGKYYSFSCTAQ  1450

Query  1092  E---CHRAASSLDHEETNYPLQQV------------------EW------FGNPRGYNIS  1124
                   + A++L +   N    Q                    W      F   R Y + 
Sbjct  1451  TRLGWGKIATALVYTTNNRERPQAPSVPQISRSQIQAHQITFSWTPGRDGFAPLRYYTVE  1510

Query  1125  YRE-VGKEKVHCVRIEDHTANSHVLEKLEEFAQYEILVQAFNDVGSSEYSPVAV-ERTRE  1182
              RE  G+ +    R+ D + +S     L  +  Y+  +QA ND+G S +S  +V  RT  
Sbjct  1511  MRENEGRWQPLPERV-DPSLSSFTAVGLRPYMTYQFRIQATNDLGPSAFSRESVIVRTLP  1569

Query  1183  SVPSFGPMNVEANATSSTTIVVKWGDVPREHQNGIIE--GYKVYY---GSHARAFQ---Y  1234
             + P+ G   ++    ++T++ V+W  +     NG     GY++ Y        A Q    
Sbjct  1570  AAPAVGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQSTPK  1629

Query  1235  KNIPNNKSFTTTLTELRKFVHYHIQVLACTRLGGGAPSTPPVSVQTFE  1282
              ++      +  L++L++  +Y I VL     G G P+TPP +V   E
Sbjct  1630  TDVHGINENSVVLSDLQQDRNYEIVVLPFNSQGPG-PATPPAAVYVGE  1676


 Score = 84.0 bits (206),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 162/662 (24%), Positives = 265/662 (40%), Gaps = 83/662 (13%)

Query  666   LLTHLKAATSYQFRVSAVNSVGEGSASDSSNIVALPQEPPSGPPLGLVGSARSLSEIITQ  725
             +L  L+  T Y+ +++A N VG    SD++ +    +  PS  PL +  +A S + ++ Q
Sbjct  1234  VLDSLEEWTLYEVKMNACNDVGCSKESDTA-VERTREAVPSYGPLDVQANATSSTTVVVQ  1292

Query  726   WQPPQEELRNGQILGYAMRYKLYGYESSPWTYQNITNEAQRTFLIKDLITWKDYIIQIAA  785
             W     + RNGQI GY + Y           ++ I N A  T  + +L  +  Y +Q+ A
Sbjct  1293  WGEVPRQHRNGQIDGYKVFYAA-ADRGQQVLHKTIPNNATFTTTLTELKKYVVYHVQVLA  1351

Query  786   YNNMGVGVFSDG-VKIKTKEGVPEAAPSNVRAEALNSTAVQVWWEPP-NPQ-KINGINQG  842
             Y  +G G  S   ++++T E  P   PSNV    ++ T  ++ W+ P +P  KI      
Sbjct  1352  YTRLGNGALSTPPIRVQTFEDTP-GVPSNVSFPDVSLTMARIIWDVPVDPNGKILAYQVT  1410

Query  843   YKLQAWKSDPATEEEDAVAIAVPPSLLDPLAEQSAVMAGLEKYTEYNVTVLCFTNPGDGR  902
             Y L        + E        PPS  D     + ++ G  KY  Y+ +    T  G G+
Sbjct  1411  YTLNGSAMLNYSRE-------FPPS--DRTFRATELLPG--KY--YSFSCTAQTRLGWGK  1457

Query  903   RSEPALVRT--DEDLPD--EVGSLQFDDISDRAVKVIWTPPKQVNGILRGYQLKYMVKDH  958
              +  ALV T  + + P    V  +    I    +   WTP +     LR Y ++    + 
Sbjct  1458  IAT-ALVYTTNNRERPQAPSVPQISRSQIQAHQITFSWTPGRDGFAPLRYYTVEMRENEG  1516

Query  959   PETIRVENLTSETLSIMVNSLQATTHYRFEISAWTSVGVGPPRVATIQSGIEPVLPSPPT  1018
                   E +     S     L+    Y+F I A   +G   P   + +S I   LP+ P 
Sbjct  1517  RWQPLPERVDPSLSSFTAVGLRPYMTYQFRIQATNDLG---PSAFSRESVIVRTLPAAPA  1573

Query  1019  ----KLAVSNIEAFSVVLQF----TPGFDGNSS------ITKWVAEAQTARNATWFVVVE  1064
                  L V  I   SV +Q+    T  ++G++S      + + +++  TA  +T     +
Sbjct  1574  VGVGGLKVVPITTTSVRVQWSALETALWNGDASTGGYRILYQQLSDFPTALQST--PKTD  1631

Query  1065  VSDPDATTLVVGGL----------VPFT------------LYKLRIISNECHRAASSLDH  1102
             V   +  ++V+  L          +PF             +Y    +     RA  +   
Sbjct  1632  VHGINENSVVLSDLQQDRNYEIVVLPFNSQGPGPATPPAAVYVGEAVPTGEPRAVDAAPI  1691

Query  1103  EETNY-----PLQQVEWFGNPRGYNISYR--------EVGKEKVHCVRIEDHTANSHVLE  1149
               T       P +Q    G+  GY I Y         E G++    + +   TA SH L 
Sbjct  1692  SSTEVRLLWKPPKQSMQNGDILGYKIYYLVTYSPQALEPGRKWEEEIEVVSATATSHSLV  1751

Query  1150  KLEEFAQYEILVQAFNDVGSSEYSPVAVERTRESVPSFGPMNVEANATSSTTIVVKWGDV  1209
              L++F +Y I + AFN  G    S     +T   VPS  P+++  +  +  ++ V W   
Sbjct  1752  FLDKFTEYRIQLLAFNPAGDGPRSAPITVKTLPGVPS-APLHLRFSDITMQSLEVTWD--  1808

Query  1210  PREHQNGIIEGYKVYYGSHARAFQYKNIPNNKSFTTTL--TELRKFVHYHIQVLACTRLG  1267
             P +  NG I GY V Y +     ++      K   TTL    L + V Y   V A T + 
Sbjct  1809  PPKFLNGEILGYLVTYETTEENEKFSKQVKQKVSNTTLRVQNLEEEVTYTFTVRAQTSVD  1868

Query  1268  GG  1269
              G
Sbjct  1869  YG  1870


 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 105/419 (25%), Positives = 160/419 (38%), Gaps = 103/419 (25%)

Query  284  STLSLPCQVVGVPKPNIVWFRDTERVETISGNRFSVAEDGSLEIKSLRMEDSGMFQCLAA  343
            ST  L C  +G P+P   W +D   V   S ++F           S R ED+G +QC+A 
Sbjct  89   STKILQCHALGYPQPTYRWLKDGVPVGDFSSSQF-------YRFHSTRREDAGSYQCIAR  141

Query  344  NEAGEGSIYTWLKVKTKICY----------RFSV------------------------AE  369
            N+A  GSI++  K    + Y          R +V                        +E
Sbjct  142  NDA--GSIFS-EKSDVVVAYMGIFENTTEGRLTVISGHPAIFDMPPIESIPVPSVMWQSE  198

Query  370  DGSLE--------------IKSLRMEDSGMFQCLAANE---AGEGSIYTWLKVKTSTPVI  412
            DG L               I S    D   ++  A N      E S +  L V +  P I
Sbjct  199  DGPLNYDIKYAFTHANQLIILSADENDRKGYRAKAINTQLGKEESSAFVHLNV-SGDPYI  257

Query  413  EVPPQNLTVLDGKDAT---------ISCRAVGAPTPNVSWTY-QDGNPVELSGRVQVLE-  461
            EV P+   ++  +D           + C A   P   +   + +DG  VE +G    L  
Sbjct  258  EVAPE--IIVRPQDVKVKVGTGVVELQCIANARPLHELETLWLKDGLAVETAGVRHTLND  315

Query  462  --QGDLLLAAVRETDAGKYTC-LRMNEAGNDSASGYVSVLVRTQIIQPPV-------DTR  511
                 L L     + +G+YTC +R+   G  +    VS   R QI++PP+       +T 
Sbjct  316  PWNRTLALLQANSSHSGEYTCQVRLRSGGYPA----VSASARLQILEPPLFFTPMRAETF  371

Query  512  VLLGQTATLQCKVSSDPSVPYKISWQRNNEDIDTS-STQRINIQEDGTLEIRAVRASDVA  570
               G    L C V  +P+   ++ W RN E +D    + R  +  D TL I+ +   D A
Sbjct  372  GEFGGQVQLTCDVVGEPTP--QVKWFRNAESVDAHIESGRYTLNTDNTLVIKKLILDDAA  429

Query  571  DYTCSVMSSGGNETRSARLSV------VELPYAPVNVHASRLESASQRAV-----NVSW  618
             + C  ++  G  + S  L V      +ELP   V     +  + S RAV     N++W
Sbjct  430  MFQCLAINEAGENSASTWLRVKTSAPIMELPPQNVTALDGKDATISCRAVGSPNPNITW  488


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 87/356 (24%), Positives = 147/356 (41%), Gaps = 71/356 (20%)

Query  1013  LPSPPTKLAVSNI---EAFSVVLQFTPGFDGNSSITKWVAEAQTARNATWFV--------  1061
             LP PP+ + V  +   +  S+ + +TPGFDGNS I+K++ + +       FV        
Sbjct  640   LPFPPSNVKVERLPEPQQRSINVSWTPGFDGNSPISKFIIQRREVSELEKFVGPVPDPLL  699

Query  1062  --VVEVSD--PDATTLVVGGLVPFTLYKLRIIS-NECHRAASSLDHEETNYPLQQ-----  1111
               + E+S+   D   +++  L   T+Y+ R+ + N     + S        P +      
Sbjct  700   NWITELSNVSADQRWILLENLKAATVYQFRVSAVNRVGEGSPSEPSNVVELPQEAPSGPP  759

Query  1112  VEWFGNPR----------------------GYNISYREVGKEKV--HCVRIEDHTANSHV  1147
             V + G+ R                      GY + YR  G   V      I +    + +
Sbjct  760   VGFVGSARSMSEIITQWQPPLEEHRNGQILGYILRYRLFGYNNVPWSYQNITNEAQRNFL  819

Query  1148  LEKLEEFAQYEILVQAFNDVGSSEYSPVAVERTRESVPSFGPMNVEANATSSTTIVVKWG  1207
             +++L  +  Y + + A+N++G   Y+  +  +T+E VP   P NV+  A +ST    +W 
Sbjct  820   IQELITWKDYIVQIAAYNNMGVGVYTEGSKIKTKEGVPEAPPTNVKVEAINSTAARCRWT  879

Query  1208  DVPREHQNGIIEGYKVYYGSHARAFQ--------------YKNIPNN-----KSFTTTLT  1248
                 +  NGI +GYK+      +A+Q               K +P +        T  L 
Sbjct  880   PPNPQQINGINQGYKI------QAWQRRLIDGEWRDIERRMKTVPPSLIDPLAEQTAILG  933

Query  1249  ELRKFVHYHIQVLACTRLGGGAPSTPPVSVQTFEDGNTVLSLLTITSVSHISFLVV  1304
              L KF  Y+I VL  T  G G  S+  V+V T +D    ++ L    VS  S  V+
Sbjct  934   GLEKFTEYNISVLCFTDPGDGVASS-QVAVMTMDDVPDEVTGLHFDDVSDRSVKVL  988


 Score = 39.3 bits (90),  Expect = 0.030, Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 6/68 (9%)

Query  421  VLDGKDATISCRAVGAPTPNVSWTYQDGNPVELSGRVQVLEQGDLLLAAVRETDAGKYTC  480
            V +G    + C A+G P P   W  +DG PV      Q          + R  DAG Y C
Sbjct  85   VSEGSTKILQCHALGYPQPTYRW-LKDGVPVGDFSSSQFYR-----FHSTRREDAGSYQC  138

Query  481  LRMNEAGN  488
            +  N+AG+
Sbjct  139  IARNDAGS  146


 Score = 38.1 bits (87),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 52/219 (24%), Positives = 90/219 (41%), Gaps = 25/219 (11%)

Query  580   GGNETRSARLSVVELPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPVLKFIVQKREVG  639
              G+  RSA ++V  LP  P      R    + +++ V+W P    N  +L ++V      
Sbjct  1769  AGDGPRSAPITVKTLPGVPSAPLHLRFSDITMQSLEVTWDPPKFLNGEILGYLVTYETTE  1828

Query  640   DLGPIADPLPNWVTELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVGEGSASDSSNIVA  699
             +    +  +     ++SN + +     + +L+   +Y F V A  SV  G    S N+  
Sbjct  1829  ENEKFSKQVKQ---KVSNTTLR-----VQNLEEEVTYTFTVRAQTSVDYGPGI-SENVTT  1879

Query  700   LPQEPPSGPPLGLVGSARSLSEIITQWQPPQEELRNGQILGYAMRYKLYGYESSPWTYQN  759
              PQ+     P  L+ + ++LS +   W         G ILGY +  K    + S WT   
Sbjct  1880  GPQDGSPVAPRDLILT-KTLSSVEMHWI--NGPSGRGPILGYLIEAK--KRDDSRWT---  1931

Query  760   ITNEAQRTFLIKD-------LITWKDYIIQIAAYNNMGV  791
                E  R  +++D       L+    Y  ++ AYN  G+
Sbjct  1932  -KIEQTRKGMMQDFTVSYHILMPSTAYTFRVIAYNRYGI  1969


>A0A0B4K827_DROME unnamed protein product
Length=2028

 Score = 277 bits (709),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 338/1337 (25%), Positives = 544/1337 (41%), Gaps = 201/1337 (15%)

Query  1     LLVLAGFPQPKYKWLKDGEALGD----FTSDRYYKIIST------TRKDTGSYQCIAEND  50
             L    G+P P ++W K  E          +DR  ++  T        +D+G Y C+  N 
Sbjct  267   LCPAQGYPAPSFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNS  326

Query  51    VGSIFSKKIHVTVAYMGVFQDQSERTATVPAGQAAVLELPAIESDPPPLVTWQTADSDSL  110
             VG    + +    A +    D    T TV  G+ AV        +P   V+W   D  ++
Sbjct  327   VGGESVETVLTVTAPLSAKIDPP--TQTVDFGRPAVFTC-QYTGNPIKTVSWM-KDGKAI  382

Query  111   PYSHKFAQTVDNRLVVLAADKSDENAYRARATNTQLGKEENSAFIRLVVSGNVSREVAPE  170
              +S          L + +  K D+  Y+    N Q   E   A   L + G       P 
Sbjct  383   GHSEPV-------LRIESVKKEDKGMYQCFVRNDQ---ESAEASAELKLGGRFD----PP  428

Query  171   IIVKPRDMHIEKGQASAQLQCIANARPLHVLETLWLKDDILIDH-----AGIDYSFDDPW  225
             +I +       +   S  L+C+A   P    E  W  D   I +      G   + +   
Sbjct  429   VIRQAFQEETMEPGPSVFLKCVAGGNP--TPEISWELDGKKIANNDRYQVGQYVTVNGDV  486

Query  226   NRTLSLLGTNTTHTGSYKCQARLRSGGFSVATASANVIILEKPSFNTNLRIETL-GEYRS  284
                L++   +    G YKC A+ + G   VA  SA + +   P      +   + GE   
Sbjct  487   VSYLNITSVHANDGGLYKCIAKSKVG---VAEHSAKLNVYGLPYIRQMEKKAIVAGE---  540

Query  285   TLSLPCQVVGVPKPNIVWFRDTERVETISGNRFSVAEDGSLEIKSL-RMEDSGMFQCLAA  343
             TL + C V G P  +IVW RD   +      +  V  +G+L I+++ R  D   + C+A 
Sbjct  541   TLIVTCPVAGYPIDSIVWERDNRALPI--NRKQKVFPNGTLIIENVERNSDQATYTCVAK  598

Query  344   NEAG---EGSIYTWLKVKTKIC-------------YRFSVA-------------------  368
             N+ G    GS+   + V  K+              Y+ + A                   
Sbjct  599   NQEGYSARGSLEVQVMVPPKLAPLPVNSPLYVGDYYQLTCAVVHGDAPFNITWYYNNEPA  658

Query  369   -------------EDGSLEIKSLRMEDSGMFQCLAANEAGEGSIYTWLKVKTSTPVIEVP  415
                             SL I+S+  + +G + C  AN AGE +  T L VK   P   + 
Sbjct  659   GDLAGVTILMHGRRSSSLNIESVGGDHAGNYTCKGANRAGETTAETHLSVKVP-PRWILE  717

Query  416   PQNLTVLDGKDATISCRAVGAPTPNVSWTYQDGNP------VELSGRVQVLEQGDLLLAA  469
             P +     G DA + C+A G P P V+W    G+       ++ S  ++V E+G L +  
Sbjct  718   PTDKAFAQGSDAKVECKADGFPKPQVTWKKAVGDTPGEYKDLKKSDNIRV-EEGTLHVDN  776

Query  470   VRETDAGKYTCLRMNEAGNDSASGYVSVLVRTQIIQPPVDTRVLLGQTA------TLQCK  523
             +++T+ G Y C    EA N   SG +S ++   +  PP  T  L  QTA       LQC+
Sbjct  777   IQKTNEGYYLC----EAINGIGSG-LSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCE  831

Query  524   VSSDPSVPYKISWQRNNEDIDTSSTQRINIQED-------GTLEIRAVRASDVADYTCSV  576
                +   P  I W  NN  +D  +  R  I+E+        +L I+    SD A +TC  
Sbjct  832   AKGEK--PIGILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVA  889

Query  577   MSSGGNETRSARLSVVELPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPVLKFIVQ-K  635
              ++ G++  S  + V E+P  P   +A ++   S R+V +SW   +DGNSP+ ++I++ K
Sbjct  890   TNAFGSDDASINMIVQEVPEMP---YALKVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFK  946

Query  636   REVGDLGPIADPL-PNWVTELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVGEGSASDS  694
             R       I   + P   TE            +  L  AT+Y  R+ A N++G   +S++
Sbjct  947   RSRASWSEIDRVIVPGHTTEAQ----------VQKLSPATTYNIRIVAENAIGTSQSSEA  996

Query  695   SNIVALPQEPPSGPPLGLVGSARSLSEIITQWQPPQEELRNGQILGYAMRYKLYGYESSP  754
               I+   +E PSG P  +     + + +   W+PP     NG+ILGY + YKL    SS 
Sbjct  997   VTIITA-EEAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSS-  1054

Query  755   WTYQNI---TNEAQRTFL-IKDLITWKDYIIQIAAYNNMGVGVFSDGVKIKTKEGVPEAA  810
             + ++ I   T E +   L +++L  +  Y + I A+N +G G  S+  K  T EG P   
Sbjct  1055  YVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQP  1114

Query  811   PSNVRAEALNSTAVQVWWEPPNPQKINGINQGYKLQAWKSDPATEEEDAVAIAVPPSLLD  870
             PS+     L S  ++V W  P  +  NG+ + YK+    SD   +E              
Sbjct  1115  PSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYAPSDEWYDETK--------RHYK  1166

Query  871   PLAEQSAVMAGLEKYTEYNVTVLCFTNPGDGRRSEPALVRTDEDLPDEVGSLQFDDISDR  930
               A    V+ GL+KYT Y + VL  T  GDG RS P   +T+ D+P+    ++   + + 
Sbjct  1167  KTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSVPIHCQTEPDVPEAPTDVKALVMGNA  1226

Query  931   AVKVIWTPPKQVNGILRGYQLKYMVKDHPETIRVENLTSETLSIMVNSLQATTHYRFEIS  990
             A+ V W PP Q NGI+  Y +    +      + + +    +S     L+    Y F ++
Sbjct  1227  AILVSWRPPAQPNGIITQYTVYSKAEGAETETKTQKVPHYQMSFEATELEKNKPYEFWVT  1286

Query  991   AWTSVGVGPPRVATIQSGIEPVLPSP--PTKLAVSNIEAFSVVLQFTPGFDGNSSITKWV  1048
             A T++G G       QS     +PS   P K+A       S    FT  F  ++ +   +
Sbjct  1287  ASTTIGEGQ------QSKSIVAMPSDQVPAKIA-------SFDDTFTATFKEDAKM-PCL  1332

Query  1049  AEAQTARNATWFVV-VEVSDPD-ATTLVVGGLVPFTLYKLRIISNECHR----AASSLDH  1102
             A        TW +  VE S  D    L  G L+  ++ +       CH     A  S+ H
Sbjct  1333  AVGAPQPEITWKIKGVEFSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAENSIAKDSITH  1392

Query  1103  --------------------EETNYPLQQVEWFGNP-RGYNISYR-EVGKEKVHCVRIED  1140
                                 +     L+  E    P  GY + Y+ E G+ +   V ++ 
Sbjct  1393  KLIVLAPPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHYKPEFGEWETSEVSVD-  1451

Query  1141  HTANSHVLEKLEEFAQYEILVQAFNDVGSSEYSPVAVERTRESVPSF--GPMNVEANATS  1198
               +  H +E L   ++Y++    FN++G+ E S +   RT+   P     P  +E ++ S
Sbjct  1452  --SQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILNTRTKGQKPKLPEKPRFIEVSSNS  1509

Query  1199  STTIVVKW--GDVPREH  1213
              +     W  G  P  H
Sbjct  1510  VSLHFKAWKDGGCPMSH  1526


 Score = 113 bits (283),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 244/1195 (20%), Positives = 447/1195 (37%), Gaps = 177/1195 (15%)

Query  5     AGFPQPKYKWLK-DGEALGDFTSDRYY----KII------STTRKDTGS--YQCIAENDV  51
             +G P P+  W++ DG A+GD    R      K++         R++  +  Y C+A N  
Sbjct  64    SGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQF  123

Query  52    GSIFSKKIHVTVAYMGVFQDQSERTATVPAGQAAVLEL--PAIESDPPPLVTWQTADSDS  109
             GSI S+ +HV       F+ Q      +  G AA+ +   P+  +D   +  W   + + 
Sbjct  124   GSIISRDVHVRAVVKQFFESQVYDEYVI-KGNAAIFKCQTPSFVADHIDITDWIDTEGEV  182

Query  110   LPYSHKFAQTV-DNRLVVLAAD---------KSDENAYRARATNTQLGKEENSAFI-RLV  158
                   F + + D + +VL +          +    +Y+ R  +   G+   SA   RLV
Sbjct  183   ------FTKNITDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLV  236

Query  159   VSGNVSREVAPEI-IVKPRDMHIEKGQASAQLQCIANARPLHVLETLWLKDDILIDHAGI  217
             ++  VS   AP++  ++ R M I  G     + C A   P          +      A +
Sbjct  237   ITEPVS-STAPKVPPLQSRPM-IVPGHTDLSILCPAQGYPAPSFRWYKFIEGTTRKQAVV  294

Query  218   DYSFDDPWNRTLSLLGTNTTHTGSYKCQARLRSGGFSVATASANVIILEKP-SFNTNLRI  276
                     + TL +       +G Y C      GG SV T    V+ +  P S   +   
Sbjct  295   LNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVET----VLTVTAPLSAKIDPPT  350

Query  277   ETLGEYRSTLSLPCQVVGVPKPNIVWFRDTERVETISGNRFSVAEDGSLEIKSLRMEDSG  336
             +T+   R  +   CQ  G P   + W +D + +    G+   V     L I+S++ ED G
Sbjct  351   QTVDFGRPAV-FTCQYTGNPIKTVSWMKDGKAI----GHSEPV-----LRIESVKKEDKG  400

Query  337   MFQCLAANEAGEGSIYTWLKVKTKI-------CYRFSVAEDG-----------------S  372
             M+QC   N+         LK+  +         ++    E G                 S
Sbjct  401   MYQCFVRNDQESAEASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPTPEIS  460

Query  373   LEIKSLRMEDSGMFQC---------------LAANEAGEGSIYTWLKVKTSTPVIE----  413
              E+   ++ ++  +Q                + +  A +G +Y  +  K+   V E    
Sbjct  461   WELDGKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCI-AKSKVGVAEHSAK  519

Query  414   -----VP----PQNLTVLDGKDATISCRAVGAPTPNVSWTYQDGNPVELSGRVQVLEQGD  464
                  +P     +   ++ G+   ++C   G P  ++ W  +D   + ++ + +V   G 
Sbjct  520   LNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDSIVWE-RDNRALPINRKQKVFPNGT  578

Query  465   LLLAAV-RETDAGKYTCLRMNEAGNDS-ASGYVSVLVRTQIIQPPVDTRVLLGQTATLQC  522
             L++  V R +D   YTC+  N+ G  +  S  V V+V  ++   PV++ + +G    L C
Sbjct  579   LIIENVERNSDQATYTCVAKNQEGYSARGSLEVQVMVPPKLAPLPVNSPLYVGDYYQLTC  638

Query  523   KVSSDPSVPYKISWQRNNEDID--TSSTQRINIQEDGTLEIRAVRASDVADYTCSVMSSG  580
              V      P+ I+W  NNE        T  ++ +   +L I +V      +YTC   +  
Sbjct  639   AVVHG-DAPFNITWYYNNEPAGDLAGVTILMHGRRSSSLNIESVGGDHAGNYTCKGANRA  697

Query  581   GNETRSARLSVVELPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPVLKFIVQKREVGD  640
             G  T    LSV   P   +          S   V      GF         +  K+ VGD
Sbjct  698   GETTAETHLSVKVPPRWILEPTDKAFAQGSDAKVECK-ADGFPKPQ-----VTWKKAVGD  751

Query  641   L-GPIADPLPNWVTELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVGEGSASDSSNIVA  699
               G   D     + +  N+  ++  + + +++      +   A+N +G G    S+ I+ 
Sbjct  752   TPGEYKD-----LKKSDNIRVEEGTLHVDNIQKTNEGYYLCEAINGIGSGL---SAVIMI  803

Query  700   LPQEPPS------------GPPLGLVGSARSLSEIITQWQPPQEELRNGQILGYAMRYKL  747
               Q PP             G P  L   A+    I   W      L       Y +R ++
Sbjct  804   SVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEI  863

Query  748   YGYESSPWTYQNITNEAQRTFLIKDLITWKDYIIQIAAYNNMGVGVFSDGVKIKT-KEGV  806
                         ++     +  IK        +    A N  G    SD   I    + V
Sbjct  864   ------------LSTGVMSSLSIKRTERSDSALFTCVATNAFG----SDDASINMIVQEV  907

Query  807   PEAAPSNVRAEALNSTAVQVWWEPPNPQKINGINQGYKLQAWKSDPATEEEDAVAIAVPP  866
             PE  P  ++    +  +VQ+ W    P   N     Y ++  +S  +  E D V +    
Sbjct  908   PE-MPYALKVLDKSGRSVQLSWA--QPYDGNSPLDRYIIEFKRSRASWSEIDRVIV----  960

Query  867   SLLDPLAEQSAVMAGLEKYTEYNVTVLCFTNPGDGRRSEPALVRTDEDLPD-EVGSLQFD  925
                 P     A +  L   T YN+ ++     G  + SE   + T E+ P  +  +++ +
Sbjct  961   ----PGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVE  1016

Query  926   DISDRAVKVIWTPPKQV--NGILRGYQLKYMVKDHP-----ETIRVENLTSETLSIMVNS  978
              ++   ++V W PP +   NG + GY + Y + +       ETI       +  ++ + +
Sbjct  1017  PVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQN  1076

Query  979   LQATTHYRFEISAWTSVGVGPPRVATIQSGIEPVLPSPPTKLAVSNIEAFSVVLQF-TPG  1037
             L+  T Y   I A+  +G GP      Q   E     PP+  A + + + ++ + + +P 
Sbjct  1077  LRVYTQYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPP  1136

Query  1038  FDGNSSITKWVAEAQTARNATWF--VVVEVSDPDATTLVVGGLVPFTLYKLRIIS  1090
              +  + + K   +   A +  W+           ++  V+ GL  +T Y +++++
Sbjct  1137  LESANGVIK-TYKVVYAPSDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLA  1190


 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 105/418 (25%), Positives = 170/418 (41%), Gaps = 64/418 (15%)

Query  902   RRSEPALVRTDEDLPDEVGSLQFDDISDRAVKVIWTPPKQVNGILRGYQLKYMVKDHPET  961
             RR EPA+             LQ +   ++ + ++W         +   +L     D+  T
Sbjct  821   RRGEPAV-------------LQCEAKGEKPIGILWN--------MNNMRLDPK-NDNRYT  858

Query  962   IRVENLTSETLS-IMVNSLQATTHYRFEISAWTSVGVGPPRVATIQSGIEPVLPSPPTKL  1020
             IR E L++  +S + +   + +    F   A  + G     +  I   +    P  P  L
Sbjct  859   IREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEV----PEMPYAL  914

Query  1021  AVSNIEAFSVVLQFTPGFDGNSSITKWVAEAQTARNATWFVVVEVSDPDATTLV-VGGLV  1079
              V +    SV L +   +DGNS + +++ E + +R A+W  +  V  P  TT   V  L 
Sbjct  915   KVLDKSGRSVQLSWAQPYDGNSPLDRYIIEFKRSR-ASWSEIDRVIVPGHTTEAQVQKLS  973

Query  1080  PFTLYKLRII------SNECHRAASSLDHEE---------------------TNYPLQQV  1112
             P T Y +RI+      +++   A + +  EE                     T  P  + 
Sbjct  974   PATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRT  1033

Query  1113  EWFGNPRGYNISYREVGKEKVHCVRI-----EDHTANSHVLEKLEEFAQYEILVQAFNDV  1167
             EW G   GY + Y+       +         E+   ++  L+ L  + QY +++QAFN +
Sbjct  1034  EWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKI  1093

Query  1168  GSSEYSPVAVERTRESVPSFGPMNVEANATSSTTIVVKWGDVPREHQNGIIEGYKVYYGS  1227
             G+   S    + T E  PS  P +      +S TI V W   P E  NG+I+ YKV Y  
Sbjct  1094  GAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESANGVIKTYKVVYAP  1153

Query  1228  HARAFQ--YKNIPNNKSFTTTLTELRKFVHYHIQVLACTRLGGGAPSTPPVSVQTFED  1283
                 +    ++     S  T L  L+K+ +Y +QVLA T  G G  S  P+  QT  D
Sbjct  1154  SDEWYDETKRHYKKTASSDTVLHGLKKYTNYTMQVLATTAGGDGVRSV-PIHCQTEPD  1210


 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 131/346 (38%), Gaps = 70/346 (20%)

Query  372   SLEIKSLRMEDSGMFQCLAANEAGEGSIYTWLKVKTSTPVIEVPPQ------NLTVLDGK  425
             S E   L       F   A+   GEG      K   + P  +VP +        T    +
Sbjct  1269  SFEATELEKNKPYEFWVTASTTIGEGQ---QSKSIVAMPSDQVPAKIASFDDTFTATFKE  1325

Query  426   DATISCRAVGAPTPNVSWTYQDGNPVELSG--RVQVLEQGDLLLAAVRETDAGKYTCLRM  483
             DA + C AVGAP P ++W  +    VE S   R++VL  G LL+ +V   DAG Y+C   
Sbjct  1326  DAKMPCLAVGAPQPEITWKIKG---VEFSANDRMRVLPDGSLLIKSVNRQDAGDYSCHAE  1382

Query  484   NEAGNDSASGYVSVLVRTQIIQPPVDTRVLLGQTATLQCKVSSDP-----------SVPY  532
             N    DS +  + VL       PP    V L  T T    V   P           ++ Y
Sbjct  1383  NSIAKDSITHKLIVLA------PPQSPHVTLSATTTDALTVKLKPHEGDTAPLHGYTLHY  1436

Query  533   KI---SWQRNNEDIDTSSTQ--------RINIQEDGTLEIRAVRASDVADYTCSVMSSGG  581
             K     W+ +   +D+            R  +   G   I A  ASD+ +          
Sbjct  1437  KPEFGEWETSEVSVDSQKHNIEGLLCGSRYQVYATGFNNIGAGEASDILN----------  1486

Query  582   NETRSARLSVVELPYAPVNVHASRLESASQRAVNVSWTPGFDGNSPVLKFIVQKREVGDL  641
               T+  +  + E P         R    S  +V++ +    DG  P+  F+V+ ++   +
Sbjct  1487  TRTKGQKPKLPEKP---------RFIEVSSNSVSLHFKAWKDGGCPMSHFVVESKKRDQI  1537

Query  642   GPIADPLPNWVTELSNVSAQQRWVLLTHLKAATSYQFRVSAVNSVG  687
                      W    +NV     +V+L  L+ AT Y  R++A NS G
Sbjct  1538  --------EWNQISNNVKPDNNYVVLD-LEPATWYNLRITAHNSAG  1574


 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 92/404 (23%), Positives = 154/404 (38%), Gaps = 97/404 (24%)

Query  263  IILEKPSFNTNLRIETLGEYRSTLSLPCQVVGVPKPNIVWFR-DTERVETISGNRFSVAE  321
            + L++P+   +    T  E      + C+  G P P I+W R D   V  + G R  ++ 
Sbjct  40   VFLKEPTNRIDFSNSTGAE------IECKASGNPMPEIIWIRSDGTAVGDVPGLR-QISS  92

Query  322  DGSLEIKSLRMED------SGMFQCLAANEAG-----------------EGSIYT-----  353
            DG L     R ED      + ++ CLA N+ G                 E  +Y      
Sbjct  93   DGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVKQFFESQVYDEYVIK  152

Query  354  ----------------------WLKVKTKICYR------FSVAEDGSLEIKSLRMEDS-G  384
                                  W+  + ++  +      + V   G L I+ +  ED   
Sbjct  153  GNAAIFKCQTPSFVADHIDITDWIDTEGEVFTKNITDGKYLVLPSGELHIREVGPEDGYK  212

Query  385  MFQCLAANE--------AGEGSIYTWLKVKTSTPVIEVPP---QNLTVLDGKDATISCRA  433
             +QC   +         A +G +     V ++ P  +VPP   + + V    D +I C A
Sbjct  213  SYQCRTKHRLTGETRLSATKGRLVITEPVSSTAP--KVPPLQSRPMIVPGHTDLSILCPA  270

Query  434  VGAPTPNVSW-TYQDG----NPVELSGRVQVLEQGDLLLAAVRETDAGKYTCLRMNEAGN  488
             G P P+  W  + +G      V L+ RV+ +  G L++      D+GKY C+  N  G 
Sbjct  271  QGYPAPSFRWYKFIEGTTRKQAVVLNDRVKQV-SGTLIIKDAVVEDSGKYLCVVNNSVGG  329

Query  489  DSASGYVSVLV-RTQIIQPPVDTRVLLGQTATLQCKVSSDPSVPYKISWQRNNEDIDTSS  547
            +S    ++V    +  I PP  T V  G+ A   C+ + +P     +SW ++ + I  S 
Sbjct  330  ESVETVLTVTAPLSAKIDPPTQT-VDFGRPAVFTCQYTGNPI--KTVSWMKDGKAIGHS-  385

Query  548  TQRINIQEDGTLEIRAVRASDVADYTCSVMSSGGNETRSARLSV  591
                    +  L I +V+  D   Y C V +   +   SA L +
Sbjct  386  --------EPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKL  421


 Score = 47.0 bits (110),  Expect =