BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= CFLO000001-PA

Length=201
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GBRB_DROME  unnamed protein product                                   261     2e-84
GBRB_CAEEL  unnamed protein product                                   147     1e-41
GBRB3_DROME  unnamed protein product                                  145     4e-41


>GBRB_DROME unnamed protein product
Length=606

 Score = 261 bits (667),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/161 (87%), Positives = 146/161 (91%), Gaps = 6/161 (4%)

Query  23   LPQFRVLGHRQRQTTIHLSTVGYTMRDIRYKWNEGLNSVGVSNDVSLPQFKVLGHRQRAM  82
             P  R L H      I + + GYTMRDIRYKWNEG NSVGVS++VSLPQFKVLGHRQRAM
Sbjct  192  FPMDRQLCH------IEIESFGYTMRDIRYKWNEGPNSVGVSSEVSLPQFKVLGHRQRAM  245

Query  83   EISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRHATPARVSLGVT  142
            EISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNR+ATPARV+LGVT
Sbjct  246  EISLTTGNYSRLACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRNATPARVALGVT  305

Query  143  TVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLL  183
            TVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLL
Sbjct  306  TVLTMTTLMSSTNAALPKISYVKSIDVYLGTCFVMVFASLL  346


>GBRB_CAEEL unnamed protein product
Length=550

 Score = 147 bits (372),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 99/150 (66%), Gaps = 1/150 (1%)

Query  34   RQTTIHLSTVGYTMRDIRYKWNEGLNSVGVSNDVSLPQFKVLGHRQRAMEISLTTGNYSR  93
            +  T+ + + GYT  ++  KWN  L   GV     +PQF + G       +S  TG+Y R
Sbjct  192  QNCTVEIESYGYTTSEVLMKWNYPLAVHGVEQ-ADVPQFTITGFHTEDSIVSTATGSYQR  250

Query  94   LACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRHATPARVSLGVTTVLTMTTLMSS  153
            L+   Q  RS+GY++ Q Y+P  LIV++SWVSFW+N  AT ARV+LG+TTVLTMTT+ + 
Sbjct  251  LSLVFQLRRSVGYFIFQTYLPCVLIVMLSWVSFWINHEATSARVALGITTVLTMTTISTG  310

Query  154  TNAALPKISYVKSIDVYLGTCFVMVFASLL  183
               +LP+ISYVKSID+YL  CFV VFA+LL
Sbjct  311  VRQSLPRISYVKSIDIYLVMCFVFVFAALL  340


>GBRB3_DROME unnamed protein product
Length=496

 Score = 145 bits (366),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/150 (47%), Positives = 100/150 (67%), Gaps = 2/150 (1%)

Query  34   RQTTIHLSTVGYTMRDIRYKWNEGLNSVGVSNDVSLPQFKVLGHRQRAMEISLTTGNYSR  93
            +  T+ + + GYT+ D+   W      V    D  LPQF ++G+     +  L TG Y R
Sbjct  188  QNCTVEIESYGYTVSDVVMYWKP--TPVRGVEDAELPQFTIIGYETNDRKERLATGVYQR  245

Query  94   LACEIQFVRSMGYYLIQIYIPSGLIVIISWVSFWLNRHATPARVSLGVTTVLTMTTLMSS  153
            L+   +  R++GY++ Q Y+PS LIV++SWVSFW+N  AT ARV+LG+TTVLTMTT+ + 
Sbjct  246  LSLSFKLQRNIGYFVFQTYLPSILIVMLSWVSFWINHEATSARVALGITTVLTMTTISTG  305

Query  154  TNAALPKISYVKSIDVYLGTCFVMVFASLL  183
              ++LP+ISYVK+ID+YL  CFV VFA+LL
Sbjct  306  VRSSLPRISYVKAIDIYLVMCFVFVFAALL  335



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000002-PA

Length=266
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GBRB_DROME  unnamed protein product                                   60.1    4e-10
G5EEY3_CAEEL  unnamed protein product                                 31.6    0.63 
G5EE10_CAEEL  unnamed protein product                                 31.6    0.63 


>GBRB_DROME unnamed protein product
Length=606

 Score = 60.1 bits (144),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/30 (90%), Positives = 27/30 (90%), Gaps = 0/30 (0%)

Query  1   MFGDVNISAILDSFSVSYDKRVRPNYGDDP  30
           M GDVNISAILDSFSVSYDKRVRPNYG  P
Sbjct  53  MLGDVNISAILDSFSVSYDKRVRPNYGGPP  82


 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 23/29 (79%), Gaps = 0/29 (0%)

Query  222  PPVEVGVTMYVLSISSLSEVKMVLLFRSY  250
            PPVEVGVTMYVLSISSLSEVKM      Y
Sbjct  81   PPVEVGVTMYVLSISSLSEVKMDFTLDFY  109


>G5EEY3_CAEEL unnamed protein product
Length=487

 Score = 31.6 bits (70),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  223  PVEVGVTMYVLSISSLSEVKMVLLFRSY  250
            PV+VG+T++V SIS++SEV M      Y
Sbjct  59   PVDVGITIHVSSISAVSEVDMDFTLDFY  86


 Score = 29.6 bits (65),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 2/26 (8%)

Query  7   ISAILDSFS--VSYDKRVRPNYGDDP  30
           +S++LD  +   +YDKR+RP YG+ P
Sbjct  34  LSSVLDRLTNRTTYDKRLRPRYGEKP  59


>G5EE10_CAEEL unnamed protein product
Length=448

 Score = 31.6 bits (70),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%), Gaps = 0/28 (0%)

Query  223  PVEVGVTMYVLSISSLSEVKMVLLFRSY  250
            PV+VG+T++V SIS++SEV M      Y
Sbjct  59   PVDVGITIHVSSISAVSEVDMDFTLDFY  86


 Score = 29.6 bits (65),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 19/26 (73%), Gaps = 2/26 (8%)

Query  7   ISAILDSFS--VSYDKRVRPNYGDDP  30
           +S++LD  +   +YDKR+RP YG+ P
Sbjct  34  LSSVLDRLTNRTTYDKRLRPRYGEKP  59



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000003-PA

Length=164
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSG1_CAEEL  unnamed protein product                                   32.7    0.14 
Q382R7_TRYB2  unnamed protein product                                 28.1    3.6  
Q382C0_TRYB2  unnamed protein product                                 27.3    7.7  


>OSG1_CAEEL unnamed protein product
Length=1182

 Score = 32.7 bits (73),  Expect = 0.14, Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 7/69 (10%)

Query  7    LLLASESTHDSRTRDQQYKKRTNGDEASAIARMVVMMPVVDVDRLMKTTTTMPRVVVAKR  66
            ++ AS    +SR   QQ  ++TN +         V MP +DV+ L K   ++P+ V A R
Sbjct  66   MVRASRERSESRRASQQNLRKTNSEPN-------VDMPSIDVEALQKLLLSIPKFVSASR  118

Query  67   IARTDEHGS  75
                  H S
Sbjct  119  NRINQRHDS  127


>Q382R7_TRYB2 unnamed protein product
Length=974

 Score = 28.1 bits (61),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 22/95 (23%)

Query  19   TRDQQYKKRTNGDEASAIARMVVMMPVVDV--------------DRLMKTTTTMPRVVVA  64
            ++ QQ    + GD   A+ + V ++P   V              DRL++   +M R   A
Sbjct  506  SKPQQPSNSSGGDSKLAVRKTVSVLPTKSVRLTRNSRLVRQQRVDRLVQGQLSMRRAASA  565

Query  65   KRIARTDEHGSGIVQVE--------AGALGGVEAP  91
             + A +DE   G V ++         G L  +E+P
Sbjct  566  TQGAVSDEEAVGPVAMQDTLVAPDDVGGLQDIESP  600


>Q382C0_TRYB2 unnamed protein product
Length=618

 Score = 27.3 bits (59),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query  118  QRGS-GGGYNFPNETCGPQPSYHRVPGDDDYYYCFNYNDDNNG  159
            +RGS  G  +  +  CG QPS  R+ G+    + FN+   N G
Sbjct  211  RRGSPAGAESSVDRKCGDQPSLLRIDGNGRRIFLFNHMLKNEG  253



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000004-PA

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLR1_DROME  unnamed protein product                                   794     0.0   
GLR1_CAEEL  unnamed protein product                                   496     2e-163
Q9VDH5_DROME  unnamed protein product                                 434     9e-141


>GLR1_DROME unnamed protein product
Length=991

 Score = 794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/759 (55%), Positives = 530/759 (70%), Gaps = 82/759 (11%)

Query  1    LRLQQIYQGLKPGNDTFQVDTVKRIQNVSEALDFLRNIEELNRWSNKYVVLDCPTDMAKE  60
            LRLQQIYQ LKPGN+TF+V  VKRI NV+ A++FL  +E+L R+S K +VLDCP +MAKE
Sbjct  182  LRLQQIYQELKPGNETFRVQMVKRIANVTMAIEFLHTLEDLGRFSKKRIVLDCPAEMAKE  241

Query  61   IVVSHVRDVTLGRRTYHYLLSGLIMDDRWESEVIEYGAINITGFRIVDANRAHVKEFLVG  120
            I+V HVRD+ LGRRTYHYLLSGL+MD+ W S+V+E+GAINITGFRIVD+NR  V++F   
Sbjct  242  IIVQHVRDIKLGRRTYHYLLSGLVMDNHWPSDVVEFGAINITGFRIVDSNRRAVRDFHDS  301

Query  121  WRQL-------SGNLFPGAGRDSISAQAALMYDAVFVLFEGFNKFVGKKTSK---NNPRR  170
             ++L       S N        +ISAQAALMYDAVFVL E FN+ + KK  +   N+ +R
Sbjct  302  RKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQFRSNHLQR  361

Query  171  ------TGSMSIGGQPSNLTLDCNSKNGVVSHFEHGEKIVKQLRKVDIVGLTGQIKFSEE  224
                  + S + G   S+  LDCN+  G V+ +E GEKI + LRKV+I GL+G+I+F E+
Sbjct  362  RSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFDED  421

Query  225  GRRQNYTLDVVEMTVNSAPVKVAEWKDFSGYQLVPTRRDRHPKS---------EIVKNKT  275
            GRR NYTL VVEM+VNS   +VAEW+D +G  L+P     +  S         +  +N T
Sbjct  422  GRRINYTLHVVEMSVNSTLQQVAEWRDDAG--LLPLHSHNYASSSRSASASTGDYDRNHT  479

Query  276  YIITTI---------------------------------------VARELQIVKDKKYGS  296
            YI++++                                       +  E+++V+D  YG+
Sbjct  480  YIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGA  539

Query  297  ENPDQPGGWDGMVGELIRREADMAIAPMTIMSERERVIDFSKPFMSLGISIMIKKPVKQN  356
            EN   PGGWDGMVGELIR+EAD+AI+ MTI +ERERVIDFSKPFM+LGISIMIKKPVKQ 
Sbjct  540  ENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQT  599

Query  357  PGVFSFLNPLSKEIWVCIVFSCIGVSVVLFIVSRFSPYEWRVLTLNTSRDPSLVSRDGSL  416
            PGVFSFLNPLS+EIW+ ++ S +GVS VL+ V+RF PYEWR++     R P     D + 
Sbjct  600  PGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIV-----RRP---QADSTA  651

Query  417  QHSHGAQG----SPHGQHTSMV--NDFTLLNSLWFSLGAIMQQGTDISPRSISGRIVGCV  470
            Q   G  G    S    H   V  N+FT+LNS W+SL A MQQG DI+P SI+GRI   V
Sbjct  652  QQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAV  711

Query  471  WWFFTLILISSYTANLAAFLTVERMVTPINSPEDLAAQSEVKYGTLEGGSTWSFFERSQI  530
            WWFFT+ILISSYTANLAAFLTVERMV PI +PEDL  Q++V YGTL  GSTW FF RSQI
Sbjct  712  WWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFRRSQI  771

Query  531  DLYKQMYRTMKDN-NVKVKSYDEGIQRVRMSKGKYALLIESPKNDYVNEREPCDTMKVGR  589
             L+ +M+  M  N +  V +YDEGI+RVR SKGKYALL+ESPKN+YVN R PCDTMKVGR
Sbjct  772  GLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGR  831

Query  590  NLDVKGFGIATPLGSPLRDSINLAVLSLKESGELAKLQNKWWYERTECRHSDKQDTSRNE  649
            N+D KGFG+ATP+GSPLR  +N AVL+LKE+GEL +++NKWW+++TEC + D++ ++ NE
Sbjct  832  NIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTEC-NLDQETSTPNE  890

Query  650  LSLSNVAGIFYILIGGLLLALSVALIEFCYKSHTEATRA  688
            LSLSNVAGI+YILIGGLLLA+ VA++EF  ++ T   ++
Sbjct  891  LSLSNVAGIYYILIGGLLLAVIVAIMEFFCRNKTPQLKS  929


>GLR1_CAEEL unnamed protein product
Length=962

 Score = 496 bits (1277),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 299/742 (40%), Positives = 421/742 (57%), Gaps = 104/742 (14%)

Query  32   LDFLRNIEELNRWSNKYVVLDCPTDMAKEIVVSHVRDVTLGRRTYHYLLSGLIMDDRWES  91
             + +RN  E NR     +++DC +    + ++ ++R     +  YHY+L+       ++ 
Sbjct  214  FNMMRN-NETNR-----ILIDCASPKRLKKLLINIRSAQFNQANYHYVLANYDFLP-YDQ  266

Query  92   EVIEYGAINITGFRIVDANRAHVKEFLVGWRQLSGNLFPGAGRDSISAQAALMYDAVFVL  151
            E+ + G INI+GF I++ +    +E+    + L  +   G G D +S +AA+ +DA+ V 
Sbjct  267  EMFQNGNINISGFNIINKDG---REYWSLKKHLKTSSSLGGG-DDVSVEAAVGHDAMLVT  322

Query  152  FEGFNKFVGKKTSKNN----PRRTGSMSIGGQPSNLTLDCNSKNGVVSHFEHGEKIVKQL  207
            + GF K +    S  +     RR  +    G   +   D +  N   S FEHG+ I    
Sbjct  323  WHGFAKCLQANDSLFHGTFRHRRFFNRGFPGIYCDPLSDRSHPNRPFSSFEHGKTIGVAF  382

Query  208  RKVDIV----GLTGQIKFSEEGRRQNYTLDVVEMTVNSAPV----KVAEWKDFSGY--QL  257
            R + I      LTG I+F   G R+N+ + +V++  N+       +V  W+   G+    
Sbjct  383  RNMKIGHKEGTLTGNIEFDRFGNRKNFDVSIVDLVSNTKATFNSKEVLAWRQGVGFFSNR  442

Query  258  VPTRRDRHPKSEIVKNKTYIITTIVA------RE-----------------------LQI  288
               +  R  +++   N+  ++T +VA      RE                       L++
Sbjct  443  TVAQHSRKSQNDHKDNQVIVLTNLVAPFVMIKRECLEMANLTECQGNNKFEGFCIDLLKL  502

Query  289  VKDK------------KYGSENPDQPGGWDGMVGELIRREADMAIAPMTIMSERERVIDF  336
            + DK            K GS+  D  G WDGM+GEL+   A   +A +TI  ERERV+DF
Sbjct  503  LADKIEEFNYEIKLGTKAGSKQAD--GSWDGMIGELLSGRAHAVVASLTINQERERVVDF  560

Query  337  SKPFMSLGISIMIKKPVKQNPGVFSFLNPLSKEIWVCIVFSCIGVSVVLFIVSRFSPYEW  396
            SKPFM+ GISIMIKKP KQ   VFSF+ PLS EIW+ I+F+ IGVSVV+F+VSRFSPYEW
Sbjct  561  SKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEW  620

Query  397  RVLTLNTSRDPSLVSRDGSLQHSHGAQGSPHGQHTSMVNDFTLLNSLWFSLGAIMQQGTD  456
            RV    TSR    +S                       NDF++ N LWF+L A MQQGTD
Sbjct  621  RVE--ETSRGGFTIS-----------------------NDFSVYNCLWFTLAAFMQQGTD  655

Query  457  ISPRSISGRIVGCVWWFFTLILISSYTANLAAFLTVERMVTPINSPEDLAAQSEVKYGTL  516
            I PRSISGRI    WWFFT+I++SSYTANLAAFLT+E+M  PI S EDLA QS++KYG  
Sbjct  656  ILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQ  715

Query  517  EGGSTWSFFERSQIDLYKQMYRTMKDN--NVKVKSYDEGIQRVRMSKGKYALLIESPKND  574
             GGST SFF+ S + +Y++M+R M+     V V SY EGI+RVR  KG+YA L+E+  N+
Sbjct  716  GGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANE  775

Query  575  YVNEREPCDTMKVGRNLDVKGFGIATPLGSPLRDSINLAVLSLKESGELAKLQNKWWYER  634
            Y N R+PCDTMKVG NL+  G+GIATP GS  +D INLA+L+L+E GEL KL+NKWWY+R
Sbjct  776  YENTRKPCDTMKVGANLNSIGYGIATPFGSDWKDHINLAILALQERGELKKLENKWWYDR  835

Query  635  TECRHSDKQDTSRNELSLSNVAGIFYILIGGLLLALSVALIEFCYKSHTEATRAKI----  690
             +C      D S   L+LS VAGIFYIL+GG+++++  AL EF Y+S  EA ++      
Sbjct  836  GQCDAGITVDGSSASLNLSKVAGIFYILMGGMVISMLAALGEFLYRSRIEARKSNSNSMV  895

Query  691  -----PLSDAMKAKARLTIGGG  707
                  L  A+ ++ RL++ GG
Sbjct  896  ANFAKNLKSALSSQLRLSVEGG  917


>Q9VDH5_DROME unnamed protein product
Length=853

 Score = 434 bits (1115),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 261/738 (35%), Positives = 406/738 (55%), Gaps = 109/738 (15%)

Query  1    LRLQQIYQ--GLKPGNDTFQVDTVKRIQNVSEALDFLRNIEELNRWSNKYVVLDCPTDMA  58
            +RLQ++ +  G+ P   T        ++ +S++ D+   ++++   +  ++VLDC T+  
Sbjct  171  VRLQELLKAHGMTPFPIT--------VRQLSDSGDYRPLLKQIKNSAEAHIVLDCSTERI  222

Query  59   KEIVVSHVRDVTLGRRTYHYLLSGLIMDDRWESEVIEYGAINITGFRIVDANRAHVKEFL  118
             E V+   + + +    + YL++ L +      E   YG  NITGFR++  N   V + +
Sbjct  223  HE-VLKQAQQIGMMSDYHSYLVTSLDLHTVNLDE-FRYGGTNITGFRLI--NEKIVSDVV  278

Query  119  VGWRQLSGNLFPGAGRDSISAQAALMYDAVFVLFEGFNKFVGKKTSKNNPRRTGSMSIGG  178
              W      L   A   ++ ++ ALMYDAV +  +  +     +    +P     +S  G
Sbjct  279  RQWSIDEKGLLRSANLTTVRSETALMYDAVHLFAKALHDLDTSQQIDIHP-----ISCDG  333

Query  179  QPSNLTLDCNSKNGVVSHFEHGEKIVKQLRKVDIVGLTGQIKFSEEGRRQNYTLDVVEMT  238
            Q               S ++HG  ++  ++ V++ GLT  IKF  +G R ++ LD+VE+T
Sbjct  334  Q---------------STWQHGFSLINYMKIVEMKGLTNVIKFDHQGFRTDFMLDIVELT  378

Query  239  VNSAPVKVAEWKDFSGYQLVPTRRDRHPKSEI---VKNKTYIITTIVAR-----------  284
              +   K+  W       +  TR     + EI   +KNKT ++TTI++            
Sbjct  379  -PAGIRKIGTWNSTLPDGINFTRTFSQKQQEIEANLKNKTLVVTTILSNPYCMRKESAIP  437

Query  285  --------------------------ELQIVKDKKYGSENPDQPGGWDGMVGELIRREAD  318
                                      ++Q+V D  YGS N    G W+GM+ EL+ + AD
Sbjct  438  LSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLN-KLTGEWNGMIRELLEQRAD  496

Query  319  MAIAPMTIMSERERVIDFSKPFMSLGISIMIKKPVKQNPGVFSFLNPLSKEIWVCIVFSC  378
            +AIA +TI  ERE+ +DF+ PFM+LG+SI+ +KP+KQ P +FSFL+PLS ++W+ +  + 
Sbjct  497  LAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAY  556

Query  379  IGVSVVLFIVSRFSPYEWRVLTLNTSRDPSLVSRDGSLQHSHGAQGSPHGQHTSMVNDFT  438
            +GVSV+LFI+++F+PYEW   T                          HG+     + FT
Sbjct  557  LGVSVLLFILAKFTPYEWPAYT------------------------DAHGEKVE--SQFT  590

Query  439  LLNSLWFSLGAIMQQGTDISPRSISGRIVGCVWWFFTLILISSYTANLAAFLTVERMVTP  498
            LLN +WF++G++MQQG D  P+++S R+V  +WWFFTLI+ISSYTANLAAFLTVERM +P
Sbjct  591  LLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSP  650

Query  499  INSPEDLAAQSEVKYGTLEGGSTWSFFERSQIDLYKQMYRTMKDN--NVKVKSYDEGIQR  556
            I S EDLA Q+ +KYG L+GGST +FF  S+I  Y++M+  M+    +V   S  EG++R
Sbjct  651  IESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVER  710

Query  557  VRMSKGKYALLIESPKNDYVNEREPCDTMKVGRNLDVKGFGIATPLGSPLRDSINLAVLS  616
            V   KG YA L+ES   +YV ER  C+  +VG  LD K +GIATP  SP R +IN  +L 
Sbjct  711  VAKGKGSYAFLMESTSIEYVTERN-CELTQVGGMLDTKSYGIATPPNSPYRTAINSVILK  769

Query  617  LKESGELAKLQNKWWYERT---ECR-HSDKQDTSRNELSLSNVAGIFYILIGGLLLALSV  672
            L+E G+L  L+ KWW E+    +CR  + K  ++ NEL L+NV G+F +L+GG+ +A  +
Sbjct  770  LQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVI  829

Query  673  ALIEFCYKSHTEATRAKI  690
            A+ EF +KS   A   ++
Sbjct  830  AVCEFVWKSRKVAVEERL  847



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000005-PA

Length=498
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRE12_DROME  unnamed protein product                                  157     2e-42
Q8IQH6_DROME  unnamed protein product                                 154     2e-41
Q9VU17_DROME  unnamed protein product                                 155     2e-41


>TRE12_DROME unnamed protein product
Length=488

 Score = 157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 110/410 (27%), Positives = 195/410 (48%), Gaps = 15/410 (4%)

Query  6    KKTMEKDKPVDFSL----------LRQVLIGIVCNLLIVDSGFHEGWSTP-MIPKLEKDD  54
            K  M  D  V FS+            QVL  +  +L  +  GF   +++P ++   ++  
Sbjct  2    KILMRADTHVSFSVPADGLKANFTFSQVLAALSVSLCSLVVGFVSAYTSPALVSMTDRTI  61

Query  55   PEVRIDAEQGTWIINLLYVGVGVGSVIPLLLMDRIGRKWTMLVAAVPKIASWIIFATARN  114
                +  + G+W+  ++ +    G +    L++ +GR+ T+L  AVP I S ++ A A N
Sbjct  62   TSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVN  121

Query  115  HWAFYAGRLLAGVGTGVTYCVTPMYLGEISTKRTRGPLSASLAVWINMGMLVIYAVGMWS  174
                  GR L G   G+     P+YLGE      RG L        N+G+LV Y  G + 
Sbjct  122  VIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFM  181

Query  175  TRLTTSLVAVAVPLMFLASFMWLPKSAVFLAKKNRMGKAEKVLKWSLGRD-DVEAELEEI  233
                 + +  A+P+ FL   + +P++  +   + +  +A K LKW  G++ DVE EL+E+
Sbjct  182  NWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKEL  241

Query  234  RRIVANEQERQLSFFRSLVESAARRESRRAFGIIGILMASMIFSGAAPILAYQLETFEAA  293
             +  A + +RQ +  ++      +R + +   I   LM    FSG   ++ Y ++ F+ A
Sbjct  242  MQSQA-DADRQAT--QNTCLELFKRNNLKPLSISLGLMFFQQFSGINAVIFYTVQIFKDA  298

Query  294  GFEVSPNVSVLGSGVAIVVAGMACVLLVKRTGKRMLLLTAGPTTAVSLAVVAGFFTLKSM  353
            G  +  N+S +  GV    A    ++L+ R G+++LL  +     V+L+++ GFF  K+ 
Sbjct  299  GSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLSILGGFFYCKAH  358

Query  354  GFDVSGVNWIPTVFIIVYALAYGVALNPLPLSYISEVFPVDGRQGAGRAV  403
            G DVS + W+P    ++Y L + +   P+P   + E+ P   R  A   V
Sbjct  359  GPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVV  408


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/370 (31%), Positives = 186/370 (50%), Gaps = 20/370 (5%)

Query  41   GWSTPMIPKL--EKDDPEVRIDAEQGTWIINLLYVGVGVGSVIPLLLMDRIGRKWTMLVA  98
            GW++P   ++    +  +  +D +Q +W+ + + +G     +    L++ IGRKWTML  
Sbjct  34   GWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFL  93

Query  99   AVPKIASWIIFATARNHWAFYAGRLLAGVGTGVTYCVT-PMYLGEISTKRTRGPLSASLA  157
             +P I  W +   A N    YA R + G+  G  +CVT PMY GEI+ K  RG L +   
Sbjct  94   VLPFILGWTMLIWAVNVSMLYASRFILGIAGG-AFCVTAPMYTGEIAQKEIRGTLGSFFQ  152

Query  158  VWINMGMLVIYAVGMWSTRLTTSLVAVAVPLMFLASFMWLPKSAVFLAKKNRMGKAEKVL  217
            + I +G+L +YAVG        S++   +PL+F A F ++P+S  +L  K+R   A K +
Sbjct  153  LMITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSI  212

Query  218  KWSLGRD-DVEAELEEIRRIVANEQERQLSFFRSLVESAARRE-SRRAFGIIGILMASMI  275
            +W  G++ D E EL E+R     E +R+    +  V +A  R  +R+A  I   LM    
Sbjct  213  QWLRGKEYDYEPELAELR-----ETDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQ  267

Query  276  FSGAAPILAYQLETFEAAGFEVSPNVSVLGSGVAIVVAGMACVLLVKRTGKRMLLLTAGP  335
              G   ++ Y    F  A   +    + +  G+  VVA     L+V + G+R+LLL +G 
Sbjct  268  VCGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGI  327

Query  336  TTAVSLAVVAGFFTL-KSMGFDVSGVNWIPT----VFIIVYALAYGVALNPLPLSYISEV  390
            + A+S   +  +F L K     V  + W+P     +FII++++ YG    P+P   + E+
Sbjct  328  SMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFIIMFSIGYG----PVPWLMMGEL  383

Query  391  FPVDGRQGAG  400
            F  D +  AG
Sbjct  384  FATDIKGFAG  393


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 155 bits (393),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 113/370 (31%), Positives = 186/370 (50%), Gaps = 20/370 (5%)

Query  41   GWSTPMIPKL--EKDDPEVRIDAEQGTWIINLLYVGVGVGSVIPLLLMDRIGRKWTMLVA  98
            GW++P   ++    +  +  +D +Q +W+ + + +G     +    L++ IGRKWTML  
Sbjct  102  GWTSPAETEIVDRGEGYDFPVDKDQFSWVGSAMTLGAACVCIPIGFLINMIGRKWTMLFL  161

Query  99   AVPKIASWIIFATARNHWAFYAGRLLAGVGTGVTYCVT-PMYLGEISTKRTRGPLSASLA  157
             +P I  W +   A N    YA R + G+  G  +CVT PMY GEI+ K  RG L +   
Sbjct  162  VLPFILGWTMLIWAVNVSMLYASRFILGIAGG-AFCVTAPMYTGEIAQKEIRGTLGSFFQ  220

Query  158  VWINMGMLVIYAVGMWSTRLTTSLVAVAVPLMFLASFMWLPKSAVFLAKKNRMGKAEKVL  217
            + I +G+L +YAVG        S++   +PL+F A F ++P+S  +L  K+R   A K +
Sbjct  221  LMITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTYLVSKDRSENAIKSI  280

Query  218  KWSLGRD-DVEAELEEIRRIVANEQERQLSFFRSLVESAARRE-SRRAFGIIGILMASMI  275
            +W  G++ D E EL E+R     E +R+    +  V +A  R  +R+A  I   LM    
Sbjct  281  QWLRGKEYDYEPELAELR-----ETDRETKANKVNVWAALNRPVTRKALAISMGLMFFQQ  335

Query  276  FSGAAPILAYQLETFEAAGFEVSPNVSVLGSGVAIVVAGMACVLLVKRTGKRMLLLTAGP  335
              G   ++ Y    F  A   +    + +  G+  VVA     L+V + G+R+LLL +G 
Sbjct  336  VCGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLVVDKLGRRILLLASGI  395

Query  336  TTAVSLAVVAGFFTL-KSMGFDVSGVNWIPT----VFIIVYALAYGVALNPLPLSYISEV  390
            + A+S   +  +F L K     V  + W+P     +FII++++ YG    P+P   + E+
Sbjct  396  SMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFIIMFSIGYG----PVPWLMMGEL  451

Query  391  FPVDGRQGAG  400
            F  D +  AG
Sbjct  452  FATDIKGFAG  461



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000006-PA

Length=120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GLR1_DROME  unnamed protein product                                   166     1e-48
GLR1_CAEEL  unnamed protein product                                   36.6    0.002
Q9VDH5_DROME  unnamed protein product                                 33.9    0.020


>GLR1_DROME unnamed protein product
Length=991

 Score = 166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 84/93 (90%), Gaps = 0/93 (0%)

Query  15   FVCAYTVCDRFAHGVYSMIGAVNPDSFDILHSYSNTFQMPFVTPWFPEKVLTPSSGFLDF  74
            F  +  +C++F+ GVYSM+GAV+PDSFD LHSYSNTFQMPFVTPWFPEKVL PSSG LDF
Sbjct  88   FKLSRLICNQFSRGVYSMLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLAPSSGLLDF  147

Query  75   AISMRPDYYQAIIDTVRHYGWKKIIYLYDSHDG  107
            AISMRPDY+QAIIDT+++YGW+ IIYLYDSHDG
Sbjct  148  AISMRPDYHQAIIDTIQYYGWQSIIYLYDSHDG  180


>GLR1_CAEEL unnamed protein product
Length=962

 Score = 36.6 bits (83),  Expect = 0.002, Method: Composition-based stats.
 Identities = 22/85 (26%), Positives = 40/85 (47%), Gaps = 3/85 (4%)

Query  21   VCDRFAHGVYSMIGAVNPDSFDILHSYSNTFQMPFV--TPWFPEKVLTPSSGFLDFAISM  78
            VCD    G  +++ +V+    + +   S+  +MP V  T    +       G L F +S+
Sbjct  87   VCDELKEGAMALLSSVDGKGREGIRGVSDALEMPLVSLTALSNDDHQQQQFGNL-FEVSV  145

Query  79   RPDYYQAIIDTVRHYGWKKIIYLYD  103
            RP   + + D + H GW +++ L D
Sbjct  146  RPPISELLADFIVHKGWGEVLVLID  170


>Q9VDH5_DROME unnamed protein product
Length=853

 Score = 33.9 bits (76),  Expect = 0.020, Method: Composition-based stats.
 Identities = 11/24 (46%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  84   QAIIDTVRHYGWKKIIYLYDSHDG  107
            +A +D VRH+GWK    +Y+++DG
Sbjct  146  KAYVDIVRHWGWKTFTIIYENNDG  169



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000007-PA

Length=285
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O96881_DROME  unnamed protein product                                 362     2e-126
E1JIC9_DROME  unnamed protein product                                 325     7e-113
G5EG47_CAEEL  unnamed protein product                                 163     1e-48 


>O96881_DROME unnamed protein product
Length=292

 Score = 362 bits (928),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/287 (63%), Positives = 227/287 (79%), Gaps = 8/287 (3%)

Query  1    MDPALLREREAFMKRAAATPSIEKKKKEPEKETVQNDQ--KKKSKPSSVSSGPKLDMYSY  58
            MDPALLREREAF KRA ATP++EKK K             ++K +P +    P+LD  +Y
Sbjct  1    MDPALLREREAFKKRAMATPTVEKKSKPDRPAPPPPSDDSRRKMRPPN---APRLDATTY  57

Query  59   KTSSGSSQVRFSILTKIVQHMKARYQEGEDHPLTLEEILDETNQLDVGVRAKQWLQGESL  118
            KT SGSSQ RF +L KIV+ M+ R+Q+G+DHPLT++EILDETNQLD+G   K WL  E+L
Sbjct  58   KTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQSVKNWLASEAL  117

Query  119  TQNPKIEVTPDG-KYSFKSKYKLKDKKSLLRLLKQHDLRGMGGILLEDIQESLPHSEKHL  177
              NPK+E +P G K+SFK  YK+KD K+L+RLLKQHDL+G+GGILL+D+QESLPH EK L
Sbjct  118  HNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQESLPHCEKVL  177

Query  178  KNLQNELLYITRSQDKKKIVFYNDKTAHFPVDEEFQKLWRAVTVEAMDDAKIEEHLEKQG  237
            KN   E+L++ R  DKKKI+FYND+TA+F VD+EFQKLWR+ TV+AMDDAKI+E+LEKQG
Sbjct  178  KNRSAEILFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDAKIDEYLEKQG  237

Query  238  IRSMQDHGLKKVAAIKRKKPNSSKRKQFKKPRDNEHLADVLETYDEN  284
            IRSMQDHGLKK  AI ++K  ++K++QFKKPRDNEHLADVLE Y++N
Sbjct  238  IRSMQDHGLKK--AIPKRKKAANKKRQFKKPRDNEHLADVLEVYEDN  282


>E1JIC9_DROME unnamed protein product
Length=249

 Score = 325 bits (834),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 198/237 (84%), Gaps = 3/237 (1%)

Query  49   SGPKLDMYSYKTSSGSSQVRFSILTKIVQHMKARYQEGEDHPLTLEEILDETNQLDVGVR  108
            + P+LD  +YKT SGSSQ RF +L KIV+ M+ R+Q+G+DHPLT++EILDETNQLD+G  
Sbjct  5    NAPRLDATTYKTMSGSSQYRFGVLAKIVKFMRTRHQDGDDHPLTIDEILDETNQLDIGQS  64

Query  109  AKQWLQGESLTQNPKIEVTPDG-KYSFKSKYKLKDKKSLLRLLKQHDLRGMGGILLEDIQ  167
             K WL  E+L  NPK+E +P G K+SFK  YK+KD K+L+RLLKQHDL+G+GGILL+D+Q
Sbjct  65   VKNWLASEALHNNPKVEASPCGTKFSFKPVYKIKDGKTLMRLLKQHDLKGLGGILLDDVQ  124

Query  168  ESLPHSEKHLKNLQNELLYITRSQDKKKIVFYNDKTAHFPVDEEFQKLWRAVTVEAMDDA  227
            ESLPH EK LKN   E+L++ R  DKKKI+FYND+TA+F VD+EFQKLWR+ TV+AMDDA
Sbjct  125  ESLPHCEKVLKNRSAEILFVVRPIDKKKILFYNDRTANFSVDDEFQKLWRSATVDAMDDA  184

Query  228  KIEEHLEKQGIRSMQDHGLKKVAAIKRKKPNSSKRKQFKKPRDNEHLADVLETYDEN  284
            KI+E+LEKQGIRSMQDHGLKK  AI ++K  ++K++QFKKPRDNEHLADVLE Y++N
Sbjct  185  KIDEYLEKQGIRSMQDHGLKK--AIPKRKKAANKKRQFKKPRDNEHLADVLEVYEDN  239


>G5EG47_CAEEL unnamed protein product
Length=289

 Score = 163 bits (413),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/295 (35%), Positives = 171/295 (58%), Gaps = 19/295 (6%)

Query  1    MDPALLREREAFMKRAAATPSIEKKKKEPEKETVQNDQKKKSKPSSVSSGP-----KLDM  55
            MDP LLR+R AF K AA T +++ K             +        SSGP     KL  
Sbjct  1    MDPELLRQRTAFQKHAATTMAVQNKPTTAPNSHTTYSSEAAKAKKKKSSGPAQNLSKLPD  60

Query  56   YSYKTSSG---SSQVRFSILTKIVQHMKARYQEGEDHPLTLEEILDETNQLDVGVRAKQW  112
            ++   S+    S+   FS + KIV +MK R+   +  PLTL+EILDE    D+  R+  +
Sbjct  61   FNNSVSNANALSNATNFSTMAKIVDYMKKRHLNNQQWPLTLQEILDELQIFDLSKRSLAF  120

Query  113  LQGESLTQNPKIEVTPDGKYSFKSKYKLKDKKSLLRLLKQHDLRGMGGILLEDIQESLPH  172
            LQ E+L  NP++ +    K++F+  YK+K K SL+ + ++H   G GGIL+ D+ E + +
Sbjct  121  LQ-EALPNNPRL-IMESEKFAFRPPYKIKGKTSLVAVARKHYQDGKGGILVSDLAECVAN  178

Query  173  SEKHLKNLQNELLYITRSQDKKK--IVFYNDKTAHFP-VDEEFQKLWRAVTVEAMDDAKI  229
             +  L+ + +E++ +    +KKK  +VFYNDK   FP ++++F+ LWR V+V+ +D+ KI
Sbjct  179  YDALLQQVSSEVIVVPTQVNKKKDRVVFYNDKEFTFPELEDDFKALWRHVSVDHLDEKKI  238

Query  230  EEHLEKQGIRSMQDHG--LKKVAAIKRKKPNSSKRKQFKKPRDNEHLADVLETYD  282
            EE+L+K+G+ +M+D    ++  A +KRK    + +++F +   NEH+  VLE Y+
Sbjct  239  EEYLQKKGLDAMKDLTPKVRMQAPLKRK----AAKRRFNQKVQNEHMDGVLEDYE  289



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000008-PA

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RASS_DICDI  unnamed protein product                                   100     3e-26
O17599_CAEEL  unnamed protein product                                 92.8    2e-23
RASD_DICDI  unnamed protein product                                   85.9    8e-21


>RASS_DICDI unnamed protein product
Length=194

 Score = 100 bits (248),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 94/174 (54%), Gaps = 15/174 (9%)

Query  9    KTALTVRFLTRRYIGEYDHQSEPNNLKYLDSPKNKYKHEVLVDGEPILFEILDTCPKSVD  68
            K+ LT++F+ ++++ EYD   E           + Y+ +  VDGE  L +I DT  +   
Sbjct  16   KSCLTIQFIAQKFVDEYDPTLE-----------DSYRKQTTVDGEECLLDIYDTAGQEDF  64

Query  69   ELPSIETLQWADGLLLVYSITERSSFKFIRKVKQALAVADPEGSMLLALVGNKVDMIHLR  128
                 + ++  +G L VYSIT   SFK I ++   L       S+   LVGNK D+   R
Sbjct  65   SAVRDQYMRTGEGFLCVYSITYLQSFKEIHRLHNHLLKVKDLDSVPFVLVGNKCDLNEYR  124

Query  129  QINTEEGEILAKEMDCWFCEISAAEQACIIDQVGDSFHELCREVLAAKRRNKQS  182
            +++T EGE LAK+++C F E SA E+      V +SF+EL REV  A++ N+ S
Sbjct  125  EVSTAEGEELAKKLNCKFLETSAKERI----NVSESFYELVREVKKARQSNQHS  174


>O17599_CAEEL unnamed protein product
Length=181

 Score = 92.8 bits (229),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 95/176 (54%), Gaps = 19/176 (11%)

Query  9    KTALTVRFLTRRYIGEYDHQSEPNNLKYLDSPKNKYKHEVLVDGEPILFEILDTCPKSVD  68
            K+ALTV+F++  +I +YD   E           + Y+ E+ VDG+P + EILDT     +
Sbjct  16   KSALTVQFVSSTFIEKYDPTIE-----------DFYRKEIEVDGQPSVLEILDTA--GTE  62

Query  69   ELPSIETL--QWADGLLLVYSITERSSFKFIRKVKQALAVADPEGSMLLALVGNKVDMIH  126
            +  S+  L  +   G ++VYSIT + +F  IR +K+ +       ++ + LVGNK D+ H
Sbjct  63   QFSSMRDLYIKNGQGFVVVYSITSQQTFHDIRNMKEQIVRVKGSENVPILLVGNKCDLSH  122

Query  127  LRQINTEEGEILAKEMDCWFCEISAAEQACIIDQVGDSFHELCREVLAAKRRNKQS  182
             RQ+ +EEG  LA+   C F E SA         V  +F E+ RE+   + +++QS
Sbjct  123  QRQVRSEEGLALAESWSCPFTECSAKNN----QNVNVTFAEIVREMNYVQNKSRQS  174


>RASD_DICDI unnamed protein product
Length=187

 Score = 85.9 bits (211),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 84/164 (51%), Gaps = 15/164 (9%)

Query  9    KTALTVRFLTRRYIGEYDHQSEPNNLKYLDSPKNKYKHEVLVDGEPILFEILDTCPKSVD  68
            K+ALT++ +   +I EYD   E           + Y+ +V +D E  L +ILDT  +   
Sbjct  16   KSALTIQLIQNHFIDEYDPTIE-----------DSYRKQVSIDDETCLLDILDTAGQEEY  64

Query  69   ELPSIETLQWADGLLLVYSITERSSFKFIRKVKQALAVADPEGSMLLALVGNKVDMIHLR  128
                 + ++   G L VYSIT RSS+  I   ++ +     +  + L LVGNK D+ H R
Sbjct  65   SAMRDQYMRTGQGFLCVYSITSRSSYDEIASFREQILRVKDKDRVPLILVGNKADLDHER  124

Query  129  QINTEEGEILAKEMDCWFCEISAAEQACIIDQVGDSFHELCREV  172
            Q++  EG+ LAK  +C F E SA  +      V ++F+ L RE+
Sbjct  125  QVSVNEGQELAKGFNCPFMESSAKSRI----NVEEAFYSLVREI  164



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000009-PA

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TY3H_DROME  unnamed protein product                                   790     0.0   
TY3H_CAEEL  unnamed protein product                                   422     2e-142
PH4H_DROME  unnamed protein product                                   416     5e-141


>TY3H_DROME unnamed protein product
Length=579

 Score = 790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/580 (66%), Positives = 454/580 (78%), Gaps = 20/580 (3%)

Query  1    MAVAAAQKNREMFAIKKSYSIENGYPARRRSLVDDARFETLVVKQTKQSVLEEARIRTND  60
            MAVAAAQKNREMFAIKKSYSIENGYP+RRRSLVDDARFETLVVKQTKQ+VLEEAR + ND
Sbjct  2    MAVAAAQKNREMFAIKKSYSIENGYPSRRRSLVDDARFETLVVKQTKQTVLEEARSKAND  61

Query  61   SDPETCNEVDQPFENSSSSASSDDEQQET----------------LACAAKKGEAKAEAS  104
               E C    Q    S       DE                         ++        
Sbjct  62   DSLEDCIVQAQEHIPSEQDVELQDEHANLENLPLEEYVPVEEDVEFESVEQEQSESQSQE  121

Query  105  SSDGEEKGGDDFGLTEEELVLARSIAENPE-DQTVQTAALVLRLREGMTALPRILKTIEN  163
                ++   +D+GLTE+E++LA + +E+ + +  +Q+AALV+RL+EG+++L RILK IE 
Sbjct  122  PEGNQQPTKNDYGLTEDEILLANAASESSDAEAAMQSAALVVRLKEGISSLGRILKAIET  181

Query  164  FKGQVSHVETRASKKEG-QFDVLVKVNMTRQNLSSLIRNLRQGSSLGGLTLLAENTNAVT  222
            F G V HVE+R S+ EG   DVL+K++MTR NL  LIR+LRQ  S   + L+A+N   + 
Sbjct  182  FHGTVQHVESRQSRVEGVDHDVLIKLDMTRGNLLQLIRSLRQSGSFSSMNLMADNN--LN  239

Query  223  VKDPWFPRHASDLDNCNHLMTKYEPDLDMTHPGFADKEYRARRKLIAEIAFAYKYGDPIP  282
            VK PWFP+HAS+LDNCNHLMTKYEPDLDM HPGFADK YR RRK IAEIAFAYKYGDPIP
Sbjct  240  VKAPWFPKHASELDNCNHLMTKYEPDLDMNHPGFADKVYRQRRKEIAEIAFAYKYGDPIP  299

Query  283  NIPYTETENETWRRVFNTLVDLVPKHACKEYQRVFERLIEEKIFEPHCVPQLQEVSDFLR  342
             I Y++ E +TWR VF T+ DL PKHAC EY+  F++L +E+IF    +PQLQE+SDFLR
Sbjct  300  FIDYSDVEVKTWRSVFKTVQDLAPKHACAEYRAAFQKLQDEQIFVETRLPQLQEMSDFLR  359

Query  343  KSTGFTLRPAAGLLTARDFLSSLAFRIFQSTQYIRHINSPYHTPEPDAIHELLGHMPLLA  402
            K+TGF+LRPAAGLLTARDFL+SLAFRIFQSTQY+RH+NSPYHTPEPD+IHELLGHMPLLA
Sbjct  360  KNTGFSLRPAAGLLTARDFLASLAFRIFQSTQYVRHVNSPYHTPEPDSIHELLGHMPLLA  419

Query  403  DPSFAQFSQEIGLASLGASDEEIEKLSTIYWFTVEFGLCKEGADTKAYGAGLLSAYGELL  462
            DPSFAQFSQEIGLASLGASDEEIEKLST+YWFTVEFGLCKE    KAYGAGLLS+YGELL
Sbjct  420  DPSFAQFSQEIGLASLGASDEEIEKLSTVYWFTVEFGLCKEHGQIKAYGAGLLSSYGELL  479

Query  463  HALSDKCEHRPFEPSTTAVQPYQDQEYQPIYYVANSFEDAKEKFRRWVATMSRPFEVRFN  522
            HA+SDKCEHR FEP++TAVQPYQDQEYQPIYYVA SFEDAK+KFRRWV+TMSRPFEVRFN
Sbjct  480  HAISDKCEHRAFEPASTAVQPYQDQEYQPIYYVAESFEDAKDKFRRWVSTMSRPFEVRFN  539

Query  523  PHTQSVEVLDSVERLEGALSQLNIELTHLTNALNKMKVSF  562
            PHT+ VEVLDSV++LE  + Q+N E+ HLTNA++K++  F
Sbjct  540  PHTERVEVLDSVDKLETLVHQMNTEILHLTNAISKLRRPF  579


>TY3H_CAEEL unnamed protein product
Length=519

 Score = 422 bits (1084),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 203/408 (50%), Positives = 278/408 (68%), Gaps = 4/408 (1%)

Query  157  ILKTIENFKGQVSHVETRASKKEGQFDVLVKVNMTRQNLSSLIRNLRQGS-SLGGLTLLA  215
            IL+ + + K Q+ HVETR +  E   DVL+    T+  L      L Q   +L   ++ A
Sbjct  112  ILQNMSSAKVQICHVETRGN--EASHDVLLACKATKNQLIHSAELLTQNHVALTKFSIFA  169

Query  216  EN-TNAVTVKDPWFPRHASDLDNCNHLMTKYEPDLDMTHPGFADKEYRARRKLIAEIAFA  274
            +  ++       WFPRH S+LD C+  +TKYEP  D  HPG  D  Y ARRK + + A  
Sbjct  170  KKLSDEKNQSQIWFPRHISELDQCSKCITKYEPTTDPRHPGHGDVAYIARRKFLNDQALE  229

Query  275  YKYGDPIPNIPYTETENETWRRVFNTLVDLVPKHACKEYQRVFERLIEEKIFEPHCVPQL  334
            +K+GD I  + YTE E+ TW+ V+  L DL   H C  Y++  + L EEK+     +PQ+
Sbjct  230  FKFGDEIGYVDYTEEEHATWKAVYEKLGDLHLSHTCAVYRQNLKILQEEKVLTADRIPQI  289

Query  335  QEVSDFLRKSTGFTLRPAAGLLTARDFLSSLAFRIFQSTQYIRHINSPYHTPEPDAIHEL  394
            ++V+ FL+K TGF LRP +GLL+ARDFL+SLAFR+FQ+T Y+RH  SP+H+PEPD IHEL
Sbjct  290  RDVNKFLQKKTGFELRPCSGLLSARDFLASLAFRVFQTTTYLRHHKSPHHSPEPDLIHEL  349

Query  395  LGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTIYWFTVEFGLCKEGADTKAYGAGL  454
            LGH+P+ +DP  AQ SQ+IGL SLGASDE IEKLST+YWF VEFGLCKE    KA GAGL
Sbjct  350  LGHVPMFSDPLLAQMSQDIGLMSLGASDEHIEKLSTVYWFIVEFGLCKEDGKLKAIGAGL  409

Query  455  LSAYGELLHALSDKCEHRPFEPSTTAVQPYQDQEYQPIYYVANSFEDAKEKFRRWVATMS  514
            LSAYGEL+HA SD  EH+ F+P+ TAVQ Y+D +YQP+Y+VA+S  DA  K R++ ++M 
Sbjct  410  LSAYGELMHACSDAPEHKDFDPAVTAVQKYEDDDYQPLYFVADSIHDALAKLRKYASSMD  469

Query  515  RPFEVRFNPHTQSVEVLDSVERLEGALSQLNIELTHLTNALNKMKVSF  562
            RPF V ++P T+S+E ++S   LE A S+L+ +L+ +T+A ++MK+S 
Sbjct  470  RPFSVVYDPFTKSIEAIESSADLEKAFSRLSNDLSAITHAADRMKISI  517


>PH4H_DROME unnamed protein product
Length=452

 Score = 416 bits (1068),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 201/408 (49%), Positives = 273/408 (67%), Gaps = 2/408 (0%)

Query  153  ALPRILKTIENFKGQVSHVETRASKKEGQFDVLVKVNMTRQNLSSLIRNLRQGSSLGGLT  212
            AL  IL   +     + H+E+R+S +   ++  V+ +     L   I ++++  S   + 
Sbjct  47   ALANILAIFKKHDINLVHIESRSSLRVPGYEFFVEADGKSGALGKAIEDVKEQCSYFNII  106

Query  213  LLAENTNAVTVKDPWFPRHASDLDNCNHLMTKYEPDLDMTHPGFADKEYRARRKLIAEIA  272
                  NA  V  PWFPR   DLD   + +  Y  +LD  HPGF D EYR RRK  A+IA
Sbjct  107  SRDYKDNATAV--PWFPRRIRDLDRFANQILSYGSELDADHPGFTDPEYRKRRKYFADIA  164

Query  273  FAYKYGDPIPNIPYTETENETWRRVFNTLVDLVPKHACKEYQRVFERLIEEKIFEPHCVP  332
            + YK+G+P+P++ YT+ E ETW  +F  L  L   HAC+EY  VF  L++   F    +P
Sbjct  165  YNYKHGEPLPHVDYTKEEIETWGIIFRNLTKLYKTHACREYNHVFPLLVDNCGFREDNIP  224

Query  333  QLQEVSDFLRKSTGFTLRPAAGLLTARDFLSSLAFRIFQSTQYIRHINSPYHTPEPDAIH  392
            QL++VS+FLR  TGFTLRP AGLL++RDFL+ LAFR+F STQYIRH + P +TPEPD  H
Sbjct  225  QLEDVSNFLRDCTGFTLRPVAGLLSSRDFLAGLAFRVFHSTQYIRHPSKPMYTPEPDVCH  284

Query  393  ELLGHMPLLADPSFAQFSQEIGLASLGASDEEIEKLSTIYWFTVEFGLCKEGADTKAYGA  452
            EL+GH+PL ADP+FAQFSQEIGLASLGA D+ IEKLSTI+WFTVE+G+C++  + KAYGA
Sbjct  285  ELMGHVPLFADPAFAQFSQEIGLASLGAPDDYIEKLSTIFWFTVEYGVCRQEGELKAYGA  344

Query  453  GLLSAYGELLHALSDKCEHRPFEPSTTAVQPYQDQEYQPIYYVANSFEDAKEKFRRWVAT  512
            GLLS+YGEL + L+DK + + FEP  T V  Y   ++QP+YYVA+SFE AKEK  ++  +
Sbjct  345  GLLSSYGELEYCLTDKPQLKDFEPEVTGVTKYPITQFQPLYYVADSFETAKEKTIKFANS  404

Query  513  MSRPFEVRFNPHTQSVEVLDSVERLEGALSQLNIELTHLTNALNKMKV  560
            + RPF VR+N +TQSVEVLDS  ++   +  +N E   L NA+ K++V
Sbjct  405  IPRPFGVRYNAYTQSVEVLDSKPQISNLMDNINSEFQILQNAVAKLRV  452



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000010-PA

Length=113
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UNC89_CAEEL  unnamed protein product                                  28.1    2.0  


>UNC89_CAEEL unnamed protein product
Length=8081

 Score = 28.1 bits (61),  Expect = 2.0, Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 29/51 (57%), Gaps = 2/51 (4%)

Query  25    TVEYTRASPSQIEKQSQRS--RDVAMKRQEKPKNQKSAHVSQGKRQSSPEQ  73
             TVE   ASP++ EK  ++S   +V   +++ P+  +    S  K++ SPE+
Sbjct  1696  TVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKKEKSPEK  1746



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000011-PA

Length=410
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBJ6_DROME  unnamed protein product                                 50.4    2e-06


>A1ZBJ6_DROME unnamed protein product
Length=1379

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 36/49 (73%), Gaps = 2/49 (4%)

Query  153  VPKLIIRDSSTAS--ETTINTSTDSQTTLITLVNTTDSEQHDDSLDLMD  199
            VPKL++  +S+AS  +TTINTSTDS  TLIT V  TD+ +  DSLD+ D
Sbjct  294  VPKLVVMGTSSASIPDTTINTSTDSACTLITNVTHTDTSETCDSLDMGD  342



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000012-PA

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6NR39_DROME  unnamed protein product                                 266     6e-86
A0A0B4KFV9_DROME  unnamed protein product                             256     7e-82
A1ZBJ6_DROME  unnamed protein product                                 265     1e-80


>Q6NR39_DROME unnamed protein product
Length=498

 Score = 266 bits (679),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 161/187 (86%), Gaps = 7/187 (4%)

Query  30   RYGSPHHNRSQSVRTPGSRASGRPNYLCLPQQRSRVASMPNTGVEEDFYRLRHFSITTKG  89
            RYGSPHH+RSQSV+ PGSRASGRPN LCLPQQRSRVASMPNTGVEE++YRLRHFSIT KG
Sbjct  118  RYGSPHHSRSQSVKMPGSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKG  177

Query  90   VVNRGDSLKSRRSRSNNSVASSNSSTEHLTA----SYPGSARNSAAGSLASSRESSASQ-  144
            VVNRGDSLKSRRSRSNNSVASSNSSTEHLT     S P S   SA  SLASSRESS S  
Sbjct  178  VVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASV--SARTSLASSRESSTSNP  235

Query  145  GPAPYRVLMLGASAVGKSSLVSQFMTSEYLHAYDTSVDDESGEKTVNILLNGEESELTFI  204
            G  PYRVLMLG  AVGKSSLVSQFMTSEYLHAYDTS+DDESGEK V++LL+GEESEL FI
Sbjct  236  GNGPYRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFI  295

Query  205  DHPSSEM  211
            DH  +EM
Sbjct  296  DHGYTEM  302


>A0A0B4KFV9_DROME unnamed protein product
Length=514

 Score = 256 bits (653),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 161/203 (79%), Gaps = 23/203 (11%)

Query  30   RYGSPHHNRSQSVRTPGSRASGRPNYLCLPQQRSRVASMPNTGVEEDFYRLRHFSITTKG  89
            RYGSPHH+RSQSV+ PGSRASGRPN LCLPQQRSRVASMPNTGVEE++YRLRHFSIT KG
Sbjct  118  RYGSPHHSRSQSVKMPGSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKG  177

Query  90   VVNRGDSLKSRRSRSNNSVASSNSSTEHLTA----SYPGSARNSAAGSLASSRESSASQ-  144
            VVNRGDSLKSRRSRSNNSVASSNSSTEHLT     S P S   SA  SLASSRESS S  
Sbjct  178  VVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASV--SARTSLASSRESSTSNP  235

Query  145  GPAPYRVLMLGASAVGKSSLVSQFMTSEYLHAYDTSV----------------DDESGEK  188
            G  PYRVLMLG  AVGKSSLVSQFMTSEYLHAYDTS+                DDESGEK
Sbjct  236  GNGPYRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDLGNCDIRILIEKAADDDESGEK  295

Query  189  TVNILLNGEESELTFIDHPSSEM  211
             V++LL+GEESEL FIDH  +EM
Sbjct  296  AVSVLLSGEESELIFIDHGYTEM  318


>A1ZBJ6_DROME unnamed protein product
Length=1379

 Score = 265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 161/187 (86%), Gaps = 7/187 (4%)

Query  30    RYGSPHHNRSQSVRTPGSRASGRPNYLCLPQQRSRVASMPNTGVEEDFYRLRHFSITTKG  89
             RYGSPHH+RSQSV+ PGSRASGRPN LCLPQQRSRVASMPNTGVEE++YRLRHFSIT KG
Sbjct  999   RYGSPHHSRSQSVKMPGSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKG  1058

Query  90    VVNRGDSLKSRRSRSNNSVASSNSSTEHLTA----SYPGSARNSAAGSLASSRESSASQ-  144
             VVNRGDSLKSRRSRSNNSVASSNSSTEHLT     S P S   SA  SLASSRESS S  
Sbjct  1059  VVNRGDSLKSRRSRSNNSVASSNSSTEHLTTQQQLSAPASV--SARTSLASSRESSTSNP  1116

Query  145   GPAPYRVLMLGASAVGKSSLVSQFMTSEYLHAYDTSVDDESGEKTVNILLNGEESELTFI  204
             G  PYRVLMLG  AVGKSSLVSQFMTSEYLHAYDTS+DDESGEK V++LL+GEESEL FI
Sbjct  1117  GNGPYRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLLSGEESELIFI  1176

Query  205   DHPSSEM  211
             DH  +EM
Sbjct  1177  DHGYTEM  1183



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000013-PA

Length=91
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SAS5_CAEEL  unnamed protein product                                   26.9    2.7  
Q38FW1_TRYB2  unnamed protein product                                 26.6    3.4  
CYAD_DICDI  unnamed protein product                                   26.2    4.6  


>SAS5_CAEEL unnamed protein product
Length=404

 Score = 26.9 bits (58),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 10/16 (63%), Positives = 11/16 (69%), Gaps = 0/16 (0%)

Query  6    SYYPSDVGGKTYGSNN  21
            SYYPS+  GKT   NN
Sbjct  340  SYYPSEAAGKTTARNN  355


>Q38FW1_TRYB2 unnamed protein product
Length=641

 Score = 26.6 bits (57),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 20/43 (47%), Gaps = 0/43 (0%)

Query  41   ESRVRASSHWDERAPYGTLSLFKWGPRIDQILEKKVASRSENR  83
            ES  R    W+E+ PY  + LF  G   D  +++   +R   R
Sbjct  92   ESVERIIDDWEEKDPYKEVHLFALGTTPDSYMQRLARARVAQR  134


>CYAD_DICDI unnamed protein product
Length=2123

 Score = 26.2 bits (56),  Expect = 4.6, Method: Composition-based stats.
 Identities = 10/26 (38%), Positives = 15/26 (58%), Gaps = 0/26 (0%)

Query  49   HWDERAPYGTLSLFKWGPRIDQILEK  74
            HW+ R PY  ++L    P++ Q L K
Sbjct  524  HWEVRKPYTLMALASMIPQLTQALYK  549



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000014-PA

Length=172
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6NR39_DROME  unnamed protein product                                 243     7e-79
A0A0B4KFV9_DROME  unnamed protein product                             242     2e-78
A1ZBJ6_DROME  unnamed protein product                                 244     3e-75


>Q6NR39_DROME unnamed protein product
Length=498

 Score = 243 bits (619),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 140/195 (72%), Gaps = 23/195 (12%)

Query  1    PENCIATYEPHGYCVVYSTADRSSARVAEEVLQSLWRSDHMSARAVILVGNKVDLVRCRF  60
            P+ C+  Y+PHGYCV+YS ADRSS  VAE+VLQ LW + +++ +AVILV NK DL R R 
Sbjct  304  PDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRL  363

Query  61   VTTEEGKQMAINYDCKFIETAVSINHNVDELLVGLLSQIRLKLENPERCRDIIRRRSRRN  120
            VT+EEGK MA  YDCKFIET+V INHNVDELLVGLLSQIRLKLENPE+ RD+ R+RS R 
Sbjct  364  VTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRK  423

Query  121  RSR--------------SPIGSCSE---------NNSPKKYRGSRTSASLKVRSLLGKVW  157
              R              +P+G   E          +SP+KYRGSRTS SLKV+ LLG+VW
Sbjct  424  SKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVW  483

Query  158  ARDSKSKSCENLHVL  172
             RDSKSKSCENLHVL
Sbjct  484  TRDSKSKSCENLHVL  498


>A0A0B4KFV9_DROME unnamed protein product
Length=514

 Score = 242 bits (617),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 140/195 (72%), Gaps = 23/195 (12%)

Query  1    PENCIATYEPHGYCVVYSTADRSSARVAEEVLQSLWRSDHMSARAVILVGNKVDLVRCRF  60
            P+ C+  Y+PHGYCV+YS ADRSS  VAE+VLQ LW + +++ +AVILV NK DL R R 
Sbjct  320  PDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRL  379

Query  61   VTTEEGKQMAINYDCKFIETAVSINHNVDELLVGLLSQIRLKLENPERCRDIIRRRSRRN  120
            VT+EEGK MA  YDCKFIET+V INHNVDELLVGLLSQIRLKLENPE+ RD+ R+RS R 
Sbjct  380  VTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRK  439

Query  121  RSR--------------SPIGSCSE---------NNSPKKYRGSRTSASLKVRSLLGKVW  157
              R              +P+G   E          +SP+KYRGSRTS SLKV+ LLG+VW
Sbjct  440  SKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVW  499

Query  158  ARDSKSKSCENLHVL  172
             RDSKSKSCENLHVL
Sbjct  500  TRDSKSKSCENLHVL  514


>A1ZBJ6_DROME unnamed protein product
Length=1379

 Score = 244 bits (623),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/195 (61%), Positives = 140/195 (72%), Gaps = 23/195 (12%)

Query  1     PENCIATYEPHGYCVVYSTADRSSARVAEEVLQSLWRSDHMSARAVILVGNKVDLVRCRF  60
             P+ C+  Y+PHGYCV+YS ADRSS  VAE+VLQ LW + +++ +AVILV NK DL R R 
Sbjct  1185  PDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRL  1244

Query  61    VTTEEGKQMAINYDCKFIETAVSINHNVDELLVGLLSQIRLKLENPERCRDIIRRRSRRN  120
             VT+EEGK MA  YDCKFIET+V INHNVDELLVGLLSQIRLKLENPE+ RD+ R+RS R 
Sbjct  1245  VTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRK  1304

Query  121   RSR--------------SPIGSCSE---------NNSPKKYRGSRTSASLKVRSLLGKVW  157
               R              +P+G   E          +SP+KYRGSRTS SLKV+ LLG+VW
Sbjct  1305  SKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKGLLGRVW  1364

Query  158   ARDSKSKSCENLHVL  172
              RDSKSKSCENLHVL
Sbjct  1365  TRDSKSKSCENLHVL  1379



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000015-PA

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

U183_CAEEL  unnamed protein product                                   230     1e-71
Q22129_CAEEL  unnamed protein product                                 31.2    1.6  
CPNA1_CAEEL  unnamed protein product                                  31.2    1.9  


>U183_CAEEL unnamed protein product
Length=422

 Score = 230 bits (586),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 137/384 (36%), Positives = 201/384 (52%), Gaps = 37/384 (10%)

Query  5    ENPLEVDLVINLPQDGVRLIFDPVVQRLKIIEVYNMKMVKLKYCSITFNSPETLPSIEQI  64
            ++P   D++I +   G+RL FD + Q +K+IEV N+ M+ L Y    F+ P  + +++++
Sbjct  67   KDPFYQDIIIYIGSTGIRLYFDGLSQLIKLIEVDNLSMITLTYNDTIFSDPNNMATLDRV  126

Query  65   EHSFGATHPGVYDSDKQVFVLNFRGLSFYFPIDS-----KFQPGYAHGLGSLQFPNGTSP  119
               FG+THPG YD    ++V ++ GLSF FP        + +PG+   L SL++   + P
Sbjct  127  NEFFGSTHPGSYDDKHNIYVQSWPGLSFCFPYGGENSNLEVRPGFGGNLRSLKYDANSQP  186

Query  120  LVAKTAIYMGNMAAGGSNSEMHCLKTSPPPLPLVCYHNNIYLEKAEVLRDKARTRGLKLH  179
             + K +IY      G + SE   + T     P  CY       K E + +     G+ + 
Sbjct  187  KLTKMSIY-----RGPNPSEPESVDT-----PFSCYCGQNRTRKVEAIWENGNIVGIDIQ  236

Query  180  LFTEGSSTNRVV-LEPKRHNLTKEVWFGDTCEDVLSALGAPSRVFFKAEDKMRIHSPHAH  238
              T+     R+V  E      T++++FGD+  DV S LGAP++VF+K++DKM+IH    H
Sbjct  237  FDTQ---NGRIVDGEYDVSTYTRQIYFGDSVSDVQSILGAPTKVFYKSDDKMKIHR-GLH  292

Query  239  KRDKIRRSDFFFNYFTLGLDILFDAKTQCVKKFVLHTNYPGHYNFNIYHRCEFSLTLPLE  298
            K       +FFFNYF +GLDILFD  ++ V KFVLHTN PGH +F +Y RC FS+ L   
Sbjct  293  KETLYGPPNFFFNYFVMGLDILFDFVSKRVVKFVLHTNAPGHCDFGMYSRCNFSIFLN--  350

Query  299  TNNTAESGNLIDVSPSPVTLTAYTKWDHVSEQLKASPRPVVLNRASSTNTTNPFGCTFCY  358
                       D      T + + ++ H        PRPVVL R        PFG TFCY
Sbjct  351  -----------DKQYEIRTDSKFDEFSHAFMNDSNPPRPVVLARQEQ----QPFGSTFCY  395

Query  359  GIRDAIVEVMANQHIASVTLYTTA  382
            GI+  IVE   N  + SVT+Y  A
Sbjct  396  GIKQIIVERTENGFLTSVTIYDGA  419


>Q22129_CAEEL unnamed protein product
Length=465

 Score = 31.2 bits (69),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/68 (24%), Positives = 31/68 (46%), Gaps = 12/68 (18%)

Query  11   DLVINLPQ------------DGVRLIFDPVVQRLKIIEVYNMKMVKLKYCSITFNSPETL  58
            D+V+ +P+            D +R IF  +  R+   +VY  +M  ++Y +I     E  
Sbjct  147  DMVVQVPEKRWANLDDQHQTDNLRDIFPEIANRISKYQVYKQQMFLIRYANIGNAQKEHG  206

Query  59   PSIEQIEH  66
            P  +++E 
Sbjct  207  PESDEVEQ  214


>CPNA1_CAEEL unnamed protein product
Length=1107

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 30/64 (47%), Gaps = 5/64 (8%)

Query  8    LEVDLVINLPQDGVRLIFDPVVQRLK--IIEVYNMKMVKLKYCSITFNSPETLPSIEQIE  65
            LEVDL +  P D  R  FD V+  +   + E  NM +      S  F   E +PSI   E
Sbjct  129  LEVDLNLGHPIDATREKFDTVLSSVNNHLHETKNMDLSPTSRDSTQF---EQIPSIAPEE  185

Query  66   HSFG  69
             +FG
Sbjct  186  SAFG  189



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000016-PA

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CARM1_DROME  unnamed protein product                                  28.1    1.4  
CARM1_ANOGA  unnamed protein product                                  26.6    4.5  
Q9NAC0_CAEEL  unnamed protein product                                 26.2    5.2  


>CARM1_DROME unnamed protein product
Length=530

 Score = 28.1 bits (61),  Expect = 1.4, Method: Composition-based stats.
 Identities = 17/63 (27%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query  3    EAKVKSPSLQFY--LAYQSITAQSKLCGSTYKKTRKRSTINSEQEVLLALGSTSGAVAFL  60
            E    S   QFY  L+ Q    Q  +  STY++    + ++ + +++L +G+ SG ++F 
Sbjct  137  EESSASQYFQFYGYLSQQQNMMQDYVRTSTYQRAILGNAVDFQDKIVLDVGAGSGILSFF  196

Query  61   RVK  63
             V+
Sbjct  197  AVQ  199


>CARM1_ANOGA unnamed protein product
Length=622

 Score = 26.6 bits (57),  Expect = 4.5, Method: Composition-based stats.
 Identities = 17/63 (27%), Positives = 32/63 (51%), Gaps = 2/63 (3%)

Query  3    EAKVKSPSLQFY--LAYQSITAQSKLCGSTYKKTRKRSTINSEQEVLLALGSTSGAVAFL  60
            E    S   QFY  L+ Q    Q  +  STY++    +  + + +++L +G+ SG ++F 
Sbjct  114  EDSSASQYFQFYGYLSQQQNMMQDFVRTSTYQRAIYNNAQDFQNKIVLDVGAGSGILSFF  173

Query  61   RVK  63
             V+
Sbjct  174  AVQ  176


>Q9NAC0_CAEEL unnamed protein product
Length=254

 Score = 26.2 bits (56),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 11/35 (31%), Positives = 17/35 (49%), Gaps = 0/35 (0%)

Query  13   FYLAYQSITAQSKLCGSTYKKTRKRSTINSEQEVL  47
             +L         K+CG   K   KRS +N E+++L
Sbjct  193  IHLITSKFDLIDKICGEFDKLKNKRSEVNDERDML  227



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000017-PA

Length=740
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O44906_CAEEL  unnamed protein product                                 711     0.0  
Q8ITY0_CAEEL  unnamed protein product                                 644     0.0  
Q8ITY2_CAEEL  unnamed protein product                                 642     0.0  


>O44906_CAEEL unnamed protein product
Length=651

 Score = 711 bits (1836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/628 (54%), Positives = 445/628 (71%), Gaps = 16/628 (3%)

Query  127  RIADTPVISRLNAPLAPKVRAFIEEAVRLCRPDDVYVCDGSDLENKQLLKLLENKGTIQP  186
            ++   P+     A L+PKV+ F+ E   L  P  +Y+CDGS  E   ++  L  +G + P
Sbjct  26   KLNHIPIFKGDFASLSPKVQRFVAEKAELMNPAGIYICDGSQKEYDDIVDKLVERGVLTP  85

Query  187  LPKYDNCWWARTNPADVARVESKTFICTPNRRETVPTPRTGVKGTLGNWISPQDMDSAIL  246
            L  Y+N +  RT+P DVARVESKT++ T ++ ++V     GV+  +G W+S +     + 
Sbjct  86   LKAYENNYLCRTDPRDVARVESKTWMVTKDKYDSVCHTPDGVRPIMGQWMSEEQFGVELD  145

Query  247  ERFPNCMKGRTMYVIPFSMGPVGSALSKIGIEITDSAYVVCSMRIMTRMGENALRALGRA  306
             RFP CM GR MYV+P+SMGP+G  LSK GIE+TDS YVV  MR MTRMG   L ALG  
Sbjct  146  SRFPGCMAGRPMYVVPYSMGPIGGPLSKNGIELTDSPYVVLCMRTMTRMGTKVLEALGDN  205

Query  307  DFVKCLHSVGASTGNGSDNAT-WPCDPERTIILHRPARNEIVSYGSGYGGNSLLGKKCFA  365
            DFV+C+HSVG            WPC+PE+ +I HRP   EI S+GSGYGGNS+LGKKCFA
Sbjct  206  DFVRCIHSVGLPRPVKQKVINHWPCNPEKVMIAHRPKEREIWSFGSGYGGNSILGKKCFA  265

Query  366  LRIGSTIARDEGWLAEHMLILGVTNPEGKKRYIAAAFPSACGKTNLAMMKPSLPGYKVEC  425
            LRI   I RDEGWLAEHMLI+GVTNPEG++++IAAAFPSACGKTNLAM+ P++PG+KV  
Sbjct  266  LRIACNIGRDEGWLAEHMLIMGVTNPEGEEKFIAAAFPSACGKTNLAMLTPTVPGWKVRV  325

Query  426  VGDDIAWMRFDGHGKLRAINPENGFFGVAPGTSSATNPNAMATIFRNTIFTNVAKTSDGG  485
            VGDDIAWM+F   G+L AINPE GFFGVAPGTS  TN  AM +   NTIFTNVA+T+DG 
Sbjct  326  VGDDIAWMKFGADGRLYAINPEAGFFGVAPGTSHKTNAMAMESCRANTIFTNVAETADGE  385

Query  486  VFWEGMEKEVPD----------NIQITDWHGKAWQRGSKTPAAHPNSRFCTPASQCPIID  535
             FWEG+EKE+ +          +++IT+W G+ W  G +  AAHPNSRF  PA QCP I 
Sbjct  386  YFWEGLEKELKEAKGYTDEQLKHLEITNWLGERWHIGDEGKAAHPNSRFTAPAKQCPNIH  445

Query  536  PAWEDPQGVPIDAILFGGRRPTGVPLIYQARDWQHGVFIGASMRSEATAAAEHKGKVVMN  595
            P WE PQGVPIDAI+FGGRRP GVPL++++  W+HG+ +GA ++SE TAAAE  GK VM+
Sbjct  446  PDWEAPQGVPIDAIVFGGRRPEGVPLVFESFSWEHGILVGALVKSETTAAAEFTGKNVMH  505

Query  596  DPFAMRPFFGYNFGDYLIHWLSMSRVPNAQLPAVFHVNWFRKGPNG-FLWPGFGENSRVL  654
            DP AMRPF GYN+G YL HW+ + + P+ + P +FHVNWFR+  +  FLWPGFG+N RVL
Sbjct  506  DPMAMRPFMGYNYGKYLEHWIKLGKAPH-KAPKIFHVNWFRETKDHKFLWPGFGDNIRVL  564

Query  655  DWILRRIDG--EDVAVESPIGYLPKPESLNLEGLSEKIDLQELFSLPREFWQKEVTELRE  712
            DWILRR+ G  E++A+E+ IGY+PK  ++NL+GL  +ID  +L S+P+++W ++V E R 
Sbjct  565  DWILRRVAGGEEEIAIETAIGYVPKRGTINLDGLP-RIDWNDLMSIPKDYWVEDVDESRH  623

Query  713  YFDSQVGQDMPEAILKELNKLESSVAKL  740
            + D+QVG D+P+ I  EL+KLE  V  L
Sbjct  624  FLDTQVGSDLPQPIRDELDKLEKRVHAL  651


>Q8ITY0_CAEEL unnamed protein product
Length=594

 Score = 644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/556 (56%), Positives = 394/556 (71%), Gaps = 15/556 (3%)

Query  127  RIADTPVISRLNAPLAPKVRAFIEEAVRLCRPDDVYVCDGSDLENKQLLKLLENKGTIQP  186
            ++   P+     A L+PKV+ F+ E   L  P  +Y+CDGS  E   ++  L  +G + P
Sbjct  26   KLNHIPIFKGDFASLSPKVQRFVAEKAELMNPAGIYICDGSQKEYDDIVDKLVERGVLTP  85

Query  187  LPKYDNCWWARTNPADVARVESKTFICTPNRRETVPTPRTGVKGTLGNWISPQDMDSAIL  246
            L  Y+N +  RT+P DVARVESKT++ T ++ ++V     GV+  +G W+S +     + 
Sbjct  86   LKAYENNYLCRTDPRDVARVESKTWMVTKDKYDSVCHTPDGVRPIMGQWMSEEQFGVELD  145

Query  247  ERFPNCMKGRTMYVIPFSMGPVGSALSKIGIEITDSAYVVCSMRIMTRMGENALRALGRA  306
             RFP CM GR MYV+P+SMGP+G  LSK GIE+TDS YVV  MR MTRMG   L ALG  
Sbjct  146  SRFPGCMAGRPMYVVPYSMGPIGGPLSKNGIELTDSPYVVLCMRTMTRMGTKVLEALGDN  205

Query  307  DFVKCLHSVGASTGNGSDNAT-WPCDPERTIILHRPARNEIVSYGSGYGGNSLLGKKCFA  365
            DFV+C+HSVG            WPC+PE+ +I HRP   EI S+GSGYGGNS+LGKKCFA
Sbjct  206  DFVRCIHSVGLPRPVKQKVINHWPCNPEKVMIAHRPKEREIWSFGSGYGGNSILGKKCFA  265

Query  366  LRIGSTIARDEGWLAEHMLILGVTNPEGKKRYIAAAFPSACGKTNLAMMKPSLPGYKVEC  425
            LRI   I RDEGWLAEHMLI+GVTNPEG++++IAAAFPSACGKTNLAM+ P++PG+KV  
Sbjct  266  LRIACNIGRDEGWLAEHMLIMGVTNPEGEEKFIAAAFPSACGKTNLAMLTPTVPGWKVRV  325

Query  426  VGDDIAWMRFDGHGKLRAINPENGFFGVAPGTSSATNPNAMATIFRNTIFTNVAKTSDGG  485
            VGDDIAWM+F   G+L AINPE GFFGVAPGTS  TN  AM +   NTIFTNVA+T+DG 
Sbjct  326  VGDDIAWMKFGADGRLYAINPEAGFFGVAPGTSHKTNAMAMESCRANTIFTNVAETADGE  385

Query  486  VFWEGMEKEVPD----------NIQITDWHGKAWQRGSKTPAAHPNSRFCTPASQCPIID  535
             FWEG+EKE+ +          +++IT+W G+ W  G +  AAHPNSRF  PA QCP I 
Sbjct  386  YFWEGLEKELKEAKGYTDEQLKHLEITNWLGERWHIGDEGKAAHPNSRFTAPAKQCPNIH  445

Query  536  PAWEDPQGVPIDAILFGGRRPTGVPLIYQARDWQHGVFIGASMRSEATAAAEHKGKVVMN  595
            P WE PQGVPIDAI+FGGRRP GVPL++++  W+HG+ +GA ++SE TAAAE  GK VM+
Sbjct  446  PDWEAPQGVPIDAIVFGGRRPEGVPLVFESFSWEHGILVGALVKSETTAAAEFTGKNVMH  505

Query  596  DPFAMRPFFGYNFGDYLIHWLSMSRVPNAQLPAVFHVNWFRKGPNG-FLWPGFGENSRVL  654
            DP AMRPF GYN+G YL HW+ + + P+ + P +FHVNWFR+  +  FLWPGFG+N RVL
Sbjct  506  DPMAMRPFMGYNYGKYLEHWIKLGKAPH-KAPKIFHVNWFRETKDHKFLWPGFGDNIRVL  564

Query  655  DWILRRIDG--EDVAV  668
            DWILRR+ G  E++AV
Sbjct  565  DWILRRVAGGEEEIAV  580


>Q8ITY2_CAEEL unnamed protein product
Length=541

 Score = 642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/543 (57%), Positives = 395/543 (73%), Gaps = 16/543 (3%)

Query  212  ICTPNRRETVPTPRTGVKGTLGNWISPQDMDSAILERFPNCMKGRTMYVIPFSMGPVGSA  271
            + T ++ ++V     GV+  +G W+S +     +  RFP CM GR MYV+P+SMGP+G  
Sbjct  1    MVTKDKYDSVCHTPDGVRPIMGQWMSEEQFGVELDSRFPGCMAGRPMYVVPYSMGPIGGP  60

Query  272  LSKIGIEITDSAYVVCSMRIMTRMGENALRALGRADFVKCLHSVGASTGNGSDNAT-WPC  330
            LSK GIE+TDS YVV  MR MTRMG   L ALG  DFV+C+HSVG            WPC
Sbjct  61   LSKNGIELTDSPYVVLCMRTMTRMGTKVLEALGDNDFVRCIHSVGLPRPVKQKVINHWPC  120

Query  331  DPERTIILHRPARNEIVSYGSGYGGNSLLGKKCFALRIGSTIARDEGWLAEHMLILGVTN  390
            +PE+ +I HRP   EI S+GSGYGGNS+LGKKCFALRI   I RDEGWLAEHMLI+GVTN
Sbjct  121  NPEKVMIAHRPKEREIWSFGSGYGGNSILGKKCFALRIACNIGRDEGWLAEHMLIMGVTN  180

Query  391  PEGKKRYIAAAFPSACGKTNLAMMKPSLPGYKVECVGDDIAWMRFDGHGKLRAINPENGF  450
            PEG++++IAAAFPSACGKTNLAM+ P++PG+KV  VGDDIAWM+F   G+L AINPE GF
Sbjct  181  PEGEEKFIAAAFPSACGKTNLAMLTPTVPGWKVRVVGDDIAWMKFGADGRLYAINPEAGF  240

Query  451  FGVAPGTSSATNPNAMATIFRNTIFTNVAKTSDGGVFWEGMEKEVPD----------NIQ  500
            FGVAPGTS  TN  AM +   NTIFTNVA+T+DG  FWEG+EKE+ +          +++
Sbjct  241  FGVAPGTSHKTNAMAMESCRANTIFTNVAETADGEYFWEGLEKELKEAKGYTDEQLKHLE  300

Query  501  ITDWHGKAWQRGSKTPAAHPNSRFCTPASQCPIIDPAWEDPQGVPIDAILFGGRRPTGVP  560
            IT+W G+ W  G +  AAHPNSRF  PA QCP I P WE PQGVPIDAI+FGGRRP GVP
Sbjct  301  ITNWLGERWHIGDEGKAAHPNSRFTAPAKQCPNIHPDWEAPQGVPIDAIVFGGRRPEGVP  360

Query  561  LIYQARDWQHGVFIGASMRSEATAAAEHKGKVVMNDPFAMRPFFGYNFGDYLIHWLSMSR  620
            L++++  W+HG+ +GA ++SE TAAAE  GK VM+DP AMRPF GYN+G YL HW+ + +
Sbjct  361  LVFESFSWEHGILVGALVKSETTAAAEFTGKNVMHDPMAMRPFMGYNYGKYLEHWIKLGK  420

Query  621  VPNAQLPAVFHVNWFRKGPNG-FLWPGFGENSRVLDWILRRIDG--EDVAVESPIGYLPK  677
             P+ + P +FHVNWFR+  +  FLWPGFG+N RVLDWILRR+ G  E++A+E+ IGY+PK
Sbjct  421  APH-KAPKIFHVNWFRETKDHKFLWPGFGDNIRVLDWILRRVAGGEEEIAIETAIGYVPK  479

Query  678  PESLNLEGLSEKIDLQELFSLPREFWQKEVTELREYFDSQVGQDMPEAILKELNKLESSV  737
              ++NL+GL  +ID  +L S+P+++W ++V E R + D+QVG D+P+ I  EL+KLE  V
Sbjct  480  RGTINLDGLP-RIDWNDLMSIPKDYWVEDVDESRHFLDTQVGSDLPQPIRDELDKLEKRV  538

Query  738  AKL  740
              L
Sbjct  539  HAL  541



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000018-PA

Length=175
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEL5_DROME  unnamed protein product                                 29.6    1.00 
Q384A0_TRYB2  unnamed protein product                                 28.1    5.2  
Q585N5_TRYB2  unnamed protein product                                 27.3    7.6  


>Q9VEL5_DROME unnamed protein product
Length=225

 Score = 29.6 bits (65),  Expect = 1.00, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 21/53 (40%), Gaps = 0/53 (0%)

Query  35   WLKKPFSFATKKGSLLPGASTELGYLSQLAEISAPSDTSKMSSNRVSVHHQRL  87
            W  + F  A  +  L+ G     G L      S P     +  NRV VHH RL
Sbjct  81   WRDEGFEKAKARAGLVDGVECRDGELRTAFGCSKPLYPPHVDVNRVPVHHSRL  133


>Q384A0_TRYB2 unnamed protein product
Length=763

 Score = 28.1 bits (61),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (58%), Gaps = 4/33 (12%)

Query  77   SNRVSVHHQRLIDD----DRMSEICVVAPLPKI  105
            +NRV+  H  LID     D   E+CV  PLP++
Sbjct  123  NNRVACFHGPLIDRIFVVDDGKEVCVGLPLPRV  155


>Q585N5_TRYB2 unnamed protein product
Length=635

 Score = 27.3 bits (59),  Expect = 7.6, Method: Compositional matrix adjust.
 Identities = 19/49 (39%), Positives = 26/49 (53%), Gaps = 17/49 (35%)

Query  40   FSFATKKGSLLPGASTELGYLSQLAEISAPSDTSKMSSNRVSVHHQRLI  88
            FS  T +GSLLPGA             SAPS    ++SNRV V ++ ++
Sbjct  168  FSQVTGEGSLLPGA-------------SAPS----LTSNRVKVDNETVL  199



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000019-PA

Length=1834
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O46205_DROME  unnamed protein product                                 221     1e-57
Q7K3V3_DROME  unnamed protein product                                 221     1e-57
Q9W4J1_DROME  unnamed protein product                                 221     1e-57


>O46205_DROME unnamed protein product
Length=1920

 Score = 221 bits (563),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 151/228 (66%), Gaps = 25/228 (11%)

Query  397  ATGQEDFFAMLNLQNKSANAATGTVGVAESNNNNKNNNNNCQGELADIQSILNVTAHTSS  456
            A+  EDFF  L L++K+AN   G   ++   +  K+   + + +LADIQSILN+T+ +SS
Sbjct  609  ASQSEDFFHQLYLKHKTAN---GCGAISHPPSPIKHEPADTK-DLADIQSILNMTSSSSS  664

Query  457  MLQ-LRAKAGTPDNCPVRQRGSSQASGSSGSSSTPQSNNDHGNEEEDQDVFAAEFRKMKL  515
             L+       TP++      G  Q                   EEE QD F +EFR+MKL
Sbjct  665  FLRNFEQSVNTPNSSQYSLDGRDQ-------------------EEEAQDAFTSEFRRMKL  705

Query  516  KGEFPCRLCNSIYPNLRALKGHSRIHVNTI-PGKPFPCNICTYDCVDKNALMKHMKSHNG  574
            +GEFPC+LC +++PNLRALKGH+R+H+  + P  PF CN+C Y   DK AL++HM++HNG
Sbjct  706  RGEFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNG  765

Query  575  PRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKSVLIYHPSEDSA  622
             RPY+C++CNY+FTTKANCERH+RNRHGK +REEVK  ++YHP+ED+ 
Sbjct  766  DRPYECAVCNYAFTTKANCERHLRNRHGKTSREEVKRAIVYHPAEDAG  813


 Score = 156 bits (395),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 98/165 (59%), Gaps = 12/165 (7%)

Query  1605  GLPTSETPFKCHVYMCDSGFADRQDCLDHLKNCHEEAYTRLVDRGALEKD-YDGNDQ---  1660
              L   + P+KCH  +C+  FA+R  CL+H+K  H   Y  L+ +GA+E +  + N     
Sbjct  1615  ALAGGDLPYKCH--LCEGSFAERLQCLEHIKQAHAHEYALLLAKGAIETESLEANPHQQP  1672

Query  1661  ------SDVEETASATRRVRVADYANRKVICAFCMRRFWSAEDLRRHMRTHTGERPYFCD  1714
                   SD E       R +  DY+NRKVICAFC+RRFWS EDLRRHMRTH+GERP+ CD
Sbjct  1673  SQQAVHSDDEAPNGGGNRGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGERPFQCD  1732

Query  1715  VCAQRFTLKHSMLRHRKKHDSPDSAMYVGTSGDEDSAPVSSQPST  1759
             +C ++FTLKHSMLRH KKH           S   D   VSS PST
Sbjct  1733  ICLRKFTLKHSMLRHMKKHSGRAHNGDTPGSDCSDDEQVSSPPST  1777


 Score = 132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 13/136 (10%)

Query  1272  NEDLSSISVMLNNA-SHNYQQNFH------AQYM--SEEEGLVAPLSDHSGSDSVNSLTA  1322
             ++DL  ++ +++NA S N   N +      A +M  S+EEGLVA     S S+S NS T 
Sbjct  1368  SQDLVPVAKLVDNATSQNMGFNSYFRPSDVANHMEQSDEEGLVA---SGSASESNNSGTE  1424

Query  1323  TPTFKKKKMKKKKKKSAYSLAPNRVKCPYCQRPFPWASSLNRHILTHTGQKPYECRFCPL  1382
               T       + KKKSAYSLAPNRV CPYCQR FPW+SSL RHILTHTGQKP++C  CPL
Sbjct  1425  DVT-SSSSSSEPKKKSAYSLAPNRVSCPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPL  1483

Query  1383  FFTTKSNCDRHLLRKH  1398
              FTTKSNCDRHLLRKH
Sbjct  1484  LFTTKSNCDRHLLRKH  1499


 Score = 108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 14/96 (15%)

Query  76   YTCPACPVVLTSPRELTNHLRGHNSPRHTGGVGTTSDGGSGAEDADYVCGVCQKQLSSAS  135
            Y CP C VV  +P E TNH+R HN               +  +  ++ C +C K LSSAS
Sbjct  250  YLCPICEVVSATPHEFTNHIRCHNY--------------ANGDTENFTCRICSKVLSSAS  295

Query  136  SLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRT  171
            SLDRHVLVH+GERPF C +C ++FTTNGNM+RH+RT
Sbjct  296  SLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRHMRT  331


 Score = 105 bits (261),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 54/65 (83%), Gaps = 1/65 (2%)

Query  1000  KLIMKNGVLMQKQKQRRYRTERPFRCEHCGHGFTLRSNMERHVKQQHPQYWSQKPRGTNS  1059
             K+++KNGVLM KQKQRRYRTERPF CEHC   FTLRSNMERHVKQQHPQ+++Q+ R  + 
Sbjct  1036  KMVIKNGVLMPKQKQRRYRTERPFACEHCSARFTLRSNMERHVKQQHPQFYAQRERSAHH  1095

Query  1060  T-RGR  1063
               RGR
Sbjct  1096  VMRGR  1100


 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 0/64 (0%)

Query  124   CGVCQKQLSSASSLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRTAHGSLSPGCHSW  183
             C  CQ+    +SSL RH+L H+G++PF+C HC + FTT  N +RH+   HG++      +
Sbjct  1450  CPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHGNVESAMSVY  1509

Query  184   TDSE  187
               +E
Sbjct  1510  VPTE  1513


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 1/51 (2%)

Query  1349  CPYCQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHK  1399
             C  C +    ASSL+RH+L HTG++P+ CR+C L FTT  N  RH +R HK
Sbjct  284   CRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRH-MRTHK  333


 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 14/102 (14%)

Query  76   YTCPACPVVLTSPRELTNHLRGHNSPRHTGGVGTTSDGGSGAEDADYVCGVCQKQLSSAS  135
            + C  C  V  + R L    +GHN   H G VG             + C +C   +   +
Sbjct  709  FPCKLCTAVFPNLRAL----KGHNR-VHLGAVGPA---------GPFRCNMCPYAVCDKA  754

Query  136  SLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRTAHGSLS  177
            +L RH+  H+G+RP+ C  C+ +FTT  N  RH+R  HG  S
Sbjct  755  ALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTS  796


 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 5/127 (4%)

Query  1629  DCLDHLKNCHEEAYTRLVDRG-ALEKDYDGNDQSDVEETASATRRVRVADYANRKVICAF  1687
             D  +H++   EE    LV  G A E +  G +      ++S  ++      A  +V C +
Sbjct  1396  DVANHMEQSDEEG---LVASGSASESNNSGTEDVTSSSSSSEPKKKSAYSLAPNRVSCPY  1452

Query  1688  CMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSMLRH-RKKHDSPDSAMYVGTSG  1746
             C R F  +  LRRH+ THTG++P+ C  C   FT K +  RH  +KH + +SAM V    
Sbjct  1453  CQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHGNVESAMSVYVPT  1512

Query  1747  DEDSAPV  1753
             ++ S P+
Sbjct  1513  EDVSEPI  1519


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 7/58 (12%)

Query  1349  CPY--CQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHKKQATE  1404
             CPY  C +     ++L RH+ TH G +PYEC  C   FTTK+NC+RHL  +H K + E
Sbjct  746   CPYAVCDK-----AALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTSRE  798


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 4/69 (6%)

Query  552   CNICTYDCVDKNALMKHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKS  611
             C  C       ++L +H+ +H G +P++CS C   FTTK+NC+RH+  +HG  N E   S
Sbjct  1450  CPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHG--NVESAMS  1507

Query  612   VLIYHPSED  620
             V  Y P+ED
Sbjct  1508  V--YVPTED  1514


 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 9/76 (12%)

Query  113   GGSGAEDADY-----VCGVCQKQLSSASSLDRHVLVHSGERPFRCVHCDMSFTTNGNMNR  167
             GG+  +  DY     +C  C ++  S   L RH+  HSGERPF+C  C   FT   +M R
Sbjct  1687  GGNRGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLR  1746

Query  168   HVRT----AHGSLSPG  179
             H++     AH   +PG
Sbjct  1747  HMKKHSGRAHNGDTPG  1762


 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query  1670  TRRVRVADYAN---RKVICAFCMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSM  1726
             T  +R  +YAN       C  C +   SA  L RH+  HTGERP+ C  C   FT   +M
Sbjct  266   TNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNM  325

Query  1727  LRHRKKH  1733
              RH + H
Sbjct  326   HRHMRTH  332


 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  1346  RVKCPYCQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHKKQATET  1405
             +V C +C R F     L RH+ TH+G++P++C  C   FT K +  RH ++KH  +A   
Sbjct  1700  KVICAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLRH-MKKHSGRA-HN  1757

Query  1406  GLTRAASVSSPELPQESSPP  1425
             G T  +  S  E  Q SSPP
Sbjct  1758  GDTPGSDCSDDE--QVSSPP  1775


 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 3/83 (4%)

Query  518  EFPCRLCNSIYPNLRALKGHSRIHVNTIPG--KPFPCNICTYDCVDKNALMKHMKSHNGP  575
            ++ C +C  +         H R H N   G  + F C IC+      ++L +H+  H G 
Sbjct  249  KYLCPICEVVSATPHEFTNHIRCH-NYANGDTENFTCRICSKVLSSASSLDRHVLVHTGE  307

Query  576  RPYQCSMCNYSFTTKANCERHVR  598
            RP+ C  C+ +FTT  N  RH+R
Sbjct  308  RPFNCRYCHLTFTTNGNMHRHMR  330


 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  552   CNICTYDCVDKNALMKHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGK  603
             C  C         L +HM++H+G RP+QC +C   FT K +  RH++   G+
Sbjct  1703  CAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLRHMKKHSGR  1754


 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  1685  CAFCMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSMLRH-RKKH  1733
             C  C         L RHMRTH G+RPY C VC   FT K +  RH R +H
Sbjct  743   CNMCPYAVCDKAALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRH  792


 Score = 39.7 bits (91),  Expect = 0.033, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query  516   KGEFP--------CRLCNSIYPNLRALKGHSRIHVNTIPGKPFPCNICTYDCVDKNALMK  567
             +G++P        C  C   + +   L+ H R H      +PF C+IC      K+++++
Sbjct  1690  RGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGE---RPFQCDICLRKFTLKHSMLR  1746

Query  568   HMKSHNG  574
             HMK H+G
Sbjct  1747  HMKKHSG  1753


 Score = 39.3 bits (90),  Expect = 0.042, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  147   ERPFRCVHCDMSFTTNGNMNRHVRTAH  173
             ERPF C HC   FT   NM RHV+  H
Sbjct  1056  ERPFACEHCSARFTLRSNMERHVKQQH  1082


 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  1011  KQKQRRYRTERPFRCEHCGHGFTLRSNMERHVKQ  1044
             ++  R +  ERPF+C+ C   FTL+ +M RH+K+
Sbjct  1717  RRHMRTHSGERPFQCDICLRKFTLKHSMLRHMKK  1750


 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  1015  RRYRTERPFRCEHCGHGFTLRSNMERHVKQQH  1046
             R +  +RP+ C  C + FT ++N ERH++ +H
Sbjct  761   RTHNGDRPYECAVCNYAFTTKANCERHLRNRH  792


 Score = 36.2 bits (82),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 39/86 (45%), Gaps = 10/86 (12%)

Query  1655  YDGNDQSDVEETA--SATRRVRVADYANRKVICAFCMRRFWSAEDLRRHMRTHTGER---  1709
              DG DQ +  + A  S  RR+++      +  C  C   F +   L+ H R H G     
Sbjct  683   LDGRDQEEEAQDAFTSEFRRMKLRG----EFPCKLCTAVFPNLRALKGHNRVHLGAVGPA  738

Query  1710  -PYFCDVCAQRFTLKHSMLRHRKKHD  1734
              P+ C++C      K +++RH + H+
Sbjct  739   GPFRCNMCPYAVCDKAALVRHMRTHN  764


 Score = 35.8 bits (81),  Expect = 0.46, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  1699  RRHMRTHTGERPYFCDVCAQRFTLKHSMLRHRKK  1732
             ++  R +  ERP+ C+ C+ RFTL+ +M RH K+
Sbjct  1047  KQKQRRYRTERPFACEHCSARFTLRSNMERHVKQ  1080


 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 30/56 (54%), Gaps = 3/56 (5%)

Query  560   VDKNALM---KHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKSV  612
             V KN ++   +  + +   RP+ C  C+  FT ++N ERHV+ +H +   +  +S 
Sbjct  1038  VIKNGVLMPKQKQRRYRTERPFACEHCSARFTLRSNMERHVKQQHPQFYAQRERSA  1093


 Score = 35.4 bits (80),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  1020  ERPFRCEHCGHGFTLRSNMERHVKQQH  1046
             ++PF+C HC   FT +SN +RH+ ++H
Sbjct  1473  QKPFKCSHCPLLFTTKSNCDRHLLRKH  1499


 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  1020  ERPFRCEHCGHGFTLRSNMERHVK  1043
             ERPF C +C   FT   NM RH++
Sbjct  307   ERPFNCRYCHLTFTTNGNMHRHMR  330


 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 26/59 (44%), Gaps = 4/59 (7%)

Query  120  ADYVCGVCQKQLSSASSLDRHVLVHSGER----PFRCVHCDMSFTTNGNMNRHVRTAHG  174
             ++ C +C     +  +L  H  VH G      PFRC  C  +      + RH+RT +G
Sbjct  707  GEFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNG  765


>Q7K3V3_DROME unnamed protein product
Length=1893

 Score = 221 bits (563),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 151/228 (66%), Gaps = 25/228 (11%)

Query  397  ATGQEDFFAMLNLQNKSANAATGTVGVAESNNNNKNNNNNCQGELADIQSILNVTAHTSS  456
            A+  EDFF  L L++K+AN   G   ++   +  K+   + + +LADIQSILN+T+ +SS
Sbjct  609  ASQSEDFFHQLYLKHKTAN---GCGAISHPPSPIKHEPADTK-DLADIQSILNMTSSSSS  664

Query  457  MLQ-LRAKAGTPDNCPVRQRGSSQASGSSGSSSTPQSNNDHGNEEEDQDVFAAEFRKMKL  515
             L+       TP++      G  Q                   EEE QD F +EFR+MKL
Sbjct  665  FLRNFEQSVNTPNSSQYSLDGRDQ-------------------EEEAQDAFTSEFRRMKL  705

Query  516  KGEFPCRLCNSIYPNLRALKGHSRIHVNTI-PGKPFPCNICTYDCVDKNALMKHMKSHNG  574
            +GEFPC+LC +++PNLRALKGH+R+H+  + P  PF CN+C Y   DK AL++HM++HNG
Sbjct  706  RGEFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNG  765

Query  575  PRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKSVLIYHPSEDSA  622
             RPY+C++CNY+FTTKANCERH+RNRHGK +REEVK  ++YHP+ED+ 
Sbjct  766  DRPYECAVCNYAFTTKANCERHLRNRHGKTSREEVKRAIVYHPAEDAG  813


 Score = 156 bits (394),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 98/165 (59%), Gaps = 12/165 (7%)

Query  1605  GLPTSETPFKCHVYMCDSGFADRQDCLDHLKNCHEEAYTRLVDRGALEKD-YDGNDQ---  1660
              L   + P+KCH  +C+  FA+R  CL+H+K  H   Y  L+ +GA+E +  + N     
Sbjct  1618  ALAGGDLPYKCH--LCEGSFAERLQCLEHIKQAHAHEYALLLAKGAIETESLEANPHQQP  1675

Query  1661  ------SDVEETASATRRVRVADYANRKVICAFCMRRFWSAEDLRRHMRTHTGERPYFCD  1714
                   SD E       R +  DY+NRKVICAFC+RRFWS EDLRRHMRTH+GERP+ CD
Sbjct  1676  SQQAVHSDDEAPNGGGNRGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGERPFQCD  1735

Query  1715  VCAQRFTLKHSMLRHRKKHDSPDSAMYVGTSGDEDSAPVSSQPST  1759
             +C ++FTLKHSMLRH KKH           S   D   VSS PST
Sbjct  1736  ICLRKFTLKHSMLRHMKKHSGRAHNGDTPGSDCSDDEQVSSPPST  1780


 Score = 132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 13/136 (10%)

Query  1272  NEDLSSISVMLNNA-SHNYQQNFH------AQYM--SEEEGLVAPLSDHSGSDSVNSLTA  1322
             ++DL  ++ +++NA S N   N +      A +M  S+EEGLVA     S S+S NS T 
Sbjct  1371  SQDLVPVAKLVDNATSQNMGFNSYFRPSDVANHMEQSDEEGLVA---SGSASESNNSGTE  1427

Query  1323  TPTFKKKKMKKKKKKSAYSLAPNRVKCPYCQRPFPWASSLNRHILTHTGQKPYECRFCPL  1382
               T       + KKKSAYSLAPNRV CPYCQR FPW+SSL RHILTHTGQKP++C  CPL
Sbjct  1428  DVT-SSSSSSEPKKKSAYSLAPNRVSCPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPL  1486

Query  1383  FFTTKSNCDRHLLRKH  1398
              FTTKSNCDRHLLRKH
Sbjct  1487  LFTTKSNCDRHLLRKH  1502


 Score = 108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 14/96 (15%)

Query  76   YTCPACPVVLTSPRELTNHLRGHNSPRHTGGVGTTSDGGSGAEDADYVCGVCQKQLSSAS  135
            Y CP C VV  +P E TNH+R HN               +  +  ++ C +C K LSSAS
Sbjct  250  YLCPICEVVSATPHEFTNHIRCHNY--------------ANGDTENFTCRICSKVLSSAS  295

Query  136  SLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRT  171
            SLDRHVLVH+GERPF C +C ++FTTNGNM+RH+RT
Sbjct  296  SLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRHMRT  331


 Score = 106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 1/65 (2%)

Query  1000  KLIMKNGVLMQKQKQRRYRTERPFRCEHCGHGFTLRSNMERHVKQQHPQYWSQKPR-GTN  1058
             K+++KNGVLM KQKQRRYRTERPF CEHC   FTLRSNMERHVKQQHPQ+++Q+ R G +
Sbjct  1036  KMVIKNGVLMPKQKQRRYRTERPFACEHCSARFTLRSNMERHVKQQHPQFYAQRQRSGHH  1095

Query  1059  STRGR  1063
               RGR
Sbjct  1096  VMRGR  1100


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 0/64 (0%)

Query  124   CGVCQKQLSSASSLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRTAHGSLSPGCHSW  183
             C  CQ+    +SSL RH+L H+G++PF+C HC + FTT  N +RH+   HG++      +
Sbjct  1453  CPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHGNVESAMSVY  1512

Query  184   TDSE  187
               +E
Sbjct  1513  VPTE  1516


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 1/51 (2%)

Query  1349  CPYCQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHK  1399
             C  C +    ASSL+RH+L HTG++P+ CR+C L FTT  N  RH +R HK
Sbjct  284   CRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRH-MRTHK  333


 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 14/102 (14%)

Query  76   YTCPACPVVLTSPRELTNHLRGHNSPRHTGGVGTTSDGGSGAEDADYVCGVCQKQLSSAS  135
            + C  C  V  + R L    +GHN   H G VG             + C +C   +   +
Sbjct  709  FPCKLCTAVFPNLRAL----KGHNR-VHLGAVGPA---------GPFRCNMCPYAVCDKA  754

Query  136  SLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRTAHGSLS  177
            +L RH+  H+G+RP+ C  C+ +FTT  N  RH+R  HG  S
Sbjct  755  ALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTS  796


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 5/127 (4%)

Query  1629  DCLDHLKNCHEEAYTRLVDRG-ALEKDYDGNDQSDVEETASATRRVRVADYANRKVICAF  1687
             D  +H++   EE    LV  G A E +  G +      ++S  ++      A  +V C +
Sbjct  1399  DVANHMEQSDEEG---LVASGSASESNNSGTEDVTSSSSSSEPKKKSAYSLAPNRVSCPY  1455

Query  1688  CMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSMLRH-RKKHDSPDSAMYVGTSG  1746
             C R F  +  LRRH+ THTG++P+ C  C   FT K +  RH  +KH + +SAM V    
Sbjct  1456  CQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHGNVESAMSVYVPT  1515

Query  1747  DEDSAPV  1753
             ++ S P+
Sbjct  1516  EDVSEPI  1522


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 7/58 (12%)

Query  1349  CPY--CQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHKKQATE  1404
             CPY  C +     ++L RH+ TH G +PYEC  C   FTTK+NC+RHL  +H K + E
Sbjct  746   CPYAVCDK-----AALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTSRE  798


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 4/69 (6%)

Query  552   CNICTYDCVDKNALMKHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKS  611
             C  C       ++L +H+ +H G +P++CS C   FTTK+NC+RH+  +HG  N E   S
Sbjct  1453  CPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHG--NVESAMS  1510

Query  612   VLIYHPSED  620
             V  Y P+ED
Sbjct  1511  V--YVPTED  1517


 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query  1670  TRRVRVADYAN---RKVICAFCMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSM  1726
             T  +R  +YAN       C  C +   SA  L RH+  HTGERP+ C  C   FT   +M
Sbjct  266   TNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNM  325

Query  1727  LRHRKKH  1733
              RH + H
Sbjct  326   HRHMRTH  332


 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 9/76 (12%)

Query  113   GGSGAEDADY-----VCGVCQKQLSSASSLDRHVLVHSGERPFRCVHCDMSFTTNGNMNR  167
             GG+  +  DY     +C  C ++  S   L RH+  HSGERPF+C  C   FT   +M R
Sbjct  1690  GGNRGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLR  1749

Query  168   HVRT----AHGSLSPG  179
             H++     AH   +PG
Sbjct  1750  HMKKHSGRAHNGDTPG  1765


 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  1346  RVKCPYCQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHKKQATET  1405
             +V C +C R F     L RH+ TH+G++P++C  C   FT K +  RH ++KH  +A   
Sbjct  1703  KVICAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLRH-MKKHSGRA-HN  1760

Query  1406  GLTRAASVSSPELPQESSPP  1425
             G T  +  S  E  Q SSPP
Sbjct  1761  GDTPGSDCSDDE--QVSSPP  1778


 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 3/83 (4%)

Query  518  EFPCRLCNSIYPNLRALKGHSRIHVNTIPG--KPFPCNICTYDCVDKNALMKHMKSHNGP  575
            ++ C +C  +         H R H N   G  + F C IC+      ++L +H+  H G 
Sbjct  249  KYLCPICEVVSATPHEFTNHIRCH-NYANGDTENFTCRICSKVLSSASSLDRHVLVHTGE  307

Query  576  RPYQCSMCNYSFTTKANCERHVR  598
            RP+ C  C+ +FTT  N  RH+R
Sbjct  308  RPFNCRYCHLTFTTNGNMHRHMR  330


 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  552   CNICTYDCVDKNALMKHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGK  603
             C  C         L +HM++H+G RP+QC +C   FT K +  RH++   G+
Sbjct  1706  CAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLRHMKKHSGR  1757


 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  1685  CAFCMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSMLRH-RKKH  1733
             C  C         L RHMRTH G+RPY C VC   FT K +  RH R +H
Sbjct  743   CNMCPYAVCDKAALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRH  792


 Score = 39.7 bits (91),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query  516   KGEFP--------CRLCNSIYPNLRALKGHSRIHVNTIPGKPFPCNICTYDCVDKNALMK  567
             +G++P        C  C   + +   L+ H R H      +PF C+IC      K+++++
Sbjct  1693  RGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGE---RPFQCDICLRKFTLKHSMLR  1749

Query  568   HMKSHNG  574
             HMK H+G
Sbjct  1750  HMKKHSG  1756


 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  147   ERPFRCVHCDMSFTTNGNMNRHVRTAH  173
             ERPF C HC   FT   NM RHV+  H
Sbjct  1056  ERPFACEHCSARFTLRSNMERHVKQQH  1082


 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  1011  KQKQRRYRTERPFRCEHCGHGFTLRSNMERHVKQ  1044
             ++  R +  ERPF+C+ C   FTL+ +M RH+K+
Sbjct  1720  RRHMRTHSGERPFQCDICLRKFTLKHSMLRHMKK  1753


 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  1015  RRYRTERPFRCEHCGHGFTLRSNMERHVKQQH  1046
             R +  +RP+ C  C + FT ++N ERH++ +H
Sbjct  761   RTHNGDRPYECAVCNYAFTTKANCERHLRNRH  792


 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 39/86 (45%), Gaps = 10/86 (12%)

Query  1655  YDGNDQSDVEETA--SATRRVRVADYANRKVICAFCMRRFWSAEDLRRHMRTHTGE----  1708
              DG DQ +  + A  S  RR+++      +  C  C   F +   L+ H R H G     
Sbjct  683   LDGRDQEEEAQDAFTSEFRRMKLRG----EFPCKLCTAVFPNLRALKGHNRVHLGAVGPA  738

Query  1709  RPYFCDVCAQRFTLKHSMLRHRKKHD  1734
              P+ C++C      K +++RH + H+
Sbjct  739   GPFRCNMCPYAVCDKAALVRHMRTHN  764


 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  1798  SDLISNLLGIGGNVVDKALQLSPDDAAKLLGI  1829
             SDLI NLLGI    +   L  S D+AAKLLG+
Sbjct  1859  SDLIGNLLGISDQGILNKLLSSADEAAKLLGV  1890


 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  1699  RRHMRTHTGERPYFCDVCAQRFTLKHSMLRHRKK  1732
             ++  R +  ERP+ C+ C+ RFTL+ +M RH K+
Sbjct  1047  KQKQRRYRTERPFACEHCSARFTLRSNMERHVKQ  1080


 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  576   RPYQCSMCNYSFTTKANCERHVRNRH  601
             RP+ C  C+  FT ++N ERHV+ +H
Sbjct  1057  RPFACEHCSARFTLRSNMERHVKQQH  1082


 Score = 35.4 bits (80),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  1020  ERPFRCEHCGHGFTLRSNMERHVKQQH  1046
             ++PF+C HC   FT +SN +RH+ ++H
Sbjct  1476  QKPFKCSHCPLLFTTKSNCDRHLLRKH  1502


 Score = 35.0 bits (79),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 25/54 (46%), Gaps = 3/54 (6%)

Query  519  FPCRLCNSIYPNLRALKGHSRIHVNTIPGKPFPCNICTYDCVDKNALMKHMKSH  572
            F CR+C+ +  +  +L  H  +H      +PF C  C         + +HM++H
Sbjct  282  FTCRICSKVLSSASSLDRHVLVHTGE---RPFNCRYCHLTFTTNGNMHRHMRTH  332


 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  1020  ERPFRCEHCGHGFTLRSNMERHVK  1043
             ERPF C +C   FT   NM RH++
Sbjct  307   ERPFNCRYCHLTFTTNGNMHRHMR  330


 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 26/59 (44%), Gaps = 4/59 (7%)

Query  120  ADYVCGVCQKQLSSASSLDRHVLVHSGE----RPFRCVHCDMSFTTNGNMNRHVRTAHG  174
             ++ C +C     +  +L  H  VH G      PFRC  C  +      + RH+RT +G
Sbjct  707  GEFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNG  765


>Q9W4J1_DROME unnamed protein product
Length=1894

 Score = 221 bits (563),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/228 (47%), Positives = 151/228 (66%), Gaps = 25/228 (11%)

Query  397  ATGQEDFFAMLNLQNKSANAATGTVGVAESNNNNKNNNNNCQGELADIQSILNVTAHTSS  456
            A+  EDFF  L L++K+AN   G   ++   +  K+   + + +LADIQSILN+T+ +SS
Sbjct  609  ASQSEDFFHQLYLKHKTAN---GCGAISHPPSPIKHEPADTK-DLADIQSILNMTSSSSS  664

Query  457  MLQ-LRAKAGTPDNCPVRQRGSSQASGSSGSSSTPQSNNDHGNEEEDQDVFAAEFRKMKL  515
             L+       TP++      G  Q                   EEE QD F +EFR+MKL
Sbjct  665  FLRNFEQSVNTPNSSQYSLDGRDQ-------------------EEEAQDAFTSEFRRMKL  705

Query  516  KGEFPCRLCNSIYPNLRALKGHSRIHVNTI-PGKPFPCNICTYDCVDKNALMKHMKSHNG  574
            +GEFPC+LC +++PNLRALKGH+R+H+  + P  PF CN+C Y   DK AL++HM++HNG
Sbjct  706  RGEFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNG  765

Query  575  PRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKSVLIYHPSEDSA  622
             RPY+C++CNY+FTTKANCERH+RNRHGK +REEVK  ++YHP+ED+ 
Sbjct  766  DRPYECAVCNYAFTTKANCERHLRNRHGKTSREEVKRAIVYHPAEDAG  813


 Score = 156 bits (394),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 98/165 (59%), Gaps = 12/165 (7%)

Query  1605  GLPTSETPFKCHVYMCDSGFADRQDCLDHLKNCHEEAYTRLVDRGALEKD-YDGNDQ---  1660
              L   + P+KCH  +C+  FA+R  CL+H+K  H   Y  L+ +GA+E +  + N     
Sbjct  1618  ALAGGDLPYKCH--LCEGSFAERLQCLEHIKQAHAHEYALLLAKGAIETESLEANPHQQP  1675

Query  1661  ------SDVEETASATRRVRVADYANRKVICAFCMRRFWSAEDLRRHMRTHTGERPYFCD  1714
                   SD E       R +  DY+NRKVICAFC+RRFWS EDLRRHMRTH+GERP+ CD
Sbjct  1676  SQQAVHSDDEAPNGGGNRGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGERPFQCD  1735

Query  1715  VCAQRFTLKHSMLRHRKKHDSPDSAMYVGTSGDEDSAPVSSQPST  1759
             +C ++FTLKHSMLRH KKH           S   D   VSS PST
Sbjct  1736  ICLRKFTLKHSMLRHMKKHSGRAHNGDTPGSDCSDDEQVSSPPST  1780


 Score = 132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 93/136 (68%), Gaps = 13/136 (10%)

Query  1272  NEDLSSISVMLNNA-SHNYQQNFH------AQYM--SEEEGLVAPLSDHSGSDSVNSLTA  1322
             ++DL  ++ +++NA S N   N +      A +M  S+EEGLVA     S S+S NS T 
Sbjct  1371  SQDLVPVAKLVDNATSQNMGFNSYFRPSDVANHMEQSDEEGLVA---SGSASESNNSGTE  1427

Query  1323  TPTFKKKKMKKKKKKSAYSLAPNRVKCPYCQRPFPWASSLNRHILTHTGQKPYECRFCPL  1382
               T       + KKKSAYSLAPNRV CPYCQR FPW+SSL RHILTHTGQKP++C  CPL
Sbjct  1428  DVT-SSSSSSEPKKKSAYSLAPNRVSCPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPL  1486

Query  1383  FFTTKSNCDRHLLRKH  1398
              FTTKSNCDRHLLRKH
Sbjct  1487  LFTTKSNCDRHLLRKH  1502


 Score = 108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 62/96 (65%), Gaps = 14/96 (15%)

Query  76   YTCPACPVVLTSPRELTNHLRGHNSPRHTGGVGTTSDGGSGAEDADYVCGVCQKQLSSAS  135
            Y CP C VV  +P E TNH+R HN               +  +  ++ C +C K LSSAS
Sbjct  250  YLCPICEVVSATPHEFTNHIRCHNY--------------ANGDTENFTCRICSKVLSSAS  295

Query  136  SLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRT  171
            SLDRHVLVH+GERPF C +C ++FTTNGNM+RH+RT
Sbjct  296  SLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRHMRT  331


 Score = 106 bits (265),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 55/65 (85%), Gaps = 1/65 (2%)

Query  1000  KLIMKNGVLMQKQKQRRYRTERPFRCEHCGHGFTLRSNMERHVKQQHPQYWSQKPR-GTN  1058
             K+++KNGVLM KQKQRRYRTERPF CEHC   FTLRSNMERHVKQQHPQ+++Q+ R G +
Sbjct  1036  KMVIKNGVLMPKQKQRRYRTERPFACEHCSARFTLRSNMERHVKQQHPQFYAQRQRSGHH  1095

Query  1059  STRGR  1063
               RGR
Sbjct  1096  VMRGR  1100


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (61%), Gaps = 0/64 (0%)

Query  124   CGVCQKQLSSASSLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRTAHGSLSPGCHSW  183
             C  CQ+    +SSL RH+L H+G++PF+C HC + FTT  N +RH+   HG++      +
Sbjct  1453  CPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHGNVESAMSVY  1512

Query  184   TDSE  187
               +E
Sbjct  1513  VPTE  1516


 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 34/51 (67%), Gaps = 1/51 (2%)

Query  1349  CPYCQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHK  1399
             C  C +    ASSL+RH+L HTG++P+ CR+C L FTT  N  RH +R HK
Sbjct  284   CRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNMHRH-MRTHK  333


 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 14/102 (14%)

Query  76   YTCPACPVVLTSPRELTNHLRGHNSPRHTGGVGTTSDGGSGAEDADYVCGVCQKQLSSAS  135
            + C  C  V  + R L    +GHN   H G VG             + C +C   +   +
Sbjct  709  FPCKLCTAVFPNLRAL----KGHNR-VHLGAVGPA---------GPFRCNMCPYAVCDKA  754

Query  136  SLDRHVLVHSGERPFRCVHCDMSFTTNGNMNRHVRTAHGSLS  177
            +L RH+  H+G+RP+ C  C+ +FTT  N  RH+R  HG  S
Sbjct  755  ALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTS  796


 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 5/127 (4%)

Query  1629  DCLDHLKNCHEEAYTRLVDRG-ALEKDYDGNDQSDVEETASATRRVRVADYANRKVICAF  1687
             D  +H++   EE    LV  G A E +  G +      ++S  ++      A  +V C +
Sbjct  1399  DVANHMEQSDEEG---LVASGSASESNNSGTEDVTSSSSSSEPKKKSAYSLAPNRVSCPY  1455

Query  1688  CMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSMLRH-RKKHDSPDSAMYVGTSG  1746
             C R F  +  LRRH+ THTG++P+ C  C   FT K +  RH  +KH + +SAM V    
Sbjct  1456  CQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHGNVESAMSVYVPT  1515

Query  1747  DEDSAPV  1753
             ++ S P+
Sbjct  1516  EDVSEPI  1522


 Score = 58.2 bits (139),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 7/58 (12%)

Query  1349  CPY--CQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHKKQATE  1404
             CPY  C +     ++L RH+ TH G +PYEC  C   FTTK+NC+RHL  +H K + E
Sbjct  746   CPYAVCDK-----AALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRHGKTSRE  798


 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 41/69 (59%), Gaps = 4/69 (6%)

Query  552   CNICTYDCVDKNALMKHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGKLNREEVKS  611
             C  C       ++L +H+ +H G +P++CS C   FTTK+NC+RH+  +HG  N E   S
Sbjct  1453  CPYCQRMFPWSSSLRRHILTHTGQKPFKCSHCPLLFTTKSNCDRHLLRKHG--NVESAMS  1510

Query  612   VLIYHPSED  620
             V  Y P+ED
Sbjct  1511  V--YVPTED  1517


 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 33/67 (49%), Gaps = 3/67 (4%)

Query  1670  TRRVRVADYAN---RKVICAFCMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSM  1726
             T  +R  +YAN       C  C +   SA  L RH+  HTGERP+ C  C   FT   +M
Sbjct  266   TNHIRCHNYANGDTENFTCRICSKVLSSASSLDRHVLVHTGERPFNCRYCHLTFTTNGNM  325

Query  1727  LRHRKKH  1733
              RH + H
Sbjct  326   HRHMRTH  332


 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 39/76 (51%), Gaps = 9/76 (12%)

Query  113   GGSGAEDADY-----VCGVCQKQLSSASSLDRHVLVHSGERPFRCVHCDMSFTTNGNMNR  167
             GG+  +  DY     +C  C ++  S   L RH+  HSGERPF+C  C   FT   +M R
Sbjct  1690  GGNRGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLR  1749

Query  168   HVRT----AHGSLSPG  179
             H++     AH   +PG
Sbjct  1750  HMKKHSGRAHNGDTPG  1765


 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 44/80 (55%), Gaps = 4/80 (5%)

Query  1346  RVKCPYCQRPFPWASSLNRHILTHTGQKPYECRFCPLFFTTKSNCDRHLLRKHKKQATET  1405
             +V C +C R F     L RH+ TH+G++P++C  C   FT K +  RH ++KH  +A   
Sbjct  1703  KVICAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLRH-MKKHSGRA-HN  1760

Query  1406  GLTRAASVSSPELPQESSPP  1425
             G T  +  S  E  Q SSPP
Sbjct  1761  GDTPGSDCSDDE--QVSSPP  1778


 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 3/83 (4%)

Query  518  EFPCRLCNSIYPNLRALKGHSRIHVNTIPG--KPFPCNICTYDCVDKNALMKHMKSHNGP  575
            ++ C +C  +         H R H N   G  + F C IC+      ++L +H+  H G 
Sbjct  249  KYLCPICEVVSATPHEFTNHIRCH-NYANGDTENFTCRICSKVLSSASSLDRHVLVHTGE  307

Query  576  RPYQCSMCNYSFTTKANCERHVR  598
            RP+ C  C+ +FTT  N  RH+R
Sbjct  308  RPFNCRYCHLTFTTNGNMHRHMR  330


 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  552   CNICTYDCVDKNALMKHMKSHNGPRPYQCSMCNYSFTTKANCERHVRNRHGK  603
             C  C         L +HM++H+G RP+QC +C   FT K +  RH++   G+
Sbjct  1706  CAFCLRRFWSTEDLRRHMRTHSGERPFQCDICLRKFTLKHSMLRHMKKHSGR  1757


 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  1685  CAFCMRRFWSAEDLRRHMRTHTGERPYFCDVCAQRFTLKHSMLRH-RKKH  1733
             C  C         L RHMRTH G+RPY C VC   FT K +  RH R +H
Sbjct  743   CNMCPYAVCDKAALVRHMRTHNGDRPYECAVCNYAFTTKANCERHLRNRH  792


 Score = 39.7 bits (91),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query  516   KGEFP--------CRLCNSIYPNLRALKGHSRIHVNTIPGKPFPCNICTYDCVDKNALMK  567
             +G++P        C  C   + +   L+ H R H      +PF C+IC      K+++++
Sbjct  1693  RGKYPDYSNRKVICAFCLRRFWSTEDLRRHMRTHSGE---RPFQCDICLRKFTLKHSMLR  1749

Query  568   HMKSHNG  574
             HMK H+G
Sbjct  1750  HMKKHSG  1756


 Score = 39.3 bits (90),  Expect = 0.040, Method: Compositional matrix adjust.
 Identities = 15/27 (56%), Positives = 16/27 (59%), Gaps = 0/27 (0%)

Query  147   ERPFRCVHCDMSFTTNGNMNRHVRTAH  173
             ERPF C HC   FT   NM RHV+  H
Sbjct  1056  ERPFACEHCSARFTLRSNMERHVKQQH  1082


 Score = 36.6 bits (83),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  1011  KQKQRRYRTERPFRCEHCGHGFTLRSNMERHVKQ  1044
             ++  R +  ERPF+C+ C   FTL+ +M RH+K+
Sbjct  1720  RRHMRTHSGERPFQCDICLRKFTLKHSMLRHMKK  1753


 Score = 36.2 bits (82),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  1015  RRYRTERPFRCEHCGHGFTLRSNMERHVKQQH  1046
             R +  +RP+ C  C + FT ++N ERH++ +H
Sbjct  761   RTHNGDRPYECAVCNYAFTTKANCERHLRNRH  792


 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 23/86 (27%), Positives = 39/86 (45%), Gaps = 10/86 (12%)

Query  1655  YDGNDQSDVEETA--SATRRVRVADYANRKVICAFCMRRFWSAEDLRRHMRTHTGE----  1708
              DG DQ +  + A  S  RR+++      +  C  C   F +   L+ H R H G     
Sbjct  683   LDGRDQEEEAQDAFTSEFRRMKLRG----EFPCKLCTAVFPNLRALKGHNRVHLGAVGPA  738

Query  1709  RPYFCDVCAQRFTLKHSMLRHRKKHD  1734
              P+ C++C      K +++RH + H+
Sbjct  739   GPFRCNMCPYAVCDKAALVRHMRTHN  764


 Score = 36.2 bits (82),  Expect = 0.36, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  1798  SDLISNLLGIGGNVVDKALQLSPDDAAKLLGI  1829
             SDLI NLLGI    +   L  S D+AAKLLG+
Sbjct  1860  SDLIGNLLGISDQGILNKLLSSADEAAKLLGV  1891


 Score = 35.8 bits (81),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  1699  RRHMRTHTGERPYFCDVCAQRFTLKHSMLRHRKK  1732
             ++  R +  ERP+ C+ C+ RFTL+ +M RH K+
Sbjct  1047  KQKQRRYRTERPFACEHCSARFTLRSNMERHVKQ  1080


 Score = 35.4 bits (80),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  576   RPYQCSMCNYSFTTKANCERHVRNRH  601
             RP+ C  C+  FT ++N ERHV+ +H
Sbjct  1057  RPFACEHCSARFTLRSNMERHVKQQH  1082


 Score = 35.4 bits (80),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%), Gaps = 0/27 (0%)

Query  1020  ERPFRCEHCGHGFTLRSNMERHVKQQH  1046
             ++PF+C HC   FT +SN +RH+ ++H
Sbjct  1476  QKPFKCSHCPLLFTTKSNCDRHLLRKH  1502


 Score = 35.0 bits (79),  Expect = 0.69, Method: Compositional matrix adjust.
 Identities = 14/54 (26%), Positives = 25/54 (46%), Gaps = 3/54 (6%)

Query  519  FPCRLCNSIYPNLRALKGHSRIHVNTIPGKPFPCNICTYDCVDKNALMKHMKSH  572
            F CR+C+ +  +  +L  H  +H      +PF C  C         + +HM++H
Sbjct  282  FTCRICSKVLSSASSLDRHVLVHTGE---RPFNCRYCHLTFTTNGNMHRHMRTH  332


 Score = 33.1 bits (74),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (63%), Gaps = 0/24 (0%)

Query  1020  ERPFRCEHCGHGFTLRSNMERHVK  1043
             ERPF C +C   FT   NM RH++
Sbjct  307   ERPFNCRYCHLTFTTNGNMHRHMR  330


 Score = 33.1 bits (74),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 17/59 (29%), Positives = 26/59 (44%), Gaps = 4/59 (7%)

Query  120  ADYVCGVCQKQLSSASSLDRHVLVHSGE----RPFRCVHCDMSFTTNGNMNRHVRTAHG  174
             ++ C +C     +  +L  H  VH G      PFRC  C  +      + RH+RT +G
Sbjct  707  GEFPCKLCTAVFPNLRALKGHNRVHLGAVGPAGPFRCNMCPYAVCDKAALVRHMRTHNG  765



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000020-PA

Length=457
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CDC14_CAEEL  unnamed protein product                                  252     3e-76
Q382T8_TRYB2  unnamed protein product                                 147     4e-38
Q382E9_TRYB2  unnamed protein product                                 66.2    2e-11


>CDC14_CAEEL unnamed protein product
Length=709

 Score = 252 bits (643),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 193/356 (54%), Gaps = 39/356 (11%)

Query  75   AVVEIVKNKFYLATLLPGTRNPES------PTADTYLFETDTYLTYKNFYDDFGPLNLAC  128
             + E++ N+ Y         NP++          T     +    Y+ FY+DFGP NL+ 
Sbjct  16   TLTELLPNRLYFGCFP----NPDAIDKSDKSVKKTCFININNKFHYEPFYEDFGPWNLSV  71

Query  129  LYKYCREVNKVLA--NPRFKLIVHYTSSNA-----KLRANAVYLAASYSVLYLDQSPSDV  181
            LY+ C +V K+L     R + +V +   +      K+R N  Y+  +Y ++Y   S  D 
Sbjct  72   LYRLCVQVGKLLEVEEKRSRRVVLFCQDDGTGQYDKIRVNTAYVLGAYLIIYQGFSADDA  131

Query  182  YKSMRGDVGVMLRPFQDASIGISRYTIDLLDCLNALKKSASLGFFDFEDFDVHDYEKYGK  241
            Y  +     V    F+DAS+G  +Y + L D L  ++K+   G+ DF DFD  +YE Y +
Sbjct  132  YLKVSSGETVKFVGFRDASMGSPQYLLHLHDVLRGIEKALKFGWLDFSDFDYEEYEFYER  191

Query  242  IRNGDLNWIVPRKFIAFLGPSTEP----GTALHYPEKYLNYFMKNDVATVLRLNKANYEA  297
            + NGD NWI+P K ++F GP  E     G   H P+ Y +YF +N V+T++RLN  NY+A
Sbjct  192  VENGDFNWIIPGKILSFCGPHNESREENGYPYHAPDVYFDYFRENKVSTIVRLNAKNYDA  251

Query  298  HRHATPHTKRFFEKQCGRLRFTSAGILHYEMYFPDGSTPPMNVLREFLHVAESTRGTLAV  357
             +                  FT AG  H +++F DGSTP   ++ +F+ V ++T+G +AV
Sbjct  252  SK------------------FTKAGFDHVDLFFIDGSTPSDEIMLKFIKVVDNTKGGVAV  293

Query  358  HCKAGLGRTGTLIAAYMMKHYMFSAREAVAWLRICRPGSVIGAQQVWLESIQGDMW  413
            HCKAGLGRTGTLIA +MMK Y  +A E + WLR+CRPGSVIG QQ +L   Q   W
Sbjct  294  HCKAGLGRTGTLIACWMMKEYGLTAGECMGWLRVCRPGSVIGPQQPYLIEKQKFCW  349


>Q382T8_TRYB2 unnamed protein product
Length=818

 Score = 147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 108/392 (28%), Positives = 168/392 (43%), Gaps = 115/392 (29%)

Query  114  YKNFYDDFGPLNLACLYKYCREVNKVL------------ANPRFKL-------IVHYTSS  154
            Y+ F+ DFGPL L C+    R +  +L            +N   K         VH+ ++
Sbjct  144  YQPFFADFGPLGLDCVTALSRYLKSLLELCASFRSDDSDSNQEMKASQNNVFDFVHFNTN  203

Query  155  NA-------------------------KLRANAVYLAASYSVLYLDQSPSDVYKSMRGDV  189
             +                           RANA  L A + V  L  S ++ ++  +   
Sbjct  204  ESLSGGLLWGGISEHVIPVVFCSGLGNHERANAACLLACFCVAGLRWSAAETWRIFQEAF  263

Query  190  GVMLRPFQDASIGISRYTIDLLDCLNALKKSASLGFFDFEDFDVHDYEKYGKIRNGDLNW  249
              ++  F+DAS G+S + + L D L  L+++  LG++D   FD+ +Y+   ++R  D  W
Sbjct  264  PPIIS-FRDASYGVSTFPLSLSDILGGLQRAVELGWYDPNTFDLQEYD---RLRIYDCCW  319

Query  250  IVPRKFIAFLGPSTEPGTALHYPEKYLNYFMKNDVATVLRLNKANYEAHRHATPHTKRFF  309
            I+P+  + F  P +  G     P  Y   F +  VA V+RLN+  Y+  RHA        
Sbjct  320  IIPKALLTFSSPVS--GDPNRDPVMYAKLFQELRVAGVVRLNEPLYD--RHA--------  367

Query  310  EKQCGRLRFTSAGILHYEMYFPDGSTPPMNVLREFLHV----------------------  347
                    F S GI H ++ FPDG+ P   ++  F+ V                      
Sbjct  368  --------FLSRGIQHEDLEFPDGTAPNDAIINRFMEVVDPILSVQPPATHSDARKRATK  419

Query  348  -------------------------AESTRGTLAVHCKAGLGRTGTLIAAYMMKHYMFSA  382
                                     ++S  G +AVHC AGLGRTGT+   Y+++ Y F+A
Sbjct  420  ERETSDSVDLHPKGREDVRFRGRLKSDSRGGAVAVHCHAGLGRTGTIACTYIIRRYGFTA  479

Query  383  REAVAWLRICRPGSVIGAQQVWLESIQGDMWR  414
            R AV W R+CRPGSV+GAQ ++LE  +  + R
Sbjct  480  RGAVGWTRLCRPGSVMGAQHMFLEKFERRLLR  511


>Q382E9_TRYB2 unnamed protein product
Length=494

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/185 (26%), Positives = 82/185 (44%), Gaps = 15/185 (8%)

Query  262  STEPGTALHYPEKYLNYFMKNDVATVLRLNKANYEAHRHATPHTKRFFEKQ----CGRLR  317
            S  P T+L      +  F +  +  VL L     E   HA+      +        G   
Sbjct  95   SQRPSTSLFRKYSLIEQFREKRITGVLNLQ----EKGEHASCGPDGIYASTGYSYSGEQD  150

Query  318  FTSAGILHYEMYFPDGSTPPMNVLREFLHVAES---TRGTLAVHCKAGLGRTGTLIAAYM  374
                 I +YE  +PD + P  +++   + V +S     G + VHC AGLGRTG +IA Y+
Sbjct  151  LMRHQISYYEFPWPDMTAPKQDIVLRSVQVMDSHVKKSGKVLVHCHAGLGRTGLMIACYL  210

Query  375  MKHYMFSAREAVAWLRICRPGSVIGAQQV-WLESIQGDMWREGRQFRLKYHG---DDNLI  430
            +      + + +  +R  RPG++  ++QV ++   +  +WR    FR++      D +L 
Sbjct  211  LYAQKMPSADVIELVRQMRPGAIQTSRQVKFIHDFESHLWRLSHTFRVEVSESALDIDLF  270

Query  431  LHHKR  435
            L  +R
Sbjct  271  LKKQR  275



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000021-PA

Length=1186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SETB1_DROME  unnamed protein product                                  647     0.0  
MET2_CAEEL  unnamed protein product                                   315     2e-89
Q95RU8_DROME  unnamed protein product                                 72.8    2e-12


>SETB1_DROME unnamed protein product
Length=1262

 Score = 647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/902 (43%), Positives = 510/902 (57%), Gaps = 142/902 (16%)

Query  339   DLPPAGQLIRPVPKIDDFVFIMKH-PLFPWIKAKIQSIVSKSPMN------YSVKLLQKK  391
             ++PP G+++RP  ++ +  + +K+  +  W+  K+      + +N      Y ++ L   
Sbjct  449   EVPPPGEIVRPPIQLGETYYAVKNKAIASWVSIKVIEFTESTAINGNTMKSYKIRYLNTP  508

Query  392   YAGKVKTLPGKQLASSTPSEVIIPVGTRVVAIFQDTYCSN----------YYSGVIAEPP  441
             Y   +KT+  K +A   P  V + +GTRV+A F  T  S           +Y G+IAEP 
Sbjct  509   YQ-MIKTVTAKHIAYFEPPPVRLTIGTRVIAYFDGTTLSRGKDKGVVQSAFYPGIIAEPL  567

Query  442   KSTNKYRYLVFFDDGYAQYVKHKHIFLVCESSARVWEDIPPESRDFVKKYLESYP-ERPM  500
             K  N+YRYL+F+DDGY QYV H+ + LVC++S +VWED+   SRDF++KY+E Y  +RPM
Sbjct  568   KQANRYRYLIFYDDGYTQYVPHRDVRLVCQASEKVWEDVHAASRDFIQKYVEKYSVDRPM  627

Query  501   VKLQRGQVVKTEWNGKWWIARVREVDASLVQMHFDAD-NRTEWIYRGSARLGPLYVEL--  557
             V+  RGQ + TE NG W  ARV ++D SLV M F+ D N TEWIYRGS RLGP++ E   
Sbjct  628   VQCTRGQSMTTESNGTWLYARVIDIDCSLVLMQFEGDKNHTEWIYRGSLRLGPVFRETQN  687

Query  558   -MKANLRQQGCHSSINTPSRHRGGLFMSKNGPYVEYTSNTTDEQDANKEKQSTPSNIQEV  616
              M ++  QQ     +  P R           P++ YT          KE +S+       
Sbjct  688   NMNSSSAQQ-----LRVPRRTE---------PFIRYT----------KEMESS-------  716

Query  617   STTPQQSRAVAKKSTAK------------------KTMAPETSTAN-------------Y  645
             S   QQ RA A+KS+A                   +T A   ST+N             Y
Sbjct  717   SKVNQQMRAFARKSSASAQNNALAAASSAATPAGGRTNAGGVSTSNSASAVRHLNNSTIY  776

Query  646   NPVETKSSHSIVYYQTQNKIQTKKFVPHRCGPKCVESISFTPDELRGYSPLSIPLLCGWN  705
                E +    +VY+  +  +  K +  H C P C+  I      L  YSPL+ PLL GW 
Sbjct  777   VDDENRPKGHVVYFTAKRNLPPKMYKCHECSPNCLFKIVH---RLDSYSPLAKPLLSGWE  833

Query  706   RQFCRFPKGKKIIFYQAPCGVRLRNMEELHKYLRKTNCPMSVDLFEFDFWVHCLAEFVLD  765
             R   R  K KK + Y+ PCG  LR++ E+H+YLR T   ++VD F+F   + CLAE+ +D
Sbjct  834   RLVMR-QKTKKSVVYKGPCGKSLRSLAEVHRYLRATENVLNVDNFDFTPDLKCLAEYSID  892

Query  766   KCFVNIKDLSYGVESVAIPCVNEIDHAYPDTIKYTTQREPTDDVHINLDPDFLCSCDCED  825
                V   D+S G E +AIP VN  D+  P    Y  QR PT+ VH+NLD +FL  CDCED
Sbjct  893   PSIVKDTDISKGQEKMAIPLVNYYDNTLPPPCTYAKQRIPTEGVHLNLDEEFLLCCDCED  952

Query  826   DCADKNKCQCWQLTIQGATLGG-RVPNAAVGYVYKRLPEAVTTGIYECNSRCKCSVKTCL  884
             DC+DK+KC CWQLT+ G      + P   +GY YKRL E V TGIYECNSRCKC  K CL
Sbjct  953   DCSDKSKCACWQLTVAGVRYCNPKKPIEEIGYQYKRLHEHVPTGIYECNSRCKCK-KNCL  1011

Query  885   NRVVQHPLNLKLQVFKTAPRGWGIRCLNDIPLGSFICIYAGRLLTEQGANEGGKNYGDEY  944
             NRVVQ  L +KLQVFKT+ RGWG+RC+NDIP G+FICIYAG LLTE  ANEGG++ GDEY
Sbjct  1012  NRVVQFSLEMKLQVFKTSNRGWGLRCVNDIPKGAFICIYAGHLLTETMANEGGQDAGDEY  1071

Query  945   LAELDYVEVVEGIKEGYESDVLDPELPLGGDPDSDPKYKEKGKHDDTESHKTGSNDSDDE  1004
              A+LDY+EV E +KEGYES+V            SDP  +E     D E         DD+
Sbjct  1072  FADLDYIEVAEQLKEGYESEV----------DHSDPDAEEDNGGPDAED--------DDD  1113

Query  1005  YKIDKKLQKTLNIDEDSNDGSIRSRLRKRKKDDSNQGLEDKGSEDGQSLKDGQDKAGSDE  1064
             ++ +   Q+ +                   K  S  G     S     L D Q++A  + 
Sbjct  1114  FRPNYHYQRKI-------------------KRSSRSGSTQNSSTQSSEL-DSQERAVINF  1153

Query  1065  DDNNMREPSKLDLAVDTRKIEKGTFKSVREFFGEEESVYIMDAKTTGNIGRYLNHSCDPN  1124
             + N        DL    R+       SVR  FG++E+ YIMDAKTTGN+GRY NHSC PN
Sbjct  1154  NPN-------ADLDETVRE------NSVRRLFGKDEAPYIMDAKTTGNLGRYFNHSCSPN  1200

Query  1125  VFVQNVFVDTHDVRFPWVAFFALSYIRAGQELTWNYSYDVGSIPGKVIPCKCGASNCRGR  1184
             +FVQNVFVDTHD+RFPWVAFF+ ++IR+G ELTWNY+Y+VG +PGKV+ C+CGA NCR R
Sbjct  1201  LFVQNVFVDTHDLRFPWVAFFSAAHIRSGTELTWNYNYEVGVVPGKVLYCQCGAPNCRLR  1260

Query  1185  LL  1186
             LL
Sbjct  1261  LL  1262


 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 52/194 (27%), Positives = 87/194 (45%), Gaps = 11/194 (6%)

Query  29   CINFKCSSGVDMRPTTSFAC-SFYGVNMQKKKKRFICKACLDAALDHQEQLVDALIGHKP  87
            C+N  C+         + A  +FY V  +  K++F+C  C D A+D  E+    L+  +P
Sbjct  265  CVNCNCTKLHKQYVLANMATLNFYQVLRKSSKQQFLCMGCHDTAMDLYEEYAGQLMAKQP  324

Query  88   LLQCDF-PDHTMEVEISDSDESDSETKDGKDMFLIEGNALVEFEKKVDSTLTTIFEKYDI  146
            LL  DF  DH   V +  SDE + E +  K  F    N L   E ++D  +  +  K D 
Sbjct  325  LLLKDFHQDHADFVALDSSDEEEEEKQPEKSDF--SKNKLQLIEDELDDAIKNVLNKVDF  382

Query  147  NFQLEEANTALKTEWNLIDGKMHFNVNKLKKYSNLANLIFTATEAKLNDS---ISKTMKR  203
              QL  + T L+ + + ++ +      +L+K    A+ +  A    L +S     K +  
Sbjct  383  TAQLSWSKTILQAKADHLERQFALADVELEKVQTTADKMHCA----LYNSCPVAHKHLPT  438

Query  204  LDLIRSTFYNEFKP  217
            LD+  S + +E  P
Sbjct  439  LDIEPSDYVHEVPP  452


>MET2_CAEEL unnamed protein product
Length=1304

 Score = 315 bits (808),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 187/532 (35%), Positives = 273/532 (51%), Gaps = 64/532 (12%)

Query  674   RCGPKCVESISFTPDELRGY--SPLSIPLLCGWNRQFCRFPKGKKI------IFYQAPCG  725
             +CGP C++ +   P E R +  SP+  PLLCGW R       GKK       I Y +PCG
Sbjct  816   QCGPDCLQKMDADPYEARFHRNSPIHTPLLCGWRRIMYTMSTGKKRGAVKKNIIYFSPCG  875

Query  726   VRLRNMEELHKYLRKTNCPMSVDLFEFDFWVHCLAEFVLDKCFVNIKDLSYGVESVAIPC  785
               L  + ++ +Y+  T   +++D F FD  +       +D  ++ + D S G E + IP 
Sbjct  876   AALHQISDVSEYIHVTRSLLTIDCFSFDARIDTATYITVDDKYLKVADFSLGTEGIPIPL  935

Query  786   VNEIDHAYPDTIKYTTQR-EPTDDVHIN-LDPDFLCSCDCEDDCADKNKCQCWQLTIQGA  843
             VN +D+  P +++Y+ +R +  D V I+ +  DF   C C+ DC+D +KC+C QL+I+  
Sbjct  936   VNSVDNDEPPSLEYSKRRFQYNDQVDISSVSRDFCSGCSCDGDCSDASKCECQQLSIEAM  995

Query  844   TLGGRVPN---------AAVGYVYKRLPEAVTTGIYECNSRCKCSVKTCLNRVVQHPLNL  894
                 R+P+             Y  + L   V +G+YECN +C C  K+C NRVVQ+ +  
Sbjct  996   K---RLPHNLQFDGHDELVPHYQNRLLSSKVISGLYECNDQCSCHRKSCYNRVVQNNIKY  1052

Query  895   KLQVFKTAPRGWGIRCLNDIPLGSFICIYAGRLLTEQGANEGGKNYGDEYLAELDYVEVV  954
              + +FKTA  GWG+R L DIP  +FIC Y G +LT+  A+E      D+Y A+LD  + V
Sbjct  1053  PMHIFKTAQSGWGVRALTDIPQSTFICTYVGAILTDDLADE--LRNADQYFADLDLKDTV  1110

Query  955   EGIKEGYESDVLDPELPLGGDPDSDPKYKEKGKHDDTESHKTGSNDSDDEYKIDKKLQKT  1014
             E +++G E    D     GGD         +  +DD E     S D          + K 
Sbjct  1111  E-LEKGREDHETD--FGYGGD---------ESDYDDEEGSDGDSGDD--------VMNKM  1150

Query  1015  LNIDEDSNDGSIRSRLRKRKKDDSNQGLEDKGSEDGQSLKDGQDKAGSDEDDNNMREPSK  1074
             +   + S  G    RL ++K+               QS K G  K GS E D+     S 
Sbjct  1151  VKRQDSSESGEETKRLTRQKR--------------KQSKKSG--KGGSVEKDDTTPRDSM  1194

Query  1075  LDLAVDTRKIEKGTFKSVREFFGEEESVYIMDAKTTGNIGRYLNHSCDPNVFVQNVFVDT  1134
                 ++++  ++  F   + F  E   +Y++DAK  GN+GR+LNHSCDPNV VQ+V  DT
Sbjct  1195  EKDNIESK--DEPVFNWDKYF--EPFPLYVIDAKQRGNLGRFLNHSCDPNVHVQHVMYDT  1250

Query  1135  HDVRFPWVAFFALSYIRAGQELTWNYSYDVGSIPGKVIPCKCGASNCRGRLL  1186
             HD+R PWVAFF   Y++AG ELTW+Y Y         + C CGA NC GRLL
Sbjct  1251  HDLRLPWVAFFTRKYVKAGDELTWDYQYTQDQTATTQLTCHCGAENCTGRLL  1302


>Q95RU8_DROME unnamed protein product
Length=1637

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 90/198 (45%), Gaps = 26/198 (13%)

Query  766   KCFVNIKDLSYGVESVAIPCV-NEI------DHA----YPDTIKYTTQ-REPTDDVHINL  813
             + FV   D S G E+  I  V NE+      D A    +PD  +Y TQ     + V I+ 
Sbjct  1332  RTFVVCADASNGREARPIQVVRNELAMSENEDEADSLMWPD-FRYVTQCIIQQNSVQIDR  1390

Query  814   DPDFLCSCDCEDDCADKNKCQCWQLTIQGATLGGRVPNAAVGYVYKRLPEAVTTGIYECN  873
                 +  C C D C+  ++CQC   + Q         NA   Y    +       I+ECN
Sbjct  1391  RVSQMRICSCLDSCS-SDRCQCNGASSQNWYTAESRLNADFNYEDPAV-------IFECN  1442

Query  874   SRCKCSVKTCLNRVVQHPLNLKLQVFKTA--PRGWGIRCLNDIPLGSFICIYAGRLLTEQ  931
               C C+  +C NRVVQ+     LQ+ +     +GWG+R L ++P G+F+  Y G +LT  
Sbjct  1443  DVCGCNQLSCKNRVVQNGTRTPLQIVECEDQAKGWGVRALANVPKGTFVGSYTGEILT--  1500

Query  932   GANEGGKNYGDEYLAELD  949
              A E  +   D Y  +LD
Sbjct  1501  -AMEADRRTDDSYYFDLD  1517


 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query  1095  FFGEEESVYIMDAKTTGNIGRYLNHSCDPNVFVQNVFVDTHDVRFPWVAFFALSYIRAGQ  1154
             ++ + ++ + +DA   GN+ R+ NHSC+PNV    VF +  D RFP +AFF+   I AG+
Sbjct  1512  YYFDLDNGHCIDANYYGNVTRFFNHSCEPNVLPVRVFYEHQDYRFPKIAFFSCRDIDAGE  1571

Query  1155  ELTWNYSYDVGSIPGK-VIPCKCGASNCR  1182
             E+ ++Y      +  +  + C+C  + C+
Sbjct  1572  EICFDYGEKFWRVEHRSCVGCRCLTTTCK  1600



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000022-PA

Length=141
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MTPN_DICDI  unnamed protein product                                   98.6    2e-27
TNKS_DROME  unnamed protein product                                   72.8    1e-15
Q8MQG0_CAEEL  unnamed protein product                                 68.9    2e-14


>MTPN_DICDI unnamed protein product
Length=120

 Score = 98.6 bits (244),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/118 (45%), Positives = 73/118 (62%), Gaps = 1/118 (1%)

Query  23   EMGELVWGIKNGDLDQVRDIFENKNINVNKMIDN-RTPLHYAADYGQKEVVRYLLDKGAD  81
            E  +  W +KNGD+  V+   E K   ++    N R P H+AAD+ Q EV+ YL+ KGA 
Sbjct  3    EQNDFTWAVKNGDIANVKKSVEAKKDLISITDGNKRGPCHWAADFNQVEVLEYLISKGAK  62

Query  82   IHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNGETPDGQKYLDVAEKDEIKELLK  139
                D +GIT +LAA++EGHT  V+LL++ GA+ +   PDGQ   D AEK +IK LLK
Sbjct  63   FDNTDDYGITPLLAAVYEGHTGAVELLVKKGANKSVVGPDGQTAYDAAEKADIKALLK  120


>TNKS_DROME unnamed protein product
Length=1181

 Score = 72.8 bits (177),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 45/126 (36%), Positives = 68/126 (54%), Gaps = 5/126 (4%)

Query  8    RVAFFLSINSTETIAE--MGELVWGIKNGDLDQVRDIFENKNINVNKMIDNR-TPLHYAA  64
            R    LS+N    +A   + EL    K G++ +V+ +   + +N       + TPLH+AA
Sbjct  6    RSRAILSVNLDAVMANDPLRELFEACKTGEIAKVKKLITPQTVNARDTAGRKSTPLHFAA  65

Query  65   DYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNGETPDGQK  124
             YG++EVV +LL+ GA I A D+ G+  +      GH +VV+LLL+ GA PN  T D   
Sbjct  66   GYGRREVVEFLLNSGASIQACDEGGLHPLHNCCSFGHAEVVRLLLKAGASPN--TTDNWN  123

Query  125  YLDVAE  130
            Y  + E
Sbjct  124  YTPLHE  129


 Score = 71.2 bits (173),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 53/151 (35%), Positives = 77/151 (51%), Gaps = 38/151 (25%)

Query  27   LVWGIKNGDLDQVRDIFENKNINVN-KMIDNR--TPLHYAADYGQKEVVRYLLDKGADIH  83
            L+   K GDLD VR I  N  I+VN + +D R  TPLH+AA + +  VV++LL+ GA+++
Sbjct  488  LLEAAKAGDLDTVRRIVLNNPISVNCRDLDGRHSTPLHFAAGFNRVPVVQFLLEHGAEVY  547

Query  84   AKD-----------------------KHGITVILAAIW----------EGHTDVVKLLLE  110
            A D                       KHG  V ++ +W          +G  D+ KLLL+
Sbjct  548  AADKGGLVPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLK  607

Query  111  NGADPNGETPDGQKYLD-VAEKD-EIKELLK  139
            +GADP  +  DG    D V E D ++ ELL+
Sbjct  608  HGADPMKKNRDGATPADLVKESDHDVAELLR  638


 Score = 63.9 bits (154),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 1/93 (1%)

Query  26   ELVWGIKNGDLDQVRDIFENKNINVNKMIDNR-TPLHYAADYGQKEVVRYLLDKGADIHA  84
            EL+   ++G  D++  +    N+N +     R TPLH AA Y +  +V  LL  GAD+HA
Sbjct  179  ELLEAARSGAEDRLLALLTPLNVNCHASDGRRSTPLHLAAGYNRIGIVEILLANGADVHA  238

Query  85   KDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            KDK G+  +  A   GH DV KLL++ GA+ N 
Sbjct  239  KDKGGLVPLHNACSYGHFDVTKLLIQAGANVNA  271


 Score = 58.9 bits (141),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 52/95 (55%), Gaps = 6/95 (6%)

Query  32   KNGDLDQVRDIFENKNINV-NKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGI  90
            K G+L +V+ +   ++IN  +    N TPLH AA Y   E   YLL+ GAD++A+DK G+
Sbjct  648  KKGNLARVQRLVTPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGL  707

Query  91   TVILAAIWEGHTDVVKLLLE-----NGADPNGETP  120
              +  A   GH D+  LL++     N  D  G TP
Sbjct  708  IPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTP  742


 Score = 53.5 bits (127),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/81 (35%), Positives = 46/81 (57%), Gaps = 0/81 (0%)

Query  59   PLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNGE  118
            PLH A+ YG  ++   L+     ++A DK G T +  A  +G T +  LLL +GAD   +
Sbjct  709  PLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMK  768

Query  119  TPDGQKYLDVAEKDEIKELLK  139
              +GQ  +++A  D++K LL+
Sbjct  769  NQEGQTPIELATADDVKCLLQ  789


 Score = 36.6 bits (83),  Expect = 0.004, Method: Composition-based stats.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 3/79 (4%)

Query  58   TPLHYAA---DYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGAD  114
            TPLH A    D  +K+++  L  KG+ ++ K+K  +T +  A    H D +++LL+ GA 
Sbjct  365  TPLHLAVVSPDGKRKQLMELLTRKGSLLNEKNKAFLTPLHLAAELLHYDAMEVLLKQGAK  424

Query  115  PNGETPDGQKYLDVAEKDE  133
             N     GQ  L    +DE
Sbjct  425  VNALDSLGQTPLHRCARDE  443


 Score = 35.4 bits (80),  Expect = 0.009, Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 4/55 (7%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENG  112
            TPLH AA  G+ ++   LL  GAD + K++ G T I  A      D VK LL++ 
Sbjct  741  TPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELAT----ADDVKCLLQDA  791


 Score = 30.8 bits (68),  Expect = 0.38, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query  47   NINVNKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAA  96
            N+N N +    TPLH AA   + EV   LL +GAD    + H  + I AA
Sbjct  268  NVNANDLW-AFTPLHEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAA  316


 Score = 26.9 bits (58),  Expect = 7.6, Method: Composition-based stats.
 Identities = 13/26 (50%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  56   NRTPLHYAADYGQKEVVRYLLDKGAD  81
            N TPLH AA  G+ +V   LL  GA+
Sbjct  123  NYTPLHEAASKGKVDVCLALLQHGAN  148


>Q8MQG0_CAEEL unnamed protein product
Length=1841

 Score = 68.9 bits (167),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query  39   VRDIFENKNINVNKMID-NRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAI  97
            V  I  N    +N   +   TPLH A  +GQ  +V++L++ GAD+  K +   T +  A 
Sbjct  704  VAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAA  763

Query  98   WEGHTDVVKLLLENGADPNGETPDGQKYLDVAEK  131
             +GH + V+ LLENGA PN +T  GQ  L +A++
Sbjct  764  QQGHNNCVRYLLENGASPNEQTATGQTPLSIAQR  797


 Score = 54.3 bits (129),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 34/93 (37%), Positives = 50/93 (54%), Gaps = 3/93 (3%)

Query  52   KMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLEN  111
            + +   TPLH AA   Q +VVR L+  GA + A+ +   T +  A   G+TD+V LLL+ 
Sbjct  454  ETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIVILLLQA  513

Query  112  GADPNGETPDGQKYLDVAEK---DEIKELLKSH  141
            GA+ N  T D    L +A K   +E+  +L  H
Sbjct  514  GANSNATTRDNYSPLHIAAKEGQEEVAGILLDH  546


 Score = 54.3 bits (129),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 0/72 (0%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            TPLH +A  G KE+   L++ G+D+ AK  +G+T +     E H  V ++L  NGA+ N 
Sbjct  658  TPLHLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINS  717

Query  118  ETPDGQKYLDVA  129
            +T  G   L VA
Sbjct  718  KTNAGYTPLHVA  729


 Score = 53.5 bits (127),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 42/80 (53%), Gaps = 0/80 (0%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            TPLH A+ YG  EVVR LL++G  +  + K+ +T +  A    +  V  LLLENGA    
Sbjct  559  TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKA  618

Query  118  ETPDGQKYLDVAEKDEIKEL  137
               +G   L +A K    E+
Sbjct  619  AAKNGYTPLHIAAKKNQMEI  638


 Score = 52.0 bits (123),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/84 (37%), Positives = 48/84 (57%), Gaps = 3/84 (4%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            TPLH AA YG + V + LL+KGA+++ + +H I+ +  A   G T++  LLL  GA  + 
Sbjct  229  TPLHIAAHYGHENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDS  288

Query  118  ETPDGQKYLDVAEK---DEIKELL  138
             T D    L  A +   D++ +LL
Sbjct  289  RTKDLLTPLHCAARSGHDQVVDLL  312


 Score = 51.6 bits (122),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 61/109 (56%), Gaps = 2/109 (2%)

Query  32   KNGDLDQVRDIFE-NKNINVNKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGI  90
            + GDL++V ++     +IN +   +    LH A+  G  EVVR L+ + A + A  + G 
Sbjct  42   RAGDLEKVLELLRAGTDINTSNA-NGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGN  100

Query  91   TVILAAIWEGHTDVVKLLLENGADPNGETPDGQKYLDVAEKDEIKELLK  139
            T +  A   G + +V +L+ENGA+ N ++ +G   L +A ++  +E++K
Sbjct  101  TALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVK  149


 Score = 50.8 bits (120),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 1/78 (1%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            TPLH AA   Q E+   LL   AD +AK + G T +  +  EGH ++  LL+ENG+D   
Sbjct  625  TPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEISGLLIENGSDVGA  684

Query  118  ETPDGQKYLDV-AEKDEI  134
            +  +G   + + A++D +
Sbjct  685  KANNGLTAMHLCAQEDHV  702


 Score = 50.1 bits (118),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 39/65 (60%), Gaps = 1/65 (2%)

Query  47   NINVNKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVK  106
            N+NV   ++  TPL+ AA    +EVV+YLL  GA+     + G T +  A+ +GH  VV 
Sbjct  124  NVNVQS-VNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVA  182

Query  107  LLLEN  111
            +LLEN
Sbjct  183  VLLEN  187


 Score = 49.3 bits (116),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/98 (33%), Positives = 51/98 (52%), Gaps = 0/98 (0%)

Query  32   KNGDLDQVRDIFENKNINVNKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGIT  91
            K G  + VR++ + +           T LH A+  GQ  +V  L++ GA+++ +  +G T
Sbjct  75   KEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVENGANVNVQSVNGFT  134

Query  92   VILAAIWEGHTDVVKLLLENGADPNGETPDGQKYLDVA  129
             +  A  E H +VVK LL++GA+    T DG   L VA
Sbjct  135  PLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVA  172


 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 53/106 (50%), Gaps = 0/106 (0%)

Query  32   KNGDLDQVRDIFENKNINVNKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGIT  91
            K G+L+ VR + E       +  +  TPLH AA Y   +V   LL+ GA   A  K+G T
Sbjct  566  KYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYT  625

Query  92   VILAAIWEGHTDVVKLLLENGADPNGETPDGQKYLDVAEKDEIKEL  137
             +  A  +   ++   LL+  ADPN ++  G   L ++ ++  KE+
Sbjct  626  PLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPLHLSAQEGHKEI  671


 Score = 48.9 bits (115),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 45/87 (52%), Gaps = 3/87 (3%)

Query  55   DNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGAD  114
            DN +PLH AA  GQ+EV   LLD  AD     K G T +  A   G+ +VV+LLLE G  
Sbjct  523  DNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTP  582

Query  115  PNGETPDGQKYLDVA---EKDEIKELL  138
             + E  +    L VA     D++  LL
Sbjct  583  VDIEGKNQVTPLHVAAHYNNDKVAMLL  609


 Score = 47.0 bits (110),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 31/98 (32%), Positives = 50/98 (51%), Gaps = 1/98 (1%)

Query  37   DQVRDIFENKNINVN-KMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILA  95
            + V  +   K  NVN +   N +PLH A  +G+  +   LL +GA I ++ K  +T +  
Sbjct  240  ENVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHC  299

Query  96   AIWEGHTDVVKLLLENGADPNGETPDGQKYLDVAEKDE  133
            A   GH  VV LL+  GA  + +T +G   L +A + +
Sbjct  300  AARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGD  337


 Score = 46.2 bits (108),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 45/81 (56%), Gaps = 0/81 (0%)

Query  51   NKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLE  110
            ++ ++  TPLH A    + +VV  LL   A I A  + G+T +  A + G  ++V  LL+
Sbjct  387  SRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVAAFMGAINIVIYLLQ  446

Query  111  NGADPNGETPDGQKYLDVAEK  131
             GA+P+ ET  G+  L +A +
Sbjct  447  QGANPDVETVRGETPLHLAAR  467


 Score = 46.2 bits (108),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 0/74 (0%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            TPLH AA  G   +V YLL +GA+   +   G T +  A     TDVV++L+ NGA  + 
Sbjct  427  TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDA  486

Query  118  ETPDGQKYLDVAEK  131
            +  + Q  L +A +
Sbjct  487  QARELQTPLHIASR  500


 Score = 43.9 bits (102),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 42/127 (33%), Positives = 55/127 (43%), Gaps = 41/127 (32%)

Query  53   MIDNRT-----PLHYAADYGQKEVVRYLLDKGADIHAKDKHG------------------  89
            +ID+RT     PLH AA  G  +VV  L+ +GA I AK K+G                  
Sbjct  285  IIDSRTKDLLTPLHCAARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAART  344

Query  90   ---------------ITVILAAIWEGHTDVVKLLLENGADPNGETPDGQKYLDVA-EKDE  133
                           +T +  A   GH  V KLLL+  ADPN    +G   L +A +K+ 
Sbjct  345  LLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNR  404

Query  134  IK--ELL  138
            IK  ELL
Sbjct  405  IKVVELL  411


 Score = 43.5 bits (101),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 0/113 (0%)

Query  17   STETIAEMGELVWGIKNGDLDQVRDIFENKNINVNKMIDNRTPLHYAADYGQKEVVRYLL  76
            S +T   +  L    +   +D  R +  ++    +  +D  TPLH AA  G   V + LL
Sbjct  320  SAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLL  379

Query  77   DKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNGETPDGQKYLDVA  129
            D+ AD +++  +G T +  A  +    VV+LLL+  A     T  G   L VA
Sbjct  380  DRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEATTESGLTPLHVA  432


 Score = 40.8 bits (94),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 0/75 (0%)

Query  57   RTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPN  116
            +TPLH A+  G  ++V  LL  GA+ +A  +   + +  A  EG  +V  +LL++ AD  
Sbjct  492  QTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKT  551

Query  117  GETPDGQKYLDVAEK  131
              T  G   L +A K
Sbjct  552  LLTKKGFTPLHLASK  566


 Score = 40.8 bits (94),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 0/75 (0%)

Query  34   GDLDQVRDIFENKNINVNKMIDNRTPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVI  93
            G L+ V+ + EN      K   + TPLH AA  G    VRYLL+ GA  + +   G T +
Sbjct  733  GQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPL  792

Query  94   LAAIWEGHTDVVKLL  108
              A   G+  VV+ L
Sbjct  793  SIAQRLGYVSVVETL  807


 Score = 38.9 bits (89),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 0/62 (0%)

Query  58   TPLHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNG  117
            T +H  A      V + L + GA+I++K   G T +  A   G  ++VK L+ENGAD   
Sbjct  691  TAMHLCAQEDHVPVAQILYNNGAEINSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGE  750

Query  118  ET  119
            +T
Sbjct  751  KT  752


 Score = 38.1 bits (87),  Expect = 0.001, Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 0/67 (0%)

Query  63   AADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADPNGETPDG  122
            AA  G  E V  LL  G DI+  + +G+  +  A  EGH++VV+ L++  A  +  T  G
Sbjct  40   AARAGDLEKVLELLRAGTDINTSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKG  99

Query  123  QKYLDVA  129
               L +A
Sbjct  100  NTALHIA  106


 Score = 32.0 bits (71),  Expect = 0.17, Method: Composition-based stats.
 Identities = 26/76 (34%), Positives = 32/76 (42%), Gaps = 1/76 (1%)

Query  57   RTP-LHYAADYGQKEVVRYLLDKGADIHAKDKHGITVILAAIWEGHTDVVKLLLENGADP  115
            R P LH AA          LL    +     K G T +  A   GH +V +LLLE GA+ 
Sbjct  194  RLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHENVGQLLLEKGANV  253

Query  116  NGETPDGQKYLDVAEK  131
            N +       L VA K
Sbjct  254  NYQARHNISPLHVATK  269



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000023-PA

Length=162
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SYQ4_DROME  unnamed protein product                                 142     4e-44
Q9VZ35_DROME  unnamed protein product                                 30.0    0.51 


>Q8SYQ4_DROME unnamed protein product
Length=148

 Score = 142 bits (359),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 86/130 (66%), Gaps = 3/130 (2%)

Query  17   VLAVVFAVVAVYAADTKNEEYGPEKLFRRIIPADVLRDFPNMCFASTKCKTININETWDL  76
            ++   F V           + G  ++F+R+IPADVLRDFP MCFAST+C T+   ++WDL
Sbjct  10   LILTAFTVSLCAEQKITKSDAGEIRIFKRLIPADVLRDFPGMCFASTRCATVEPGKSWDL  69

Query  77   TPFCGLSRCVEGP--DGRLMEVVDDCGPLPKPNPKCNLSL-KTNKTAPFPGCCPIFECEG  133
            TPFCG S CV+    D +L E+V+DCGPLP  N KC L   KTNKTA FP CCPIF C+ 
Sbjct  70   TPFCGRSTCVQNEENDAKLFELVEDCGPLPLANDKCKLDTEKTNKTASFPYCCPIFTCDP  129

Query  134  GAKLEYPEIS  143
            G KLEYPEI 
Sbjct  130  GVKLEYPEIG  139


>Q9VZ35_DROME unnamed protein product
Length=160

 Score = 30.0 bits (66),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 23/90 (26%), Positives = 38/90 (42%), Gaps = 11/90 (12%)

Query  59   CFASTKCKTININETWDLTPFCGLSRCVEGPDGRLMEVVDDCGPLPK-PNPKCNLSLKTN  117
            C  +   + + I E +     C   +C+E      +++ +D   +PK     C     TN
Sbjct  38   CMDTLTGRQLYIGEVFTREDQCVRIQCLE-----TLQLWEDSCQVPKLTQGNCTPVPSTN  92

Query  118  KTAPFPGCCPIFECE-----GGAKLEYPEI  142
              A +P CCP++EC+      G  LE   I
Sbjct  93   PHAEYPRCCPLYECKSYESNSGGTLEQTNI  122



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000024-PA

Length=475
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIMP_DROME  unnamed protein product                                  158     5e-43
O18406_DROME  unnamed protein product                                 68.9    1e-12
Q9VF85_DROME  unnamed protein product                                 68.9    2e-12


>SLIMP_DROME unnamed protein product
Length=464

 Score = 158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 121/438 (28%), Positives = 216/438 (49%), Gaps = 42/438 (10%)

Query  35   SALFVPGNKANKTFTYLTPNIDFSDYFADIQNLQKELNQRDIKIDAQELKKAWDYYQFVR  94
            SAL++ G+KAN+ +  L P +DF+  F + Q L++ ++ R + I  + +   ++ Y+   
Sbjct  23   SALYITGDKANENYVTLQPYMDFNKTFGERQFLEQSISSRGLDIRLETVLSKYEKYKTHH  82

Query  95   SNRDALEEKLSIVNGQLQEFFKNNDLSADDLKRKEDLQHQNKLIKQDIKAIKEAAWELEE  154
            +    + E+   V  +L+E  K+   SA  L   E+L+   K ++ ++KA+K+  + +E+
Sbjct  83   AQLSKVAEERERVTKRLKELTKSGS-SAVQL---EELKEHGKSLRNELKALKQTLYPIED  138

Query  155  SVIPQVLKLPNETDKRTPI--ESPLLLKSVGEKSNFINRERHSHLDIGKNLGLLEYKNPI  212
              I   L LPN    + P+  E  LL +    KS     +  SHL   +   L+ + +  
Sbjct  139  DFIHDYLHLPNLLHVQCPVGGEEKLLYRHGIPKSE---NKTTSHLARQE---LVHFVDNN  192

Query  213  QYYLCDKAALFELEAL-ALAGEILKQSNSMRVALPDFCRSIIVEGCGMDHESSVESFMLQ  271
            +YYL ++AALF++ A+ +LA   +   + ++ A PDF R +++E     + + +  + L 
Sbjct  193  RYYLMEQAALFDVNAMQSLARYFVNHGHFIQTANPDFVRCVLLEA----NATPLSDYHL-  247

Query  272  NDTDVKEEYLVNRL---HLVGGASLPAMLAMYTKQAFKPSDFPIRIFSAGRHYT------  322
                V+EE+L N++   +L GGAS  + L   TK    PS  P+R    GR Y       
Sbjct  248  ----VQEEHLQNKINTAYLTGGASFESYLGAMTKLCVYPSVLPLRYVCCGRSYNRAEADL  303

Query  323  --PFPSSLTVQHGLFSVCQASAVQALTLVKDKDSKEYKEEFERLIEAATKIYNDIGCHYR  380
              P PS       L++  Q +AVQ    V  +   E   + E ++  AT  Y  +   +R
Sbjct  304  YGPIPS-------LYTATQTNAVQ--IFVATQTDNEADSQLEHILNLATDFYKALDIPFR  354

Query  381  VVIRPAKELNLAESMRLSFEMYSVHADQYVEIGHVSACGDYFSKRLMIACPTTTSVGYPA  440
            +    A +L  AES+R   E+Y+    +YV +G +S  GD+ SKR++ +        +  
Sbjct  355  ISYATAADLTPAESIRAVIEVYAPSLQRYVCVGRISNYGDFVSKRILFSTRREKHYDFLH  414

Query  441  AVSGTLLSVPKMLGCLIE  458
             V G +L   +++  L+E
Sbjct  415  MVGGPVLYTSRLIAALVE  432


>O18406_DROME unnamed protein product
Length=322

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 122/301 (41%), Gaps = 26/301 (9%)

Query  179  LKSVGEKSNFINRERHSHLDIGKNLGLLEYKNPIQYYLCDKAALFELEALALAGEILKQS  238
            LK   E +  +N  R  HL          Y     YYL  + A  E   +  A + + + 
Sbjct  22   LKEFSELARALNLYRMDHLG--------NYTGHKSYYLTGQLATLEQAIIQYALQAVTEH  73

Query  239  NSMRVALPDFCRSIIVEGCGMDHESSVESFMLQNDTDVKEEYLVNRLHLVGGASLPAMLA  298
                +++PD     ++E CGM  E            +  + Y ++    + G S  A+  
Sbjct  74   GFKLISVPDILPKEVIESCGMRTEG-----------ERTQVYKLDTGECLSGTSEMALAG  122

Query  299  MYTKQAFKPSDFPIRIFSAGRHYTPFPSSLTVQHGLFSVCQASAVQALTLVKDKDSKEYK  358
             +  +       P+++ +  R Y    S L  + G++ V Q + V+   +  ++ S+   
Sbjct  123  FFANKLLSEDQLPLKVTAVSRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTEEQSEAEL  182

Query  359  EEFERLIEAATKIYNDIGCHYRVVIRPAKELNLAESMRLSFEMYSVHADQYVEIGHVSAC  418
            EEF+ +      ++  +G ++R++  P  EL      +   E +      + EI   S C
Sbjct  183  EEFKNI---EVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNC  239

Query  419  GDYFSKRLMIACPTTT--SVGYPAAVSGTLLSVPKMLGCLIE--ENPDEFVTPEKLRGLF  474
             DY ++RL I    +    + +   ++GT  ++P++L  L+E  +  D    P  LR   
Sbjct  240  TDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLESYQKEDGIEIPAVLRPFM  299

Query  475  D  475
            D
Sbjct  300  D  300


>Q9VF85_DROME unnamed protein product
Length=417

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 122/301 (41%), Gaps = 26/301 (9%)

Query  179  LKSVGEKSNFINRERHSHLDIGKNLGLLEYKNPIQYYLCDKAALFELEALALAGEILKQS  238
            LK   E +  +N  R  HL          Y     YYL  + A  E   +  A + + + 
Sbjct  117  LKEFSELARALNLYRMDHLG--------NYTGHKSYYLTGQLATLEQAIIQYALQAVTEH  168

Query  239  NSMRVALPDFCRSIIVEGCGMDHESSVESFMLQNDTDVKEEYLVNRLHLVGGASLPAMLA  298
                +++PD     ++E CGM  E            +  + Y ++    + G S  A+  
Sbjct  169  GFKLISVPDILPKEVIESCGMRTEG-----------ERTQVYKLDTGECLSGTSEMALAG  217

Query  299  MYTKQAFKPSDFPIRIFSAGRHYTPFPSSLTVQHGLFSVCQASAVQALTLVKDKDSKEYK  358
             +  +       P+++ +  R Y    S L  + G++ V Q + V+   +  ++ S+   
Sbjct  218  FFANKLLSEDQLPLKVTAVSRCYRAETSGLQEEKGIYRVHQFNKVEMFAICTEEQSEAEL  277

Query  359  EEFERLIEAATKIYNDIGCHYRVVIRPAKELNLAESMRLSFEMYSVHADQYVEIGHVSAC  418
            EEF+ +      ++  +G ++R++  P  EL      +   E +      + EI   S C
Sbjct  278  EEFKNI---EVDLFRRLGLNFRLLDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNC  334

Query  419  GDYFSKRLMIACPTTT--SVGYPAAVSGTLLSVPKMLGCLIE--ENPDEFVTPEKLRGLF  474
             DY ++RL I    +    + +   ++GT  ++P++L  L+E  +  D    P  LR   
Sbjct  335  TDYQARRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLESYQKEDGIEIPAVLRPFM  394

Query  475  D  475
            D
Sbjct  395  D  395



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


Query= CFLO000025-PA

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W1E4_DROME  unnamed protein product                                 80.5    3e-16


>Q9W1E4_DROME unnamed protein product
Length=317

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 48/69 (70%), Gaps = 0/69 (0%)

Query  595  KVRFNLKPIVHTIVHWRYAHRAARRGPWEEYARDRARFQRRVMEIGTVLKPVFSTHHRER  654
            KVRFN+KP VH ++ W YA+RAAR+  W+  ARDR RFQ+R+  I  +L  V +  HR+R
Sbjct  248  KVRFNMKPEVHVMLAWDYAYRAARKSEWQVMARDRDRFQQRIRRISPILNAVLTPVHRDR  307

Query  655  IWNERFAND  663
            ++  RF ++
Sbjct  308  VYQARFLHE  316



Lambda      K        H
   0.323    0.135    0.395 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 1533981904


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 4, 2020  4:51 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= CFLO000026-PA

Length=408
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O45246_CAEEL  unnamed protein product                                 31.2    1.9  
MYOD_DICDI  unnamed protein product                                   30.0    4.5  
Q383X7_TRYB2  unnamed protein product                                 29.6    5.4  


>O45246_CAEEL unnamed protein product
Length=643

 Score = 31.2 bits (69),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 0/44 (0%)

Query  15   ELEALEKNDLISRILQLEAYNFQLKQIMEKNANVKDVQKSHSSK  58
            E E   + D IS   QLEAY FQ+KQ +E++ ++   + +  +K
Sbjct  527  EREDAAQRDRISSRNQLEAYAFQVKQALEEHGSLLSAEDAKRAK  570


>MYOD_DICDI unnamed protein product
Length=1109

 Score = 30.0 bits (66),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 9/80 (11%)

Query  5    VKKNKVLSREELEALEKNDLISRILQLEAYNFQLKQIMEKNANVKDVQKSHSSKRKFDFS  64
            +K NK   R  +E   + D I+        NF+LK I++KN N K +  +H+  +    S
Sbjct  721  MKSNKERRRLSIERPYQGDYINY-----RENFELKDIVKKNGNEK-IMFTHAVNKYDRRS  774

Query  65   KCHKRHILLK---LYYLGWE  81
            +C +R +LL    +Y++  E
Sbjct  775  RCQRRVLLLSDTAIYFIATE  794


>Q383X7_TRYB2 unnamed protein product
Length=918

 Score = 29.6 bits (65),  Expect = 5.4, Method: Compositional matrix adjust.
 Identities = 27/114 (24%), Positives = 47/114 (41%), Gaps = 18/114 (16%)

Query  1    MIKVVKKNKV---LSREELEALEKNDLISRILQLEAYNFQLKQIME--------------  43
            +I VV+K      + R    AL K D++  +  L+A N  L + +E              
Sbjct  124  VIDVVQKEHSSISICRAHFSALTKRDILGAMRNLKAPNRALSEAVEARQELDLRLGAVFT  183

Query  44   KNANVKDVQKSHSSKRKFDFSKCHKRHILLKLYYLGWEYQGFATQENTTSTIEH  97
            +   +K   +  +  +   F  C +   L  L   GWE +GF  ++  T T++H
Sbjct  184  RFQTLKFCSQFKNFPKVLSFGPC-QFPTLGFLVQRGWEQKGFVPEDYFTLTLQH  236



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000027-PA

Length=491
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q580K4_TRYB2  unnamed protein product                                 57.4    1e-08
Q38EJ5_TRYB2  unnamed protein product                                 32.0    1.2  
VPS53_CAEEL  unnamed protein product                                  30.0    5.7  


>Q580K4_TRYB2 unnamed protein product
Length=479

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 107/487 (22%), Positives = 182/487 (37%), Gaps = 80/487 (16%)

Query  23   TMSNESEIPKDDDTSFGKQAFSENQQTNKVKPVDLKNIKARVDKVHIDGLNRTKDDVVQA  82
            T S+ES +P        ++ +   +   KV  V ++        V I G+      V+  
Sbjct  2    TFSSESSVPP-------QEVYIGEEDIGKVLNVPIRT------HVRIRGIENIHPRVISR  48

Query  83   QVKELFNAKDFQDIIVNAHAVRGKLESLGCFKTIGVYIDTSQGLDSTPEGVEVTFKVHEL  142
             V+ +  +++ +DI  N +  R +   +G F  +   ++ +   +S    V +     + 
Sbjct  49   DVEAIKRSENIEDITNNMNEARTRWARMGIFSKVDFNLEPTFHGESNDVCVHIDVVEAKP  108

Query  143  KRIMGSINTMVGNNEASLLVGAKSPNLFGRGERLQVDYSYGHKNSSNINISAMK------  196
            K+  G   T     E +L +     N+ G    L   Y      +  +++S +       
Sbjct  109  KKTFGVFTTETVLPELTLSL----ENILGGRYSLSGSYVPPTSRAHAVSLSMLSNATYLG  164

Query  197  ---PFYTGRLSK-VLTASVYNTSTEFPWSGYRENDKGFLLDFAFD------SNESGTFKH  246
                +Y GR S+  +     N   +   +  R   +G L +F          +  GT   
Sbjct  165  QTGEYYLGRRSENKMYHLASNERIDEVKATTRNEKRGLLSEFTIGFQRRLLVSREGT---  221

Query  247  NLQYEGIVRDLSATKQATFKVREQCGPTLKSSLRHICTVDKRDEKIFPSYGTLVQCTTEV  306
            NL  E +++D   T +  F+           +  ++C +        P  G  +    E+
Sbjct  222  NLPDE-MLQDFRTTFKGYFRHELGVSNVWHHADPYLCGIYP-----LPIKGVQLSMKNEL  275

Query  307  AG--LGGNIGFVKNELAFQTNYSPVDSL-TFQLAAQTGFLRGINNDMHITIADNFFLGGP  363
            AG  LGG   F+K E+     Y P+    + Q  ++   +        I ++D  FL   
Sbjct  276  AGGPLGGGFNFLKTEIQ-TAKYWPLGPFCSVQWNSKVAGIWSYKR-ARIPLSDRLFLSS-  332

Query  364  MNVRGFEIRGCGP-------REEGF--SLGGNTYWAAALHFYSPLPFRPGKNTFGNLFRL  414
             +VRGF  R  GP       RE G   + GGN  WA +L    P  F P       L  +
Sbjct  333  CHVRGF--RSVGPSTVDGGVREGGHFAATGGNALWATSLSVNFPFLFFPNN----GLAAM  386

Query  415  HGFVNGGNVN--NATIKLGGTYEENLKILTENVRCTAGCGVAMKIGNI--------ARIE  464
            H F N GN+   N++ +L  TY            C A  G  + +  +         R E
Sbjct  387  HLFGNVGNLRMVNSSSELFDTYRWFRT-------CAASVGFGIVVTRVPLFGVTPNGRFE  439

Query  465  LNFCVPL  471
            LNFCVP+
Sbjct  440  LNFCVPV  446


>Q38EJ5_TRYB2 unnamed protein product
Length=346

 Score = 32.0 bits (71),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 35/142 (25%), Positives = 51/142 (36%), Gaps = 19/142 (13%)

Query  321  AFQTNYSPVDSLTFQLAAQTGFLRGINNDMHITIADNFFLGGPMNVRGFEIRGCGPREEG  380
            AF+TN + + +L   +     ++   N+DM I       L    +      R    RE+ 
Sbjct  200  AFETNRNCITALERHIEVLKEYIAESNDDMRIEALRKELLPLLESAISLHPRPTLIREKA  259

Query  381  FSLGGNTYWAAALHFYSPLPFRP-----------GKNTFGNLFRLHGFV--NGG------  421
            F L      AAAL F  PL   P           G  T   L +    +  +GG      
Sbjct  260  FLLSETLGDAAALEFLDPLICNPPPEEADAAGNVGGRTVATLLKAKAAILADGGKMQEAL  319

Query  422  NVNNATIKLGGTYEENLKILTE  443
             V  A +K   + EE   I+ E
Sbjct  320  EVAEAALKESPSDEEAKAIVAE  341


>VPS53_CAEEL unnamed protein product
Length=798

 Score = 30.0 bits (66),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 12/32 (38%), Positives = 21/32 (66%), Gaps = 0/32 (0%)

Query  291  KIFPSYGTLVQCTTEVAGLGGNIGFVKNELAF  322
            ++FP+  +L Q  + +A + G IG + NELA+
Sbjct  40   ELFPTEQSLTQLDSIIASVEGEIGELDNELAY  71



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000028-PA

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T9E6_DROME  unnamed protein product                                 374     2e-119
M9NEQ1_DROME  unnamed protein product                                 356     3e-114
Q0E8U2_DROME  unnamed protein product                                 355     7e-114


>Q8T9E6_DROME unnamed protein product
Length=766

 Score = 374 bits (961),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 252/673 (37%), Positives = 357/673 (53%), Gaps = 87/673 (13%)

Query  94   DTMDLIFENITYTV---SMGWRKG-QKEILHGLNGRLPSKQLIALMGPSGAGKSTLLDVL  149
            D +D+ F ++ YTV   S   RK   KEILHGLNG   S +L A+MGPSGAGKSTLL+V+
Sbjct  102  DPVDIQFADVRYTVKKFSFPERKFVTKEILHGLNGSFRSGELTAIMGPSGAGKSTLLNVM  161

Query  150  SGYRITGVQGVVYVNGR--VRNLDSFRRHSAYITQDDRLQLLLTVLENMRVAADLKLGTD  207
            SG+  TGV G + VN +    + + FR+   YI QDD L+  L V E M +AA LKLG  
Sbjct  162  SGFCSTGVSGDIRVNRKPMAPSSERFRQMLCYIHQDDLLRPQLLVGEIMLLAAHLKLGFK  221

Query  208  TPKHVKETVIEEILSTLGLYEHMYTM-AGRLSGGQRKRLSIALELVNNPTVLFLDEPTTG  266
              K  K  +I+ ILS LGL +H Y +  G+LSGGQ+KRL+IALEL++NP VL+LDEPTTG
Sbjct  222  VTKAYKMDLIKHILSLLGL-DHRYNVPTGKLSGGQKKRLAIALELISNPPVLYLDEPTTG  280

Query  267  LDSSSCTQVVNLLKVLARQGRTIICTIHQPSATMFQLFDQVYVLSNGECLYQGATHNLLP  326
            LDSSSC+  V LLK LA QG TI+CTIHQPSA +F++FD++Y + +G C+YQG    L+P
Sbjct  281  LDSSSCSSCVALLKKLASQGHTIVCTIHQPSALIFEMFDKLYTVVDGHCMYQGPVRELVP  340

Query  327  YLESVKLPCPMYHNPADY---------------VIELACGEYGED-------------KI  358
            +L   +L CP YHNPADY               +I  A  +Y ED             ++
Sbjct  341  FLADQQLVCPSYHNPADYLLEVAVGEHQRDLNELIHAANKKYYEDVDRHRYMSSDDMARL  400

Query  359  EPLVQGSQNGKNL-----------------KWFDNPS----ALLDTKSL----RALNP-L  392
               ++ +  GK +                   +  PS    AL + K+L     + +P L
Sbjct  401  VESIKENMGGKAVVKTSEALAAFAAAQFSSFDYVKPSPQELALEEIKALSGGPESADPDL  460

Query  393  KEKNGNTQGHQPTSQ----------------LHQMSVLMRRCCIKVKRDTTLTHMRIIVN  436
             EKN   Q  QP ++                L Q  +LM+R  I  KR+  L   RI  +
Sbjct  461  LEKNLRPQP-QPLAKAGELARPPNAIRSASFLMQYVLLMQRILICAKRNYFLLLARIFSH  519

Query  437  VCTGIMLGLLFIKAGNDANRVLENYNLLFACLMHHMMTTMMLTVLTFPTEMSVLQKEHFN  496
            +  G++ G L++  GN+A  VL NY  L+   +  + T  M  VLTFP E+ +L +EHFN
Sbjct  520  IFIGVVFGYLYMNVGNNAQSVLGNYVYLYGSTLLLVYTGKMAVVLTFPLEIDMLTREHFN  579

Query  497  RWYSLKAYYLSVSIVDIPVMFISCLLFSSIVYFMSDQPVDPWARFSMFFSISLLVAAVAQ  556
            RWY L  Y+LS+   +IP   +   ++  I   ++        R   F  + ++ +  AQ
Sbjct  580  RWYKLGPYFLSLISFEIPFQSLCTAMYIIISVHLTGNDATDSFRIYYFMLLGIMASLSAQ  639

Query  557  SFGLMIGSVCNVVNGTFLAPTLSVPMMMFAGFGVSLR--DLPSYLKWGSYISYLRYGLEG  614
            ++G  +G+        FL P L+V   MF+ FG   R  D+    +W  ++SY R G  G
Sbjct  640  AWGFFVGATLPTKLAVFLGPILAV---MFSVFGFCTRYIDITPLFRWMWHLSYFRAGFHG  696

Query  615  YVNAIYGLDRKPLDCVNEDFDFCLFKKTKKFVSDVTSMRDDQFWNDIAALACILVILRFA  674
             +NAIYG+DR  L+C  E   +C F+  K F+  +  M  D   +D   L  I++ +   
Sbjct  697  ALNAIYGMDRPFLEC-PETAMYCHFRSPKVFLKYM--MISDVHMSDCLILMGIVIGVMHV  753

Query  675  AYFFLRWRLMSSR  687
                  W  ++ R
Sbjct  754  LTLITLWHKLNKR  766


>M9NEQ1_DROME unnamed protein product
Length=608

 Score = 356 bits (914),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 203/572 (35%), Positives = 333/572 (58%), Gaps = 7/572 (1%)

Query  92   KTDTMDLIFENITYTVSMGWRKGQKEILHGLNGRLPSKQLIALMGPSGAGKSTLLDVLSG  151
            K   ++L F  ++Y++  G  KG   I++   G   S +L A++GPSGAGKSTLL+ L+G
Sbjct  17   KQKALELHFSQVSYSLK-GATKGSTPIINEACGVFKSGRLTAILGPSGAGKSTLLNALAG  75

Query  152  YRITGVQGVVYVNGRVRNLDSFRRHSAYITQDDRLQLLLTVLENMRVAADLKLGTDTPKH  211
            +++ GV G   +NGR R++ SFR+ SAYI Q+  +  LLTV E +RV+ DLK+ + T   
Sbjct  76   FKLQGVTGQFLLNGRPRDIMSFRKMSAYIAQNFVMLNLLTVEETLRVSTDLKMPSSTAAQ  135

Query  212  VKETVIEEILSTLGLYEHMYTMAGRLSGGQRKRLSIALELVNNPTVLFLDEPTTGLDSSS  271
             K+ +I++I+  L L     T+   LSGG+ KRLSI +ELV NP ++F DEPT+GLD   
Sbjct  136  EKQKIIDDIIDILQLQSCRRTLVKNLSGGEHKRLSIGIELVTNPPIMFFDEPTSGLDCVG  195

Query  272  CTQVVNLLKVLARQGRTIICTIHQPSATMFQLFDQVYVLSNGECLYQGATHNLLPYLESV  331
              QV+  L+ LA  GR ++C +HQP + +FQLFD V VL++GE LY G    +LP     
Sbjct  196  SYQVICHLQRLAHDGRIVVCVVHQPGSRLFQLFDDVLVLAHGEVLYAGEQREMLPTFAQS  255

Query  332  KLPCPMYHNPADYVIELACGEYGEDKIEPLVQGSQNGKNLKWFDNPSAL-LDTKSLRALN  390
               CP Y+NPAD+ +E+       ++ E L+  +QN        N   L +D ++L  ++
Sbjct  256  GHICPQYYNPADFALEVCSQSSTTERCESLI--TQNKMMHSTASNVVKLQVDEETLIDVH  313

Query  391  PLKEKNGNTQGHQPTSQLHQMSVLMRRCCIKVKRDTTLTHMRIIVNVCTGIMLGLLFIKA  450
                   + +G +      Q+SVL+RR    + RD     MR++++V   ++LG+++ + 
Sbjct  314  KDALDLSHLRGKEQVGFWTQLSVLLRRHLRSMSRDMFAVQMRLVMHVVVALLLGVVYWQI  373

Query  451  GNDANRVLENYNLLFACLMHHMMTTMMLTVLTFPTEMSVLQKEHFNRWYSLKAYYLSVSI  510
            G DA +++ N + LF  ++       M ++L    + +V  +E++N WYSL AYYLS  +
Sbjct  374  GGDAQKIVSNVSCLFFVILFVFAGNAMPSILLCMQDSAVFIREYYNGWYSLGAYYLSKVL  433

Query  511  VDIPVMFISCLLFSSIVYFMSDQPVDPWARFSMFFSISLLVAAVAQSFGLMIGSVCNVVN  570
             D+P+      +F SI YFM+ QP + + RF+M +++ ++ A +    G++ GS+  +  
Sbjct  434  ADLPLQLTCPTMFISIGYFMTGQPPE-FQRFAMCWALCVMTAFIGHFIGVIAGSLFTMQL  492

Query  571  GTFLAPTLSVPMMMFAGFGVSLRDLPSYLKWGSYISYLRYGLEGYVNAIYGLDRKPLDCV  630
              FL P+ ++P ++F+GF + L +L  +L+    +S+ RY  EG + AIYG DR  L+C 
Sbjct  493  AIFLVPSATIPFLLFSGFFIRLNELSWFLRPICDVSFFRYIFEGLMRAIYGYDRGELECY  552

Query  631  NEDFDFCLFKKTKKFVSDVTSMRDDQFWNDIA  662
                +FC ++  ++F+ D   M  ++F  D+A
Sbjct  553  ATS-NFCYYRTAEQFLKDF-QMEGNEFDWDMA  582


>Q0E8U2_DROME unnamed protein product
Length=609

 Score = 355 bits (912),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 206/579 (36%), Positives = 335/579 (58%), Gaps = 20/579 (3%)

Query  92   KTDTMDLIFENITYTVSMGWRKGQKEILHGLNGRLPSKQLIALMGPSGAGKSTLLDVLSG  151
            K   ++L F  ++Y++  G  KG   I++   G   S +L A++GPSGAGKSTLL+ L+G
Sbjct  17   KQKALELHFSQVSYSLK-GATKGSTPIINEACGVFKSGRLTAILGPSGAGKSTLLNALAG  75

Query  152  YRITGVQGVVYVNGRVRNLDSFRRHSAYITQDDRLQLLLTVLENMRVAADLKLGTDTPKH  211
            +++ GV G   +NGR R++ SFR+ SAYI Q+  +  LLTV E +RV+ DLK+ + T   
Sbjct  76   FKLQGVTGQFLLNGRPRDIMSFRKMSAYIAQNFVMLNLLTVEETLRVSTDLKMPSSTAAQ  135

Query  212  VKETVIEEILSTLGLYEHMYTMAGRLSGGQRKRLSIALELVNNPTVLFLDEPTTGLDSSS  271
             K+ +I++I+  L L     T+   LSGG+ KRLSI +ELV NP ++F DEPT+GLD   
Sbjct  136  EKQKIIDDIIDILQLQSCRRTLVKNLSGGEHKRLSIGIELVTNPPIMFFDEPTSGLDCVG  195

Query  272  CTQVVNLLKVLARQGRTIICTIHQPSATMFQLFDQVYVLSNGECLYQGATHNLLPYLESV  331
              QV+  L+ LA  GR ++C +HQP + +FQLFD V VL++GE LY G    +LP     
Sbjct  196  SYQVICHLQRLAHDGRIVVCVVHQPGSRLFQLFDDVLVLAHGEVLYAGEQREMLPTFAQS  255

Query  332  KLPCPMYHNPADYVIELACGEYGEDKIEPLVQGSQ-------NGKNLKWFDNPSALLDT-  383
               CP Y+NPAD+ +E+       ++ E L+  ++       N   L+  D  +AL+D  
Sbjct  256  GHICPQYYNPADFALEVCSQSSTTERCESLITQNKMMHSTASNVVKLQ-VDEETALIDVH  314

Query  384  KSLRALNPLKEKNGNTQGHQPTSQLHQMSVLMRRCCIKVKRDTTLTHMRIIVNVCTGIML  443
            K    L+ L+       G +      Q+SVL+RR    + RD     MR++++V   ++L
Sbjct  315  KDALDLSHLR-------GKEQVGFWTQLSVLLRRHLRSMSRDMFAVQMRLVMHVVVALLL  367

Query  444  GLLFIKAGNDANRVLENYNLLFACLMHHMMTTMMLTVLTFPTEMSVLQKEHFNRWYSLKA  503
            G+++ + G DA +++ N + LF  ++       M ++L    + +V  +E++N WYSL A
Sbjct  368  GVVYWQIGGDAQKIVSNVSCLFFVILFVFAGNAMPSILLCMQDSAVFIREYYNGWYSLGA  427

Query  504  YYLSVSIVDIPVMFISCLLFSSIVYFMSDQPVDPWARFSMFFSISLLVAAVAQSFGLMIG  563
            YYLS  + D+P+      +F SI YFM+ QP + + RF+M +++ ++ A +    G++ G
Sbjct  428  YYLSKVLADLPLQLTCPTMFISIGYFMTGQPPE-FQRFAMCWALCVMTAFIGHFIGVIAG  486

Query  564  SVCNVVNGTFLAPTLSVPMMMFAGFGVSLRDLPSYLKWGSYISYLRYGLEGYVNAIYGLD  623
            S+  +    FL P+ ++P ++F+GF + L +L  +L+    +S+ RY  EG + AIYG D
Sbjct  487  SLFTMQLAIFLVPSATIPFLLFSGFFIRLNELSWFLRPICDVSFFRYIFEGLMRAIYGYD  546

Query  624  RKPLDCVNEDFDFCLFKKTKKFVSDVTSMRDDQFWNDIA  662
            R  L+C     +FC ++  ++F+ D   M  ++F  D+A
Sbjct  547  RGELECYATS-NFCYYRTAEQFLKDF-QMEGNEFDWDMA  583



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000029-PA

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8U2_DROME  unnamed protein product                                 278     3e-86
M9NEQ1_DROME  unnamed protein product                                 278     3e-86
Q9VQY4_DROME  unnamed protein product                                 244     9e-72


>Q0E8U2_DROME unnamed protein product
Length=609

 Score = 278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/390 (40%), Positives = 228/390 (58%), Gaps = 10/390 (3%)

Query  97   SPKDHDDASRNAIVISLLSFMARQGCTVACVVHQPSSRMTQSFDDLMIMNQGRCAYCGPR  156
             P    D   +  VI  L  +A  G  V CVVHQP SR+ Q FDD++++  G   Y G +
Sbjct  186  EPTSGLDCVGSYQVICHLQRLAHDGRIVVCVVHQPGSRLFQLFDDVLVLAHGEVLYAGEQ  245

Query  157  DKVLDHFRASGYVCPDFYNLSEFLLEVVTGQRGGDYELTSGGKTSADRTESTAADDDKL-  215
             ++L  F  SG++CP +YN ++F LEV +  +    E      T      STA++  KL 
Sbjct  246  REMLPTFAQSGHICPQYYNPADFALEVCS--QSSTTERCESLITQNKMMHSTASNVVKLQ  303

Query  216  ----SQVSSVRSWGEEIFMPERHYAVSSWEQHKVLLRRAFICISRDNTLTKMRLSAHLIV  271
                + +  V     ++        V  W Q  VLLRR    +SRD    +MRL  H++V
Sbjct  304  VDEETALIDVHKDALDLSHLRGKEQVGFWTQLSVLLRRHLRSMSRDMFAVQMRLVMHVVV  363

Query  272  AVLLGLVFYDFGEDASKVQSNVAALFFFALFLFFANAMPAVQTFPSETRVFLRENANNWY  331
            A+LLG+V++  G DA K+ SNV+ LFF  LF+F  NAMP++     ++ VF+RE  N WY
Sbjct  364  ALLLGVVYWQIGGDAQKIVSNVSCLFFVILFVFAGNAMPSILLCMQDSAVFIREYYNGWY  423

Query  332  SLESYYVTKVLSDLPLQIVCPTGFLLVAYYLTGQPLEAARFFQVWMICILTTILAQSFGI  391
            SL +YY++KVL+DLPLQ+ CPT F+ + Y++TGQP E  RF   W +C++T  +    G+
Sbjct  424  SLGAYYLSKVLADLPLQLTCPTMFISIGYFMTGQPPEFQRFAMCWALCVMTAFIGHFIGV  483

Query  392  ATGAAFSTHAGTFLVPAFNIPMFLFAGFFLKLGEIPFYLQFFSDVSYFRYAFEGLLQAVY  451
              G+ F+     FLVP+  IP  LF+GFF++L E+ ++L+   DVS+FRY FEGL++A+Y
Sbjct  484  IAGSLFTMQLAIFLVPSATIPFLLFSGFFIRLNELSWFLRPICDVSFFRYIFEGLMRAIY  543

Query  452  -LGRPKIPCYA--DFCYLRTPDRILGELGM  478
               R ++ CYA  +FCY RT ++ L +  M
Sbjct  544  GYDRGELECYATSNFCYYRTAEQFLKDFQM  573


 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 1/87 (1%)

Query  11   ILHNVSGEFRAGRLTAILGPSGSGKTTLLSLIACRRNNCKINNPNANDRP-ETTTTRMSA  69
            I++   G F++GRLTAILGPSG+GK+TLL+ +A  +          N RP +  + R  +
Sbjct  42   IINEACGVFKSGRLTAILGPSGAGKSTLLNALAGFKLQGVTGQFLLNGRPRDIMSFRKMS  101

Query  70   CYVPQEFELMPFLTTRETIYIASRLKL  96
             Y+ Q F ++  LT  ET+ +++ LK+
Sbjct  102  AYIAQNFVMLNLLTVEETLRVSTDLKM  128


>M9NEQ1_DROME unnamed protein product
Length=608

 Score = 278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 155/389 (40%), Positives = 227/389 (58%), Gaps = 9/389 (2%)

Query  97   SPKDHDDASRNAIVISLLSFMARQGCTVACVVHQPSSRMTQSFDDLMIMNQGRCAYCGPR  156
             P    D   +  VI  L  +A  G  V CVVHQP SR+ Q FDD++++  G   Y G +
Sbjct  186  EPTSGLDCVGSYQVICHLQRLAHDGRIVVCVVHQPGSRLFQLFDDVLVLAHGEVLYAGEQ  245

Query  157  DKVLDHFRASGYVCPDFYNLSEFLLEVVTGQRGGDYELTSGGKTSADRTESTAADDDKLS  216
             ++L  F  SG++CP +YN ++F LEV +  +    E      T      STA++  KL 
Sbjct  246  REMLPTFAQSGHICPQYYNPADFALEVCS--QSSTTERCESLITQNKMMHSTASNVVKLQ  303

Query  217  ----QVSSVRSWGEEIFMPERHYAVSSWEQHKVLLRRAFICISRDNTLTKMRLSAHLIVA  272
                 +  V     ++        V  W Q  VLLRR    +SRD    +MRL  H++VA
Sbjct  304  VDEETLIDVHKDALDLSHLRGKEQVGFWTQLSVLLRRHLRSMSRDMFAVQMRLVMHVVVA  363

Query  273  VLLGLVFYDFGEDASKVQSNVAALFFFALFLFFANAMPAVQTFPSETRVFLRENANNWYS  332
            +LLG+V++  G DA K+ SNV+ LFF  LF+F  NAMP++     ++ VF+RE  N WYS
Sbjct  364  LLLGVVYWQIGGDAQKIVSNVSCLFFVILFVFAGNAMPSILLCMQDSAVFIREYYNGWYS  423

Query  333  LESYYVTKVLSDLPLQIVCPTGFLLVAYYLTGQPLEAARFFQVWMICILTTILAQSFGIA  392
            L +YY++KVL+DLPLQ+ CPT F+ + Y++TGQP E  RF   W +C++T  +    G+ 
Sbjct  424  LGAYYLSKVLADLPLQLTCPTMFISIGYFMTGQPPEFQRFAMCWALCVMTAFIGHFIGVI  483

Query  393  TGAAFSTHAGTFLVPAFNIPMFLFAGFFLKLGEIPFYLQFFSDVSYFRYAFEGLLQAVY-  451
             G+ F+     FLVP+  IP  LF+GFF++L E+ ++L+   DVS+FRY FEGL++A+Y 
Sbjct  484  AGSLFTMQLAIFLVPSATIPFLLFSGFFIRLNELSWFLRPICDVSFFRYIFEGLMRAIYG  543

Query  452  LGRPKIPCYA--DFCYLRTPDRILGELGM  478
              R ++ CYA  +FCY RT ++ L +  M
Sbjct  544  YDRGELECYATSNFCYYRTAEQFLKDFQM  572


 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 1/87 (1%)

Query  11   ILHNVSGEFRAGRLTAILGPSGSGKTTLLSLIACRRNNCKINNPNANDRP-ETTTTRMSA  69
            I++   G F++GRLTAILGPSG+GK+TLL+ +A  +          N RP +  + R  +
Sbjct  42   IINEACGVFKSGRLTAILGPSGAGKSTLLNALAGFKLQGVTGQFLLNGRPRDIMSFRKMS  101

Query  70   CYVPQEFELMPFLTTRETIYIASRLKL  96
             Y+ Q F ++  LT  ET+ +++ LK+
Sbjct  102  AYIAQNFVMLNLLTVEETLRVSTDLKM  128


>Q9VQY4_DROME unnamed protein product
Length=832

 Score = 244 bits (623),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 117/277 (42%), Positives = 170/277 (61%), Gaps = 1/277 (0%)

Query  235  YAVSSWEQHKVLLRRAFICISRDNTLTKMRLSAHLIVAVLLGLVFYDFGEDASKVQSNVA  294
            +  S W Q  +LL+R+F  I RD  LT MRL +H+IV  ++G+++YD G +ASK+ SN  
Sbjct  553  FPTSGWTQFWILLKRSFRTILRDKMLTHMRLFSHVIVGAIIGMIYYDVGNEASKIMSNAG  612

Query  295  ALFFFALFLFFANAMPAVQTFPSETRVFLRENANNWYSLESYYVTKVLSDLPLQIVCPTG  354
             +FF +LF  F   MP + TFP+E  VF+RE+ N WYSL+++Y  K ++D+P QIV  + 
Sbjct  613  CIFFVSLFTTFTAMMPTILTFPTEMSVFVREHLNYWYSLKAFYFAKTIADMPFQIVFSSV  672

Query  355  FLLVAYYLTGQPLEAARFFQVWMICILTTILAQSFGIATGAAFSTHAGTFLVPAFNIPMF  414
            ++LV YYLT QP+E  R     +IC+L +++AQS G+  GA  +   G FL P   IP  
Sbjct  673  YVLVVYYLTSQPMELERVSMFVLICVLNSLVAQSLGLLIGAGMNIETGVFLGPVTTIPTI  732

Query  415  LFAGFFLKLGEIPFYLQFFSDVSYFRYAFEGLLQAVY-LGRPKIPCYADFCYLRTPDRIL  473
            LF+GFF+    IP YLQ+ + VSY RY FEG + A+Y + R K+ C   +C+ R P + L
Sbjct  733  LFSGFFVNFDTIPGYLQWVTYVSYVRYGFEGAMVAIYGMDRAKMQCNQMYCHYRVPKKFL  792

Query  474  GELGMPSMPLHATLIALVVWIVGLHSLVYGVLRYKLR  510
             E+ M +       +AL+     L  + Y VLR+KL 
Sbjct  793  EEMSMDNALFWVDAVALIGIFFALRIIAYFVLRWKLH  829


 Score = 104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 117/244 (48%), Gaps = 66/244 (27%)

Query  8    WKEILHNVSGEFRAGRLTAILGPSGSGKTTLLSLIACRRN-----NCKINNPNANDRPET  62
            +K IL +VSG+FR G +TAI+GPSG+GK+TL++++A  +      +  IN+   N R   
Sbjct  162  FKTILKSVSGKFRNGEITAIMGPSGAGKSTLMNILAGYKTAQLSGSVLINSKERNLR---  218

Query  63   TTTRMSACYVPQEFELMPFLTTR----------------------------ETIYI----  90
               R  +CY+ Q+  L+  LT R                            ETI +    
Sbjct  219  -RFRKLSCYIMQDDVLIANLTVREAMMVAANLKLGKNMISYAKVVVVEEILETIGLKESV  277

Query  91   ---------ASRLKLS----------------PKDHDDASRNAIVISLLSFMARQGCTVA  125
                       R +LS                P    D+S    +ISLL  +AR G T+ 
Sbjct  278  NTLTCNLSGGQRKRLSIALELVNNPPVMFFDEPTSGLDSSTCFQLISLLRSLARGGRTIV  337

Query  126  CVVHQPSSRMTQSFDDLMIMNQGRCAYCGPRDKVLDHFRASGYVCPDFYNLSEFLLEVVT  185
            C +HQPS+R+ + FD L ++ QG+C Y G    ++ +  + GY CP ++N ++++LEV +
Sbjct  338  CTIHQPSARLFEKFDHLYLLAQGQCVYEGRVKGLVPYLSSLGYECPSYHNPADYVLEVAS  397

Query  186  GQRG  189
            G+ G
Sbjct  398  GEYG  401



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000030-PA

Length=81
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SWY9_DROME  unnamed protein product                                 30.4    0.092
Q8IR93_DROME  unnamed protein product                                 30.4    0.11 
M9PG56_DROME  unnamed protein product                                 30.4    0.12 


>Q8SWY9_DROME unnamed protein product
Length=469

 Score = 30.4 bits (67),  Expect = 0.092, Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  29   TAETPLRQQDNVENKDGIEINKIPTTPLADGPR  61
            T   PLR+  N+ +++ I  ++IP TP    PR
Sbjct  377  TKNPPLRKTRNITSQNSINWHQIPATPTPPSPR  409


>Q8IR93_DROME unnamed protein product
Length=398

 Score = 30.4 bits (67),  Expect = 0.11, Method: Composition-based stats.
 Identities = 18/67 (27%), Positives = 30/67 (45%), Gaps = 3/67 (4%)

Query  2    KEGEEKSGEETEKCAAMEECTTEADDCTAETPLRQQDNVENKDGIEINKIPTTPLADGPR  61
            +E E ++ +E    A  +E   + D    E+PLR Q    NK G    + P T     P+
Sbjct  252  REAEVQTEDEQAFLARQQEILKQGDQVRGESPLRSQGVGSNKSG---PRTPGTTGQSSPK  308

Query  62   QFDVQFS  68
            + D + +
Sbjct  309  KIDPKLT  315


>M9PG56_DROME unnamed protein product
Length=848

 Score = 30.4 bits (67),  Expect = 0.12, Method: Composition-based stats.
 Identities = 12/33 (36%), Positives = 19/33 (58%), Gaps = 0/33 (0%)

Query  29   TAETPLRQQDNVENKDGIEINKIPTTPLADGPR  61
            T   PLR+  N+ +++ I  ++IP TP    PR
Sbjct  756  TKNPPLRKTRNITSQNSINWHQIPATPTPPSPR  788



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000031-PA

Length=579
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GALT7_DROME  unnamed protein product                                  792     0.0   
GALT5_CAEEL  unnamed protein product                                  380     1e-124
GALT6_DROME  unnamed protein product                                  363     9e-118


>GALT7_DROME unnamed protein product
Length=591

 Score = 792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/538 (69%), Positives = 436/538 (81%), Gaps = 2/538 (0%)

Query  44   ENLKGKKSYAPVLTKGMGNFE-VEIKHKTGPGEGGKAHTLREDQQNDVQESEASYGMNIA  102
            + L+G+    P L  G+GNFE  ++K ++GPGE G+AH+L  D+++    SE  YGMNIA
Sbjct  54   QRLEGRPREVPKLVDGLGNFEPKDVKPRSGPGENGEAHSLSPDKKHMSDASEMEYGMNIA  113

Query  103  CSDEIAFDRNIPDLRPAECKHWNYSEDLPKTSVIIVFHNEGWSVLLRTVHSVINRTPPQF  162
            CSDEI+  R++ D R  EC+HW+Y  DLP+TSVIIVFHNEG+SVL+RTVHSVI+R+P   
Sbjct  114  CSDEISMHRSVRDTRLEECRHWDYPFDLPRTSVIIVFHNEGFSVLMRTVHSVIDRSPTHM  173

Query  163  LEEVLLVDDYSDKENLKSNLDTYIELWEGKVRLIRNTERQGLIRTRSRGAREARGEVIVF  222
            L E++LVDD+SDKENL+S LD Y+  ++G V++IRN ER+GLIRTRSRGA EA GEVIVF
Sbjct  174  LHEIILVDDFSDKENLRSQLDEYVLQFKGLVKVIRNKEREGLIRTRSRGAMEATGEVIVF  233

Query  223  LDAHCEVNVNWLPPLLAPIAENSNVMTVPVIDGIDHKTFEYKTVYQEGHLYRGIFEWGML  282
            LDAHCEVN NWLPPLLAPI  +  VMTVP+IDGIDHK FEY+ VY   + +RGIFEWGML
Sbjct  234  LDAHCEVNTNWLPPLLAPIYRDRTVMTVPIIDGIDHKNFEYRPVYGTDNHFRGIFEWGML  293

Query  283  YKENELPTKEVRSRKHSSMPYRSPTHAGGLFAINRKYFLSLGGYDEGLLVWGGENFELSF  342
            YKENE+P +E R R H+S PYRSPTHAGGLFAINR+YFL LG YD GLLVWGGENFELSF
Sbjct  294  YKENEVPRREQRRRAHNSEPYRSPTHAGGLFAINREYFLELGAYDPGLLVWGGENFELSF  353

Query  343  KIWQCGGMILWVPCSHVGHVYRGFMPYNFGNLAQKKKGPLITINYKRVIETWFDEEYKKY  402
            KIWQCGG I WVPCS VGHVYRGFMPYNFG LA KKKGPLITINYKRVIETWFD+ +K+Y
Sbjct  354  KIWQCGGSIEWVPCSRVGHVYRGFMPYNFGKLASKKKGPLITINYKRVIETWFDDTHKEY  413

Query  403  FYTREPLATLLDHGDISEQLEFKKRKKCKSFQWYMDNVAYDVFDKFPKLPGNIKWGELKN  462
            FYTREPLA  LD GDISEQL  KKR  CKSFQW+MD++AYDV+DKFP LP N+ WGEL++
Sbjct  414  FYTREPLARYLDMGDISEQLALKKRLNCKSFQWFMDHIAYDVYDKFPGLPANLHWGELRS  473

Query  463  VATQQCLDTMNHAPPSLMAVSPCHGYGNNQLIRLNTKGQLGVGERCIEADGQGIKLVVCR  522
            VA+  CLD+M H PP++M ++ CHG GNNQL+RLN  GQLGVGERC+EAD QGIKL VCR
Sbjct  474  VASDGCLDSMGHQPPAIMGLTYCHGGGNNQLVRLNAAGQLGVGERCVEADRQGIKLAVCR  533

Query  523  LGTVDGPWEYKD-SNTLHHRVHNKCVALHPQTYHLSLMPCDFNNAYQQWTFESINPHW  579
            LGTVDGPW+Y + +  L HRVH KC+ALHP T  LSL  CD N++YQQW F+ I P W
Sbjct  534  LGTVDGPWQYNEHTKHLMHRVHKKCMALHPATQQLSLGHCDVNDSYQQWWFKEIRPRW  591


>GALT5_CAEEL unnamed protein product
Length=626

 Score = 380 bits (977),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 210/515 (41%), Positives = 299/515 (58%), Gaps = 26/515 (5%)

Query  74   GEGGKAHTLREDQQNDVQESEASYGM-----NIACSDEIAFDRNIPDLRPAECKHWNYSE  128
            GE GKA  + + + +  ++++   GM     N   SD I+  R +P    AECK   Y+E
Sbjct  113  GELGKAVVVDKTKLSTEEKAKYDKGMLNNAFNQYASDMISVHRTLPTNIDAECKTEKYNE  172

Query  129  DLPKTSVIIVFHNEGWSVLLRTVHSVINRTPPQFLEEVLLVDDYSDKENLKSNLDTYIEL  188
            +LP+TSVII FHNE WSVLLRTVHSV+ RTP   LEEV+LVDD+SD ++ K  L+ Y+  
Sbjct  173  NLPRTSVIICFHNEAWSVLLRTVHSVLERTPDHLLEEVVLVDDFSDMDHTKRPLEEYMSQ  232

Query  189  WEGKVRLIRNTERQGLIRTRSRGAREARGEVIVFLDAHCEVNVNWLPPLLAPIAENSNVM  248
            + GKV+++R  +R+GLIR R RGA  A GEV+ +LD+HCE    W+ PLL  I  +   +
Sbjct  233  FGGKVKILRMEKREGLIRARLRGAAVATGEVLTYLDSHCECMEGWMEPLLDRIKRDPTTV  292

Query  249  TVPVIDGIDHKTFEYKTVYQEGHLYR-GIFEWGMLYKENELPTKEVRSRKHSSMPYRSPT  307
              PVID ID  TFEY   + + +    G F+WG+ +  + +P ++ ++R     P RSPT
Sbjct  293  VCPVIDVIDDNTFEYH--HSKAYFTSVGGFDWGLQFNWHSIPERDRKNRTRPIDPVRSPT  350

Query  308  HAGGLFAINRKYFLSLGGYDEGLLVWGGENFELSFKIWQCGGMILWVPCSHVGHVYRGFM  367
             AGGLF+I++KYF  LG YD G  +WGGEN ELSFKIW CGG +  VPCSHVGHV+R   
Sbjct  351  MAGGLFSIDKKYFEKLGTYDPGFDIWGGENLELSFKIWMCGGTLEIVPCSHVGHVFRKRS  410

Query  368  PYNFGNLAQKKKGPLITINYKRVIETWFDEEYKKYFYTREPLATLLDHGDISEQLEFKKR  427
            PY +          ++  N  R+ E W D +YK Y+Y R     L D GDIS + + ++ 
Sbjct  411  PYKWRTGVN-----VLKRNSIRLAEVWLD-DYKTYYYERIN-NQLGDFGDISSRKKLRED  463

Query  428  KKCKSFQWYMDNVAYDVFDKFPKLPG-NIKWGELKNVATQ--QCLDTM--NHAPPSLMAV  482
              CKSF+WY+DN+  ++F     +PG ++  GE++N A Q  +CLD M   H     +  
Sbjct  464  LGCKSFKWYLDNIYPELF-----VPGESVAKGEVRNSAVQPARCLDCMVGRHEKNRPVGT  518

Query  483  SPCHGYGNNQLIRLNTKGQLGVGERCIEADGQGIKLVVCRLGTVDGPWEYK-DSNTLHHR  541
              CHG G NQ   L+  G++   E C++  G  + +  C     +  W Y  D+  L H 
Sbjct  519  YQCHGQGGNQYWMLSKDGEIRRDESCVDYAGSDVMVFPCHGMKGNQEWRYNHDTGRLQHA  578

Query  542  VHNKCVALHPQTYHLSLMPCDFNNAYQQWTFESIN  576
            V  KC+ +      L ++ C +++ YQ W F+  N
Sbjct  579  VSQKCLGMTKDGAKLEMVACQYDDPYQHWKFKEYN  613


>GALT6_DROME unnamed protein product
Length=666

 Score = 363 bits (933),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 215/523 (41%), Positives = 301/523 (58%), Gaps = 27/523 (5%)

Query  70   KTGPGEGGKAHTLREDQQNDVQESEA-SYGMNIACSDEIAFDRNIPDLRPAECKHWNYSE  128
            + G GEGGKA TL ++ Q D+++  +   G N   SD I+ +R++PD+R   C+   Y  
Sbjct  140  RVGLGEGGKASTLDDESQRDLEKRMSLENGFNALLSDSISVNRSVPDIRHPLCRKKEYVA  199

Query  129  DLPKTSVIIVFHNEGWSVLLRTVHSVINRTPPQFLEEVLLVDDYSDKENLKSNLDTYIEL  188
             LP  SVII+F+NE  SVL+R+VHS+INR+PP+ ++E++LVDD+SD+E L   L+TYI  
Sbjct  200  KLPTVSVIIIFYNEYLSVLMRSVHSLINRSPPELMKEIILVDDHSDREYLGKELETYIAE  259

Query  189  WEGKVRLIRNTERQGLIRTRSRGAREARGEVIVFLDAHCEVNVNWLPPLLAPIAENSNVM  248
                VR++R   R GLI  R+ GAR A  EV++FLD+H E N NWLPPLL PIA N    
Sbjct  260  HFKWVRVVRLPRRTGLIGARAAGARNATAEVLIFLDSHVEANYNWLPPLLEPIALNKRTA  319

Query  249  TVPVIDGIDHKTFEYKTVYQEGHLYRGIFEWGMLYKENELPTKEVRSRKHSSMPYRSPTH  308
              P ID IDH  F Y+    EG   RG F+W   YK   L  +++   KH + P++SP  
Sbjct  320  VCPFIDVIDHTNFHYRA-QDEGA--RGAFDWEFFYKRLPLLPEDL---KHPADPFKSPIM  373

Query  309  AGGLFAINRKYFLSLGGYDEGLLVWGGENFELSFKIWQCGGMILWVPCSHVGHVYRGFMP  368
            AGGLFAI+R++F  LGGYDEGL +WGGE +ELSFKIW CGG +   PCS +GH+YRG  P
Sbjct  374  AGGLFAISREFFWELGGYDEGLDIWGGEQYELSFKIWMCGGEMYDAPCSRIGHIYRG--P  431

Query  369  YNFGNLAQKKKGPLITINYKRVIETWFDEEYKKYFYTR-EPLATLLDHGDISEQLEFKKR  427
             N  +    +KG  +  NYKRV E W D EYK Y Y+  + L   +D GD++EQ   + +
Sbjct  432  RN--HQPSPRKGDYLHKNYKRVAEVWMD-EYKNYLYSHGDGLYESVDPGDLTEQKAIRTK  488

Query  428  KKCKSFQWYMDNVAYDVFDKFPKL-PGNIKWGELKNVATQQ-CLDTMNHAPPSLMAVSPC  485
              CKSF+W+M+ VA+D+   +P + P +   G L+NV  Q  CLDT+     + M +  C
Sbjct  489  LNCKSFKWFMEEVAFDLMKTYPPVDPPSYAMGALQNVGNQNLCLDTLGRKKHNKMGMYAC  548

Query  486  HGY----GNNQLIRLNTKGQLGVGER--CIEAD----GQGIKLVVCRLGTVDGPW--EYK  533
                      Q   L+ K  L +  +  C++         + L  C     +  W  +Y+
Sbjct  549  ADNIKTPQRTQFWELSWKRDLRLRRKKECLDVQIWDANAPVWLWDCHSQGGNQYWYYDYR  608

Query  534  DSNTLHHRVHNKCVALHPQTYHLSLMPCDFNNAYQQWTFESIN  576
                 H     +C+ L P +  +    CD +N +QQW F S N
Sbjct  609  HKQLKHGTEGRRCLELLPFSQEVVANKCDTDNRFQQWNFGSFN  651



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000032-PA

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VK69_DROME  unnamed protein product                                 816     0.0  
TCPD_CAEEL  unnamed protein product                                   667     0.0  
C0H5I7_PLAF7  unnamed protein product                                 575     0.0  


>Q9VK69_DROME unnamed protein product
Length=533

 Score = 816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/519 (75%), Positives = 461/519 (89%), Gaps = 0/519 (0%)

Query  25   QAYKDRTKPTDIRFSNISAAKAVSYAIRTSLGPKGMDKMIQASNGEVTITNDGATILKEI  84
            +A+KD++KPTD+R SNI AAKAVS AIRTSLGP+GMDKMIQA NGEV+ITNDGATILK++
Sbjct  15   KAFKDKSKPTDVRLSNIQAAKAVSDAIRTSLGPRGMDKMIQAGNGEVSITNDGATILKQM  74

Query  85   NVIHPAAKMLVELSRAQDIEAGDGTTSVVVIAGALLEAAERLLQKDIHPTLISESFQNGA  144
            NV+HPAAKMLVELSRAQD+ AGDGTTSVVVIAGALLEA E+LLQK +HPT IS+SFQ  +
Sbjct  75   NVLHPAAKMLVELSRAQDVAAGDGTTSVVVIAGALLEACEKLLQKGLHPTAISDSFQRCS  134

Query  145  HFAVNVLKEMAKSVDMTNLPMLYSTASTSLNSKVVSQYSNVLSTIAVNAVLKVTEPGKEN  204
            + AV +LK+M+  +++ +   L  +ASTSLNSKVVSQ S++L+ IAV+AVLKVT+PGKE 
Sbjct  135  NKAVEILKQMSTPIELDDRETLIKSASTSLNSKVVSQQSSLLAPIAVDAVLKVTDPGKET  194

Query  205  AVDLKDIKVIKKLGGTVEDTELIDGLVFTQKSCNTNGPKRVEKAKIGLIQFCISPPKTDM  264
            +VDLK+IKVI  LGGTVEDTEL+DGLVFT +S  +N PKR+EKAKIGLIQFCIS PKTDM
Sbjct  195  SVDLKNIKVISSLGGTVEDTELVDGLVFTCRSAGSNAPKRIEKAKIGLIQFCISAPKTDM  254

Query  265  DHNVIVSDYSQMDRVLKEERAYILNIVKQIKKAGCNVLLVQKSILRDAVSDLAIHFLDKI  324
            DHNVIVSDY+ MDRVLKEER+YILNIVKQIKK+GCNVLLVQKSILRDAVSDLA HFLDKI
Sbjct  255  DHNVIVSDYAAMDRVLKEERSYILNIVKQIKKSGCNVLLVQKSILRDAVSDLAQHFLDKI  314

Query  325  KCMVIKDIEREDIPFVCKTLGCRPIASLDHFVPENLVNAELCEEIQTGNSKFVKITGIQN  384
            KCMV+KD+EREDI FVCKTL CRPIASLDHF  ENL +A+L EE+ +G +KFVKITGIQN
Sbjct  315  KCMVVKDVEREDIEFVCKTLHCRPIASLDHFTAENLSSADLVEEVASGTNKFVKITGIQN  374

Query  385  QGKTVTVVVRGSNKLILEEAERSLHDALCVIRCLVKQNAILPGGGAPEIQMSLRLAQYSR  444
             G+TV+++ RGSNKL+LEEA RSLHDALCV+RCLVK  A + GGGAPEI+M+L+LA  ++
Sbjct  375  MGRTVSIICRGSNKLVLEEAARSLHDALCVVRCLVKLRAQIVGGGAPEIEMALQLAALAQ  434

Query  445  TMTGVDSYCIRAYANALEIIPLTLAENAGLNPIATVTELRKRHASGETDAGINVRKGTIT  504
            T+ GVD+YC RA+A+ALE+IP TLAENAGLNPIATVTELR RHA GE +AGINVRKG IT
Sbjct  435  TVEGVDAYCFRAFADALEVIPSTLAENAGLNPIATVTELRNRHAQGEKNAGINVRKGAIT  494

Query  505  RMFEEDVVQPLLVTVSAMTLATETVRSILKIDDIVNTFN  543
             +F E+VVQPLLV++S++TLATET+RSILKIDDIVNTF+
Sbjct  495  DIFAENVVQPLLVSISSITLATETIRSILKIDDIVNTFS  533


>TCPD_CAEEL unnamed protein product
Length=540

 Score = 667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/519 (64%), Positives = 419/519 (81%), Gaps = 1/519 (0%)

Query  22   GLRQAYKDRTKPTDIRFSNISAAKAVSYAIRTSLGPKGMDKMIQASNGEVTITNDGATIL  81
            G  + +KD+ KP  +R SNI AAKAV+ A+RTSLGP+GMDKMIQ+ NG+VTITNDGATIL
Sbjct  18   GRERNFKDKDKPESVRNSNIVAAKAVADAVRTSLGPRGMDKMIQSGNGDVTITNDGATIL  77

Query  82   KEINVIHPAAKMLVELSRAQDIEAGDGTTSVVVIAGALLEAAERLLQKDIHPTLISESFQ  141
             +++VIHP AKMLVELS+AQDIEAGDGTT+VVV+AGALL+AA+ LL K IHPT ISESFQ
Sbjct  78   NQMSVIHPTAKMLVELSKAQDIEAGDGTTTVVVMAGALLDAAQNLLSKGIHPTTISESFQ  137

Query  142  NGAHFAVNVLKEMAKSVDMTNLPMLYSTASTSLNSKVVSQYSNVLSTIAVNAVLKVTEPG  201
            + A  A  +L EM+  VD++N  +L   A+TSLNSKVVSQ+S +L+ +AVNAV K+    
Sbjct  138  SAAAEAEKILDEMSSPVDLSNDALLNKMATTSLNSKVVSQHSWLLAPMAVNAVKKIINSE  197

Query  202  KENAVDLKDIKVIKKLGGTVEDTELIDGLVFTQKSCNTNGPKRVEKAKIGLIQFCISPPK  261
             ++ V+LK IK+IKK+G TVE++ELI+G +  QK+     P R+EKAKIGLIQF ISPPK
Sbjct  198  NDSNVNLKMIKIIKKMGDTVEESELIEGALIDQKTMGRGAPTRIEKAKIGLIQFQISPPK  257

Query  262  TDMDHNVIVSDYSQMDRVLKEERAYILNIVKQIKKAGCNVLLVQKSILRDAVSDLAIHFL  321
            TDM++ VI++DY+QMDR LKEER Y+L I KQIK AGCNVLL+QKSILRDAV++LA+HFL
Sbjct  258  TDMENQVIITDYAQMDRALKEERQYLLEICKQIKAAGCNVLLIQKSILRDAVNELALHFL  317

Query  322  DKIKCMVIKDIEREDIPFVCKTLGCRPIASLDHFVPENLVNAELCEEIQT-GNSKFVKIT  380
             K+K M IKDIEREDI F  + LGCRP+AS+DHF  + L  A+L EEI T G+ K +K+T
Sbjct  318  AKMKIMCIKDIEREDIEFYSRILGCRPVASVDHFNADALGYADLVEEIPTGGDGKVIKVT  377

Query  381  GIQNQGKTVTVVVRGSNKLILEEAERSLHDALCVIRCLVKQNAILPGGGAPEIQMSLRLA  440
            G+QN G  V++++RGSNKL+LEEA+RS+HDALCVIRCLVK+ A+LPGGGAPE++++++L 
Sbjct  378  GVQNPGHAVSILLRGSNKLVLEEADRSIHDALCVIRCLVKKKALLPGGGAPEMEIAVKLR  437

Query  441  QYSRTMTGVDSYCIRAYANALEIIPLTLAENAGLNPIATVTELRKRHASGETDAGINVRK  500
              ++T  G   YC RA+A+ALE+IP TLAENAGL+PI TVTELR  HA+G +  G+NVRK
Sbjct  438  NLAQTQHGATQYCWRAFADALELIPYTLAENAGLSPIHTVTELRNNHANGNSSYGVNVRK  497

Query  501  GTITRMFEEDVVQPLLVTVSAMTLATETVRSILKIDDIV  539
            G +T M EEDVVQPLLVT SA+  A+E VRSILKIDDIV
Sbjct  498  GYVTDMVEEDVVQPLLVTASAIKQASECVRSILKIDDIV  536


>C0H5I7_PLAF7 unnamed protein product
Length=529

 Score = 575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/510 (56%), Positives = 383/510 (75%), Gaps = 3/510 (1%)

Query  32   KPTDIRFSNISAAKAVSYAIRTSLGPKGMDKMIQASNGEVTITNDGATILKEINVIHPAA  91
            K  D+R +NI AAKAV+   RTSLGPKGMDKMI+   G V ITNDGATILKE+ V HP A
Sbjct  18   KQNDVRLTNILAAKAVADVTRTSLGPKGMDKMIEDGKGGVIITNDGATILKEMAVAHPTA  77

Query  92   KMLVELSRAQDIEAGDGTTSVVVIAGALLEAAERLLQKDIHPTLISESFQNGAHFAVNVL  151
            KM+VELS+AQD+EAGDGTTSVVV+ G+ L   + LL K+IH   ISESF   +  +  +L
Sbjct  78   KMIVELSKAQDVEAGDGTTSVVVMCGSFLNVCKSLLDKNIHCQKISESFFEASLKSEEIL  137

Query  152  KEMAKSVDMTNLPMLYSTASTSLNSKVVSQYSNVLSTIAVNAVLKVTEPGKENAVDLKDI  211
            +EM+  +D+ +  ML   A TSLNSKVVS  S++L+ IAV+ +LK+T+  K+  VDL ++
Sbjct  138  REMSIPIDLNDKNMLIQNAITSLNSKVVSYNSSLLAPIAVDVILKITDINKDTNVDLNNV  197

Query  212  KVIKKLGGTVEDTELIDGLVFT--QKSCNTNGPKRVEKAKIGLIQFCISPPKTDMDHNVI  269
            +++KKLGGT+EDTE++DGL+FT  + S    G K + +AKIGLIQFC+S PKTDMD+ V+
Sbjct  198  RIVKKLGGTIEDTEIVDGLIFTGNKISKKAQGLKNLTQAKIGLIQFCLSLPKTDMDNTVV  257

Query  270  VSDYSQMDRVLKEERAYILNIVKQIKKAGCNVLLVQKSILRDAVSDLAIHFLDKIKCMVI  329
            V DY+ MDR+L+EER  I  ++K+I   GCN+L++QKSILRDAV+DLA+ FL K K MVI
Sbjct  258  VKDYNSMDRLLREERLIIGKMIKKIASTGCNLLIIQKSILRDAVNDLALDFLAKAKIMVI  317

Query  330  KDIEREDIPFVCKTLGCRPIASLDHFVPENLVNAELCEEIQTGNSKFVKITGIQNQGKTV  389
            KDI+REDI F+ KT  C P+ASLD+F  + L  AE       G  + VKITG++++  T+
Sbjct  318  KDIDREDIEFISKTCNCIPVASLDYFTSDKLGYAENVTTESVGYGEIVKITGVESKN-TI  376

Query  390  TVVVRGSNKLILEEAERSLHDALCVIRCLVKQNAILPGGGAPEIQMSLRLAQYSRTMTGV  449
            +V++R SN L+L+EAERSLHDALCV+R L+K+ A+LPGG APE+++S +L Q++ T+ G 
Sbjct  377  SVLLRASNNLMLDEAERSLHDALCVVRSLIKEKAVLPGGAAPEMELSQKLYQWANTLKGS  436

Query  450  DSYCIRAYANALEIIPLTLAENAGLNPIATVTELRKRHASGETDAGINVRKGTITRMFEE  509
               C++A+++ALE+IP TLAENAGL+P+  VTELR +HA G    GIN+R GTI+ M +E
Sbjct  437  KQICVKAFSDALELIPYTLAENAGLSPLHIVTELRNKHAEGHKYHGINIRTGTISNMIDE  496

Query  510  DVVQPLLVTVSAMTLATETVRSILKIDDIV  539
            +V+QPLLVT +A+ LATETV  ILKIDD V
Sbjct  497  NVIQPLLVTSTAIKLATETVMMILKIDDTV  526



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000033-PA

Length=210
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387T3_TRYB2  unnamed protein product                                 206     9e-68
Q9VUM1_DROME  unnamed protein product                                 32.0    0.39 
C1GLT_DROME  unnamed protein product                                  30.4    1.1  


>Q387T3_TRYB2 unnamed protein product
Length=207

 Score = 206 bits (525),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 120/149 (81%), Gaps = 3/149 (2%)

Query  60   VPQQSSALFFQYNEQLGPPYHIIVDTNFVNFSVKNKLDIIENMRHCLYAHCIPYVTDCVM  119
             P Q++ +F  YN+ LGPP+HI +DTNF+NFS++NK++I+E +  C+ A  IP V DCVM
Sbjct  61   APLQTN-MFLSYNKSLGPPFHIWLDTNFINFSMQNKIEIVEGLMDCMLAKVIPCVCDCVM  119

Query  120  GEMEKLGKKYRIALKVIKDPRFERIPCMHKGTYADDCIVNRVTQHKCYIVATNDKDLKRR  179
             E+EKLGKK+RIALK+ +D RF+R+ C   G YADDC+V  VTQH  YIVAT D++LKRR
Sbjct  120  AELEKLGKKFRIALKIARDKRFKRLTC--DGKYADDCVVRTVTQHPIYIVATCDQELKRR  177

Query  180  IRKIPGVPIMYVSQHRYTIERMPDAYGAP  208
            +RKIPGVPIMY+S+HRYTIER+P+ YGAP
Sbjct  178  LRKIPGVPIMYISKHRYTIERLPEVYGAP  206


>Q9VUM1_DROME unnamed protein product
Length=501

 Score = 32.0 bits (71),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 14/49 (29%), Positives = 24/49 (49%), Gaps = 0/49 (0%)

Query  77   PPYHIIVDTNFVNFSVKNKLDIIENMRHCLYAHCIPYVTDCVMGEMEKL  125
            P Y +IVD N +   + N++ I+       Y    P +   ++GE+E L
Sbjct  96   PEYCLIVDANAIAVDIDNEISIVHKFTKEKYQKRFPELDSLIVGEIEYL  144


>C1GLT_DROME unnamed protein product
Length=388

 Score = 30.4 bits (67),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 29/123 (24%), Positives = 51/123 (41%), Gaps = 20/123 (16%)

Query  80   HIIVDTNFVNFSVKNKLDIIENMRHCLYAHC-----------IPYVTDCVMGEMEKLGKK  128
            H I D ++   +  +   I+ENMR+ LY +             PYV    M      G  
Sbjct  169  HHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCKFKPYVKQGYMSG----GAG  224

Query  129  YRIALKVIKDPRFERIP----CMHKGTYADDCIVNRVTQHKCYIVATNDKDLKRRIRKIP  184
            Y ++ + ++    E +P    C    + A+D  + +  Q+   ++A + +D   R R  P
Sbjct  225  YVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGKCLQN-VNVLAGDSRDSNGRGRFFP  283

Query  185  GVP  187
             VP
Sbjct  284  FVP  286



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000034-PA

Length=1855
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FAT_DROME  unnamed protein product                                    1788    0.0  
DS_DROME  unnamed protein product                                     655     0.0  
X2J8E9_DROME  unnamed protein product                                 654     0.0  


>FAT_DROME unnamed protein product
Length=5147

 Score = 1788 bits (4630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 956/1799 (53%), Positives = 1237/1799 (69%), Gaps = 97/1799 (5%)

Query  93    MQSRAVEKRAQLEVKEGEPLGTLVGRIPVIPDFTYRFNEQPKEFNLDPVSGEIRTAVLLD  152
             MQSRAV+  A  EV EG+P GT VG IP  P F+YRFNE P+EF LDPV+GE++T V+LD
Sbjct  60    MQSRAVDTSADFEVLEGQPRGTTVGFIPTKPKFSYRFNEPPREFTLDPVTGEVKTNVVLD  119

Query  153   RERLTSDRFDLVVLSSQPTYPIEVKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLD  212
             RE +  D +DLVVLSSQPTYPIEV+I+V+DVNDN+PEFPE SIA+SF+ESA++GT+LLLD
Sbjct  120   REGM-RDHYDLVVLSSQPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLD  178

Query  213   TATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSL  272
              ATD D  ENG+TD Y IV GN D KFRL+ T NPS  +SYLHLETT  LDRE    Y L
Sbjct  179   AATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQL  238

Query  273   NVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKD  332
             N+ ARD G PP+ G L VNVT+LDVNDNPP+F  S+Y   LNE++  GT ++TV A D D
Sbjct  239   NISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDND  298

Query  333   SEDNARLTYYLSETNERQFSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSC  392
               DN+++TYYL+ET E QF+VNPETG ++T+E  + CPQQ + +   ++        KSC
Sbjct  299   LGDNSKITYYLAET-EHQFTVNPETGVISTTER-VNCPQQTNVKSSASQ--------KSC  348

Query  393   VIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAA  452
             V  VFA+DHG+PRQ+GRTYVTVNLLD+NDHDP I F +FP     ATVDENA  G++VAA
Sbjct  349   VFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAA  408

Query  453   IGVIDADEGLNSETSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYN  512
             + V D+D GLN  TS+ I +GNEL HF L         A    +VRVNG LDREEI KYN
Sbjct  409   VAVKDSDSGLNGRTSVRIVSGNELGHFRL-------EEAADLHIVRVNGVLDREEIGKYN  461

Query  513   LTIVARDRGNPPRSATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDA  572
             LT+VA D+G P R+ TA+L I VNDVNDHEPVF++SEYSAVLSEL+P GSFVASITATD 
Sbjct  462   LTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDE  521

Query  573   DTGLNARIYYDFEATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELRVQARDGGPNPKF  632
             DTG+NA+++YD   +GNE  WF++D  TGL+ T   LDREI  +VEL + ARDGGPNPKF
Sbjct  522   DTGVNAQVHYDI-LSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKF  580

Query  633   VSTHLRVTILDENDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHP  692
               T L+V ILDENDE P+F+     V L E+ P  ++VA ++A D+DQGTNGSV ++L P
Sbjct  581   AYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAP  640

Query  693   SVLRDYPRTFALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPT-QSSTATVLLSIED  751
             SV R YP  FALD+LTGQL T+  LDRE+M++Y I V+ARDQG+PT QS+TATV L++ D
Sbjct  641   SVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVAD  700

Query  752   VNDNAPVFYPTTYFFPVG---------RDSTRGTLAGKLFATDADSKENALIRYSLESGG  802
             VNDN P FYP  Y + +          ++  +  +   + A+D D  +NALI Y LESGG
Sbjct  701   VNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGG  760

Query  803   DGGLFAMDERTGELFLQG----PLRHRSLFKLTVSARDNGDRAAARNALVEVVDRESLVH  858
             + GLF +D R+G + L+G     +  +  +KL VSARD G R + ++A+VE+V +  L  
Sbjct  761   E-GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEM  819

Query  859   LEF-KAFDNGYRFRVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIASVTYAIVLGD  917
             LE  +A   GY F+++E H     +    + P+R+VG VQV    G+  + + Y I+ GD
Sbjct  820   LECGQAQAGGYEFQMVEDH-----EQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGD  874

Query  918   PEGRFRIDESTGAITTAGCIDREKTAQYNLQV---------SARAGLAYGLARVNVSVLD  968
                 FRID  +G ITTA  +DRE+ A Y L +         +A + ++YG   VN++++D
Sbjct  875   RAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIID  934

Query  969   SNDNPPRFS-SEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTRNPGQQFRI  1027
              NDN P F+   E E  + L E AAVGQE+ L+R RDRD G+N+R+ YSLT NP QQFRI
Sbjct  935   LNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRI  994

Query  1028  AEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPVF  1087
                TG++YL +P+   PG+++ +E+ A D+           +       I D N+HTPVF
Sbjct  995   GPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVL-----IADVNDHTPVF  1049

Query  1088  ELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYWISEGNSEGRFGIFPDGQLYVR  1147
             +  SYETSLPE+T VN RFF L A+D D G +NGR+SY I EGN+E  FG+FPDG L+VR
Sbjct  1050  DHTSYETSLPETTKVNTRFFALAATDIDLG-DNGRISYEIIEGNTERMFGVFPDGYLFVR  1108

Query  1148  NELDREEQDYYALEVTASDHGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPA  1207
               LDREE+DYYAL V+  D G P RSS V +V+HV+DENDNAPQF NS+FTF + EN PA
Sbjct  1109  APLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPA  1168

Query  1208  DTFVGKLVASDRDAGRNADLTYSLPATQQDFAVDPRNGFVRSLRAFDREHLV--------  1259
             DTFVGKL A DRD GRNA+L+++L +  QDF +D RNGF+++LR FDRE LV        
Sbjct  1169  DTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEA  1228

Query  1260  --------ASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKRLPYQIQV  1311
                      S  GN + LEATV DNG + RL+D+VK+ V + DVNDNAP+F R PY + +
Sbjct  1229  SGEDGSLRGSMAGNYMLLEATVSDNG-IPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTI  1287

Query  1312  SEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSGDE--QFAIDEATGQIILAKRLDRESR  1369
             SE A+ G  +  V+T DADEGLNGDV+Y+L   G+E  QF +D ATGQ+ L +RLDRES+
Sbjct  1288  SEGASEGTHITHVFTQDADEGLNGDVYYSLA-KGNEAGQFNLDSATGQLSLGRRLDRESQ  1346

Query  1370  DTYRLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKPRISVPETTALNVELLRF  1429
             + + L VVA DA  +  LS++A++ + VLDENDNAP F      +SV ET+    EL+RF
Sbjct  1347  EIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRF  1406

Query  1430  RATDADLGSNAELSYAITAGNKYDAFHVEPATGALYLRKPLDYEDQKFHQLNVSCSDSGH  1489
             RA+DAD G N+++ ++I+AGN+ D FH++  TG+LYL KPLDYED   + LN++ SD G 
Sbjct  1407  RASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGT  1466

Query  1490  PRLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSY  1549
             P LS+ V   V VVD NDNPP+FP+TAIVRQI EG+P+  P+VTV+A+DPDSG NG VSY
Sbjct  1467  PSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSY  1526

Query  1550  AIASQEPE-DEKRRFGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKS  1608
             AI+ QEP+  + R FGIN  T VIHTL  I+RE IDTF+L VVATD AQP+  +LS EK 
Sbjct  1527  AISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKL  1586

Query  1609  VTVIVTDVNDNAPVFVNMPAFVL-PRTSPLRDEPVQIGQFLARDADSSTNGQVTYELLRS  1667
             VTVIV D+NDNAPVFV+M A +L P+ S  +     + Q  A+DADSS+NG VTYE++  
Sbjct  1587  VTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG  1646

Query  1668  DNNYTDLVQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVP  1727
                  +L ++ R TG++      G  F +  R ++ ++++DEA Q+ERRS+E Y T+I P
Sbjct  1647  PQ---ELFKLQRNTGIIT--FTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITP  1701

Query  1728  GAEGDG---PVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTN  1784
             G+ G     P +E    L GSV ENE +GTS+L V A         +A  E  +EY+VTN
Sbjct  1702  GSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAH--------LASAE--IEYFVTN  1751

Query  1785  VTAGVDGPMVDRLFDVDARSGLLSTAAPLDRELGAEWYEVEVYAVVVGAARPSTSSTKV  1843
             VTA      VDRLFD+DA+ G+LSTAA LDRE G E YEVEVYA+ +G  +P TS TKV
Sbjct  1752  VTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALG-GQPRTSRTKV  1809


 Score = 494 bits (1273),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 495/1789 (28%), Positives = 806/1789 (45%), Gaps = 194/1789 (11%)

Query  136   FNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSS---QPTYP--IEVKIRVIDVNDNAPEF  190
             F+L+P +G +     LD E +    + L+V +    QP+    I V   V+D+NDNAP F
Sbjct  1970  FSLNPQTGMLTLTARLDYEEV--QHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF  2027

Query  191   PESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSIS  250
                S +    E+    T+++  +A D D+  NG+ + YSI  G+ D +F +   G     
Sbjct  2028  DPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIE-YSITAGDVDSEFGIDSNGT----  2082

Query  251   SSYLHLETTSKLDREQIEYYSLNVCARDRG------------------------------  280
                  + T   LDRE    Y+L V ARD                                
Sbjct  2083  -----IRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQE  2137

Query  281   ----QPPKLGCLLVNVTVL--DVNDNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSE  334
                 Q  +     V VT+L  DVND  P+F+ +   A++ E+  + T ++ V+A D D  
Sbjct  2138  FLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIM-ENVAINTVVIAVKAVDNDEG  2196

Query  335   DNARLTYYLSETNERQ--------FSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAG  386
              N  + Y + E  +          FS+NP  G++   +A           D+  +     
Sbjct  2197  RNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDA----------LDRELR-----  2241

Query  387   GCPKSCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAK  446
                 S ++ + A+D G P Q   + + + +LD ND+ P      F P    A+V ENA+ 
Sbjct  2242  ---SSYLLNITARDRGEPPQSTESQLLIRILDENDNSP-----VFDPKQYSASVAENASI  2293

Query  447   GSIVAAIGVIDADEGLNSETSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDRE  506
             G++V  +   D DEG N      I  G++         N D + ++   +VRV   L+ E
Sbjct  2294  GAMVLQVSATDVDEGANGRIRYSIVLGDQ---------NHDFSISEDTGVVRVAKNLNYE  2344

Query  507   EIPKYNLTIVARDRG-NPPRSATAYLAIHVNDVNDHEPVFQQSEYSAVLSE--LSPVGSF  563
              + +Y+LT+ A D     P   TA L I++ D+ND+ P F  S Y A + E  + P G +
Sbjct  2345  RLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGY  2404

Query  564   VASITATDADTG-LNARIYYDFEATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELRVQ  622
             V ++ A DADT  LN+++ Y F   G+    F I+  +G +     LDRE +    L + 
Sbjct  2405  VLTVNAYDADTPPLNSQVRY-FLKEGDSD-LFRINASSGDIALLKPLDREQQSEYTLTLV  2462

Query  623   ARDGGPNPKFVSTHLRVTILDENDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGT  682
             A D G  P   +  +RV + D ND  P F        + EN P+ + V T  A D D+G 
Sbjct  2463  AMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGL  2522

Query  683   NGSVAYSLHPSVLRDYPRTFALDSLTGQLMTKVTLDRERMAEYRILVVARDQG-SPTQSS  741
             N  + ++L    L ++   F +DS TG++ T  TLDRE  + Y + ++A+D   +  ++S
Sbjct  2523  NAKLRFNL----LGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRAS  2578

Query  742   TATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYSLESG  801
             +  + +S+ DVNDN P F  TTY   V    ++G       A D D  ENA++ Y++ SG
Sbjct  2579  SVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SG  2637

Query  802   GDGGLFAMDERTGELFLQGPLRHRS------LFKLTVSARDNGDRAAARNALVEVVDRES  855
              D   F ++ +TG +  +  L+ ++       + + +SA D G+++ +  A + V+ R  
Sbjct  2638  RDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPP  2697

Query  856   LVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIASVTYAIVL  915
              +   F    N + F + E              P + +  V     +   +  + YAI  
Sbjct  2698  ELFPTFAYMANSH-FAMSE-----------DVRPGKMITKVSATSPKKGLVGKIRYAIAG  2745

Query  916   GDPEGRFRIDESTGAITTA-GCIDREKTAQYNLQVSARAGLAYGLARVNV---SVLDSND  971
             G      R+D ++G ++     +D E T  Y + + A  G    L  V +   +V D+ND
Sbjct  2746  GIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDAND  2805

Query  972   NPPR-----FSSEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTRNPGQQFR  1026
             N P      +++E  EE+ P        Q + + +A DRD G N  V+Y L  +    F 
Sbjct  2806  NAPVMEQLIYNAEVLEEESP-------PQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFE  2858

Query  1027  IAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPV  1086
             I E +G +Y    + +         V A D     Q    +  T  + + + D N++ P 
Sbjct  2859  ITE-SGEIYTRMRLDREEIGDYAFVVEAVD-----QGVPHMTGTASVLLHLLDKNDNPPK  2912

Query  1087  FELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYWISEGNSEGRFGIFPD-GQLY  1145
             F    +  ++ E+  +      + +SD D G N    SY  SE   E +F I P  G + 
Sbjct  2913  FTR-LFSLNVTENAEIGSFVIRVTSSDLDLGAN-ANASYSFSENPGE-KFRIEPQSGNIT  2969

Query  1146  VRNELDREEQDYYALEVTASDHGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENE  1205
             V   LDRE+QD Y L+V ASD G  +  + +++ +   D+NDNAP+F +S ++F   E +
Sbjct  2970  VAGHLDREQQDEYILKVVASD-GAWRAETPITITIQ--DQNDNAPEFEHSFYSFSFPELQ  3026

Query  1206  PADTFVGKLVASDRDA-GRNADLTYSLPATQQDFAVDPRNGFVRSLRAFDREH-LVASTG  1263
              +   VG+++A+DRD  G N+ ++YSL      F++DP  G V S +A   +H     + 
Sbjct  3027  QSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSP  3086

Query  1264  GNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKRLPYQIQVSEAAAVGNQLLR  1323
              N+ +L     DNG    L     +++ I D ++N P+F++  Y   + + A  G +++R
Sbjct  3087  ENMYALTVLATDNGK-PPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVR  3145

Query  1324  VYTSDA-DEGLNGDVFYTLEDSGDEQFAIDEATGQIILAKRLDRESRDTYRLTVVAHDAG  1382
             V+ +D  D G N   +  +  +    F++    G I L K +       Y L V A D G
Sbjct  3146  VHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRG  3205

Query  1383  QEMQLSASATVDVDVLDENDNAPRFVDGKPRISVPETTALNVELLRFRATDADLGSNAEL  1442
                Q   +  V V V  EN + PRF     ++ VPE   +   +L   ATD D G N  L
Sbjct  3206  VPPQSDETRVVIV-VTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGML  3264

Query  1443  SYAITAGNKYDAFHVEPATGALYLRKPLDYEDQKFHQLNVSCSDSGHPRLSSLVSLRVDV  1502
              Y+I+ GN+   F V+  TG + +++ LDY+  + + LN++  D G+  LSS+  L + +
Sbjct  3265  RYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIIL  3324

Query  1503  VDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEPEDEKRR  1562
              D NDNPPVF +      I E  PV   V    A D DS  N ++ YA     P  ++  
Sbjct  3325  TDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGP--DRHF  3382

Query  1563  FGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPV  1622
             F +N +   I + +  + EE   + L + A +   P SS + +  ++ V V  VN+  P 
Sbjct  3383  FIMNQSNGTISSAVSFDYEERRIYTLQIKAKN---PDSS-MESYANLYVHVLGVNEFYPQ  3438

Query  1623  FVNMPAFVLPRTSPLRDEPVQIGQFLARDADSSTNGQVTYELLRSDNNYTDLVQIHRGTG  1682
             F+  P F     S       ++G   A D DS  +G+V Y L+ S N+    +  + G  
Sbjct  3439  FL-QPVFHF-DVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLI  3496

Query  1683  MLAMRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWEHSGTL  1742
              +A  L       R  + RV +    +   + R +    A +I+   +G+ P        
Sbjct  3497  YVARHL------DRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPPEFIKHYY  3550

Query  1743  EGSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTNVTAGVDGPMVDRLFDVDA  1802
               ++ E   VGT V  V+A  +      V        Y + N         + + F +D 
Sbjct  3551  TSTISEAAPVGTKVTTVKAIDKD-----VRTQNNQFSYSIINGN-------LKQSFKIDV  3598

Query  1803  RSGLLSTAAPLDRELGAEWYEVEVYAVVVGAAR----PSTSSTKVSLNF  1847
             ++G +STA+ LDRE      E   Y +V+GA      P T S  V +  
Sbjct  3599  QTGEISTASRLDRE------ETSTYNLVIGAIDTGLPPQTGSATVHIEL  3641


 Score = 457 bits (1175),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 458/1596 (29%), Positives = 718/1596 (45%), Gaps = 148/1596 (9%)

Query  133   PKEFNLDPVSGEIRTAVLLDRERLTSDRFDLVVLS-SQPTYPIEVK--IRVIDVNDNAPE  189
             P  F+L+P  G++R    LDRE  +S   ++      +P    E +  IR++D NDN+P 
Sbjct  2218  PLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPV  2277

Query  190   FPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSI  249
             F     + S AE+AS G  +L  +ATD D   NG    YSIV G+ +  F        SI
Sbjct  2278  FDPKQYSASVAENASIGAMVLQVSATDVDEGANGRI-RYSIVLGDQNHDF--------SI  2328

Query  250   SSSYLHLETTSKLDREQIEYYSLNVCARDRG-QPPKLGCLLVNVTVLDVNDNPPMFLQSE  308
             S     +     L+ E++  YSL V A D   + P      + + +LD+NDN P FL S 
Sbjct  2329  SEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSP  2388

Query  309   YVAVLNESS--PVGTHILTVQAYDKDSED-NARLTYYLSETNERQFSVNPETGEVTTSEA  365
             Y+A + E++  P G ++LTV AYD D+   N+++ Y+L E +   F +N  +G++   + 
Sbjct  2389  YLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLK-  2447

Query  366   PLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPE  425
             PL+  QQ                     + + A D G+P   G   V V + D ND+DP 
Sbjct  2448  PLDREQQ-----------------SEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDP-  2489

Query  426   IRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAGNELRHFELTGYN  485
                  F   S  ATV EN   G+ V      D DEGLN++    +  G  +  F +    
Sbjct  2490  ----VFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL-LGEHMHRFHIDSET  2544

Query  486   DDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRG-NPPRSATAYLAIHVNDVNDHEPV  544
              + ++A +         LDREE   Y+LT++A+D     PR+++  L I V+DVND+ P 
Sbjct  2545  GEISTATT---------LDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPK  2595

Query  545   FQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNEHAWFAIDRDTGLVT  604
             F  + Y+  + E    G FV    A D D G NA ++Y    +G +  +F I+  TG+V+
Sbjct  2596  FDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI--SGRDQHYFDINTKTGVVS  2653

Query  605   TRATLDREIEGSVELR----VQARDGGPNPKFVSTHLRVTILDENDEVPKFASSYL---E  657
             T+  L  + +   +L     + A D G         L V IL   +  P FA  Y+    
Sbjct  2654  TKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTV-ILRPPELFPTFA--YMANSH  2710

Query  658   VALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQL-MTKVT  716
              A+SE+     ++  +SA    +G  G + Y++   ++ D  R   +D  +G L + +  
Sbjct  2711  FAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLR---VDPNSGLLSVGQDG  2767

Query  717   LDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTRGT  776
             LD E    Y I + A D  +P+  S   + L++ D NDNAPV     Y   V  + +   
Sbjct  2768  LDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQ  2827

Query  777   LAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGPLRHRSL--FKLTVSA  834
             L   + A+D DS +N  + Y L++  D G F + E +GE++ +  L    +  +   V A
Sbjct  2828  LIAVVKASDRDSGDNGNVIYRLQNDFD-GTFEITE-SGEIYTRMRLDREEIGDYAFVVEA  2885

Query  835   RDNGDRAAARNALVEVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRDVG  894
              D G       A V       L+HL  K  DN  +F  +          +   T + ++G
Sbjct  2886  VDQGVPHMTGTASV-------LLHLLDKN-DNPPKFTRL---------FSLNVTENAEIG  2928

Query  895   TVQV-----DVQQGQKIASVTYAIVLGDPEGRFRIDESTGAITTAGCIDREKTAQYNLQV  949
             +  +     D+  G   A+ +Y+    +P  +FRI+  +G IT AG +DRE+  +Y L+V
Sbjct  2929  SFVIRVTSSDLDLGAN-ANASYSFS-ENPGEKFRIEPQSGNITVAGHLDREQQDEYILKV  2986

Query  950   SARAGLAYGLARVNVSVLDSNDNPPRFSSEEREEDVP--LNELAAVGQEVCLARARDRDV  1007
              A  G       + +++ D NDN P F         P     +A VGQ   +A  RD+  
Sbjct  2987  VASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQ--IIATDRDKQ-  3043

Query  1008  GLNARVVYSLTRNPGQQFRIAEGTGIVYLAKPV-------TQPPGTVLQIEVTARDSAGA  1060
             G N+ + YSL + P   F I   TG V+  K V        + P  +  + V A D+   
Sbjct  3044  GPNSVISYSL-QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKP  3102

Query  1061  EQQQHSLATTQQIRVVIEDANNHTPVFELPSYETSLPESTPVNERFFGLLASDA-DFGPN  1119
                   L     + + I DA+N+ P FE   Y   LP+     +R   + A+D  D G N
Sbjct  3103  PLYSECL-----VNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN  3157

Query  1120  N---GRVSYWISEGNSEGRFGIFPDGQLYVRNELDREEQDYYALEVTASDHGNPKRSSSV  1176
                   +++ +S   S GR     DG + +   +       Y L V A+D G P +S   
Sbjct  3158  EMDYSLMTFNLSSIFSVGRH----DGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDET  3213

Query  1177  SLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPA--T  1234
              +V+ V  EN + P+F  +S+   + ENEP  + +  + A+D D G N  L YS+     
Sbjct  3214  RVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNE  3273

Query  1235  QQDFAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGD  1294
             +QDF+VD R G +   +  D + +          L  TV D G    L     +++ + D
Sbjct  3274  RQDFSVDERTGGIVIQQQLDYDLI------QEYHLNITVQDLG-YHPLSSVAMLTIILTD  3326

Query  1295  VNDNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSGDEQ--FAID  1352
             VNDN P F    Y   + E   VG  + + + +D D   N  + Y    SG ++  F ++
Sbjct  3327  VNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMN  3386

Query  1353  EATGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKP  1412
             ++ G I  A   D E R  Y L + A +    M+  + A + V VL  N+  P+F+    
Sbjct  3387  QSNGTISSAVSFDYEERRIYTLQIKAKNPDSSME--SYANLYVHVLGVNEFYPQFLQPVF  3444

Query  1413  RISVPETTALNVELLRFRATDADLGSNAELSYAITAGNKYDAFHVEPATGALYLRKPLDY  1472
                V ET+A+   +   +ATD D G +  + Y +   +    F ++  TG +Y+ + LD 
Sbjct  3445  HFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDR  3504

Query  1473  EDQKFHQLNVSCSDSGHPRLSSL--VSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRP  1530
             E Q    L V   + G  R +      + + + D ND PP F        I E  PV   
Sbjct  3505  ETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTK  3563

Query  1531  VVTVSAEDPD-SGDNGLVSYAIASQEPEDEKRRFGINPATAVIHTLLPIEREEIDTFKLI  1589
             V TV A D D    N   SY+I +    + K+ F I+  T  I T   ++REE  T+ L+
Sbjct  3564  VTTVKAIDKDVRTQNNQFSYSIING---NLKQSFKIDVQTGEISTASRLDREETSTYNLV  3620

Query  1590  VVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFVNMPAFVLPRTSPLRDEPVQIGQFLA  1649
             + A DT  P     +   +V + + DVNDN P F   P  +    S        I   +A
Sbjct  3621  IGAIDTGLPPQ---TGSATVHIELEDVNDNGPTFT--PEGLNGYISENEPAGTSIMTLIA  3675

Query  1650  RDADSSTN-GQVTYELLRSDNNYTDLVQIHRGTGML  1684
              D D   N G  TY+L+     +   + + R +G++
Sbjct  3676  SDPDLPRNGGPFTYQLI--GGKHKSWLSVDRNSGVV  3709


 Score = 443 bits (1139),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 416/1527 (27%), Positives = 700/1527 (46%), Gaps = 120/1527 (8%)

Query  125   FTYRFNEQPKEFNLDPVSGEIRTAVLLDRERLTSDRFDLVV------LSSQPTYPIEVKI  178
             ++    +Q  +F++   +G +R A  L+ ERL+  R+ L V      L +      E+ I
Sbjct  2315  YSIVLGDQNHDFSISEDTGVVRVAKNLNYERLS--RYSLTVRAEDCALENPAGDTAELTI  2372

Query  179   RVIDVNDNAPEFPESSIAVSFAESASA--GTKLLLDTATDRDTPENGITDDYSIVDGNAD  236
              ++D+NDN P F +S       E+     G  +L   A D DTP       Y + +G++D
Sbjct  2373  NILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSD  2432

Query  237   GKFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLD  296
               FR        I++S   +     LDREQ   Y+L + A D G PP  G  +V V V D
Sbjct  2433  -LFR--------INASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQD  2483

Query  297   VNDNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSETNERQFSVNPE  356
             +NDN P+F    Y A + E+ P GTH+LT +A DKD   NA+L + L   +  +F ++ E
Sbjct  2484  INDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSE  2543

Query  357   TGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHG-TPRQEGRTYVTVN  415
             TGE++T+   L+       +++ +  H          + + AQD   T  +     +T++
Sbjct  2544  TGEISTATT-LD-------REETSVYH----------LTLMAQDSSITEPRASSVNLTIS  2585

Query  416   LLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAGNE  475
             + D ND+ P+     F  T+    V E  +KG  V     +D D+G N+     I +G +
Sbjct  2586  VSDVNDNIPK-----FDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-SGRD  2639

Query  476   LRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHV  535
               +F++    + +    S +L  +  K    +   Y + I A D+G    S+ A L + +
Sbjct  2640  QHYFDI----NTKTGVVSTKL-ELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL  2694

Query  536   NDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNEHAWFA  595
                         +     +SE    G  +  ++AT    GL  +I Y   A G       
Sbjct  2695  RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI-AGGIMGDSLR  2753

Query  596   IDRDTGLVTT-RATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDEVPKFASS  654
             +D ++GL++  +  LD E+    E+ ++A DG        T + + + D ND  P     
Sbjct  2754  VDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQL  2813

Query  655   YLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQLMTK  714
                  + E      L+A + A D D G NG+V Y L      D+  TF + + +G++ T+
Sbjct  2814  IYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQ----NDFDGTFEI-TESGEIYTR  2868

Query  715   VTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTR  774
             + LDRE + +Y  +V A DQG P  + TA+VLL + D NDN P F    +   V  ++  
Sbjct  2869  MRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEI  2927

Query  775   GTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGPL--RHRSLFKLTV  832
             G+   ++ ++D D   NA   YS  S   G  F ++ ++G + + G L    +  + L V
Sbjct  2928  GSFVIRVTSSDLDLGANANASYSF-SENPGEKFRIEPQSGNITVAGHLDREQQDEYILKV  2986

Query  833   SARDNGDRAAARNALVEVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRD  892
              A D   RA     +   +  ++    EF+     + F  ++       ++   +   RD
Sbjct  2987  VASDGAWRA--ETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATD---RD  3041

Query  893   VGTVQVDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAITTAGCIDREKTAQYNLQVSAR  952
                     +QG   + ++Y+  L  P   F ID +TG + +   + R K +QY       
Sbjct  3042  --------KQGPN-SVISYS--LQQPSPMFSIDPATGEVFSKKAV-RFKHSQYVRSPENM  3089

Query  953   AGLA-----------YGLARVNVSVLDSNDNPPRFSSEEREEDVPLNELAAVGQEVCLAR  1001
               L            Y    VN++++D+++NPP+F  E+ E   PL + A  GQ +    
Sbjct  3090  YALTVLATDNGKPPLYSECLVNINIVDAHNNPPKF--EQAEYLAPLPQDAVRGQRIVRVH  3147

Query  1002  ARDR-DVGLNARVVYSLTRNPGQQFRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGA  1060
             A D+ D+G N      +T N    F +    G + L KP+  PP T  ++ V A D    
Sbjct  3148  ANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVP  3207

Query  1061  EQQQHSLATTQQIRVVIEDANNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNN  1120
              Q   +     ++ +V+   N  TP F + SY+  +PE+ PV      + A+D D GPN 
Sbjct  3208  PQSDET-----RVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPN-  3261

Query  1121  GRVSYWISEGNSEGRFGIFP-DGQLYVRNELDREEQDYYALEVTASDHGNPKRSSSVSLV  1179
             G + Y IS GN    F +    G + ++ +LD +    Y L +T  D G    SS   L 
Sbjct  3262  GMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLT  3321

Query  1180  VHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPATQQD--  1237
             + + D NDN P F +  +  ++ EN+P  TFV +  A+D+D+ +NA + Y+   +  D  
Sbjct  3322  IILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRH  3381

Query  1238  -FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVN  1296
              F ++  NG + S  +FD E     T    + ++A   D+     +     + V++  VN
Sbjct  3382  FFIMNQSNGTISSAVSFDYEERRIYT----LQIKAKNPDSS----MESYANLYVHVLGVN  3433

Query  1297  DNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTL-EDSGDEQFAIDEAT  1355
             +  PQF +  +   VSE +AVG ++  V  +D D G +G V+Y L   S D+ F ID  T
Sbjct  3434  EFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNT  3493

Query  1356  GQIILAKRLDRESRDTYRLTVVAHDAGQ-EMQLSASATVDVDVLDENDNAPRFVDGKPRI  1414
             G I +A+ LDRE+++   LTV+A + G      +  A V + + D ND  P F+      
Sbjct  3494  GLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTS  3552

Query  1415  SVPETTALNVELLRFRATDADLGS-NAELSYAITAGNKYDAFHVEPATGALYLRKPLDYE  1473
             ++ E   +  ++   +A D D+ + N + SY+I  GN   +F ++  TG +     LD E
Sbjct  3553  TISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDRE  3612

Query  1474  DQKFHQLNVSCSDSGHPRLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVT  1533
             +   + L +   D+G P  +   ++ +++ D NDN P F    +   I E  P    ++T
Sbjct  3613  ETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMT  3672

Query  1534  VSAEDPDSGDN-GLVSYAIASQEPEDEKRRFGINPATAVIHTLLPIEREEIDTFKLIVVA  1592
             + A DPD   N G  +Y +   +    K    ++  + V+ +    +RE     + I+  
Sbjct  3673  LIASDPDLPRNGGPFTYQLIGGK---HKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEV  3729

Query  1593  TDTAQPTSSRLSAEKSVTVIVTDVNDN  1619
              D+ +P   +  ++  +T+ V D NDN
Sbjct  3730  EDSGKP---KQKSQHLLTITVLDQNDN  3753


 Score = 433 bits (1113),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 495/1838 (27%), Positives = 805/1838 (44%), Gaps = 230/1838 (13%)

Query  99    EKRAQLE--VKEGEPLGTLVGRIPV------IPDF------TYRFNEQPKEFNLDPVSGE  144
             E+R++L   V E EP+GT +  +        I  F      T    +  + F++D   G 
Sbjct  1714  EQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGI  1773

Query  145   IRTAVLLDRERLTSDRFDL----VVLSSQP-TYPIEVKIRVIDVNDNAPEFPESSIAVSF  199
             + TA  LDRE    + +++    + L  QP T   +V++ V+D ND+ P+F ++    + 
Sbjct  1774  LSTAAELDRE-AGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNV  1832

Query  200   AESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSISSSYLHLETT  259
             +E    G  +    A D DT    +T  + ++DG+ DGKF L     PS     L+    
Sbjct  1833  SEDLQIGHTISTLRAHDPDT-LGSVT--FLLMDGH-DGKFLL----EPSTGKLILN----  1880

Query  260   SKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVLNESSPV  319
               LDRE    Y L +   D  Q  +       + V D NDNPP+F  + Y   + E++  
Sbjct  1881  DTLDRETKSKYELRIRVSDGVQYTEA---YATIQVSDTNDNPPLFEDTVYSFDIPENAQR  1937

Query  320   GTHILTVQAYDKDSEDNARLTY-YLSETNERQFSVNPETGEVTTSEAPLECPQQQSCQDQ  378
             G  +  + A D D   NA+L+Y  +S+     FS+NP+TG +T + A L+  + Q     
Sbjct  1938  GYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLT-ARLDYEEVQ-----  1991

Query  379   RAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGFA  438
                           ++ V AQD+G P       V  N+LD ND+ P      F P S  +
Sbjct  1992  ------------HYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAP-----IFDPMSYSS  2034

Query  439   TVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAGNELRHFELTGYNDDEASAQSFRLVR  498
              V EN    + V  +   D D G N      I AG+           D E    S   +R
Sbjct  2035  EVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDV----------DSEFGIDSNGTIR  2084

Query  499   VNGKLDREEIPKYNLTIVARD------------------RGNPPR---------------  525
                 LDRE    Y LT+ ARD                  +   PR               
Sbjct  2085  TRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQ  2144

Query  526   ---SATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYY  582
                S+T  + I + DVND  PVF  +  +A++  ++ + + V ++ A D D G N  I Y
Sbjct  2145  QRLSSTVKVTILIKDVNDEVPVFISANETAIMENVA-INTVVIAVKAVDNDEGRNGYIDY  2203

Query  583   DFEATGNEHAW------FAIDRDTGLVTTRATLDREIEGSVELRVQARDGGPNPKFVSTH  636
               +   +E         F+++   G +     LDRE+  S  L + ARD G  P+   + 
Sbjct  2204  LMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQ  2263

Query  637   LRVTILDENDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLR  696
             L + ILDEND  P F       +++EN    ++V  +SA D D+G NG + YS+   VL 
Sbjct  2264  LLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSI---VLG  2320

Query  697   DYPRTFALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPTQSS-TATVLLSIEDVNDN  755
             D    F++   TG +     L+ ER++ Y + V A D      +  TA + ++I D+NDN
Sbjct  2321  DQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDN  2380

Query  756   APVFYPTTYFFPVGRDST--RGTLAGKLFATDADSKE-NALIRYSLESGGDGGLFAMDER  812
              P F  + Y   V  ++    G     + A DAD+   N+ +RY L+  GD  LF ++  
Sbjct  2381  RPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKE-GDSDLFRINAS  2439

Query  813   TGELFLQGPL--RHRSLFKLTVSARDNGDRAAARNALVEVVDRESLVHLEFKAFDNGYRF  870
             +G++ L  PL    +S + LT+ A D G        +V V  ++          DN   F
Sbjct  2440  SGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQD--------INDNDPVF  2491

Query  871   RVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIASVTYAI---VLGDPEGRFRIDES  927
              +  +H    + L     PS   GT  +  +   K   +   +   +LG+   RF ID  
Sbjct  2492  ELQSYHATVRENL-----PS---GTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSE  2543

Query  928   TGAITTAGCIDREKTAQYNLQVSAR-AGLAYGLA---RVNVSVLDSNDNPPRFSSEEREE  983
             TG I+TA  +DRE+T+ Y+L + A+ + +    A    + +SV D NDN P+F S     
Sbjct  2544  TGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNV  2603

Query  984   DVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTRNPGQQFRIAEGTGIVYLAKPVTQP  1043
              VP  E  + G+ V  ARA D D G NA V Y+++      F I   TG+V     +   
Sbjct  2604  AVP--ERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTK  2661

Query  1044  PGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPVFELPSYETSLPESTPVN  1103
               +   +  T   SA  +Q + SL++  ++ V++           + +   ++ E     
Sbjct  2662  TKSHDDLTYTIVISA-MDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPG  2720

Query  1104  ERFFGLLASDADFGPNNGRVSYWISEGNSEGRFGIFPD-GQLYV-RNELDREEQDYYALE  1161
             +    + A+    G   G++ Y I+ G       + P+ G L V ++ LD E    Y + 
Sbjct  2721  KMITKVSATSPKKGL-VGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIW  2779

Query  1162  VTASDHGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDA  1221
             + A+D   P   S   + ++V D NDNAP      +   + E E     +  + ASDRD+
Sbjct  2780  IEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDS  2839

Query  1222  GRNADLTYSLPATQQDFAVD---PRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGA  1278
             G N ++ Y L   Q DF        +G + +    DRE +    G     +EA   D G 
Sbjct  2840  GDNGNVIYRL---QNDFDGTFEITESGEIYTRMRLDREEI----GDYAFVVEAV--DQG-  2889

Query  1279  MGRLRDRVKMSVYIGDVNDNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVF  1338
             +  +     + +++ D NDN P+F RL + + V+E A +G+ ++RV +SD D G N +  
Sbjct  2890  VPHMTGTASVLLHLLDKNDNPPKFTRL-FSLNVTENAEIGSFVIRVTSSDLDLGANANAS  2948

Query  1339  YTLEDSGDEQFAIDEATGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVL  1398
             Y+  ++  E+F I+  +G I +A  LDRE +D Y L VVA D        A   + + + 
Sbjct  2949  YSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWR----AETPITITIQ  3004

Query  1399  DENDNAPRFVDGKPRISVPETTALNVELLRFRATDAD-LGSNAELSYAITAGNKYDAFHV  1457
             D+NDNAP F       S PE       + +  ATD D  G N+ +SY++   +    F +
Sbjct  3005  DQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSP--MFSI  3062

Query  1458  EPATGALYLRKPLDYEDQKF-------HQLNVSCSDSGHPRLSSLVSLRVDVVDANDNPP  1510
             +PATG ++ +K + ++  ++       + L V  +D+G P L S   + +++VDA++NPP
Sbjct  3063  DPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPP  3122

Query  1511  VFPNTAIVRQIVEGLPVHRPVVTVSAEDP-DSGDN----GLVSYAIASQEPEDEKRRFGI  1565
              F     +  + +     + +V V A D  D G N     L+++ ++S         F +
Sbjct  3123  KFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSS--------IFSV  3174

Query  1566  NPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVF-V  1624
                   I  + PI+      ++L+V ATD   P  S    E  V ++VT  N + P F V
Sbjct  3175  GRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSD---ETRVVIVVTGENMDTPRFSV  3231

Query  1625  NMPAFVLPRTSPLRDEPVQIGQFLARDADSSTNGQVTYELLRSDNNYTDLVQIHRGTGML  1684
             N    ++P   P+    + +G   A D D+  NG + Y  +   N   D     R  G++
Sbjct  3232  NSYQVIVPENEPVGSTILTVG---ATDDDTGPNGMLRYS-ISGGNERQDFSVDERTGGIV  3287

Query  1685  AMRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWEHSGTLEG  1744
               + L    +  +    + +   D        S+ +  T+I+     + PV+ H      
Sbjct  3288  IQQQLD---YDLIQEYHLNITVQDLGYHP--LSSVAMLTIILTDVNDNPPVFNHK-EYHC  3341

Query  1745  SVRENEAVGTSVLRVRAKSRRRSGVVVAGDEP---VVEYYVTNVTAGVDGPMVDRLFDVD  1801
              + EN+ VGT V +  A  +         D P   ++ Y    + +G D       F ++
Sbjct  3342  YIPENKPVGTFVFQAHAADK---------DSPKNAIIHYAF--LPSGPD----RHFFIMN  3386

Query  1802  ARSGLLSTAAPLDRELGAEWYEVEVYAVVVGAARPSTS  1839
               +G +S+A   D E      E  +Y + + A  P +S
Sbjct  3387  QSNGTISSAVSFDYE------ERRIYTLQIKAKNPDSS  3418


 Score = 425 bits (1092),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 473/1767 (27%), Positives = 752/1767 (43%), Gaps = 249/1767 (14%)

Query  133   PKEFNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSSQPTYPI------EVKIRVIDVNDN  186
             P +F LD ++G++ T   LDRE+++  ++++ V++     P        V + V DVNDN
Sbjct  647   PLQFALDALTGQLTTRRPLDREKMS--QYEISVIARDQGAPTPQSATATVWLNVADVNDN  704

Query  187   APEF-PESSI--------AVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADG  237
              P+F P   I         +   +       LL  TA+D+D  +N + + Y +  G  +G
Sbjct  705   DPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIE-YRLESG-GEG  762

Query  238   KFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDV  297
              F+L         S  + L   +        +Y L V ARD GQ       +V + +   
Sbjct  763   LFQL------DARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVL---  813

Query  298   NDNPPMFLQSEYVAVLNESSPVGTH-----------ILTVQAYDKDSEDNARLTYYLSET  346
                  M    +  A   E   V  H           +  VQ    + + N+ + Y + + 
Sbjct  814   KSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQG  873

Query  347   NERQ-FSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPR  405
             +  Q F ++  +G +TT+  PL+  +Q + +       S+     +  ++          
Sbjct  874   DRAQNFRIDTRSGRITTAR-PLDREEQANYRLTILASSSSSSSAAASSVSY---------  923

Query  406   QEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSE  465
               G+  V + ++D ND+ P   F     +    ++ ENAA G  +    V D D G+NS 
Sbjct  924   --GQCIVNIAIIDLNDNAP--VFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSR  979

Query  466   TSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKL------DREEIPKYNLTIVARD  519
              S           + LT   +     Q FR+  V G L        E     ++ ++A D
Sbjct  980   IS-----------YSLTNNPN-----QQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATD  1023

Query  520   RGNPPRSATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNAR  579
              G+PP S+   L++ + DVNDH PVF  + Y   L E + V +   ++ ATD D G N R
Sbjct  1024  AGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGR  1083

Query  580   IYYDFEATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELRVQARDGGPNPKFVSTHLRV  639
             I Y+    GN    F +  D G +  RA LDRE      L V  RD G   +     + +
Sbjct  1084  ISYEI-IEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVI  1141

Query  640   TILDENDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYP  699
              ++DEND  P+F +S    ++ EN PAD+ V  L+AVD D G N  ++++L         
Sbjct  1142  HVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT-----  1196

Query  700   RTFALDSLTGQLMTKVTLDRERMAE---------------------YRIL-VVARDQGSP  737
             + F +D+  G + T    DRE + +                     Y +L     D G P
Sbjct  1197  QDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIP  1256

Query  738   TQSSTATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYS  797
                    V + + DVNDNAP F    Y   +   ++ GT    +F  DAD   N  + YS
Sbjct  1257  RLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYS  1316

Query  798   LESGGDGGLFAMDERTGELFLQGPLRHRS--LFKLTVSARDNGDRAAARNALVEVVDRES  855
             L  G + G F +D  TG+L L   L   S  +  L V A+D    AA ++ L       S
Sbjct  1317  LAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD----AALKHPLSS---NAS  1369

Query  856   LVHLEFKAFDNGYRF-------RVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIAS  908
             +  +     DN   F        V+E     ++ + ++ +          D  QG   + 
Sbjct  1370  ITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRAS----------DADQGVN-SQ  1418

Query  909   VTYAIVLGDPEGRFRIDESTGAITTAGCIDREKTAQYNLQVSARAGLAYGLARV---NVS  965
             V ++I  G+    F ID  TG++     +D E    Y L ++A       L+     NV 
Sbjct  1419  VVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVL  1478

Query  966   VLDSNDNPPRFSS----EEREEDVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTRN-  1020
             V+D NDNPP F S     + +E +PL         +    A D D GLN +V Y++++  
Sbjct  1479  VVDDNDNPPIFPSTAIVRQIKEGIPLK------TPIVTVTADDPDSGLNGKVSYAISKQE  1532

Query  1021  ----PGQQFRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVV  1076
                  G+ F I   TG+++  + + +      ++ V A D A   ++Q  L+T + + V+
Sbjct  1533  PQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQ--LSTEKLVTVI  1590

Query  1077  IEDANNHTPVFEL-------PSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYWISE  1129
             +ED N++ PVF         P + TS   ST V +    + A DAD   +NG V+Y I  
Sbjct  1591  VEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQ----VHAKDAD-SSSNGLVTYEIVS  1645

Query  1130  GNSE--------GRFGIFPDGQLYVRNELDREEQDYYALEVTASDHG--NPKRSSSVSLV  1179
             G  E        G     P  Q         +++  Y L + ++D    + +RSS V + 
Sbjct  1646  GPQELFKLQRNTGIITFTPGPQF--------KQEVRYQLTLKSTDEAVQSERRSSEVYIT  1697

Query  1180  VHVVDEN---DNAPQFGN-SSFTFHLRENEPADTFVGKLVASDRDAG-----RNADLTYS  1230
             +          + PQF   S  +  + ENEP  T +  + A    A       N   T S
Sbjct  1698  IITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGS  1757

Query  1231  LPATQQDFAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSV  1290
                  + F +D + G + +    DRE      G     +E      G   R   R K+ V
Sbjct  1758  RGQVDRLFDIDAKLGILSTAAELDRE-----AGPEEYEVEVYAIALGGQPRT-SRTKVRV  1811

Query  1291  YIGDVNDNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSGDEQFA  1350
              + D ND+ PQF   P+   VSE   +G+ +  +   D D    G V + L D  D +F 
Sbjct  1812  TVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL--GSVTFLLMDGHDGKFL  1869

Query  1351  IDEATGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDG  1410
             ++ +TG++IL   LDRE++  Y L +   D  Q  +  A+    + V D NDN P F D 
Sbjct  1870  LEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYTEAYAT----IQVSDTNDNPPLFEDT  1925

Query  1411  KPRISVPETTALNVELLRFRATDADLGSNAELSYAITAGNKYDAFHVEPATGALYLRKPL  1470
                  +PE      ++ +  A DADLG NA+LSY + +    D F + P TG L L   L
Sbjct  1926  VYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARL  1985

Query  1471  DYEDQKFHQLNVSCSDSGHPRLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRP  1530
             DYE+ + + L V   D+G P LS+ +++  +V+D NDN P+F   +   ++ E +P+   
Sbjct  1986  DYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATE  2045

Query  1531  VVTVSAEDPDSGDNGLVSYAIASQEPEDEKRRFGINPATAVIHTLLPIEREEIDTFKLIV  1590
             VVTVSA+D DSG+NGL+ Y+I + + + E   FGI+ +   I T   ++RE   T+ L V
Sbjct  2046  VVTVSAKDIDSGNNGLIEYSITAGDVDSE---FGID-SNGTIRTRRNLDREHRSTYTLTV  2101

Query  1591  VATDTAQPTSS---------------------------------RLSAEKSVTVIVTDVN  1617
              A D A   +S                                 RLS+   VT+++ DVN
Sbjct  2102  TARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVN  2161

Query  1618  DNAPVFVNMPAFVLPRTSPLRDEPVQIGQFLARDADSSTNGQVTY---ELLRSDNNYTDL  1674
             D  PVF++     +     +    + +    A D D   NG + Y   E    D   +D 
Sbjct  2162  DEVPVFISANETAIMENVAINTVVIAVK---AVDNDEGRNGYIDYLMKEARDEDMGQSDP  2218

Query  1675  VQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVPGAEGDGP  1734
             +          +R++  +         + + A D     +  STES   + +     + P
Sbjct  2219  LPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQ--STESQLLIRILDENDNSP  2276

Query  1735  VWEHSGTLEGSVRENEAVGTSVLRVRA  1761
             V++       SV EN ++G  VL+V A
Sbjct  2277  VFD-PKQYSASVAENASIGAMVLQVSA  2302


 Score = 409 bits (1050),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 459/1697 (27%), Positives = 756/1697 (45%), Gaps = 181/1697 (11%)

Query  174   IEVKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDG  233
             ++V I + DVND  P F  S+   +  E+ +  T ++   A D D   NG  D Y + + 
Sbjct  2151  VKVTILIKDVNDEVPVFI-SANETAIMENVAINTVVIAVKAVDNDEGRNGYID-YLMKEA  2208

Query  234   NADGKFR---LLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLV  290
               +   +   L  + NP+       L     LDRE    Y LN+ ARDRG+PP+     +
Sbjct  2209  RDEDMGQSDPLPFSLNPTDG----QLRVVDALDRELRSSYLLNITARDRGEPPQSTESQL  2264

Query  291   NVTVLDVNDNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSETNERQ  350
              + +LD NDN P+F   +Y A + E++ +G  +L V A D D   N R+ Y +   ++  
Sbjct  2265  LIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNH  2324

Query  351   -FSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGR  409
              FS++ +TG V  +         ++   +R  R+S         + V A+D       G 
Sbjct  2325  DFSISEDTGVVRVA---------KNLNYERLSRYS---------LTVRAEDCALENPAGD  2366

Query  410   TY-VTVNLLDSNDHDPEIRFTYFPPTSGFATVDENAA--KGSIVAAIGVIDADEG-LNSE  465
             T  +T+N+LD ND+ P      F  +   A V EN     G  V  +   DAD   LNS+
Sbjct  2367  TAELTINILDINDNRPT-----FLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQ  2421

Query  466   TSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPR  525
                 ++ G+     +L   N   AS+    L++    LDRE+  +Y LT+VA D G+PP 
Sbjct  2422  VRYFLKEGDS----DLFRIN---ASSGDIALLK---PLDREQQSEYTLTLVAMDTGSPPL  2471

Query  526   SATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYDFE  585
             + T  + + V D+ND++PVF+   Y A + E  P G+ V +  ATD D GLNA++ ++  
Sbjct  2472  TGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL-  2530

Query  586   ATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELRVQARDGG-PNPKFVSTHLRVTILDE  644
               G     F ID +TG ++T  TLDRE      L + A+D     P+  S +L +++ D 
Sbjct  2531  -LGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDV  2589

Query  645   NDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFAL  704
             ND +PKF S+   VA+ E       V    A+D D G N  V Y++     RD    F +
Sbjct  2590  NDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISG---RDQ-HYFDI  2645

Query  705   DSLTGQLMTKVTLDRERMAE----YRILVVARDQGSPTQSSTA--TVLLSIEDVNDNAPV  758
             ++ TG + TK+ L  +  +     Y I++ A DQG  + SS A  TV+L         P 
Sbjct  2646  NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-------RPPE  2698

Query  759   FYPTTYF-----FPVGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERT  813
              +PT  +     F +  D   G +  K+ AT         IRY++  G  G    +D  +
Sbjct  2699  LFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNS  2758

Query  814   GELF-----LQGPLRHRSLFKLTVSARDNGDRAAARNALVEVVDRESLVHLEFK-AFDNG  867
             G L      L   L H  L+++ + A D GD  + R+         +L+ L    A DN 
Sbjct  2759  GLLSVGQDGLDYELTH--LYEIWIEAAD-GDTPSLRSV--------TLITLNVTDANDNA  2807

Query  868   YRFRVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIASVTYAIVLGDPEGRFRIDES  927
                 VME     ++ L  + +P + +  V+   +      +V Y +   D +G F I ES
Sbjct  2808  ---PVMEQLIYNAEVLE-EESPPQLIAVVKASDRDSGDNGNVIYRL-QNDFDGTFEITES  2862

Query  928   TGAITTAGCIDREKTAQYNLQVSA-RAGLAY--GLARVNVSVLDSNDNPPRFSSEEREED  984
              G I T   +DRE+   Y   V A   G+ +  G A V + +LD NDNPP+F+   R   
Sbjct  2863  -GEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFT---RLFS  2918

Query  985   VPLNELAAVGQEVCLARARDRDVGLNARVVYSLTRNPGQQFRIAEGTGIVYLAKPVTQPP  1044
             + + E A +G  V    + D D+G NA   YS + NPG++FRI   +G + +A  + +  
Sbjct  2919  LNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQ  2978

Query  1045  GTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPVFELPSYETSLPESTPVNE  1104
                  ++V A D A   +          I + I+D N++ P FE   Y  S PE      
Sbjct  2979  QDEYILKVVASDGAWRAETP--------ITITIQDQNDNAPEFEHSFYSFSFPELQQSIA  3030

Query  1105  RFFGLLASDADFGPNNGRVSYWISEGNSEGRFGIFP-DGQLYVR-------NELDREEQD  1156
                 ++A+D D    N  +SY + + +    F I P  G+++ +       ++  R  ++
Sbjct  3031  LVGQIIATDRDKQGPNSVISYSLQQPSP--MFSIDPATGEVFSKKAVRFKHSQYVRSPEN  3088

Query  1157  YYALEVTASDHGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVA  1216
              YAL V A+D+G P   S   + +++VD ++N P+F  + +   L ++      + ++ A
Sbjct  3089  MYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHA  3148

Query  1217  SDR-DAGRNADLTYSLPATQQD--FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATV  1273
             +D+ D G N ++ YSL        F+V   +G++  ++       V       + + AT 
Sbjct  3149  NDKQDLGTN-EMDYSLMTFNLSSIFSVGRHDGWITLVKPIQ----VPPNTRYELVVRAT-  3202

Query  1274  HDNGAMGRLRDRVKMSVYIGDVNDNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGL  1333
              D G   +  D  ++ + +   N + P+F    YQ+ V E   VG+ +L V  +D D G 
Sbjct  3203  -DRGVPPQ-SDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGP  3260

Query  1334  NGDVFYTLEDSGDEQ-FAIDEATGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASAT  1392
             NG + Y++    + Q F++DE TG I++ ++LD +    Y L +   D G    LS+ A 
Sbjct  3261  NGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYH-PLSSVAM  3319

Query  1393  VDVDVLDENDNAPRFVDGKPRISVPETTALNVELLRFRATDADLGSNAELSYA-ITAGNK  1451
             + + + D NDN P F   +    +PE   +   + +  A D D   NA + YA + +G  
Sbjct  3320  LTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD  3379

Query  1452  YDAFHVEPATGALYLRKPLDYEDQKFHQLNVSCSDSGHPRLSSLVSLRVDVVDANDNPPV  1511
                F +  + G +      DYE+++ + L +   +     + S  +L V V+  N+  P 
Sbjct  3380  RHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS-SMESYANLYVHVLGVNEFYPQ  3438

Query  1512  FPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEPEDEKRRFGINPATAV  1571
             F        + E   V   V  V A D DSG++G V Y +         + F I+  T +
Sbjct  3439  FLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSS---NDKGFRIDTNTGL  3495

Query  1572  IHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFVNMPAFVL  1631
             I+    ++RE  +   L V+A +     S R +      VI++  + N P     P F+ 
Sbjct  3496  IYVARHLDRETQNRVVLTVMAKNYG---SIRGNDTDEAQVIISIQDGNDP-----PEFIK  3547

Query  1632  PRTSPLRDEPVQIGQFL----ARDADSST-NGQVTYELLRSDNNYTDLVQIHRGTGMLAM  1686
                +    E   +G  +    A D D  T N Q +Y ++  +   +  + +  G    A 
Sbjct  3548  HYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTAS  3607

Query  1687  RL------LGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWEHSG  1740
             RL         +V G +D            +    ++  +   + +     +GP +   G
Sbjct  3608  RLDREETSTYNLVIGAID------------TGLPPQTGSATVHIELEDVNDNGPTFTPEG  3655

Query  1741  TLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTNVTAGVDGPMVDRLFDV  1800
              L G + ENE  GTS++            ++A D P +       T  + G        V
Sbjct  3656  -LNGYISENEPAGTSIM-----------TLIASD-PDLPRNGGPFTYQLIGGKHKSWLSV  3702

Query  1801  DARSGLLSTAAPLDREL  1817
             D  SG++ +    DRE+
Sbjct  3703  DRNSGVVRSTTSFDREM  3719


 Score = 387 bits (994),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 475/1773 (27%), Positives = 760/1773 (43%), Gaps = 227/1773 (13%)

Query  145   IRTAVLLDRERLTSDRFDLVVLSSQPTYPI-----EVKIRVIDVNDNAPEFPESSIAVSF  199
             +R   +LDRE +   +++L V++     P       + I V DVND+ P F +S  +   
Sbjct  446   VRVNGVLDREEI--GKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVL  503

Query  200   AESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRL-LVTGNPSISSSYLHLET  258
             +E A  G+ +   TATD DT  N     Y I+ GN    F +  +TG          + T
Sbjct  504   SELAPTGSFVASITATDEDTGVNAQVH-YDILSGNELKWFSMDPLTG---------LIVT  553

Query  259   TSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVLNESSP  318
             T  LDRE  +   L++ ARD G  PK     + V +LD ND  P F Q E    L E +P
Sbjct  554   TGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAP  613

Query  319   VGTHILTVQAYDKDSEDNARLTYYLSETNER----QFSVNPETGEVTTSEAPLECPQQQS  374
               T +  + A D D   N  +T+ L+ + ER    QF+++  TG++TT   PL+  +   
Sbjct  614   PQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRR-PLDREKMSQ  672

Query  375   CQDQRAKRHSAGGCPKSCVIAVFAQDHGTPR-QEGRTYVTVNLLDSNDHDPEI---RFTY  430
              +                 I+V A+D G P  Q     V +N+ D ND+DP+     + Y
Sbjct  673   YE-----------------ISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIY  715

Query  431   -FPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAGNELRHFELTGYNDDEA  489
                       + +   K  I+  +   D D+G N+     + +G E   F+L    D  +
Sbjct  716   SLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQL----DARS  770

Query  490   SAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHVND------------  537
              A S   +R +        P Y L + ARD G       A + I +              
Sbjct  771   GAIS---LRGDAPASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQA  827

Query  538   -------VNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNE  590
                    V DHE    Q   S    E+      +  + +T+     N+ I YD    G+ 
Sbjct  828   GGYEFQMVEDHE----QQRNSQPNREVG-----IVQVKSTNGKA--NSHIEYDI-IQGDR  875

Query  591   HAWFAIDRDTGLVTTRATLDREIEGSVELRV------QARDGGPNPKFVSTHLRVTILDE  644
                F ID  +G +TT   LDRE + +  L +       +     +  +    + + I+D 
Sbjct  876   AQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDL  935

Query  645   NDEVPKFA---SSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRT  701
             ND  P FA    S   ++L EN      +      D D G N  ++YSL      +  + 
Sbjct  936   NDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSL----TNNPNQQ  991

Query  702   FALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFYP  761
             F +  +TG L  +  +  E  +   + ++A D GSP  SS  ++ + I DVND+ PVF  
Sbjct  992   FRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDH  1051

Query  762   TTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGP  821
             T+Y   +   +   T    L ATD D  +N  I Y +  G    +F +    G LF++ P
Sbjct  1052  TSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP-DGYLFVRAP  1110

Query  822   L--RHRSLFKLTVSARDNGD--RAAARNALVEVVDRESLVHLEFKAFDNG-YRFRVMEHH  876
             L    R  + LTVS RD G   R++    ++ V+D           F N  + F + E+ 
Sbjct  1111  LDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDEND----NAPQFTNSTFTFSIPENA  1166

Query  877   GDCSDKLAYKNTP-SRDVGTVQVDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAITTAG  935
                +D    K T   RD+G             +   +  L      F ID   G I T  
Sbjct  1167  P--ADTFVGKLTAVDRDIGR------------NAELSFTLSSQTQDFTIDTRNGFIKTLR  1212

Query  936   CIDREKTAQYNLQVSA-------RAGLA--YGL----------------ARVNVSVLDSN  970
               DRE   + +    A       R  +A  Y L                 +V V V D N
Sbjct  1213  PFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVN  1272

Query  971   DNPPRFSSEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTR-NPGQQFRIAE  1029
             DN P F        V ++E A+ G  +     +D D GLN  V YSL + N   QF +  
Sbjct  1273  DNAPEFLRAPYH--VTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDS  1330

Query  1030  GTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPVFEL  1089
              TG + L + + +    +  + V A+D+A     +H L++   I +V+ D N++ P F  
Sbjct  1331  ATGQLSLGRRLDRESQEIHHLIVVAKDAA----LKHPLSSNASITIVVLDENDNAPEFTQ  1386

Query  1090  PSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYWISEGNSEGRFGIFP-DGQLYVRN  1148
              S E S+ E++P         ASDAD G N+ +V + IS GN    F I    G LY+  
Sbjct  1387  SSSEVSVLETSPTGTELMRFRASDADQGVNS-QVVFSISAGNRRDTFHIDSITGSLYLHK  1445

Query  1149  ELDREEQDYYALEVTASDHGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPAD  1208
              LD E+   Y L +TASD G P  S++V   V VVD+NDN P F +++    ++E  P  
Sbjct  1446  PLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLK  1505

Query  1209  TFVGKLVASDRDAGRNADLTYSLPATQ------QDFAVDPRNGFVRSLRAFDREHLVAST  1262
             T +  + A D D+G N  ++Y++   +      + F ++   G + +LR  DRE    S 
Sbjct  1506  TPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRE----SI  1561

Query  1263  GGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKRLPYQI---QVSEAAAVGN  1319
                 +++ AT     +  +L     ++V + D+NDNAP F  +   I   + S +     
Sbjct  1562  DTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSST  1621

Query  1320  QLLRVYTSDADEGLNGDVFYTLEDSGDEQFAIDEATGQIILAKRLDRESRDTYRLTVVAH  1379
              +++V+  DAD   NG V Y +     E F +   TG I        +    Y+LT+ + 
Sbjct  1622  AVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKST  1681

Query  1380  DAGQEMQLSASATVDVDVLD-----ENDNAPRFVD-GKPRISVPETTALNVELLRFRATD  1433
             D   + +   S+ V + ++         + P+F    K   SV E   +   +L   A  
Sbjct  1682  DEAVQSE-RRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHL  1740

Query  1434  ADLGSNAELSYAITA-------GNKYDAFHVEPATGALYLRKPLDYE--DQKFHQLNVSC  1484
             A    +AE+ Y +T        G     F ++   G L     LD E   +++     + 
Sbjct  1741  A----SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAI  1796

Query  1485  SDSGHPRLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDN  1544
             +  G PR +S   +RV V+D ND+PP F +T  V  + E L +   + T+ A DPD+   
Sbjct  1797  ALGGQPR-TSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL--  1853

Query  1545  GLVSYAIASQEPEDEKRRFGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLS  1604
             G V++ +     +    +F + P+T  +     ++RE    ++L +  +D  Q T     
Sbjct  1854  GSVTFLLM----DGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDGVQYT-----  1904

Query  1605  AEKSVTVIVTDVNDNAPVFVN-MPAFVLPRTSPLRDEPVQIGQFLARDADSSTNGQVTYE  1663
              E   T+ V+D NDN P+F + + +F +P  +       Q+GQ +ARDAD   N Q++Y 
Sbjct  1905  -EAYATIQVSDTNDNPPLFEDTVYSFDIPENA---QRGYQVGQIVARDADLGQNAQLSYG  1960

Query  1664  LLRSDNNYTDLVQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYAT  1723
             ++    N  D+  ++  TGML   L   + +  V    + V+A D    +   +   Y  
Sbjct  1961  VVSDWAN--DVFSLNPQTGMLT--LTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCN  2016

Query  1724  LIVPGAEGDGPVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVT  1783
             ++      + P+++   +    V EN  + T V+ V AK       + +G+  ++EY   
Sbjct  2017  VL--DLNDNAPIFD-PMSYSSEVFENVPIATEVVTVSAKD------IDSGNNGLIEY---  2064

Query  1784  NVTAGVDGPMVDRLFDVDARSGLLSTAAPLDRE  1816
             ++TAG     VD  F +D+ +G + T   LDRE
Sbjct  2065  SITAG----DVDSEFGIDS-NGTIRTRRNLDRE  2092


 Score = 379 bits (972),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 400/1448 (28%), Positives = 621/1448 (43%), Gaps = 138/1448 (10%)

Query  136   FNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSSQPTYPIE----VKIRVIDVNDNAPEFP  191
             F ++  SG+I     LDRE+ +     LV + +  + P+     V++ V D+NDN P F 
Sbjct  2434  FRINASSGDIALLKPLDREQQSEYTLTLVAMDTG-SPPLTGTGIVRVEVQDINDNDPVFE  2492

Query  192   ESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLL--VTGNPSI  249
               S   +  E+  +GT +L   ATD+D    G+         NA  +F LL        I
Sbjct  2493  LQSYHATVRENLPSGTHVLTPRATDKD---EGL---------NAKLRFNLLGEHMHRFHI  2540

Query  250   SSSYLHLETTSKLDREQIEYYSLNVCARDRG-QPPKLGCLLVNVTVLDVNDNPPMFLQSE  308
              S    + T + LDRE+   Y L + A+D     P+   + + ++V DVNDN P F  + 
Sbjct  2541  DSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTT  2600

Query  309   YVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSETNERQFSVNPETGEVTTSEAPLE  368
             Y   + E    G  +   +A D D  +NA + Y +S  ++  F +N +TG V+T    LE
Sbjct  2601  YNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTK---LE  2657

Query  369   CPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRF  428
                +    D             +  I + A D G      +  +TV L       PE+  
Sbjct  2658  LKTKTKSHDDL-----------TYTIVISAMDQGEQSLSSKAELTVIL-----RPPELFP  2701

Query  429   TY-FPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAG---NELRHFELTGY  484
             T+ +   S FA + E+   G ++  +      +GL  +    I  G   + LR       
Sbjct  2702  TFAYMANSHFA-MSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLR-------  2753

Query  485   NDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHVNDVNDHEPV  544
                     S  L      LD E    Y + I A D   P   +   + ++V D ND+ PV
Sbjct  2754  ----VDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPV  2809

Query  545   FQQSEYSA-VLSELSPVGSFVASITATDADTGLNARIYY----DFEATGNEHAWFAIDRD  599
              +Q  Y+A VL E SP    +A + A+D D+G N  + Y    DF+ T      F I  +
Sbjct  2810  MEQLIYNAEVLEEESP-PQLIAVVKASDRDSGDNGNVIYRLQNDFDGT------FEI-TE  2861

Query  600   TGLVTTRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDEVPKFASSYLEVA  659
             +G + TR  LDRE  G     V+A D G      +  + + +LD+ND  PKF +    + 
Sbjct  2862  SGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLN  2920

Query  660   LSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQLMTKVTLDR  719
             ++EN    S V  +++ D D G N + +YS       +    F ++  +G +     LDR
Sbjct  2921  VTENAEIGSFVIRVTSSDLDLGANANASYSFS----ENPGEKFRIEPQSGNITVAGHLDR  2976

Query  720   ERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTRGTLAG  779
             E+  EY + VVA D     ++    + ++I+D NDNAP F  + Y F          L G
Sbjct  2977  EQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVG  3033

Query  780   KLFATDADSK-ENALIRYSLESGGDGGLFAMDERTGELFLQGPLRHR---------SLFK  829
             ++ ATD D +  N++I YSL+      +F++D  TGE+F +  +R +         +++ 
Sbjct  3034  QIIATDRDKQGPNSVISYSLQQPSP--MFSIDPATGEVFSKKAVRFKHSQYVRSPENMYA  3091

Query  830   LTVSARDNGDRAAARNALVEV--VDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKN  887
             LTV A DNG        LV +  VD          A +N  +F   E+       L    
Sbjct  3092  LTVLATDNGKPPLYSECLVNINIVD----------AHNNPPKFEQAEYLA----PLPQDA  3137

Query  888   TPSRDVGTVQVDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAITTAGCIDREKTAQYNL  947
                + +  V  + +Q      + Y+++  +    F +    G IT    I      +Y L
Sbjct  3138  VRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYEL  3197

Query  948   QVSAR---AGLAYGLARVNVSVLDSNDNPPRFSSEEREEDVPLNELAAVGQEVCLARARD  1004
              V A            RV + V   N + PRFS    +  VP NE   VG  +    A D
Sbjct  3198  VVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENE--PVGSTILTVGATD  3255

Query  1005  RDVGLNARVVYSLTR-NPGQQFRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQ  1063
              D G N  + YS++  N  Q F + E TG + + + +         + +T +D       
Sbjct  3256  DDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLG-----  3310

Query  1064  QHSLATTQQIRVVIEDANNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRV  1123
              H L++   + +++ D N++ PVF    Y   +PE+ PV    F   A+D D  P N  +
Sbjct  3311  YHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKD-SPKNAII  3369

Query  1124  SYWISEGNSEGRFGIF--PDGQLYVRNELDREEQDYYALEVTASDHGNPKRS--SSVSLV  1179
              Y       +  F I    +G +      D EE+  Y L++ A    NP  S  S  +L 
Sbjct  3370  HYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAK---NPDSSMESYANLY  3426

Query  1180  VHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPATQQD--  1237
             VHV+  N+  PQF    F F + E     T VG + A+D+D+G +  + Y L  +  D  
Sbjct  3427  VHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKG  3486

Query  1238  FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAM-GRLRDRVKMSVYIGDVN  1296
             F +D   G +   R  DRE        N + L     + G++ G   D  ++ + I D N
Sbjct  3487  FRIDTNTGLIYVARHLDRE------TQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGN  3540

Query  1297  DNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVF-YTLEDSGDEQ-FAIDEA  1354
             D  P+F +  Y   +SEAA VG ++  V   D D     + F Y++ +   +Q F ID  
Sbjct  3541  D-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQ  3599

Query  1355  TGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKPRI  1414
             TG+I  A RLDRE   TY L + A D G   Q + SATV +++ D NDN P F       
Sbjct  3600  TGEISTASRLDREETSTYNLVIGAIDTGLPPQ-TGSATVHIELEDVNDNGPTFTPEGLNG  3658

Query  1415  SVPETTALNVELLRFRATDADLGSNA-ELSYAITAGNKYDAFHVEPATGALYLRKPLDYE  1473
              + E       ++   A+D DL  N    +Y +  G       V+  +G +      D E
Sbjct  3659  YISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDRE  3718

Query  1474  DQKFHQLNVSCSDSGHPRLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEG-LPVHRPVV  1532
                  +  +   DSG P+  S   L + V+D NDNP    +  I   +  G LP +  + 
Sbjct  3719  MTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPSNVKLA  3778

Query  1533  TVSAEDPD  1540
              V   D D
Sbjct  3779  DVRPNDID  3786


 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 108/244 (44%), Gaps = 28/244 (11%)

Query  106   VKEGEPLGTLVGRIPVIP--------DFTYRF--NEQPKEFNLDPVSGEIRTAVLLDRER  155
             + E  P+GT V  +  I          F+Y        + F +D  +GEI TA  LDRE 
Sbjct  3554  ISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREE  3613

Query  156   LTSDRFDLVVLSSQPTYPIE-----VKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLL  210
              ++  ++LV+ +     P +     V I + DVNDN P F    +    +E+  AGT ++
Sbjct  3614  TST--YNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIM  3671

Query  211   LDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSISSSYLHLETTSKLDREQIEYY  270
                A+D D P NG    Y ++ G    K  L V  N  +      + +T+  DRE     
Sbjct  3672  TLIASDPDLPRNGGPFTYQLIGGKH--KSWLSVDRNSGV------VRSTTSFDREMTPIL  3723

Query  271   SLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAV--LNESSPVGTHILTVQA  328
                +   D G+P +    L+ +TVLD NDNP    +S ++AV   N   P    +  V+ 
Sbjct  3724  EAIIEVEDSGKPKQKSQHLLTITVLDQNDNPST-TRSLHIAVSLFNGDLPSNVKLADVRP  3782

Query  329   YDKD  332
              D D
Sbjct  3783  NDID  3786


>DS_DROME unnamed protein product
Length=3503

 Score = 655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/1778 (32%), Positives = 845/1778 (48%), Gaps = 163/1778 (9%)

Query  135   EFNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSSQPTYPIEVKIRVIDVNDNAPEFPESS  194
             +  +D  +GEIRT V LDRE   S     + LS +    I V + V D NDNAP FP++S
Sbjct  69    DLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFPQTS  125

Query  195   IAVSFAESASAGTKLLLDTATDRDT-PENGITDDYSIVDGNADGKFRLLVTGNPSISSSY  253
             + + F E+     K  L  A D D  P N  T  Y+IV GN +  FRL  +        Y
Sbjct  126   MHIEFPENTPREVKRTLLPARDLDLEPYN--TQRYNIVSGNVNDAFRL-SSHRERDGVLY  182

Query  254   LHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVL  313
             L L+ +  LDRE    YSL + A D G PP  G + VN+T+ DVNDN P+F QS Y A +
Sbjct  183   LDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATV  242

Query  314   NESSPVGTHILTVQAYDKDSEDNARLTYYLSET---NERQFSVNPETGEVTTSEAPLECP  370
              E++ VGT +L V A D D+++N  + Y ++      E+ F ++P TG +  ++A L+  
Sbjct  243   PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA-LDFE  301

Query  371   QQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTY  430
              ++  +                 + V A+DHG    E   +V++ + D ND+ P I   +
Sbjct  302   TKELHE-----------------LVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIF  344

Query  431   FPPTSGFATVDENAAKGSIVAAIGVIDADEGLN-SETSIEIRAGNELRHFELTGYNDDEA  489
                 +    + E+A  G  VA I V D D     +  ++ +  G+   HF LT  ++   
Sbjct  345   LSDDAS-PKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDG--HFALTTRDN---  398

Query  490   SAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHVNDVNDHEPVFQQSE  549
                S  LV V+  LDRE +  Y L++VA D+G PP  A+  + + + DVND+ P F+Q  
Sbjct  399   ---SIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDL  455

Query  550   YSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNEHA-WFAIDRDTGLVTTRAT  608
             Y A + E++  G+ V  + A D D GLN+ + Y    T   HA WF ID  TGL+TTR+ 
Sbjct  456   YHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSH  515

Query  609   LDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDEVPKFASSYLEVALSENTPADS  668
             +D E E   +L V ARDGG  P   +  + VTI D ND  P F  S+  V+++EN P   
Sbjct  516   IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGR  575

Query  669   LVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQLMTKVTLDRERMAEYRIL  728
              +  +SA D D G N  V Y++       +   F + S +G++     LD ER + Y   
Sbjct  576   CILKVSASDPDCGVNAMVNYTIGEGF--KHLTEFEVRSASGEICIAGELDFERRSSYEFP  633

Query  729   VVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFF-----PVGRDSTRGTLAGKLFA  783
             V+A D+G    S+TA + + + DVNDN PVFYP  Y       P        T    + A
Sbjct  634   VLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVA  691

Query  784   TDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGP----LRHRSLFKLTVSARDNGD  839
             TD D      + Y + +G + G+F +D  TGE+F+  P    +R + +  L +SA D G+
Sbjct  692   TDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN  751

Query  840   RAAARNALV--EVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRD-VGTV  896
               +  +A+V   ++D      +  KA    Y + V E            + P    VG+V
Sbjct  752   LRSNADAVVFLSIIDAMQRPPIFEKA---RYNYYVKE------------DIPRGTVVGSV  796

Query  897   QVDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAITTAGCIDREKTAQYNLQVSARAG--  954
                       + V Y+I  GDP+G F I+ ++G I  A  +D E  +Q  L + A  G  
Sbjct  797   IAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP  856

Query  955   LAYGLARVNVSVLDSNDNPPRFSSEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVV  1014
               YG  +VN+ V D NDN P F +      VP  E A +G  +  A A D+D G + +V 
Sbjct  857   PVYGHTQVNIEVEDVNDNAPEFEASMVRISVP--ESAELGAPLYAAHAHDKDSGSSGQVT  914

Query  1015  YSLTRNPGQQ-FRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQI  1073
             YSL +  G+  F I   +G + L++ +         + VTA D         SL+T   I
Sbjct  915   YSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP-----SLSTNLTI  969

Query  1074  RVVIEDANNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYW-------  1126
              V ++D N++ PVFE   Y  ++ ES  +N +   + ASD D G NN R++Y        
Sbjct  970   LVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTG-NNARITYRIVDAGVD  1028

Query  1127  -----ISEGNSEGRFGIFPD-GQLYVRNELDREEQDYYALEVTASDHGNPKRSSSVSLVV  1180
                  IS  +    FGIFP+ G +Y+R  LDRE +D Y L V A+D+G P   +   ++V
Sbjct  1029  NVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIV  1088

Query  1181  HVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPATQQDFAV  1240
              V+D NDN P+F  S + F + EN    + VG + ASD D G NA + YSL      F V
Sbjct  1089  RVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQV  1148

Query  1241  DPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAP  1300
              P  G + +    DRE         +  L     D G   R   RV + +++ DVNDNAP
Sbjct  1149  HPVTGEISTREPLDRELR------ELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAP  1201

Query  1301  QFKRLPYQ--IQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTL----EDSGDEQFAIDEA  1354
             +    P +  + V E    G +++RV   D D G N  + Y++    +  G   F+ID  
Sbjct  1202  EIAD-PQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPT  1260

Query  1355  TGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKPRI  1414
             +G I     LD E R  YRL V A D G   + +    + V+VLD NDN P F       
Sbjct  1261  SGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVR-MLRVEVLDLNDNRPTFTSSSLVF  1319

Query  1415  SVPETTALNVELLRFRATD--ADLGSNA--------ELSYAITAGNK---YDAFHVEPAT  1461
              V E  AL   +      +  AD+  N+         ++Y +    K     AF ++  +
Sbjct  1320  RVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHS  1379

Query  1462  GALYLRKPLDYEDQKFHQLNVSCSD---SGHPRLSSLVSLRVDVVDANDNPPVFPNTAIV  1518
             G L + + LD E Q   +L +   D   S +P+ SS ++++++V D NDN P +P   I 
Sbjct  1380  GNLVVARLLDREVQSEFRLEIRALDTTASNNPQ-SSAITVKIEVADVNDNAPEWPQDPID  1438

Query  1519  RQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEP------EDEKRRFGINPATAVI  1572
              Q+ E  PV   +   +A D D+G NG + Y +    P      E     F ++  T  +
Sbjct  1439  LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL  1498

Query  1573  HTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFVNMPAFVLP  1632
                 P++ E +  + LIV A D +   + RL    +V + + D ND+AP FV+  +    
Sbjct  1499  SLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGK  1558

Query  1633  RTSPLRDEPVQIGQFLAR----DADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLAMRL  1688
               S    +  +IG+ +A     D DS  NGQ+TYE+  +  N     +I+  TG++   L
Sbjct  1559  TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI--TGGNGEGRFRINSQTGII--EL  1614

Query  1689  LGGVVFGRVD-----RLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWEHSGTLE  1743
             +  +     D     R  + + A D   Q E + +     LIV G+  + P +  +    
Sbjct  1615  VKSLPPATEDVEKGGRFNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRFLQA-VYR  1672

Query  1744  GSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTNVTAGVDGPMVDRLFDVDAR  1803
              ++ EN   G+ VL+V AKS       + G E     Y   + AGV     + LF VD +
Sbjct  1673  ATILENVPSGSFVLQVTAKS-------LHGAENANLSY--EIPAGV----ANDLFHVDWQ  1719

Query  1804  SGLLSTAAPLDRELGAEWYEVEVYAVVVGAARPSTSST  1841
              G+++T    DRE  A  Y + VY  V  A R ST S+
Sbjct  1720  RGIITTRGQFDRESQAS-YVLPVY--VRDANRQSTLSS  1754


 Score = 473 bits (1217),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 527/1829 (29%), Positives = 793/1829 (43%), Gaps = 216/1829 (12%)

Query  128   RFNEQPKEFNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSS-QPTYPIE----VKIRVID  182
             R +++ + F +DP +G I     LD E  T +  +LVV++      P+E    V IRV D
Sbjct  275   RQSDKEQMFRIDPRTGAIYINKALDFE--TKELHELVVVAKDHGEQPLETTAFVSIRVTD  332

Query  183   VNDNAPE----FPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGK  238
             VNDN P     F     +   +ESA  G  +   +  D D+       + ++  G  DG 
Sbjct  333   VNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG--DGH  390

Query  239   FRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVN  298
             F L    N SI    +HL     LDRE +  Y+L+V A D+G PP      + + + DVN
Sbjct  391   FALTTRDN-SIYLVIVHL----PLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVN  445

Query  299   DNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSETNE---RQFSVNP  355
             DNPP F Q  Y A + E +  GT +L V A+D+D   N+ LTY L+ET E   + F ++P
Sbjct  446   DNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDP  505

Query  356   ETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVN  415
             +TG +TT  + ++C  +   Q                 + V A+D G P       V V 
Sbjct  506   QTGLITT-RSHIDCETEPVPQ-----------------LTVVARDGGVPPLSSTATVLVT  547

Query  416   LLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAGNE  475
             + D ND++P    +++       +V EN   G  +  +   D D G+N+  +  I  G  
Sbjct  548   IHDVNDNEPIFDQSFYN-----VSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--GEG  600

Query  476   LRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHV  535
              +H  LT +    AS +    + + G+LD E    Y   ++A DRG    S TA + + +
Sbjct  601   FKH--LTEFEVRSASGE----ICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQL  652

Query  536   NDVNDHEPVFQQSEYSAVLSELSPVGSFVAS------ITATDADTGLNARIYYDFEATGN  589
              DVND+ PVF   EY   L E SP  S  AS      + ATD D G   ++ Y   A GN
Sbjct  653   TDVNDNRPVFYPREYKVSLRE-SPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVA-GN  710

Query  590   EHAWFAIDRDTG--LVTTRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDE  647
             E   F IDR TG   V     L    +    L + A DGG         + ++I+D    
Sbjct  711   EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQR  770

Query  648   VPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSL  707
              P F  +     + E+ P  ++V ++ A   D      V YS++      Y   F++++ 
Sbjct  771   PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY---FSIETN  827

Query  708   TGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFFP  767
             +G +     LD E  ++  +L +    G P       V + +EDVNDNAP F  +     
Sbjct  828   SGNIRIAKPLDHEAKSQV-LLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRIS  886

Query  768   VGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGPLRHRSL  827
             V   +  G       A D DS  +  + YSL      GLFA+D R+G L L   L + S 
Sbjct  887   VPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESS  946

Query  828   FK--LTVSARDNGDRAAARN--ALVEVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKL  883
              +  L V+A D G  + + N   LV+V D            DN   F   E+  + S+  
Sbjct  947   QRHTLIVTATDGGVPSLSTNLTILVDVQDVN----------DNPPVFEKDEYSVNVSESR  996

Query  884   AYKNTPSRDVGTVQVDVQQGQKIA---------SVTYAIVLGDPEGRFRIDESTGAITTA  934
             +  N     V    +D     +I          +VT +I   D    F I  ++G I   
Sbjct  997   SI-NAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR  1055

Query  935   GCIDREKTAQYNLQVSAR---AGLAYGLARVNVSVLDSNDNPPRFSSEEREEDVPLNELA  991
               +DRE   +Y L V A       A+   RV V VLD+NDN P+F   + E    + E  
Sbjct  1056  APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYE--FRIEENL  1113

Query  992   AVGQEVCLARARDRDVGLNARVVYSLTRNPGQQFRIAEGTGIVYLAKPVTQPPGTVLQIE  1051
               G  V +  A D D+G NA + YSL       F++   TG +   +P+ +    +  + 
Sbjct  1114  RRGSVVGVVTASDLDLGENAAIRYSLLP-INSSFQVHPVTGEISTREPLDRELRELYDLV  1172

Query  1052  VTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPVFELPSYET-SLPESTPVNERFFGLL  1110
             V ARD     Q     +    +R+ + D N++ P    P  +  S+ E  P       + 
Sbjct  1173  VEARD-----QGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVR  1227

Query  1111  ASDADFGPNNGRVSYWISEG---NSEGRFGIFP-DGQLYVRNELDREEQDYYALEVTASD  1166
             A D D G  N  ++Y I +G   +  G F I P  G +  R  LD EE+  Y L V ASD
Sbjct  1228  AVDRDHG-QNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASD  1286

Query  1167  HGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDR--DAGRN  1224
              GNP R +   L V V+D NDN P F +SS  F +RE+      VG +   +R  D  RN
Sbjct  1287  GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRN  1346

Query  1225  A------DL--TYSLPATQQD-----FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEA  1271
             +      DL  TY+L    +D     F +D  +G +   R  DRE + +     + +L+ 
Sbjct  1347  SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE-VQSEFRLEIRALDT  1405

Query  1272  TVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADE  1331
             T  +N         + + + + DVNDNAP++ + P  +QVSEA  VG  +     +DAD 
Sbjct  1406  TASNNPQ----SSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT  1461

Query  1332  GLNGDVFYTL----------EDSGDEQFAIDEATGQIILAKRLDRESRDTYRLTVVAHDA  1381
             G NGD+ Y L          ++     F +D  TG + L   LD E+   Y L V A D 
Sbjct  1462  GTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ  1521

Query  1382  GQEM--QLSASATVDVDVLDENDNAPRFVD-----GK-PRISVPETTALNVELLRFRATD  1433
                +  +L  S TV + +LD ND+AP FV      GK   + + + T +   +    A D
Sbjct  1522  SSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVD  1581

Query  1434  ADLGSNAELSYAITAGNKYDAFHVEPATGALYLRKPL-----DYEDQKFHQLNVSCSDSG  1488
              D G N +L+Y IT GN    F +   TG + L K L     D E      L +   D G
Sbjct  1582  EDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG  1641

Query  1489  HP--RLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGL  1546
              P  + SSL +L + V  +++NPP F        I+E +P    V+ V+A+     +N  
Sbjct  1642  QPEPKKSSL-NLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENAN  1700

Query  1547  VSYAIASQEPEDEKRRFGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAE  1606
             +SY I +    D    F ++    +I T    +RE   ++ L V   D  + ++   SA 
Sbjct  1701  LSYEIPAGVAND---LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAV  1757

Query  1607  K--------------------SVTVIVTDVNDNAPVFVNMPAFVLPRTSPLRDEPVQIGQ  1646
             +                    ++ + V DVNDN+P F   P      + P   EP  I  
Sbjct  1758  RKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF--RPGSCYGLSVPENSEPGVIHT  1815

Query  1647  FLARDADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRA  1706
              +A D D   N  + Y +  +  N  +   I   +G L+ R L      +  R  + ++A
Sbjct  1816  VVASDLDEGPNADLIYSI--TGGNLGNKFSIDSSSGELSARPLDR---EQHSRYTLQIQA  1870

Query  1707  SDEASQAERRSTESYATLIVPGAEGDGPVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRR  1766
             SD   Q + R      T+ V     + P ++ S    GSV+E+  +GTSV+++ A     
Sbjct  1871  SDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLS-KYTGSVQEDAPLGTSVVQISA-----  1923

Query  1767  SGVVVAGDEPVVEYYVTNVTAGVDGPMVDRL-------FDVDARSGLLSTAAPLDRELGA  1819
                              +   GV+  +V  L       F +D +SGL++T   LDREL A
Sbjct  1924  ----------------VDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQA  1967

Query  1820  EWYEVEVYAVVVGAARPSTSSTKVSLNFF  1848
               Y   V A   G     +++  V +N  
Sbjct  1968  S-YNFMVLATDGGRYEVRSATVPVQINVL  1995


 Score = 405 bits (1042),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 474/1765 (27%), Positives = 760/1765 (43%), Gaps = 228/1765 (13%)

Query  125   FTYRFNEQP----KEFNLDPVSGEIRTAVLLDRERLTSDRFDLVV-------LSSQPTYP  173
              TY   E P    + F +DP +G I T   +D E     +  +V        LSS  T  
Sbjct  486   LTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTAT--  543

Query  174   IEVKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDG  233
               V + + DVNDN P F +S   VS AE+   G  +L  +A+D D   N + + Y+I +G
Sbjct  544   --VLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVN-YTIGEG  600

Query  234   NADGKFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVT  293
                  F+ L      + S+   +    +LD E+   Y   V A DRG       + + +T
Sbjct  601   -----FKHLTEFE--VRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT  653

Query  294   VLDVNDNPPMFLQSEYVAVLNESSPVG-----THILTVQAYDKDSEDNARLTYYLSETNE  348
               DVNDN P+F   EY   L ES         T I+ V A D D  +  +++Y +   NE
Sbjct  654   --DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNE  711

Query  349   RQ-FSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQE  407
                F ++  TGE+         P   S + Q              ++ + A D G  R  
Sbjct  712   AGIFRIDRSTGEIFVVR-----PDMLSVRTQPMH-----------MLNISATDGGNLRSN  755

Query  408   GRTYVTVNLLDSNDHDP---EIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNS  464
                 V ++++D+    P   + R+ Y+        V E+  +G++V ++     D    S
Sbjct  756   ADAVVFLSIIDAMQRPPIFEKARYNYY--------VKEDIPRGTVVGSVIAASGDVAHRS  807

Query  465   ETSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPP  524
                  I +G+        GY   E ++ + R+ +    LD E   +  L I A   G PP
Sbjct  808   PVRYSIYSGDP------DGYFSIETNSGNIRIAK---PLDHEAKSQVLLNIQAT-LGEPP  857

Query  525   RSATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYDF  584
                   + I V DVND+ P F+ S     + E + +G+ + +  A D D+G + ++ Y  
Sbjct  858   VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL  917

Query  585   EATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDE  644
                  +   FAID  +G +     LD E      L V A DGG      +  + V + D 
Sbjct  918   VKESGK-GLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV  976

Query  645   NDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVL---------  695
             ND  P F      V +SE+   ++ +  ++A D D G N  + Y +  + +         
Sbjct  977   NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISS  1036

Query  696   RDYPRTFALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDN  755
              D  + F +   +G +  +  LDRE    Y++ V+A D G+P   +   V++ + D NDN
Sbjct  1037  SDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDN  1096

Query  756   APVFYPTTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGE  815
              P F  + Y F +  +  RG++ G + A+D D  ENA IRYSL        F +   TGE
Sbjct  1097  DPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS--FQVHPVTGE  1154

Query  816   LFLQGPLRH--RSLFKLTVSARDNGDRAAARNALVEVVDRESLVHLEFKAFDNGYRFRVM  873
             +  + PL    R L+ L V ARD G     R+A                      R  V 
Sbjct  1155  ISTREPLDRELRELYDLVVEARDQG--TPVRSA----------------------RVPVR  1190

Query  874   EHHGDCSDKLAYKNTPSRDVGTVQ--------------VDVQQGQKIASVTYAIVLG---  916
              H  D +D       P  DV +V+              VD   GQ  AS+TY+IV G   
Sbjct  1191  IHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQN-ASITYSIVKGRDS  1249

Query  917   DPEGRFRIDESTGAITTAGCIDREKTAQYNLQVSARAG---LAYGLARVNVSVLDSNDNP  973
             D  G F ID ++G I T   +D E+ + Y L V+A  G       +  + V VLD NDN 
Sbjct  1250  DGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR  1309

Query  974   PRFSSEEREEDVPLNELAAVGQEVCLARARDR--DVGLNA--------RVVYSLTRNPGQ  1023
             P F+S      V   E AA+G  V      +R  DV  N+        RV Y+L  NP  
Sbjct  1310  PTFTSSSLVFRV--REDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTL--NPLT  1365

Query  1024  Q------FRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVI  1077
             +      F I   +G + +A+ + +   +  ++E+ A D+  +   Q S  T   +++ +
Sbjct  1366  KDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT---VKIEV  1422

Query  1078  EDANNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSY----WISEGN--  1131
              D N++ P +     +  + E+TPV        A+DAD G  NG + Y    +  + N  
Sbjct  1423  ADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTG-TNGDLQYRLIRYFPQLNES  1481

Query  1132  SEGRFGIFP----DGQLYVRNELDREEQDYYALEVTASDHGN---PKRSSSVSLVVHVVD  1184
              E    +F      G L ++  LD E    Y L V A D  +    +  +SV++ + ++D
Sbjct  1482  QEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILD  1541

Query  1185  ENDNAPQF------GNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPATQQD-  1237
              ND+AP F      G  + +  + +       V  +VA D D+G N  LTY +     + 
Sbjct  1542  ANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG  1601

Query  1238  -FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVN  1296
              F ++ + G +  +++          GG   +L     D+G     +  + + + +   +
Sbjct  1602  RFRINSQTGIIELVKSLPPATEDVEKGGR-FNLIIGAKDHGQPEPKKSSLNLHLIVQGSH  1660

Query  1297  DNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDS-GDEQFAIDEAT  1355
             +N P+F +  Y+  + E    G+ +L+V         N ++ Y +     ++ F +D   
Sbjct  1661  NNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQR  1720

Query  1356  GQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASA----------------------TV  1393
             G I    + DRES+ +Y L V   DA ++  LS+SA                      T+
Sbjct  1721  GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATI  1780

Query  1394  DVDVLDENDNAPRFVDGKPR-ISVPETTALNVELLRFRATDADLGSNAELSYAITAGNKY  1452
              + V D NDN+P F  G    +SVPE +   V +    A+D D G NA+L Y+IT GN  
Sbjct  1781  YITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLG  1839

Query  1453  DAFHVEPATGALYLRKPLDYEDQKFHQLNVSCSDSGHPR-LSSLVSLRVDVVDANDNPPV  1511
             + F ++ ++G L  R PLD E    + L +  SD G P+      ++ + V D NDN P 
Sbjct  1840  NKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPR  1898

Query  1512  FPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEPEDEKRRFGINPATAV  1571
             F  +     + E  P+   VV +SA D D G N  + Y++A++     + +F I+  + +
Sbjct  1899  FKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANE----TQWQFAIDGQSGL  1954

Query  1572  IHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFV------N  1625
             I T+  ++RE   ++  +V+ATD  +      SA   V + V D+NDN P+F        
Sbjct  1955  ITTVGKLDRELQASYNFMVLATDGGR--YEVRSATVPVQINVLDINDNRPIFERYPYIGQ  2012

Query  1626  MPAFVLPRTSPLRDEPVQIGQFLARDADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLA  1685
             +PA + P  + L+   VQ     A DAD   N ++ Y L   ++  +   +I+  TG L+
Sbjct  2013  VPALIQPGQTLLK---VQ-----ALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALS  2064

Query  1686  MRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWE-HSGTLEG  1744
                      G++  L V  R      Q    S+     L++  A    PV    + T   
Sbjct  2065  ASQSLASESGKLLHLEVVARDKGNPPQ----SSLGLIELLIGEAPQGTPVLRFQNETYRV  2120

Query  1745  SVRENEAVGTSVLRV---RAKSRRR  1766
              ++EN   GT +L+V   R+  RR+
Sbjct  2121  MLKENSPSGTRLLQVVALRSDGRRQ  2145


 Score = 383 bits (983),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 474/1717 (28%), Positives = 742/1717 (43%), Gaps = 253/1717 (15%)

Query  126   TYRFNEQPKE-----FNLDPVSGEIRTAVLLDRERLTSDRFDLVVL----SSQP-TYPIE  175
             TY  N   K+     F++D  SG +  A LLDRE  +  R ++  L    S+ P +  I 
Sbjct  1358  TYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT  1417

Query  176   VKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNA  235
             VKI V DVNDNAPE+P+  I +  +E+   GT +   TATD DT  NG            
Sbjct  1418  VKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNG------------  1465

Query  236   DGKFRLLVTGNPSISSSYLH-------------LETTSKLDREQIEYYSLNVCARDRGQ-  281
             D ++RL +   P ++ S                L   + LD E ++ Y L V A D+   
Sbjct  1466  DLQYRL-IRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSN  1524

Query  282   -PPKL-GCLLVNVTVLDVNDNPPMFLQSEYVA------VLNESSPVGTHILTVQAYDKDS  333
                +L   + V + +LD ND+ P F+             +++++ +G  +  + A D+DS
Sbjct  1525  VTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDS  1584

Query  334   EDNARLTYYLSETN-ERQFSVNPETG--EVTTSEAPLECPQQQSCQDQRAKRHSAGGCPK  390
              DN +LTY ++  N E +F +N +TG  E+  S  P             A      G   
Sbjct  1585  GDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPP-------------ATEDVEKGGRF  1631

Query  391   SCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIV  450
             + +I   A+DHG P  + ++ + ++L+    H+   RF         AT+ EN   GS V
Sbjct  1632  NLIIG--AKDHGQPEPK-KSSLNLHLIVQGSHNNPPRFLQ---AVYRATILENVPSGSFV  1685

Query  451   AAIGVIDADEGLNSETSIEIRAG--NELRHFELTGYNDDEASAQSFRLVRVNGKLDREEI  508
               +         N+  S EI AG  N+L H +               ++   G+ DRE  
Sbjct  1686  LQVTAKSLHGAENANLSYEIPAGVANDLFHVDW-----------QRGIITTRGQFDRESQ  1734

Query  509   PKYNLTIVARD-----------------------RGNPPRSATAYLAIHVNDVNDHEPVF  545
               Y L +  RD                         N      A + I V DVND+ P F
Sbjct  1735  ASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF  1794

Query  546   QQ-SEYSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNEHAWFAIDRDTGLVT  604
             +  S Y   + E S  G  + ++ A+D D G NA + Y     GN    F+ID  +G ++
Sbjct  1795  RPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITG-GNLGNKFSIDSSSGELS  1852

Query  605   TRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTIL--DENDEVPKFASSYLEVALSE  662
              R  LDRE      L++QA D G  PK    H  +TI   D+ND  P+F  S    ++ E
Sbjct  1853  ARP-LDREQHSRYTLQIQASDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQE  1910

Query  663   NTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQLMTKVTLDRERM  722
             + P  + V  +SAVD D G N  + YSL      +    FA+D  +G + T   LDRE  
Sbjct  1911  DAPLGTSVVQISAVDADLGVNARLVYSL----ANETQWQFAIDGQSGLITTVGKLDRELQ  1966

Query  723   AEYRILVVARDQGS-PTQSSTATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTRGTLAGKL  781
             A Y  +V+A D G    +S+T  V +++ D+NDN P+F    Y   V      G    K+
Sbjct  1967  ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKV  2026

Query  782   FATDADSKENALIRYSL--ESGGDGGLFAMDERTGELFLQGPLRHRS--LFKLTVSARDN  837
              A DAD   NA I YSL  E+      F ++  TG L     L   S  L  L V ARD 
Sbjct  2027  QALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK  2086

Query  838   GDRAAARNALVEVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRDVGTVQ  897
             G+   +   L+E++  E+        F N   +RVM            +N+PS       
Sbjct  2087  GNPPQSSLGLIELLIGEAPQGTPVLRFQN-ETYRVM----------LKENSPSGTRLLQV  2135

Query  898   VDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAI---------------TTAGCIDREKT  942
             V ++   +   V ++   G+ +G   +D  +G I                +   + R + 
Sbjct  2136  VALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRA  2195

Query  943   AQY-------------NLQVSARAGLAYGLARVN--------------------------  963
               Y             N   S RA  +   A  N                          
Sbjct  2196  LHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAEL  2255

Query  964   -VSVLDSNDNPPRFSSEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTR-NP  1021
              + + D NDN P+FS ++    V  +E    G  V    A D D G NAR+ Y +   N 
Sbjct  2256  VIELEDENDNSPKFSQKQFVATV--SEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH  2313

Query  1022  GQQFRIAEG-TGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDA  1080
                F I    +GIV     + +    + ++++ A D  G  Q    +  T  IRV I D 
Sbjct  2314  DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDE-GVPQ----MTGTATIRVQIVDV  2368

Query  1081  NNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYWISEGNSEG--RFGI  1138
             N++ P F  P+   ++ E+T +      + A+D D  P    ++Y +   ++       I
Sbjct  2369  NDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYP---ALTYRLGAESTVDIENMSI  2424

Query  1139  FP----DGQLYVRNELDREEQDYYALEVTASDHGNPKRSSSVSLVVHVVDENDNAPQF--  1192
             F      G+L ++  LD E Q  Y L+V ASD  +  R+    L V V DENDNAP F  
Sbjct  2425  FALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLA  2481

Query  1193  --GNSSFTF-----HLRENEPADTFVGKLVASDRDA-GRNADLTYSLPATQQDFAVDPRN  1244
                 + F        + E+   D  +  + A+D D+ G N+ + Y +   Q+ F+V P N
Sbjct  2482  QQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSN  2541

Query  1245  GFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKR  1304
             G V S+     +  V+S+G   + +   +  +     L+    + V   D      QF +
Sbjct  2542  GVV-SVNMSRLQPAVSSSGDYFVRI---IAKDAGKPALKSSTLLRVQANDNGSGRSQFLQ  2597

Query  1305  LPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSGDEQFAIDEATGQ-IILAKR  1363
               Y+ Q+SEAA +G+ +L++     D+ L          +G+E+ A +    + I+L K 
Sbjct  2598  NQYRAQISEAAPLGSVVLQLGQDALDQSL-------AIIAGNEESAFELLQSKAIVLVKP  2650

Query  1364  LDRESRDTYRL-TVVAHDAG----QEMQLSASATVDVDVLDENDNAPRF-VDGKPRISVP  1417
             LDRE  D Y+L  V++H  G      +  S+  +V + +LD NDN P F    K    + 
Sbjct  2651  LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEIS  2710

Query  1418  ETTALNVELLRFRATDADLGS--NAELSYAITAGNKYDAFHVEPATGALYLRKPLDYED-  1474
             E   L   + + +A DAD  +  N+E+ Y IT+GN    F ++  TG L++   LDY+  
Sbjct  2711  ELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSG  2770

Query  1475  QKFHQLNVSCSDSGHPR-LSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVT  1533
              K ++L +   DS H R L SL   R+++ D NDN P FP T  V  + E  PV   V  
Sbjct  2771  AKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFR  2830

Query  1534  VSAEDPDSGDNGLVSYAIASQEPEDEK--RRFGINPATAVIHTLLPIEREEIDTFKLIVV  1591
               A D D G  G ++Y+I    P DE   + F ++  + ++ +    + E+   + + ++
Sbjct  2831  AHASDLDKGPFGQLNYSIGPA-PSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELL  2889

Query  1592  ATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFVNMPA-FVLPRTSPLRDEPVQIGQFLAR  1650
             A+D     +S      +V V +   ++  P F      FVLP    L    V +GQ  A 
Sbjct  2890  ASDMGGKKAS-----VAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYV-VGQVTAT  2943

Query  1651  DADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLAMR  1687
             D+DS  +G+V Y+L    +++    +++R +G + ++
Sbjct  2944  DSDSGPDGRVVYQLSAPHSHF----KVNRSSGAVLIK  2976


 Score = 184 bits (467),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 206/725 (28%), Positives = 326/725 (45%), Gaps = 98/725 (14%)

Query  136   FNLDPV-SGEIRTAVLLDRERLTSDRFDLVVLSS-----QPTYPIEVKIRVIDVNDNAPE  189
             F ++P  SG +RT ++LDRE    D + L ++++     Q T    ++++++DVNDN P 
Sbjct  2317  FVIEPAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT  2374

Query  190   FPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSI  249
             FP +++ V+ +E+   G  +   +A D DT        Y  +       +RL       I
Sbjct  2375  FPPNNL-VTVSEATELGAVITSISANDVDT--------YPAL------TYRLGAESTVDI  2419

Query  250   SSSYL--------HLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNP  301
              +  +         L    +LD E  + Y L+V A D     +    ++ V V D NDN 
Sbjct  2420  ENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNA  2476

Query  302   PMFLQSE---YVAVL------NESSPVGTHILTVQAYDKDSEDNARLTYYLSETNERQFS  352
             P+FL  +   Y A+L      +ES  V   +LTV A D DSE N     Y+ E  +  FS
Sbjct  2477  PVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFS  2536

Query  353   VNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYV  412
             V+P  G V+ + + L+ P   S  D                + + A+D G P  +  T +
Sbjct  2537  VHPSNGVVSVNMSRLQ-PAVSSSGD--------------YFVRIIAKDAGKPALKSSTLL  2581

Query  413   TVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRA  472
              V   D+     +     F      A + E A  GS+V  +G    D+      S+ I A
Sbjct  2582  RVQANDNGSGRSQ-----FLQNQYRAQISEAAPLGSVVLQLGQDALDQ------SLAIIA  2630

Query  473   GNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPP------RS  526
             GNE   FEL          QS  +V V   LDRE    Y L +V      PP       S
Sbjct  2631  GNEESAFELL---------QSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSS  2680

Query  527   ATAYLAIHVNDVNDHEPVFQQS-EYSAVLSELSPVGSFVASITATDAD--TGLNARIYYD  583
             +   + I + D ND+ P+F +S +Y A +SEL+P+   +A + A DAD     N+ + YD
Sbjct  2681  SGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYD  2740

Query  584   FEATGNEHAWFAIDRDTGLVTTRATLDREIEG-SVELRVQARDGGPNPKFVSTH-LRVTI  641
                +GN+   F ID  TG++     LD +    S EL ++A D        S    R+ +
Sbjct  2741  I-TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLEL  2799

Query  642   LDENDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYP-R  700
              DEND  PKF  +     L+EN P  S V    A D D+G  G + YS+ P+   +   +
Sbjct  2800  HDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK  2859

Query  701   TFALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFY  760
              F +DS +G + +    D E+   Y + ++A D G   + ++  V + IE  ++  P F 
Sbjct  2860  MFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFT  2917

Query  761   PTTYFF--PVGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFL  818
               TY F  P      +G + G++ ATD+DS  +  + Y L +      F ++  +G + +
Sbjct  2918  ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLI  2975

Query  819   QGPLR  823
             +  L+
Sbjct  2976  KRKLK  2980


 Score = 159 bits (403),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 201/717 (28%), Positives = 319/717 (44%), Gaps = 109/717 (15%)

Query  1170  PKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTY  1229
             P  +S   LV+ + DENDN+P+F    F   + E     TFV ++ A D DAG NA L Y
Sbjct  2247  PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY  2306

Query  1230  SLPATQQD--FAVDPR-NGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRV  1286
              +     D  F ++P  +G VR+    DRE        ++  L+    D G + ++    
Sbjct  2307  HIVDGNHDNAFVIEPAFSGIVRTNIVLDREIR------DIYKLKIIATDEG-VPQMTGTA  2359

Query  1287  KMSVYIGDVNDNAPQFKRLPYQ-IQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSG  1345
              + V I DVNDN P F   P   + VSEA  +G  +  +  +D D           E + 
Sbjct  2360  TIRVQIVDVNDNQPTFP--PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTV  2417

Query  1346  DEQ----FAIDEATGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDEN  1401
             D +    FA+D  +G+++L +RLD E +  Y L V+A DA  E    A   + V V DEN
Sbjct  2418  DIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE----ARTVLTVRVNDEN  2473

Query  1402  DNAPRFVDGKP--------RIS-VPETTALNVELLRFRATDADL-GSNAELSYAITAGNK  1451
             DNAP F+  +P         IS + E+ +++ +LL   ATDAD  G+N+++ Y I     
Sbjct  2474  DNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ-  2532

Query  1452  YDAFHVEPATGALY-----LRKPLDYEDQKFHQLNVSCSDSGHPRLSSLVSLRVDVVDAN  1506
              + F V P+ G +      L+  +      F  + +   D+G P L S   LRV   D  
Sbjct  2533  -EGFSVHPSNGVVSVNMSRLQPAVSSSGDYF--VRIIAKDAGKPALKSSTLLRVQANDNG  2589

Query  1507  DNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEPEDEKRRFGIN  1566
                  F       QI E  P+   V+ +     D+ D  L   A       +E+  F + 
Sbjct  2590  SGRSQFLQNQYRAQISEAAPLGSVVLQLGQ---DALDQSLAIIA------GNEESAFELL  2640

Query  1567  PATAVIHTLLPIEREEIDTFKL-IVVATDTAQPTSSRLSAEKSVTVIVT--DVNDNAPVF  1623
              + A++  + P++RE  D +KL +V++     P  S L++   ++VI+T  D NDN P+F
Sbjct  2641  QSKAIV-LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF  2699

Query  1624  VNMPAFV--LPRTSPLRDEPVQIGQFLARDAD--SSTNGQVTYELLRSDNNYTDLVQIHR  1679
                  +   +   +PLR     I Q  A DAD  ++ N +V Y++   ++ +        
Sbjct  2700  DRSAKYEAEISELAPLR---YSIAQLQAIDADQENTPNSEVVYDITSGNDEH--------  2748

Query  1680  GTGMLAMRLLGGVVF--GRVD------RLRVGVRASDEASQAERRSTESYATLIVPGAEG  1731
                M  + L+ GV+F   R+D         + +RA D   Q    S + +   +    E 
Sbjct  2749  ---MFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLEL--HDEN  2803

Query  1732  DG----PVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTNVTA  1787
             D     P+ E+   L     ENE VG+SV R  A    +      G    + Y +     
Sbjct  2804  DNEPKFPLTEYVHFLA----ENEPVGSSVFRAHASDLDK------GPFGQLNYSI-----  2848

Query  1788  GVDGPMVD-----RLFDVDARSGLLSTAAPLDRELGAEWYEVEVYAVVVGAARPSTS  1839
                GP        ++F VD+ SGL+++A   D E   + Y++E+ A  +G  + S +
Sbjct  2849  ---GPAPSDESSWKMFRVDSESGLVTSAFVFDYE-QRQRYDMELLASDMGGKKASVA  2901


 Score = 144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 206/817 (25%), Positives = 320/817 (39%), Gaps = 115/817 (14%)

Query  175   EVKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGN  234
             E+ I + D NDN+P+F +     + +E  + GT +    A D D   N     Y IVDGN
Sbjct  2254  ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLR-YHIVDGN  2312

Query  235   ADGKFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTV  294
              D  F +     P+ S     + T   LDRE  + Y L + A D G P   G   + V +
Sbjct  2313  HDNAFVI----EPAFSGI---VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQI  2365

Query  295   LDVNDNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSE------TNE  348
             +DVNDN P F  +  V V +E++ +G  I ++ A D D+     LTY L         N 
Sbjct  2366  VDVNDNQPTFPPNNLVTV-SEATELGAVITSISANDVDTY--PALTYRLGAESTVDIENM  2422

Query  349   RQFSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEG  408
               F+++  +G++      L+   QQ  +                 + V A D      E 
Sbjct  2423  SIFALDRYSGKLVLKRR-LDYELQQEYE-----------------LDVIASDAA---HEA  2461

Query  409   RTYVTVNLLDSNDHDPEIRF----TYFPPTSGFATVDENAAKGSIVAAIGVIDAD-EGLN  463
             RT +TV + D ND+ P         YF      + + E+ +    +  +   DAD EG N
Sbjct  2462  RTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNN  2521

Query  464   SETSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNP  523
             S+    I    E   F +   N       S  + R+   +       Y + I+A+D G P
Sbjct  2522  SKVIYIIEPAQE--GFSVHPSN----GVVSVNMSRLQPAVSSSG--DYFVRIIAKDAGKP  2573

Query  524   PRSATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYD  583
                ++  L +  ND       F Q++Y A +SE +P+GS V  +     D  L       
Sbjct  2574  ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-----  2628

Query  584   FEATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELR-VQARDGGP-----NPKFVSTHL  637
                 GNE + F + +   +V  +  LDRE     +LR V +   GP             +
Sbjct  2629  --IAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISV  2685

Query  638   RVTILDENDEVPKF-ASSYLEVALSENTPADSLVATLSAVDNDQGT--NGSVAYSLHPSV  694
              +TILD ND  P F  S+  E  +SE  P    +A L A+D DQ    N  V Y +    
Sbjct  2686  IITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSG-  2744

Query  695   LRDYPRTFALDSLTGQLMTKVTLDRERMAE-YRILVVARD-QGSPTQSSTATVLLSIEDV  752
               +    F +D +TG L     LD +  A+ Y +++ A D        S     L + D 
Sbjct  2745  --NDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDE  2802

Query  753   NDNAPVFYPTTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYSLESG----GDGGLFA  808
             NDN P F  T Y   +  +   G+   +  A+D D      + YS+           +F 
Sbjct  2803  NDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFR  2862

Query  809   MDERTGELF--LQGPLRHRSLFKLTVSARDNGDRAAARNALVEVVDRESLVHLEFKAFDN  866
             +D  +G +          R  + + + A D G + A+    VE+  R+     +F   + 
Sbjct  2863  VDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTP-QFT--ER  2919

Query  867   GYRFRVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIASVTYAIVLGDPEGR-----  921
              YRF                      V    V + QG  +  VT       P+GR     
Sbjct  2920  TYRF----------------------VLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL  2957

Query  922   ------FRIDESTGAITTAGCIDREKTAQYNLQVSAR  952
                   F+++ S+GA+     +  +     NL +  R
Sbjct  2958  SAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGR  2994


 Score = 122 bits (305),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 168/622 (27%), Positives = 258/622 (41%), Gaps = 84/622 (14%)

Query  106   VKEGEPLGTLVGRIP-----VIPDFTYRFN-------EQPKEFNLDPVSGEIRTAVLLDR  153
             V E   LG ++  I        P  TYR         E    F LD  SG++     LD 
Sbjct  2383  VSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDY  2442

Query  154   ERLTSDRFDLVVLSSQPTYPIEVKIRVIDVNDNAPEF----PESSIAV-----SFAESAS  204
             E       D++   +       + +RV D NDNAP F    P +  A+       +ES S
Sbjct  2443  ELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLS  2502

Query  205   AGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSISSSYLHLETTSKLDR  264
                 LL   ATD D+  N     Y I++   +G       G  S++ S L    +S  D 
Sbjct  2503  VDFDLLTVNATDADSEGNNSKVIY-IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD-  2560

Query  265   EQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVLNESSPVGTHIL  324
                  Y + + A+D G+P      L+ V   D       FLQ++Y A ++E++P+G+ +L
Sbjct  2561  -----YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVL  2615

Query  325   TVQAYDKDSEDNARLTYYLSETNERQFSVNPETGEVTTSEA-PLECPQQQSCQDQRAKRH  383
              +    +D+ D +     ++   E  F       E+  S+A  L  P  +   D    R 
Sbjct  2616  QL---GQDALDQS--LAIIAGNEESAF-------ELLQSKAIVLVKPLDRERNDLYKLR-  2662

Query  384   SAGGCPKSCVIAVFAQDHGTP-----RQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGF-  437
                         V +  HG P            V + +LD+ND+     F  F  ++ + 
Sbjct  2663  -----------LVLSHPHGPPLISSLNSSSGISVIITILDANDN-----FPIFDRSAKYE  2706

Query  438   ATVDENAAKGSIVAAIGVIDADE--GLNSETSIEIRAGNELRHFELTGYNDDEASAQSFR  495
             A + E A     +A +  IDAD+    NSE   +I +GN+   F +     D  +   F 
Sbjct  2707  AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTI-----DLVTGVLF-  2760

Query  496   LVRVNGKLDREEIPK-YNLTIVARDRGNP-PRSATAYLAIHVNDVNDHEPVFQQSEYSAV  553
                VN +LD +   K Y L I A D  +  P  +     + ++D ND+EP F  +EY   
Sbjct  2761  ---VNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF  2817

Query  554   LSELSPVGSFVASITATDADTGLNARIYYDF-EATGNEHAW--FAIDRDTGLVTTRATLD  610
             L+E  PVGS V    A+D D G   ++ Y    A  +E +W  F +D ++GLVT+    D
Sbjct  2818  LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFD  2877

Query  611   REIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDEVPKFASSYLEVALSENT--PADS  668
              E     ++ + A D G   K  S  +RV I   ++  P+F        L      P   
Sbjct  2878  YEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGY  2935

Query  669   LVATLSAVDNDQGTNGSVAYSL  690
             +V  ++A D+D G +G V Y L
Sbjct  2936  VVGQVTATDSDSGPDGRVVYQL  2957


 Score = 106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 112/421 (27%), Positives = 199/421 (47%), Gaps = 41/421 (10%)

Query  1373  RLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKPRISVPETTALNVELLRFRAT  1432
             R+ +VA  A     L++ A + +++ DENDN+P+F   +   +V E       + +  A 
Sbjct  2236  RVVLVARTADAPF-LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAF  2294

Query  1433  DADLGSNAELSYAITAGNKYDAFHVEPA-TGALYLRKPLDYEDQKFHQLNVSCSDSGHPR  1491
             D+D GSNA L Y I  GN  +AF +EPA +G +     LD E +  ++L +  +D G P+
Sbjct  2295  DSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQ  2354

Query  1492  LSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAI  1551
             ++   ++RV +VD NDN P FP   +V  + E   +   + ++SA D D+     ++Y +
Sbjct  2355  MTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDT--YPALTYRL  2411

Query  1552  ASQEPEDEKRR--FGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSV  1609
              ++   D +    F ++  +  +     ++ E    ++L V+A+D A        A   +
Sbjct  2412  GAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH------EARTVL  2465

Query  1610  TVIVTDVNDNAPVFVNM--PAF--VLPRTSPLRDEPVQIGQFL---ARDADS-STNGQVT  1661
             TV V D NDNAPVF+    PA+  +LP  S + +        L   A DADS   N +V 
Sbjct  2466  TVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVI  2525

Query  1662  YELLRSDNNYTDLVQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRASDE------ASQAER  1715
             Y +  +   ++    +H   G++++ +          RL+  V +S +      A  A +
Sbjct  2526  YIIEPAQEGFS----VHPSNGVVSVNM---------SRLQPAVSSSGDYFVRIIAKDAGK  2572

Query  1716  RSTESYATLIVPGAE-GDGPVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGD  1774
              + +S   L V   + G G            + E   +G+ VL++   +  +S  ++AG+
Sbjct  2573  PALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGN  2632

Query  1775  E  1775
             E
Sbjct  2633  E  2633


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 147/346 (42%), Gaps = 44/346 (13%)

Query  94    QSRAVEKRAQLEVKEGEPLGTLV---GRIPVIPDFTYRFNEQPKEFNLDPVSGEIRTAVL  150
             +S+ ++ + + ++ E  PLG++V   G+  +          +   F L   S  I     
Sbjct  2592  RSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFELLQ-SKAIVLVKP  2650

Query  151   LDRERLTSDRFDLVVLSSQPTYP-----------IEVKIRVIDVNDNAPEFPESS-IAVS  198
             LDRER  +D + L ++ S P  P           I V I ++D NDN P F  S+     
Sbjct  2651  LDRER--NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAE  2708

Query  199   FAESASAGTKLLLDTATDRD---TPENGITDDYSIVDGNADGKFRL-LVTGNPSISSSYL  254
              +E A     +    A D D   TP + +   Y I  GN +  F + LVTG         
Sbjct  2709  ISELAPLRYSIAQLQAIDADQENTPNSEVV--YDITSGNDEHMFTIDLVTGV--------  2758

Query  255   HLETTSKLDREQ-IEYYSLNVCARD-RGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAV  312
              L   ++LD +   + Y L + A D   Q P        + + D NDN P F  +EYV  
Sbjct  2759  -LFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF  2817

Query  313   LNESSPVGTHILTVQAYDKDSEDNARLTYYLS-----ETNERQFSVNPETGEVTTSEAPL  367
             L E+ PVG+ +    A D D     +L Y +      E++ + F V+ E+G VT+  A +
Sbjct  2818  LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTS--AFV  2875

Query  368   ECPQQQSCQDQRAKRHSAGGCPKSCVIAV--FAQDHGTPRQEGRTY  411
                +Q+   D        GG   S  + V   ++D  TP+   RTY
Sbjct  2876  FDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTY  2921


>X2J8E9_DROME unnamed protein product
Length=3556

 Score = 654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/1778 (32%), Positives = 845/1778 (48%), Gaps = 163/1778 (9%)

Query  135   EFNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSSQPTYPIEVKIRVIDVNDNAPEFPESS  194
             +  +D  +GEIRT V LDRE   S     + LS +    I V + V D NDNAP FP++S
Sbjct  122   DLAIDRATGEIRTKVKLDRETRASYSLVAIPLSGRN---IRVLVTVKDENDNAPTFPQTS  178

Query  195   IAVSFAESASAGTKLLLDTATDRDT-PENGITDDYSIVDGNADGKFRLLVTGNPSISSSY  253
             + + F E+     K  L  A D D  P N  T  Y+IV GN +  FRL  +        Y
Sbjct  179   MHIEFPENTPREVKRTLLPARDLDLEPYN--TQRYNIVSGNVNDAFRL-SSHRERDGVLY  235

Query  254   LHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVL  313
             L L+ +  LDRE    YSL + A D G PP  G + VN+T+ DVNDN P+F QS Y A +
Sbjct  236   LDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATV  295

Query  314   NESSPVGTHILTVQAYDKDSEDNARLTYYLSET---NERQFSVNPETGEVTTSEAPLECP  370
              E++ VGT +L V A D D+++N  + Y ++      E+ F ++P TG +  ++A L+  
Sbjct  296   PENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKA-LDFE  354

Query  371   QQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTY  430
              ++  +                 + V A+DHG    E   +V++ + D ND+ P I   +
Sbjct  355   TKELHE-----------------LVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIF  397

Query  431   FPPTSGFATVDENAAKGSIVAAIGVIDADEGLN-SETSIEIRAGNELRHFELTGYNDDEA  489
                 +    + E+A  G  VA I V D D     +  ++ +  G+   HF LT  ++   
Sbjct  398   LSDDAS-PKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDG--HFALTTRDN---  451

Query  490   SAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHVNDVNDHEPVFQQSE  549
                S  LV V+  LDRE +  Y L++VA D+G PP  A+  + + + DVND+ P F+Q  
Sbjct  452   ---SIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDL  508

Query  550   YSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNEHA-WFAIDRDTGLVTTRAT  608
             Y A + E++  G+ V  + A D D GLN+ + Y    T   HA WF ID  TGL+TTR+ 
Sbjct  509   YHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSH  568

Query  609   LDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDEVPKFASSYLEVALSENTPADS  668
             +D E E   +L V ARDGG  P   +  + VTI D ND  P F  S+  V+++EN P   
Sbjct  569   IDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGR  628

Query  669   LVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQLMTKVTLDRERMAEYRIL  728
              +  +SA D D G N  V Y++       +   F + S +G++     LD ER + Y   
Sbjct  629   CILKVSASDPDCGVNAMVNYTIGEGF--KHLTEFEVRSASGEICIAGELDFERRSSYEFP  686

Query  729   VVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFF-----PVGRDSTRGTLAGKLFA  783
             V+A D+G    S+TA + + + DVNDN PVFYP  Y       P        T    + A
Sbjct  687   VLATDRGG--LSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVA  744

Query  784   TDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGP----LRHRSLFKLTVSARDNGD  839
             TD D      + Y + +G + G+F +D  TGE+F+  P    +R + +  L +SA D G+
Sbjct  745   TDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGN  804

Query  840   RAAARNALV--EVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRD-VGTV  896
               +  +A+V   ++D      +  KA    Y + V E            + P    VG+V
Sbjct  805   LRSNADAVVFLSIIDAMQRPPIFEKA---RYNYYVKE------------DIPRGTVVGSV  849

Query  897   QVDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAITTAGCIDREKTAQYNLQVSARAG--  954
                       + V Y+I  GDP+G F I+ ++G I  A  +D E  +Q  L + A  G  
Sbjct  850   IAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEP  909

Query  955   LAYGLARVNVSVLDSNDNPPRFSSEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVV  1014
               YG  +VN+ V D NDN P F +      VP  E A +G  +  A A D+D G + +V 
Sbjct  910   PVYGHTQVNIEVEDVNDNAPEFEASMVRISVP--ESAELGAPLYAAHAHDKDSGSSGQVT  967

Query  1015  YSLTRNPGQQ-FRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQI  1073
             YSL +  G+  F I   +G + L++ +         + VTA D         SL+T   I
Sbjct  968   YSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVP-----SLSTNLTI  1022

Query  1074  RVVIEDANNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSY--------  1125
              V ++D N++ PVFE   Y  ++ ES  +N +   + ASD D G NN R++Y        
Sbjct  1023  LVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTG-NNARITYRIVDAGVD  1081

Query  1126  ----WISEGNSEGRFGIFPD-GQLYVRNELDREEQDYYALEVTASDHGNPKRSSSVSLVV  1180
                  IS  +    FGIFP+ G +Y+R  LDRE +D Y L V A+D+G P   +   ++V
Sbjct  1082  NVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIV  1141

Query  1181  HVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPATQQDFAV  1240
              V+D NDN P+F  S + F + EN    + VG + ASD D G NA + YSL      F V
Sbjct  1142  RVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQV  1201

Query  1241  DPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAP  1300
              P  G + +    DRE         +  L     D G   R   RV + +++ DVNDNAP
Sbjct  1202  HPVTGEISTREPLDRELR------ELYDLVVEARDQGTPVR-SARVPVRIHVSDVNDNAP  1254

Query  1301  QFKRLPYQ--IQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTL----EDSGDEQFAIDEA  1354
             +    P +  + V E    G +++RV   D D G N  + Y++    +  G   F+ID  
Sbjct  1255  EIAD-PQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPT  1313

Query  1355  TGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKPRI  1414
             +G I     LD E R  YRL V A D G   + +    + V+VLD NDN P F       
Sbjct  1314  SGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVR-MLRVEVLDLNDNRPTFTSSSLVF  1372

Query  1415  SVPETTALNVELLRFRATD--ADLGSNA--------ELSYAITAGNK---YDAFHVEPAT  1461
              V E  AL   +      +  AD+  N+         ++Y +    K     AF ++  +
Sbjct  1373  RVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHS  1432

Query  1462  GALYLRKPLDYEDQKFHQLNVSCSD---SGHPRLSSLVSLRVDVVDANDNPPVFPNTAIV  1518
             G L + + LD E Q   +L +   D   S +P+ SS ++++++V D NDN P +P   I 
Sbjct  1433  GNLVVARLLDREVQSEFRLEIRALDTTASNNPQ-SSAITVKIEVADVNDNAPEWPQDPID  1491

Query  1519  RQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEP------EDEKRRFGINPATAVI  1572
              Q+ E  PV   +   +A D D+G NG + Y +    P      E     F ++  T  +
Sbjct  1492  LQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGAL  1551

Query  1573  HTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFVNMPAFVLP  1632
                 P++ E +  + LIV A D +   + RL    +V + + D ND+AP FV+  +    
Sbjct  1552  SLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGK  1611

Query  1633  RTSPLRDEPVQIGQFLAR----DADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLAMRL  1688
               S    +  +IG+ +A     D DS  NGQ+TYE+  +  N     +I+  TG++   L
Sbjct  1612  TASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI--TGGNGEGRFRINSQTGII--EL  1667

Query  1689  LGGVVFGRVD-----RLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWEHSGTLE  1743
             +  +     D     R  + + A D   Q E + +     LIV G+  + P +  +    
Sbjct  1668  VKSLPPATEDVEKGGRFNLIIGAKDHG-QPEPKKSSLNLHLIVQGSHNNPPRFLQA-VYR  1725

Query  1744  GSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTNVTAGVDGPMVDRLFDVDAR  1803
              ++ EN   G+ VL+V AKS       + G E     Y   + AGV     + LF VD +
Sbjct  1726  ATILENVPSGSFVLQVTAKS-------LHGAENANLSY--EIPAGV----ANDLFHVDWQ  1772

Query  1804  SGLLSTAAPLDRELGAEWYEVEVYAVVVGAARPSTSST  1841
              G+++T    DRE  A  Y + VY  V  A R ST S+
Sbjct  1773  RGIITTRGQFDRESQAS-YVLPVY--VRDANRQSTLSS  1807


 Score = 473 bits (1217),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 527/1829 (29%), Positives = 793/1829 (43%), Gaps = 216/1829 (12%)

Query  128   RFNEQPKEFNLDPVSGEIRTAVLLDRERLTSDRFDLVVLSS-QPTYPIE----VKIRVID  182
             R +++ + F +DP +G I     LD E  T +  +LVV++      P+E    V IRV D
Sbjct  328   RQSDKEQMFRIDPRTGAIYINKALDFE--TKELHELVVVAKDHGEQPLETTAFVSIRVTD  385

Query  183   VNDNAPE----FPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGK  238
             VNDN P     F     +   +ESA  G  +   +  D D+       + ++  G  DG 
Sbjct  386   VNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGG--DGH  443

Query  239   FRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVN  298
             F L    N SI    +HL     LDRE +  Y+L+V A D+G PP      + + + DVN
Sbjct  444   FALTTRDN-SIYLVIVHL----PLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVN  498

Query  299   DNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSETNE---RQFSVNP  355
             DNPP F Q  Y A + E +  GT +L V A+D+D   N+ LTY L+ET E   + F ++P
Sbjct  499   DNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDP  558

Query  356   ETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYVTVN  415
             +TG +TT  + ++C  +   Q                 + V A+D G P       V V 
Sbjct  559   QTGLITT-RSHIDCETEPVPQ-----------------LTVVARDGGVPPLSSTATVLVT  600

Query  416   LLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRAGNE  475
             + D ND++P    +++       +V EN   G  +  +   D D G+N+  +  I  G  
Sbjct  601   IHDVNDNEPIFDQSFYN-----VSVAENEPVGRCILKVSASDPDCGVNAMVNYTI--GEG  653

Query  476   LRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPPRSATAYLAIHV  535
              +H  LT +    AS +    + + G+LD E    Y   ++A DRG    S TA + + +
Sbjct  654   FKH--LTEFEVRSASGE----ICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQL  705

Query  536   NDVNDHEPVFQQSEYSAVLSELSPVGSFVAS------ITATDADTGLNARIYYDFEATGN  589
              DVND+ PVF   EY   L E SP  S  AS      + ATD D G   ++ Y   A GN
Sbjct  706   TDVNDNRPVFYPREYKVSLRE-SPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVA-GN  763

Query  590   EHAWFAIDRDTG--LVTTRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDE  647
             E   F IDR TG   V     L    +    L + A DGG         + ++I+D    
Sbjct  764   EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQR  823

Query  648   VPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSL  707
              P F  +     + E+ P  ++V ++ A   D      V YS++      Y   F++++ 
Sbjct  824   PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGY---FSIETN  880

Query  708   TGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFYPTTYFFP  767
             +G +     LD E  ++  +L +    G P       V + +EDVNDNAP F  +     
Sbjct  881   SGNIRIAKPLDHEAKSQV-LLNIQATLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRIS  939

Query  768   VGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFLQGPLRHRSL  827
             V   +  G       A D DS  +  + YSL      GLFA+D R+G L L   L + S 
Sbjct  940   VPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESGKGLFAIDARSGHLILSQHLDYESS  999

Query  828   FK--LTVSARDNGDRAAARN--ALVEVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKL  883
              +  L V+A D G  + + N   LV+V D            DN   F   E+  + S+  
Sbjct  1000  QRHTLIVTATDGGVPSLSTNLTILVDVQDVN----------DNPPVFEKDEYSVNVSESR  1049

Query  884   AYKNTPSRDVGTVQVDVQQGQKIA---------SVTYAIVLGDPEGRFRIDESTGAITTA  934
             +  N     V    +D     +I          +VT +I   D    F I  ++G I   
Sbjct  1050  SI-NAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLR  1108

Query  935   GCIDREKTAQYNLQVSAR---AGLAYGLARVNVSVLDSNDNPPRFSSEEREEDVPLNELA  991
               +DRE   +Y L V A       A+   RV V VLD+NDN P+F   + E    + E  
Sbjct  1109  APLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYE--FRIEENL  1166

Query  992   AVGQEVCLARARDRDVGLNARVVYSLTRNPGQQFRIAEGTGIVYLAKPVTQPPGTVLQIE  1051
               G  V +  A D D+G NA + YSL       F++   TG +   +P+ +    +  + 
Sbjct  1167  RRGSVVGVVTASDLDLGENAAIRYSLLP-INSSFQVHPVTGEISTREPLDRELRELYDLV  1225

Query  1052  VTARDSAGAEQQQHSLATTQQIRVVIEDANNHTPVFELPSYET-SLPESTPVNERFFGLL  1110
             V ARD     Q     +    +R+ + D N++ P    P  +  S+ E  P       + 
Sbjct  1226  VEARD-----QGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVR  1280

Query  1111  ASDADFGPNNGRVSYWISEG---NSEGRFGIFP-DGQLYVRNELDREEQDYYALEVTASD  1166
             A D D G  N  ++Y I +G   +  G F I P  G +  R  LD EE+  Y L V ASD
Sbjct  1281  AVDRDHG-QNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASD  1339

Query  1167  HGNPKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDR--DAGRN  1224
              GNP R +   L V V+D NDN P F +SS  F +RE+      VG +   +R  D  RN
Sbjct  1340  GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRN  1399

Query  1225  A------DL--TYSLPATQQD-----FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEA  1271
             +      DL  TY+L    +D     F +D  +G +   R  DRE + +     + +L+ 
Sbjct  1400  SVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDRE-VQSEFRLEIRALDT  1458

Query  1272  TVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADE  1331
             T  +N         + + + + DVNDNAP++ + P  +QVSEA  VG  +     +DAD 
Sbjct  1459  TASNNPQ----SSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADT  1514

Query  1332  GLNGDVFYTL----------EDSGDEQFAIDEATGQIILAKRLDRESRDTYRLTVVAHDA  1381
             G NGD+ Y L          ++     F +D  TG + L   LD E+   Y L V A D 
Sbjct  1515  GTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQ  1574

Query  1382  GQEM--QLSASATVDVDVLDENDNAPRFVD-----GK-PRISVPETTALNVELLRFRATD  1433
                +  +L  S TV + +LD ND+AP FV      GK   + + + T +   +    A D
Sbjct  1575  SSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVD  1634

Query  1434  ADLGSNAELSYAITAGNKYDAFHVEPATGALYLRKPL-----DYEDQKFHQLNVSCSDSG  1488
              D G N +L+Y IT GN    F +   TG + L K L     D E      L +   D G
Sbjct  1635  EDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHG  1694

Query  1489  HP--RLSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGL  1546
              P  + SSL +L + V  +++NPP F        I+E +P    V+ V+A+     +N  
Sbjct  1695  QPEPKKSSL-NLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENAN  1753

Query  1547  VSYAIASQEPEDEKRRFGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAE  1606
             +SY I +    D    F ++    +I T    +RE   ++ L V   D  + ++   SA 
Sbjct  1754  LSYEIPAGVAND---LFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAV  1810

Query  1607  K--------------------SVTVIVTDVNDNAPVFVNMPAFVLPRTSPLRDEPVQIGQ  1646
             +                    ++ + V DVNDN+P F   P      + P   EP  I  
Sbjct  1811  RKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF--RPGSCYGLSVPENSEPGVIHT  1868

Query  1647  FLARDADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRA  1706
              +A D D   N  + Y +  +  N  +   I   +G L+ R L      +  R  + ++A
Sbjct  1869  VVASDLDEGPNADLIYSI--TGGNLGNKFSIDSSSGELSARPLDR---EQHSRYTLQIQA  1923

Query  1707  SDEASQAERRSTESYATLIVPGAEGDGPVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRR  1766
             SD   Q + R      T+ V     + P ++ S    GSV+E+  +GTSV+++ A     
Sbjct  1924  SDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLS-KYTGSVQEDAPLGTSVVQISA-----  1976

Query  1767  SGVVVAGDEPVVEYYVTNVTAGVDGPMVDRL-------FDVDARSGLLSTAAPLDRELGA  1819
                              +   GV+  +V  L       F +D +SGL++T   LDREL A
Sbjct  1977  ----------------VDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQA  2020

Query  1820  EWYEVEVYAVVVGAARPSTSSTKVSLNFF  1848
               Y   V A   G     +++  V +N  
Sbjct  2021  S-YNFMVLATDGGRYEVRSATVPVQINVL  2048


 Score = 405 bits (1041),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 474/1765 (27%), Positives = 760/1765 (43%), Gaps = 228/1765 (13%)

Query  125   FTYRFNEQP----KEFNLDPVSGEIRTAVLLDRERLTSDRFDLVV-------LSSQPTYP  173
              TY   E P    + F +DP +G I T   +D E     +  +V        LSS  T  
Sbjct  539   LTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTAT--  596

Query  174   IEVKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDG  233
               V + + DVNDN P F +S   VS AE+   G  +L  +A+D D   N + + Y+I +G
Sbjct  597   --VLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVN-YTIGEG  653

Query  234   NADGKFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVT  293
                  F+ L      + S+   +    +LD E+   Y   V A DRG       + + +T
Sbjct  654   -----FKHLTEFE--VRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT  706

Query  294   VLDVNDNPPMFLQSEYVAVLNESSPVG-----THILTVQAYDKDSEDNARLTYYLSETNE  348
               DVNDN P+F   EY   L ES         T I+ V A D D  +  +++Y +   NE
Sbjct  707   --DVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNE  764

Query  349   RQ-FSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQE  407
                F ++  TGE+         P   S + Q              ++ + A D G  R  
Sbjct  765   AGIFRIDRSTGEIFVVR-----PDMLSVRTQPMH-----------MLNISATDGGNLRSN  808

Query  408   GRTYVTVNLLDSNDHDP---EIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNS  464
                 V ++++D+    P   + R+ Y+        V E+  +G++V ++     D    S
Sbjct  809   ADAVVFLSIIDAMQRPPIFEKARYNYY--------VKEDIPRGTVVGSVIAASGDVAHRS  860

Query  465   ETSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPP  524
                  I +G+        GY   E ++ + R+ +    LD E   +  L I A   G PP
Sbjct  861   PVRYSIYSGDP------DGYFSIETNSGNIRIAK---PLDHEAKSQVLLNIQAT-LGEPP  910

Query  525   RSATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYDF  584
                   + I V DVND+ P F+ S     + E + +G+ + +  A D D+G + ++ Y  
Sbjct  911   VYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSL  970

Query  585   EATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTILDE  644
                  +   FAID  +G +     LD E      L V A DGG      +  + V + D 
Sbjct  971   VKESGK-GLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDV  1029

Query  645   NDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVL---------  695
             ND  P F      V +SE+   ++ +  ++A D D G N  + Y +  + +         
Sbjct  1030  NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISS  1089

Query  696   RDYPRTFALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDN  755
              D  + F +   +G +  +  LDRE    Y++ V+A D G+P   +   V++ + D NDN
Sbjct  1090  SDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDN  1149

Query  756   APVFYPTTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGE  815
              P F  + Y F +  +  RG++ G + A+D D  ENA IRYSL        F +   TGE
Sbjct  1150  DPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSS--FQVHPVTGE  1207

Query  816   LFLQGPLRH--RSLFKLTVSARDNGDRAAARNALVEVVDRESLVHLEFKAFDNGYRFRVM  873
             +  + PL    R L+ L V ARD G     R+A                      R  V 
Sbjct  1208  ISTREPLDRELRELYDLVVEARDQG--TPVRSA----------------------RVPVR  1243

Query  874   EHHGDCSDKLAYKNTPSRDVGTVQ--------------VDVQQGQKIASVTYAIVLG---  916
              H  D +D       P  DV +V+              VD   GQ  AS+TY+IV G   
Sbjct  1244  IHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQN-ASITYSIVKGRDS  1302

Query  917   DPEGRFRIDESTGAITTAGCIDREKTAQYNLQVSARAG---LAYGLARVNVSVLDSNDNP  973
             D  G F ID ++G I T   +D E+ + Y L V+A  G       +  + V VLD NDN 
Sbjct  1303  DGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNR  1362

Query  974   PRFSSEEREEDVPLNELAAVGQEVCLARARDR--DVGLNA--------RVVYSLTRNPGQ  1023
             P F+S      V   E AA+G  V      +R  DV  N+        RV Y+L  NP  
Sbjct  1363  PTFTSSSLVFRV--REDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTL--NPLT  1418

Query  1024  Q------FRIAEGTGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVI  1077
             +      F I   +G + +A+ + +   +  ++E+ A D+  +   Q S  T   +++ +
Sbjct  1419  KDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT---VKIEV  1475

Query  1078  EDANNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSY----WISEGN--  1131
              D N++ P +     +  + E+TPV        A+DAD G  NG + Y    +  + N  
Sbjct  1476  ADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTG-TNGDLQYRLIRYFPQLNES  1534

Query  1132  SEGRFGIFP----DGQLYVRNELDREEQDYYALEVTASDHGN---PKRSSSVSLVVHVVD  1184
              E    +F      G L ++  LD E    Y L V A D  +    +  +SV++ + ++D
Sbjct  1535  QEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILD  1594

Query  1185  ENDNAPQF------GNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTYSLPATQQD-  1237
              ND+AP F      G  + +  + +       V  +VA D D+G N  LTY +     + 
Sbjct  1595  ANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEG  1654

Query  1238  -FAVDPRNGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVN  1296
              F ++ + G +  +++          GG   +L     D+G     +  + + + +   +
Sbjct  1655  RFRINSQTGIIELVKSLPPATEDVEKGGR-FNLIIGAKDHGQPEPKKSSLNLHLIVQGSH  1713

Query  1297  DNAPQFKRLPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDS-GDEQFAIDEAT  1355
             +N P+F +  Y+  + E    G+ +L+V         N ++ Y +     ++ F +D   
Sbjct  1714  NNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQR  1773

Query  1356  GQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASA----------------------TV  1393
             G I    + DRES+ +Y L V   DA ++  LS+SA                      T+
Sbjct  1774  GIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATI  1833

Query  1394  DVDVLDENDNAPRFVDGKPR-ISVPETTALNVELLRFRATDADLGSNAELSYAITAGNKY  1452
              + V D NDN+P F  G    +SVPE +   V +    A+D D G NA+L Y+IT GN  
Sbjct  1834  YITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGNLG  1892

Query  1453  DAFHVEPATGALYLRKPLDYEDQKFHQLNVSCSDSGHPR-LSSLVSLRVDVVDANDNPPV  1511
             + F ++ ++G L  R PLD E    + L +  SD G P+      ++ + V D NDN P 
Sbjct  1893  NKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPR  1951

Query  1512  FPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEPEDEKRRFGINPATAV  1571
             F  +     + E  P+   VV +SA D D G N  + Y++A++     + +F I+  + +
Sbjct  1952  FKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANE----TQWQFAIDGQSGL  2007

Query  1572  IHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFV------N  1625
             I T+  ++RE   ++  +V+ATD  +      SA   V + V D+NDN P+F        
Sbjct  2008  ITTVGKLDRELQASYNFMVLATDGGR--YEVRSATVPVQINVLDINDNRPIFERYPYIGQ  2065

Query  1626  MPAFVLPRTSPLRDEPVQIGQFLARDADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLA  1685
             +PA + P  + L+   VQ     A DAD   N ++ Y L   ++  +   +I+  TG L+
Sbjct  2066  VPALIQPGQTLLK---VQ-----ALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALS  2117

Query  1686  MRLLGGVVFGRVDRLRVGVRASDEASQAERRSTESYATLIVPGAEGDGPVWE-HSGTLEG  1744
                      G++  L V  R      Q    S+     L++  A    PV    + T   
Sbjct  2118  ASQSLASESGKLLHLEVVARDKGNPPQ----SSLGLIELLIGEAPQGTPVLRFQNETYRV  2173

Query  1745  SVRENEAVGTSVLRV---RAKSRRR  1766
              ++EN   GT +L+V   R+  RR+
Sbjct  2174  MLKENSPSGTRLLQVVALRSDGRRQ  2198


 Score = 382 bits (982),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 474/1717 (28%), Positives = 742/1717 (43%), Gaps = 253/1717 (15%)

Query  126   TYRFNEQPKE-----FNLDPVSGEIRTAVLLDRERLTSDRFDLVVL----SSQP-TYPIE  175
             TY  N   K+     F++D  SG +  A LLDRE  +  R ++  L    S+ P +  I 
Sbjct  1411  TYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAIT  1470

Query  176   VKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNA  235
             VKI V DVNDNAPE+P+  I +  +E+   GT +   TATD DT  NG            
Sbjct  1471  VKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNG------------  1518

Query  236   DGKFRLLVTGNPSISSSYLH-------------LETTSKLDREQIEYYSLNVCARDRGQ-  281
             D ++RL +   P ++ S                L   + LD E ++ Y L V A D+   
Sbjct  1519  DLQYRL-IRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSN  1577

Query  282   -PPKL-GCLLVNVTVLDVNDNPPMFLQSEYVA------VLNESSPVGTHILTVQAYDKDS  333
                +L   + V + +LD ND+ P F+             +++++ +G  +  + A D+DS
Sbjct  1578  VTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDS  1637

Query  334   EDNARLTYYLSETN-ERQFSVNPETG--EVTTSEAPLECPQQQSCQDQRAKRHSAGGCPK  390
              DN +LTY ++  N E +F +N +TG  E+  S  P             A      G   
Sbjct  1638  GDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPP-------------ATEDVEKGGRF  1684

Query  391   SCVIAVFAQDHGTPRQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIV  450
             + +I   A+DHG P  + ++ + ++L+    H+   RF         AT+ EN   GS V
Sbjct  1685  NLIIG--AKDHGQPEPK-KSSLNLHLIVQGSHNNPPRFLQ---AVYRATILENVPSGSFV  1738

Query  451   AAIGVIDADEGLNSETSIEIRAG--NELRHFELTGYNDDEASAQSFRLVRVNGKLDREEI  508
               +         N+  S EI AG  N+L H +               ++   G+ DRE  
Sbjct  1739  LQVTAKSLHGAENANLSYEIPAGVANDLFHVDW-----------QRGIITTRGQFDRESQ  1787

Query  509   PKYNLTIVARD-----------------------RGNPPRSATAYLAIHVNDVNDHEPVF  545
               Y L +  RD                         N      A + I V DVND+ P F
Sbjct  1788  ASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEF  1847

Query  546   QQ-SEYSAVLSELSPVGSFVASITATDADTGLNARIYYDFEATGNEHAWFAIDRDTGLVT  604
             +  S Y   + E S  G  + ++ A+D D G NA + Y     GN    F+ID  +G ++
Sbjct  1848  RPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITG-GNLGNKFSIDSSSGELS  1905

Query  605   TRATLDREIEGSVELRVQARDGGPNPKFVSTHLRVTIL--DENDEVPKFASSYLEVALSE  662
              R  LDRE      L++QA D G  PK    H  +TI   D+ND  P+F  S    ++ E
Sbjct  1906  ARP-LDREQHSRYTLQIQASDRG-QPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQE  1963

Query  663   NTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYPRTFALDSLTGQLMTKVTLDRERM  722
             + P  + V  +SAVD D G N  + YSL      +    FA+D  +G + T   LDRE  
Sbjct  1964  DAPLGTSVVQISAVDADLGVNARLVYSL----ANETQWQFAIDGQSGLITTVGKLDRELQ  2019

Query  723   AEYRILVVARDQGS-PTQSSTATVLLSIEDVNDNAPVFYPTTYFFPVGRDSTRGTLAGKL  781
             A Y  +V+A D G    +S+T  V +++ D+NDN P+F    Y   V      G    K+
Sbjct  2020  ASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKV  2079

Query  782   FATDADSKENALIRYSL--ESGGDGGLFAMDERTGELFLQGPLRHRS--LFKLTVSARDN  837
              A DAD   NA I YSL  E+      F ++  TG L     L   S  L  L V ARD 
Sbjct  2080  QALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDK  2139

Query  838   GDRAAARNALVEVVDRESLVHLEFKAFDNGYRFRVMEHHGDCSDKLAYKNTPSRDVGTVQ  897
             G+   +   L+E++  E+        F N   +RVM            +N+PS       
Sbjct  2140  GNPPQSSLGLIELLIGEAPQGTPVLRFQN-ETYRVM----------LKENSPSGTRLLQV  2188

Query  898   VDVQQGQKIASVTYAIVLGDPEGRFRIDESTGAI---------------TTAGCIDREKT  942
             V ++   +   V ++   G+ +G   +D  +G I                +   + R + 
Sbjct  2189  VALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRA  2248

Query  943   AQY-------------NLQVSARAGLAYGLARVN--------------------------  963
               Y             N   S RA  +   A  N                          
Sbjct  2249  LHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAEL  2308

Query  964   -VSVLDSNDNPPRFSSEEREEDVPLNELAAVGQEVCLARARDRDVGLNARVVYSLTR-NP  1021
              + + D NDN P+FS ++    V  +E    G  V    A D D G NAR+ Y +   N 
Sbjct  2309  VIELEDENDNSPKFSQKQFVATV--SEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNH  2366

Query  1022  GQQFRIAEG-TGIVYLAKPVTQPPGTVLQIEVTARDSAGAEQQQHSLATTQQIRVVIEDA  1080
                F I    +GIV     + +    + ++++ A D  G  Q    +  T  IRV I D 
Sbjct  2367  DNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDE-GVPQ----MTGTATIRVQIVDV  2421

Query  1081  NNHTPVFELPSYETSLPESTPVNERFFGLLASDADFGPNNGRVSYWISEGNSEG--RFGI  1138
             N++ P F  P+   ++ E+T +      + A+D D  P    ++Y +   ++       I
Sbjct  2422  NDNQPTFP-PNNLVTVSEATELGAVITSISANDVDTYP---ALTYRLGAESTVDIENMSI  2477

Query  1139  FP----DGQLYVRNELDREEQDYYALEVTASDHGNPKRSSSVSLVVHVVDENDNAPQF--  1192
             F      G+L ++  LD E Q  Y L+V ASD  +  R+    L V V DENDNAP F  
Sbjct  2478  FALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLA  2534

Query  1193  --GNSSFTF-----HLRENEPADTFVGKLVASDRDA-GRNADLTYSLPATQQDFAVDPRN  1244
                 + F        + E+   D  +  + A+D D+ G N+ + Y +   Q+ F+V P N
Sbjct  2535  QQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSN  2594

Query  1245  GFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRVKMSVYIGDVNDNAPQFKR  1304
             G V S+     +  V+S+G   + +   +  +     L+    + V   D      QF +
Sbjct  2595  GVV-SVNMSRLQPAVSSSGDYFVRI---IAKDAGKPALKSSTLLRVQANDNGSGRSQFLQ  2650

Query  1305  LPYQIQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSGDEQFAIDEATGQ-IILAKR  1363
               Y+ Q+SEAA +G+ +L++     D+ L          +G+E+ A +    + I+L K 
Sbjct  2651  NQYRAQISEAAPLGSVVLQLGQDALDQSL-------AIIAGNEESAFELLQSKAIVLVKP  2703

Query  1364  LDRESRDTYRL-TVVAHDAG----QEMQLSASATVDVDVLDENDNAPRF-VDGKPRISVP  1417
             LDRE  D Y+L  V++H  G      +  S+  +V + +LD NDN P F    K    + 
Sbjct  2704  LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEIS  2763

Query  1418  ETTALNVELLRFRATDADLGS--NAELSYAITAGNKYDAFHVEPATGALYLRKPLDYED-  1474
             E   L   + + +A DAD  +  N+E+ Y IT+GN    F ++  TG L++   LDY+  
Sbjct  2764  ELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSG  2823

Query  1475  QKFHQLNVSCSDSGHPR-LSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVT  1533
              K ++L +   DS H R L SL   R+++ D NDN P FP T  V  + E  PV   V  
Sbjct  2824  AKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFR  2883

Query  1534  VSAEDPDSGDNGLVSYAIASQEPEDEK--RRFGINPATAVIHTLLPIEREEIDTFKLIVV  1591
               A D D G  G ++Y+I    P DE   + F ++  + ++ +    + E+   + + ++
Sbjct  2884  AHASDLDKGPFGQLNYSIGPA-PSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELL  2942

Query  1592  ATDTAQPTSSRLSAEKSVTVIVTDVNDNAPVFVNMPA-FVLPRTSPLRDEPVQIGQFLAR  1650
             A+D     +S      +V V +   ++  P F      FVLP    L    V +GQ  A 
Sbjct  2943  ASDMGGKKAS-----VAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYV-VGQVTAT  2996

Query  1651  DADSSTNGQVTYELLRSDNNYTDLVQIHRGTGMLAMR  1687
             D+DS  +G+V Y+L    +++    +++R +G + ++
Sbjct  2997  DSDSGPDGRVVYQLSAPHSHF----KVNRSSGAVLIK  3029


 Score = 184 bits (467),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 206/725 (28%), Positives = 326/725 (45%), Gaps = 98/725 (14%)

Query  136   FNLDPV-SGEIRTAVLLDRERLTSDRFDLVVLSS-----QPTYPIEVKIRVIDVNDNAPE  189
             F ++P  SG +RT ++LDRE    D + L ++++     Q T    ++++++DVNDN P 
Sbjct  2370  FVIEPAFSGIVRTNIVLDRE--IRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPT  2427

Query  190   FPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSI  249
             FP +++ V+ +E+   G  +   +A D DT        Y  +       +RL       I
Sbjct  2428  FPPNNL-VTVSEATELGAVITSISANDVDT--------YPAL------TYRLGAESTVDI  2472

Query  250   SSSYL--------HLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNP  301
              +  +         L    +LD E  + Y L+V A D     +    ++ V V D NDN 
Sbjct  2473  ENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNA  2529

Query  302   PMFLQSE---YVAVL------NESSPVGTHILTVQAYDKDSEDNARLTYYLSETNERQFS  352
             P+FL  +   Y A+L      +ES  V   +LTV A D DSE N     Y+ E  +  FS
Sbjct  2530  PVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFS  2589

Query  353   VNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEGRTYV  412
             V+P  G V+ + + L+ P   S  D                + + A+D G P  +  T +
Sbjct  2590  VHPSNGVVSVNMSRLQ-PAVSSSGD--------------YFVRIIAKDAGKPALKSSTLL  2634

Query  413   TVNLLDSNDHDPEIRFTYFPPTSGFATVDENAAKGSIVAAIGVIDADEGLNSETSIEIRA  472
              V   D+     +     F      A + E A  GS+V  +G    D+      S+ I A
Sbjct  2635  RVQANDNGSGRSQ-----FLQNQYRAQISEAAPLGSVVLQLGQDALDQ------SLAIIA  2683

Query  473   GNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNPP------RS  526
             GNE   FEL          QS  +V V   LDRE    Y L +V      PP       S
Sbjct  2684  GNEESAFELL---------QSKAIVLVK-PLDRERNDLYKLRLVLSHPHGPPLISSLNSS  2733

Query  527   ATAYLAIHVNDVNDHEPVFQQS-EYSAVLSELSPVGSFVASITATDAD--TGLNARIYYD  583
             +   + I + D ND+ P+F +S +Y A +SEL+P+   +A + A DAD     N+ + YD
Sbjct  2734  SGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYD  2793

Query  584   FEATGNEHAWFAIDRDTGLVTTRATLDREIEG-SVELRVQARDGGPNPKFVSTH-LRVTI  641
                +GN+   F ID  TG++     LD +    S EL ++A D        S    R+ +
Sbjct  2794  I-TSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLEL  2852

Query  642   LDENDEVPKFASSYLEVALSENTPADSLVATLSAVDNDQGTNGSVAYSLHPSVLRDYP-R  700
              DEND  PKF  +     L+EN P  S V    A D D+G  G + YS+ P+   +   +
Sbjct  2853  HDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWK  2912

Query  701   TFALDSLTGQLMTKVTLDRERMAEYRILVVARDQGSPTQSSTATVLLSIEDVNDNAPVFY  760
              F +DS +G + +    D E+   Y + ++A D G   + ++  V + IE  ++  P F 
Sbjct  2913  MFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFT  2970

Query  761   PTTYFF--PVGRDSTRGTLAGKLFATDADSKENALIRYSLESGGDGGLFAMDERTGELFL  818
               TY F  P      +G + G++ ATD+DS  +  + Y L +      F ++  +G + +
Sbjct  2971  ERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH--FKVNRSSGAVLI  3028

Query  819   QGPLR  823
             +  L+
Sbjct  3029  KRKLK  3033


 Score = 159 bits (402),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 201/717 (28%), Positives = 319/717 (44%), Gaps = 109/717 (15%)

Query  1170  PKRSSSVSLVVHVVDENDNAPQFGNSSFTFHLRENEPADTFVGKLVASDRDAGRNADLTY  1229
             P  +S   LV+ + DENDN+P+F    F   + E     TFV ++ A D DAG NA L Y
Sbjct  2300  PFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRY  2359

Query  1230  SLPATQQD--FAVDPR-NGFVRSLRAFDREHLVASTGGNVISLEATVHDNGAMGRLRDRV  1286
              +     D  F ++P  +G VR+    DRE        ++  L+    D G + ++    
Sbjct  2360  HIVDGNHDNAFVIEPAFSGIVRTNIVLDREIR------DIYKLKIIATDEG-VPQMTGTA  2412

Query  1287  KMSVYIGDVNDNAPQFKRLPYQ-IQVSEAAAVGNQLLRVYTSDADEGLNGDVFYTLEDSG  1345
              + V I DVNDN P F   P   + VSEA  +G  +  +  +D D           E + 
Sbjct  2413  TIRVQIVDVNDNQPTFP--PNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTV  2470

Query  1346  DEQ----FAIDEATGQIILAKRLDRESRDTYRLTVVAHDAGQEMQLSASATVDVDVLDEN  1401
             D +    FA+D  +G+++L +RLD E +  Y L V+A DA  E    A   + V V DEN
Sbjct  2471  DIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHE----ARTVLTVRVNDEN  2526

Query  1402  DNAPRFVDGKP--------RIS-VPETTALNVELLRFRATDADL-GSNAELSYAITAGNK  1451
             DNAP F+  +P         IS + E+ +++ +LL   ATDAD  G+N+++ Y I     
Sbjct  2527  DNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQ-  2585

Query  1452  YDAFHVEPATGALY-----LRKPLDYEDQKFHQLNVSCSDSGHPRLSSLVSLRVDVVDAN  1506
              + F V P+ G +      L+  +      F  + +   D+G P L S   LRV   D  
Sbjct  2586  -EGFSVHPSNGVVSVNMSRLQPAVSSSGDYF--VRIIAKDAGKPALKSSTLLRVQANDNG  2642

Query  1507  DNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAIASQEPEDEKRRFGIN  1566
                  F       QI E  P+   V+ +     D+ D  L   A       +E+  F + 
Sbjct  2643  SGRSQFLQNQYRAQISEAAPLGSVVLQLGQ---DALDQSLAIIA------GNEESAFELL  2693

Query  1567  PATAVIHTLLPIEREEIDTFKL-IVVATDTAQPTSSRLSAEKSVTVIVT--DVNDNAPVF  1623
              + A++  + P++RE  D +KL +V++     P  S L++   ++VI+T  D NDN P+F
Sbjct  2694  QSKAIV-LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIF  2752

Query  1624  VNMPAFV--LPRTSPLRDEPVQIGQFLARDAD--SSTNGQVTYELLRSDNNYTDLVQIHR  1679
                  +   +   +PLR     I Q  A DAD  ++ N +V Y++   ++ +        
Sbjct  2753  DRSAKYEAEISELAPLR---YSIAQLQAIDADQENTPNSEVVYDITSGNDEH--------  2801

Query  1680  GTGMLAMRLLGGVVF--GRVD------RLRVGVRASDEASQAERRSTESYATLIVPGAEG  1731
                M  + L+ GV+F   R+D         + +RA D   Q    S + +   +    E 
Sbjct  2802  ---MFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLEL--HDEN  2856

Query  1732  DG----PVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGDEPVVEYYVTNVTA  1787
             D     P+ E+   L     ENE VG+SV R  A    +      G    + Y +     
Sbjct  2857  DNEPKFPLTEYVHFLA----ENEPVGSSVFRAHASDLDK------GPFGQLNYSI-----  2901

Query  1788  GVDGPMVD-----RLFDVDARSGLLSTAAPLDRELGAEWYEVEVYAVVVGAARPSTS  1839
                GP        ++F VD+ SGL+++A   D E   + Y++E+ A  +G  + S +
Sbjct  2902  ---GPAPSDESSWKMFRVDSESGLVTSAFVFDYE-QRQRYDMELLASDMGGKKASVA  2954


 Score = 143 bits (361),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 206/817 (25%), Positives = 320/817 (39%), Gaps = 115/817 (14%)

Query  175   EVKIRVIDVNDNAPEFPESSIAVSFAESASAGTKLLLDTATDRDTPENGITDDYSIVDGN  234
             E+ I + D NDN+P+F +     + +E  + GT +    A D D   N     Y IVDGN
Sbjct  2307  ELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLR-YHIVDGN  2365

Query  235   ADGKFRLLVTGNPSISSSYLHLETTSKLDREQIEYYSLNVCARDRGQPPKLGCLLVNVTV  294
              D  F +     P+ S     + T   LDRE  + Y L + A D G P   G   + V +
Sbjct  2366  HDNAFVI----EPAFSGI---VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQI  2418

Query  295   LDVNDNPPMFLQSEYVAVLNESSPVGTHILTVQAYDKDSEDNARLTYYLSE------TNE  348
             +DVNDN P F  +  V V +E++ +G  I ++ A D D+     LTY L         N 
Sbjct  2419  VDVNDNQPTFPPNNLVTV-SEATELGAVITSISANDVDTY--PALTYRLGAESTVDIENM  2475

Query  349   RQFSVNPETGEVTTSEAPLECPQQQSCQDQRAKRHSAGGCPKSCVIAVFAQDHGTPRQEG  408
               F+++  +G++      L+   QQ  +                 + V A D      E 
Sbjct  2476  SIFALDRYSGKLVLKRR-LDYELQQEYE-----------------LDVIASDAA---HEA  2514

Query  409   RTYVTVNLLDSNDHDPEIRF----TYFPPTSGFATVDENAAKGSIVAAIGVIDAD-EGLN  463
             RT +TV + D ND+ P         YF      + + E+ +    +  +   DAD EG N
Sbjct  2515  RTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNN  2574

Query  464   SETSIEIRAGNELRHFELTGYNDDEASAQSFRLVRVNGKLDREEIPKYNLTIVARDRGNP  523
             S+    I    E   F +   N       S  + R+   +       Y + I+A+D G P
Sbjct  2575  SKVIYIIEPAQE--GFSVHPSN----GVVSVNMSRLQPAVSSSG--DYFVRIIAKDAGKP  2626

Query  524   PRSATAYLAIHVNDVNDHEPVFQQSEYSAVLSELSPVGSFVASITATDADTGLNARIYYD  583
                ++  L +  ND       F Q++Y A +SE +P+GS V  +     D  L       
Sbjct  2627  ALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAI-----  2681

Query  584   FEATGNEHAWFAIDRDTGLVTTRATLDREIEGSVELR-VQARDGGP-----NPKFVSTHL  637
                 GNE + F + +   +V  +  LDRE     +LR V +   GP             +
Sbjct  2682  --IAGNEESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISV  2738

Query  638   RVTILDENDEVPKF-ASSYLEVALSENTPADSLVATLSAVDNDQGT--NGSVAYSLHPSV  694
              +TILD ND  P F  S+  E  +SE  P    +A L A+D DQ    N  V Y +    
Sbjct  2739  IITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSG-  2797

Query  695   LRDYPRTFALDSLTGQLMTKVTLDRERMAE-YRILVVARD-QGSPTQSSTATVLLSIEDV  752
               +    F +D +TG L     LD +  A+ Y +++ A D        S     L + D 
Sbjct  2798  --NDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDE  2855

Query  753   NDNAPVFYPTTYFFPVGRDSTRGTLAGKLFATDADSKENALIRYSLESG----GDGGLFA  808
             NDN P F  T Y   +  +   G+   +  A+D D      + YS+           +F 
Sbjct  2856  NDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFR  2915

Query  809   MDERTGEL--FLQGPLRHRSLFKLTVSARDNGDRAAARNALVEVVDRESLVHLEFKAFDN  866
             +D  +G +          R  + + + A D G + A+    VE+  R+     +F   + 
Sbjct  2916  VDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTP-QFT--ER  2972

Query  867   GYRFRVMEHHGDCSDKLAYKNTPSRDVGTVQVDVQQGQKIASVTYAIVLGDPEGR-----  921
              YRF                      V    V + QG  +  VT       P+GR     
Sbjct  2973  TYRF----------------------VLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQL  3010

Query  922   ------FRIDESTGAITTAGCIDREKTAQYNLQVSAR  952
                   F+++ S+GA+     +  +     NL +  R
Sbjct  3011  SAPHSHFKVNRSSGAVLIKRKLKLDGDGDGNLYMDGR  3047


 Score = 121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 168/622 (27%), Positives = 258/622 (41%), Gaps = 84/622 (14%)

Query  106   VKEGEPLGTLVGRIP-----VIPDFTYRFN-------EQPKEFNLDPVSGEIRTAVLLDR  153
             V E   LG ++  I        P  TYR         E    F LD  SG++     LD 
Sbjct  2436  VSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDY  2495

Query  154   ERLTSDRFDLVVLSSQPTYPIEVKIRVIDVNDNAPEF----PESSIAV-----SFAESAS  204
             E       D++   +       + +RV D NDNAP F    P +  A+       +ES S
Sbjct  2496  ELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLS  2555

Query  205   AGTKLLLDTATDRDTPENGITDDYSIVDGNADGKFRLLVTGNPSISSSYLHLETTSKLDR  264
                 LL   ATD D+  N     Y I++   +G       G  S++ S L    +S  D 
Sbjct  2556  VDFDLLTVNATDADSEGNNSKVIY-IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD-  2613

Query  265   EQIEYYSLNVCARDRGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAVLNESSPVGTHIL  324
                  Y + + A+D G+P      L+ V   D       FLQ++Y A ++E++P+G+ +L
Sbjct  2614  -----YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVL  2668

Query  325   TVQAYDKDSEDNARLTYYLSETNERQFSVNPETGEVTTSEA-PLECPQQQSCQDQRAKRH  383
              +    +D+ D +     ++   E  F       E+  S+A  L  P  +   D    R 
Sbjct  2669  QL---GQDALDQS--LAIIAGNEESAF-------ELLQSKAIVLVKPLDRERNDLYKLR-  2715

Query  384   SAGGCPKSCVIAVFAQDHGTP-----RQEGRTYVTVNLLDSNDHDPEIRFTYFPPTSGF-  437
                         V +  HG P            V + +LD+ND+     F  F  ++ + 
Sbjct  2716  -----------LVLSHPHGPPLISSLNSSSGISVIITILDANDN-----FPIFDRSAKYE  2759

Query  438   ATVDENAAKGSIVAAIGVIDADE--GLNSETSIEIRAGNELRHFELTGYNDDEASAQSFR  495
             A + E A     +A +  IDAD+    NSE   +I +GN+   F +     D  +   F 
Sbjct  2760  AEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTI-----DLVTGVLF-  2813

Query  496   LVRVNGKLDREEIPK-YNLTIVARDRGNP-PRSATAYLAIHVNDVNDHEPVFQQSEYSAV  553
                VN +LD +   K Y L I A D  +  P  +     + ++D ND+EP F  +EY   
Sbjct  2814  ---VNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF  2870

Query  554   LSELSPVGSFVASITATDADTGLNARIYYDF-EATGNEHAW--FAIDRDTGLVTTRATLD  610
             L+E  PVGS V    A+D D G   ++ Y    A  +E +W  F +D ++GLVT+    D
Sbjct  2871  LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFD  2930

Query  611   REIEGSVELRVQARDGGPNPKFVSTHLRVTILDENDEVPKFASSYLEVALSENT--PADS  668
              E     ++ + A D G   K  S  +RV I   ++  P+F        L      P   
Sbjct  2931  YEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGY  2988

Query  669   LVATLSAVDNDQGTNGSVAYSL  690
             +V  ++A D+D G +G V Y L
Sbjct  2989  VVGQVTATDSDSGPDGRVVYQL  3010


 Score = 106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 112/421 (27%), Positives = 199/421 (47%), Gaps = 41/421 (10%)

Query  1373  RLTVVAHDAGQEMQLSASATVDVDVLDENDNAPRFVDGKPRISVPETTALNVELLRFRAT  1432
             R+ +VA  A     L++ A + +++ DENDN+P+F   +   +V E       + +  A 
Sbjct  2289  RVVLVARTADAPF-LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAF  2347

Query  1433  DADLGSNAELSYAITAGNKYDAFHVEPA-TGALYLRKPLDYEDQKFHQLNVSCSDSGHPR  1491
             D+D GSNA L Y I  GN  +AF +EPA +G +     LD E +  ++L +  +D G P+
Sbjct  2348  DSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQ  2407

Query  1492  LSSLVSLRVDVVDANDNPPVFPNTAIVRQIVEGLPVHRPVVTVSAEDPDSGDNGLVSYAI  1551
             ++   ++RV +VD NDN P FP   +V  + E   +   + ++SA D D+     ++Y +
Sbjct  2408  MTGTATIRVQIVDVNDNQPTFPPNNLV-TVSEATELGAVITSISANDVDT--YPALTYRL  2464

Query  1552  ASQEPEDEKRR--FGINPATAVIHTLLPIEREEIDTFKLIVVATDTAQPTSSRLSAEKSV  1609
              ++   D +    F ++  +  +     ++ E    ++L V+A+D A        A   +
Sbjct  2465  GAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAH------EARTVL  2518

Query  1610  TVIVTDVNDNAPVFVNM--PAF--VLPRTSPLRDEPVQIGQFL---ARDADS-STNGQVT  1661
             TV V D NDNAPVF+    PA+  +LP  S + +        L   A DADS   N +V 
Sbjct  2519  TVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVI  2578

Query  1662  YELLRSDNNYTDLVQIHRGTGMLAMRLLGGVVFGRVDRLRVGVRASDE------ASQAER  1715
             Y +  +   ++    +H   G++++ +          RL+  V +S +      A  A +
Sbjct  2579  YIIEPAQEGFS----VHPSNGVVSVNM---------SRLQPAVSSSGDYFVRIIAKDAGK  2625

Query  1716  RSTESYATLIVPGAE-GDGPVWEHSGTLEGSVRENEAVGTSVLRVRAKSRRRSGVVVAGD  1774
              + +S   L V   + G G            + E   +G+ VL++   +  +S  ++AG+
Sbjct  2626  PALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGN  2685

Query  1775  E  1775
             E
Sbjct  2686  E  2686


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 95/346 (27%), Positives = 147/346 (42%), Gaps = 44/346 (13%)

Query  94    QSRAVEKRAQLEVKEGEPLGTLV---GRIPVIPDFTYRFNEQPKEFNLDPVSGEIRTAVL  150
             +S+ ++ + + ++ E  PLG++V   G+  +          +   F L   S  I     
Sbjct  2645  RSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGNEESAFEL-LQSKAIVLVKP  2703

Query  151   LDRERLTSDRFDLVVLSSQPTYP-----------IEVKIRVIDVNDNAPEFPESS-IAVS  198
             LDRER  +D + L ++ S P  P           I V I ++D NDN P F  S+     
Sbjct  2704  LDRER--NDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAE  2761

Query  199   FAESASAGTKLLLDTATDRD---TPENGITDDYSIVDGNADGKFRL-LVTGNPSISSSYL  254
              +E A     +    A D D   TP + +   Y I  GN +  F + LVTG         
Sbjct  2762  ISELAPLRYSIAQLQAIDADQENTPNSEVV--YDITSGNDEHMFTIDLVTGV--------  2811

Query  255   HLETTSKLDREQ-IEYYSLNVCARD-RGQPPKLGCLLVNVTVLDVNDNPPMFLQSEYVAV  312
              L   ++LD +   + Y L + A D   Q P        + + D NDN P F  +EYV  
Sbjct  2812  -LFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHF  2870

Query  313   LNESSPVGTHILTVQAYDKDSEDNARLTYYLS-----ETNERQFSVNPETGEVTTSEAPL  367
             L E+ PVG+ +    A D D     +L Y +      E++ + F V+ E+G VT+  A +
Sbjct  2871  LAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTS--AFV  2928

Query  368   ECPQQQSCQDQRAKRHSAGGCPKSCVIAV--FAQDHGTPRQEGRTY  411
                +Q+   D        GG   S  + V   ++D  TP+   RTY
Sbjct  2929  FDYEQRQRYDMELLASDMGGKKASVAVRVEIESRDEFTPQFTERTY  2974



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000035-PA

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FAT_DROME  unnamed protein product                                    108     9e-29
Q9VFH5_DROME  unnamed protein product                                 63.2    8e-13
CAD86_DROME  unnamed protein product                                  60.1    9e-12


>FAT_DROME unnamed protein product
Length=5147

 Score = 108 bits (270),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 1/80 (1%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V+DTNDN P+F+ T YSFD+ EN  RG +VGQ+ A DAD  G N+Q+SY ++SDWANDVF
Sbjct  1912  VSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDAD-LGQNAQLSYGVVSDWANDVF  1970

Query  71    SLNPSTGVFTLTANLDYEQM  90
             SLNP TG+ TLTA LDYE++
Sbjct  1971  SLNPQTGMLTLTARLDYEEV  1990


 Score = 63.5 bits (153),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 51/93 (55%), Gaps = 1/93 (1%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             + D NDN+PVF    YS  V EN   G+ V QV+A+D D  G N +I Y+++    N  F
Sbjct  2268  ILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVD-EGANGRIRYSIVLGDQNHDF  2326

Query  71    SLNPSTGVFTLTANLDYEQMGLVLFPITMLHCA  103
             S++  TGV  +  NL+YE++      +    CA
Sbjct  2327  SISEDTGVVRVAKNLNYERLSRYSLTVRAEDCA  2359


 Score = 57.8 bits (138),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query  10    VVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDV  69
             VV D NDNAP F  ++    VLE  P G+ + +  ASDAD  G NSQ+ +++ +    D 
Sbjct  1373  VVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDAD-QGVNSQVVFSISAGNRRDT  1431

Query  70    FSLNPSTGVFTLTANLDYEQMGLVLFPITMLHCA  103
             F ++  TG   L   LDYE +      IT   C 
Sbjct  1432  FHIDSITGSLYLHKPLDYEDITSYTLNITASDCG  1465


 Score = 56.2 bits (134),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 3/74 (4%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             + D NDNAP F+ + YSF   E     + VGQ+ A+D D  GPNS ISY+L     + +F
Sbjct  3003  IQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL--QQPSPMF  3060

Query  71    SLNPSTG-VFTLTA  83
             S++P+TG VF+  A
Sbjct  3061  SIDPATGEVFSKKA  3074


 Score = 55.1 bits (131),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 47/95 (49%), Gaps = 2/95 (2%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V D NDNAP+F   +YS +V EN+P  + V  V+A D D  G N  I Y++ +   +  F
Sbjct  2017  VLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDS-GNNGLIEYSITAGDVDSEF  2075

Query  71    SLNPSTGVFTLTANLDYEQMGLVLFPITMLHCANH  105
              ++ S G      NLD E        +T   CA+ 
Sbjct  2076  GID-SNGTIRTRRNLDREHRSTYTLTVTARDCADE  2109


 Score = 53.1 bits (126),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            V D ND+ PVF+ + YS  + E  P GS V  + A+D D  G N+Q+ Y ++S      F
Sbjct  484  VNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDED-TGVNAQVHYDILSGNELKWF  542

Query  71   SLNPSTGVFTLTANLDYEQMGLVLFPIT  98
            S++P TG+   T  LD E    V   I+
Sbjct  543  SMDPLTGLIVTTGPLDREIRDTVELSIS  570


 Score = 52.0 bits (123),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 48/96 (50%), Gaps = 8/96 (8%)

Query  2     LDNPWLDRV-----VTDTNDNAPVFQATAYSFDVLENM--PRGSRVGQVAASDADGPGPN  54
             L+NP  D       + D NDN P F  + Y   V+EN   P G  V  V A DAD P  N
Sbjct  2360  LENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLN  2419

Query  55    SQISYALISDWANDVFSLNPSTGVFTLTANLDYEQM  90
             SQ+ Y  + +  +D+F +N S+G   L   LD EQ 
Sbjct  2420  SQVRY-FLKEGDSDLFRINASSGDIALLKPLDREQQ  2454


 Score = 51.2 bits (121),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 44/89 (49%), Gaps = 2/89 (2%)

Query  10    VVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALI-SDWAND  68
             ++TD NDN PVF    Y   + EN P G+ V Q  A+D D P  N+ I YA + S     
Sbjct  3323  ILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSP-KNAIIHYAFLPSGPDRH  3381

Query  69    VFSLNPSTGVFTLTANLDYEQMGLVLFPI  97
              F +N S G  +   + DYE+  +    I
Sbjct  3382  FFIMNQSNGTISSAVSFDYEERRIYTLQI  3410


 Score = 47.4 bits (111),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 41/88 (47%), Gaps = 1/88 (1%)

Query  1     MLDNPWLDRVVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYA  60
             + D   +  +VTD NDNAP F    Y   + E    G+ +  V   DAD  G N  + Y+
Sbjct  1258  LQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDAD-EGLNGDVYYS  1316

Query  61    LISDWANDVFSLNPSTGVFTLTANLDYE  88
             L        F+L+ +TG  +L   LD E
Sbjct  1317  LAKGNEAGQFNLDSATGQLSLGRRLDRE  1344


 Score = 46.6 bits (109),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 44/96 (46%), Gaps = 1/96 (1%)

Query  10    VVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDV  69
             VVT  N + P F   +Y   V EN P GS +  V A+D D  GPN  + Y++        
Sbjct  3218  VVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATD-DDTGPNGMLRYSISGGNERQD  3276

Query  70    FSLNPSTGVFTLTANLDYEQMGLVLFPITMLHCANH  105
             FS++  TG   +   LDY+ +      IT+     H
Sbjct  3277  FSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYH  3312


 Score = 46.6 bits (109),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 44/82 (54%), Gaps = 2/82 (2%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V D NDN PVF+  +Y   V EN+P G+ V    A+D D  G N+++ + L+ +  +  F
Sbjct  2481  VQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKD-EGLNAKLRFNLLGEHMHR-F  2538

Query  71    SLNPSTGVFTLTANLDYEQMGL  92
              ++  TG  +    LD E+  +
Sbjct  2539  HIDSETGEISTATTLDREETSV  2560


 Score = 45.1 bits (105),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 45/87 (52%), Gaps = 3/87 (3%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             VTD NDNAPV +   Y+ +VLE       +  V ASD D  G N  + Y L +D+ +  F
Sbjct  2800  VTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDS-GDNGNVIYRLQNDF-DGTF  2857

Query  71    SLNPSTGVFTLTANLDYEQMGLVLFPI  97
              +  S  ++T    LD E++G   F +
Sbjct  2858  EITESGEIYT-RMRLDREEIGDYAFVV  2883


 Score = 44.7 bits (104),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/87 (30%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V   N+  P F    + FDV E    G+RVG V A+D D  G + ++ Y L+    +  F
Sbjct  3429  VLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDS-GEDGRVYYLLVGSSNDKGF  3487

Query  71    SLNPSTGVFTLTANLDYEQMGLVLFPI  97
              ++ +TG+  +  +LD E    V+  +
Sbjct  3488  RIDTNTGLIYVARHLDRETQNRVVLTV  3514


 Score = 43.1 bits (100),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 45/92 (49%), Gaps = 3/92 (3%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            + D NDN P+F  + Y+  + E    G+ V  V ASD D  G NS+I+Y L        F
Sbjct  260  ILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDND-LGDNSKITYYLAE--TEHQF  316

Query  71   SLNPSTGVFTLTANLDYEQMGLVLFPITMLHC  102
            ++NP TGV + T  ++  Q   V    +   C
Sbjct  317  TVNPETGVISTTERVNCPQQTNVKSSASQKSC  348


 Score = 42.7 bits (99),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/80 (33%), Positives = 42/80 (53%), Gaps = 3/80 (4%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V D NDNAP F  + ++F + EN P  + VG++ A D D  G N+++S+ L S   +  F
Sbjct  1143  VIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRD-IGRNAELSFTLSSQTQD--F  1199

Query  71    SLNPSTGVFTLTANLDYEQM  90
             +++   G        D E +
Sbjct  1200  TIDTRNGFIKTLRPFDREAL  1219


 Score = 41.2 bits (95),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 40/85 (47%), Gaps = 5/85 (6%)

Query  10    VVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDW----  65
             +V D NDN P+F +TA    + E +P  + +  V A D D  G N ++SYA+        
Sbjct  1478  LVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDS-GLNGKVSYAISKQEPQLP  1536

Query  66    ANDVFSLNPSTGVFTLTANLDYEQM  90
                 F +N  TGV      +D E +
Sbjct  1537  QGRHFGINTETGVIHTLREIDRESI  1561


 Score = 40.8 bits (94),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 39/79 (49%), Gaps = 1/79 (1%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             + D ND  P F    Y+  + E  P G++V  V A D D    N+Q SY++I+      F
Sbjct  3536  IQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSF  3594

Query  71    SLNPSTGVFTLTANLDYEQ  89
              ++  TG  +  + LD E+
Sbjct  3595  KIDVQTGEISTASRLDREE  3613


 Score = 40.8 bits (94),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 40/79 (51%), Gaps = 2/79 (3%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             + D ND+ PVF  T+Y   + E     +R   +AA+D D  G N +ISY +I      +F
Sbjct  1039  IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDID-LGDNGRISYEIIEGNTERMF  1097

Query  71    SLNPSTGVFTLTANLDYEQ  89
              + P  G   + A LD E+
Sbjct  1098  GVFPD-GYLFVRAPLDREE  1115


 Score = 40.0 bits (92),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 36/78 (46%), Gaps = 0/78 (0%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             + D NDN P F     +  + EN P G+ +  + ASD D P      +Y LI        
Sbjct  3641  LEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWL  3700

Query  71    SLNPSTGVFTLTANLDYE  88
             S++ ++GV   T + D E
Sbjct  3701  SVDRNSGVVRSTTSFDRE  3718


 Score = 38.5 bits (88),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 2/75 (3%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V+D NDN P F +T Y+  V E + +G  V    A D D  G N+ + Y  IS      F
Sbjct  2586  VSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDD-GENAVVHYT-ISGRDQHYF  2643

Query  71    SLNPSTGVFTLTANL  85
              +N  TGV +    L
Sbjct  2644  DINTKTGVVSTKLEL  2658


 Score = 38.5 bits (88),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/86 (34%), Positives = 42/86 (49%), Gaps = 5/86 (6%)

Query  11    VTDTNDNAPVF---QATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWAN  67
             + D NDNAPVF   + +  +  + EN   G  +      D D  G NS+ISY+L ++  N
Sbjct  932   IIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDA-GVNSRISYSLTNN-PN  989

Query  68    DVFSLNPSTGVFTLTANLDYEQMGLV  93
               F + P TGV  L   +  E   L+
Sbjct  990   QQFRIGPVTGVLYLQRPIRAEPGSLI  1015


 Score = 37.4 bits (85),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V D ND+ P F  T + ++V E++  G  +  + A D D  G    +++ L+ D  +  F
Sbjct  1813  VLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLG---SVTF-LLMDGHDGKF  1868

Query  71    SLNPSTGVFTLTANLDYE  88
              L PSTG   L   LD E
Sbjct  1869  LLEPSTGKLILNDTLDRE  1886


 Score = 37.0 bits (84),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 43/83 (52%), Gaps = 5/83 (6%)

Query  10    VVTDTNDNAPVFQA-TAYSFDVLENMPRGSR--VGQVAASDADGPGPNSQISYALISDWA  66
             +V D NDNAPVF +  A       +  +GS   V QV A DAD    N  ++Y ++S   
Sbjct  1590  IVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADS-SSNGLVTYEIVS-GP  1647

Query  67    NDVFSLNPSTGVFTLTANLDYEQ  89
              ++F L  +TG+ T T    ++Q
Sbjct  1648  QELFKLQRNTGIITFTPGPQFKQ  1670


 Score = 35.0 bits (79),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 42/96 (44%), Gaps = 9/96 (9%)

Query  10    VVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDV  69
             ++ D ND  PVF  +A    ++EN+   + V  V A D D  G N  I Y +      D+
Sbjct  2156  LIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDND-EGRNGYIDYLMKEARDEDM  2213

Query  70    -------FSLNPSTGVFTLTANLDYEQMGLVLFPIT  98
                    FSLNP+ G   +   LD E     L  IT
Sbjct  2214  GQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNIT  2249


 Score = 34.3 bits (77),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 41/88 (47%), Gaps = 4/88 (5%)

Query  6    WLDRVVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYAL---I  62
             L  ++ D ND AP F     +  + E+ P  + V  + A+D D  G N  +++AL   +
Sbjct  584  QLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHD-QGTNGSVTFALAPSV  642

Query  63   SDWANDVFSLNPSTGVFTLTANLDYEQM  90
                   F+L+  TG  T    LD E+M
Sbjct  643  ERLYPLQFALDALTGQLTTRRPLDREKM  670


 Score = 33.5 bits (75),  Expect = 0.021, Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (54%), Gaps = 1/71 (1%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             + D ++N P F+   Y   + ++  RG R+ +V A+D    G N ++ Y+L++   + +F
Sbjct  3114  IVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIF  3172

Query  71    SLNPSTGVFTL  81
             S+    G  TL
Sbjct  3173  SVGRHDGWITL  3183


 Score = 32.3 bits (72),  Expect = 0.047, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 40/89 (45%), Gaps = 8/89 (9%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            V D NDN+P F   + +    E+   G+R+   AA+DAD         Y +++   ++ F
Sbjct  146  VLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKF  205

Query  71   SL----NPSTGVFTL----TANLDYEQMG  91
             L    NPS     L    T NLD E  G
Sbjct  206  RLVTTANPSGDTSYLHLETTGNLDRESRG  234


 Score = 28.1 bits (61),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 10/67 (15%)

Query  24   TAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVFSLNPSTGVFTLTA  83
            T+  F+VLE  PRG+ VG +            + SY    +     F+L+P TG      
Sbjct  67   TSADFEVLEGQPRGTTVGFIPT--------KPKFSYRF--NEPPREFTLDPVTGEVKTNV  116

Query  84   NLDYEQM  90
             LD E M
Sbjct  117  VLDREGM  123


 Score = 28.1 bits (61),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 38/88 (43%), Gaps = 13/88 (15%)

Query  6    WLDRVVTDTNDNAPVFQATAYSFDV--------LENMPRGSRV-GQVAASDADGPGPNSQ  56
            WL+  V D NDN P F    Y + +        L+      R+   V ASD D  G N+ 
Sbjct  695  WLN--VADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDD-GDNAL  751

Query  57   ISYALISDWANDVFSLNPSTGVFTLTAN  84
            I Y L S     +F L+  +G  +L  +
Sbjct  752  IEYRLES-GGEGLFQLDARSGAISLRGD  778


>Q9VFH5_DROME unnamed protein product
Length=1981

 Score = 63.2 bits (152),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 47/78 (60%), Gaps = 3/78 (4%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            V D NDNAP+FQ + Y+  V E++P GS V QV A D DG  PN+ + Y  I   A D F
Sbjct  736  VQDVNDNAPIFQQSFYAKTVPEDLPGGSSVLQVTAIDRDGSAPNNVVVYR-IQTGAGDKF  794

Query  71   SLNPSTGVFTLT--ANLD  86
             +N  TGV ++   ANLD
Sbjct  795  IINSETGVISVAHGANLD  812


 Score = 50.8 bits (120),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (52%), Gaps = 1/81 (1%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPG-PNSQISYALISDWANDV  69
            + D NDNAP F    Y   +LEN        Q+ A DAD  G  NSQ++Y ++       
Sbjct  611  ILDVNDNAPTFPQRQYETKLLENQAEFETPLQLEARDADLNGTENSQVTYEIVEGLYRSN  670

Query  70   FSLNPSTGVFTLTANLDYEQM  90
            F+++P +G+     + D+E++
Sbjct  671  FTIDPQSGLLRPVHSFDFEEL  691


 Score = 46.2 bits (108),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            V D  D  P F        + E+ P G++V +V A D D  G N+ I+Y+L    AND+F
Sbjct  271  VKDLEDQPPEFVEVQAVARIAEDAPVGTKVLRVRAIDGD-RGINNPIAYSL---EANDLF  326

Query  71   SLNPSTGVFTLTANLDYEQM  90
             +NP TG+      LD E+ 
Sbjct  327  DINPHTGIVHTLTKLDREEQ  346


 Score = 44.3 bits (103),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (53%), Gaps = 1/78 (1%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
             V D NDN P F   + ++ + EN   G+RV  + A DAD  G   +I++ +    +   F
Sbjct  1074  VLDENDNNPYFVGGSKNYTISENAAPGTRVATLQAGDADS-GDFGKITFLMDRISSQGKF  1132

Query  71    SLNPSTGVFTLTANLDYE  88
             +++  TGV T+   LD E
Sbjct  1133  TIDADTGVLTVADRLDRE  1150


 Score = 44.3 bits (103),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 48/102 (47%), Gaps = 11/102 (11%)

Query  10   VVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVA---ASDADGPGPNSQISYALIS-DW  65
            +V D NDN P F     + ++    P GS  G V+   A+DAD  G   Q+ Y L   D 
Sbjct  161  LVEDINDNVPTFLPYQNAIEI----PEGSAPGVVSTLEATDAD-EGAYGQVVYYLQELDG  215

Query  66   ANDVFSL--NPSTGVFTLTANLDYEQMGLVLFPITMLHCANH  105
             NDVFS+  +   G+  L   LDYE+  L    +  +  AN 
Sbjct  216  DNDVFSIATHQGKGILRLQKELDYERKSLYQLRVLAIDRANQ  257


 Score = 43.9 bits (102),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 42/85 (49%), Gaps = 4/85 (5%)

Query  6     WLDRVVTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISD-  64
             +L   V D NDN P F+   Y   + EN   G+ +  V ASD D    N  I+YAL  + 
Sbjct  965   FLSIQVLDENDNNPKFRLPFYRQSITENSINGAMIVNVLASDVD---KNRTITYALEGNP  1021

Query  65    WANDVFSLNPSTGVFTLTANLDYEQ  89
                 +  L+P TG   + + +D+EQ
Sbjct  1022  TYRSLMHLDPQTGEIVVASKIDHEQ  1046


 Score = 40.8 bits (94),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 35/72 (49%), Gaps = 1/72 (1%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDAD-GPGPNSQISYALISDWANDV  69
            + D NDN P F  T Y+  VLEN  + + +  V A D D G      I Y  +      +
Sbjct  500  IRDQNDNFPEFSQTIYNASVLENSEQDTIITHVQAVDVDSGDYGTMGIRYTNLRGGIAHL  559

Query  70   FSLNPSTGVFTL  81
             +LNP TGV T+
Sbjct  560  LNLNPITGVITI  571


 Score = 38.5 bits (88),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 5/90 (6%)

Query  7     LDRVVTDTNDNAPVFQATAYSFDVL--ENMPRGSRVGQVAASDADGPGPNSQISYALISD  64
             LD  V+D ND+APVF    ++  V   EN   G+ + Q  ASD D  G N+ + Y L  D
Sbjct  1290  LDICVSDFNDHAPVFVRPLHNTTVRIPENATVGTLILQAYASDGD-MGQNALVRYRLKPD  1348

Query  65    --WANDVFSLNPSTGVFTLTANLDYEQMGL  92
                +  +F ++ STG   L   L+ E+  +
Sbjct  1349  PLGSYKMFEVDGSTGELFLKEQLNREKQKI  1378


 Score = 32.7 bits (73),  Expect = 0.043, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (54%), Gaps = 1/54 (2%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISD  64
             V D NDN P F++  ++  +  N   G +  +V A+DAD  G N +I Y  + +
Sbjct  1595  VLDINDNPPRFRSKIFTGGITTNADFGLKFMRVEATDAD-EGDNGRIGYYQVGE  1647


 Score = 31.2 bits (69),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 44/102 (43%), Gaps = 17/102 (17%)

Query  10   VVTDTNDNAPVFQATAYSFDVLENMPRGSRVG------QVAASDADGPGPNSQISYALIS  63
            +V+D ND  P F  T Y  +V EN    + +       Q    D D  G N   ++ L  
Sbjct  382  IVSDVNDEIPTFGETVYRCEVNENAQTNTPLNFIDEEVQNVVFDHD-EGNNG--TFRLFL  438

Query  64   DWANDVFSLNPSTGV----FTL----TANLDYEQMGLVLFPI  97
            D  ND+F + P   V    F L    + +LD+EQ   V F I
Sbjct  439  DPPNDLFEIVPELAVNEANFMLRVKNSKSLDFEQFTEVNFTI  480


 Score = 29.3 bits (64),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 42/102 (41%), Gaps = 8/102 (8%)

Query  11    VTDTNDNAPVFQATAYSFDVLENMPRGS-RVGQVAASDADG---PGPN---SQISYALIS  63
             V + ND  P F     S +  E+   GS R+      D D      PN   SQ+ Y +++
Sbjct  1404  VRNVNDYEPQFMVNEISVNFTEHSDPGSERIKLPDTIDKDQLELDDPNDTPSQVCYFIVN  1463

Query  64    DWANDVFSLNPSTGVFTLTANLDYEQMG-LVLFPITMLHCAN  104
                   F L+P T + T+   LD E +    L+     +C N
Sbjct  1464  GNEAGYFRLDPETHILTVDRELDREVIANFTLYVRATENCRN  1505


 Score = 26.9 bits (58),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 1/39 (3%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDAD  49
            + D N+  PV +    +  +LEN P G+ V ++ A+D D
Sbjct  849  IQDVNNKPPVLKEMP-ALQILENTPVGTLVYRIQATDLD  886


>CAD86_DROME unnamed protein product
Length=1943

 Score = 60.1 bits (144),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 1/74 (1%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            + D NDNAPVF+  AYS ++ ENM  G++V QV A+D D  G   ++ Y  I  + N   
Sbjct  590  INDVNDNAPVFEQPAYSVELPENMTAGTKVVQVLATDPDS-GLGGKVRYTAILGYLNTSL  648

Query  71   SLNPSTGVFTLTAN  84
            +L+  TG+ T++ N
Sbjct  649  NLDAETGLITVSTN  662


 Score = 40.8 bits (94),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/71 (27%), Positives = 35/71 (49%), Gaps = 0/71 (0%)

Query  11   VTDTNDNAPVFQATAYSFDVLENMPRGSRVGQVAASDADGPGPNSQISYALISDWANDVF  70
            + D ND  P+F    Y F +  ++   +    + A D D   PN+++ Y +I+   ++ F
Sbjct  698  LIDVNDETPIFDKDLYEFILTHDLMGFTTTAVIHAEDKDATAPNNEVRYEIINGNYDNQF  757

Query  71   SLNPSTGVFTL  81
             L+  TG  T+
Sbjct  758  VLDKVTGELTV  768


 Score = 27.7 bits (60),  Expect = 2.3, Method: Composition-based stats.
 Identities = 28/97 (29%), Positives = 40/97 (41%), Gaps = 14/97 (14%)

Query  13   DTNDNAPVFQATAYSFDVLENMPRGSRVG----QVAASDADGPGPNSQISYALISDWAND  68
            D  ++ P F+   Y   V EN P+G+ +      V     D  G N   S  L+++  N 
Sbjct  475  DRTNSPPYFENDHYVSRVDENAPQGTALTFVDPYVPRVYDDDTGKNGVFSLTLLNN--NG  532

Query  69   VFSLNP-----STGVFTLTAN---LDYEQMGLVLFPI  97
             F ++P     S G      +   LDYEQ   V F I
Sbjct  533  TFEISPNVAERSAGFLIRVRDNSMLDYEQQQSVQFQI  569



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000036-PA

Length=462
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FAT_DROME  unnamed protein product                                    497     2e-158
STAN_DROME  unnamed protein product                                   186     7e-51 
FAT2_DROME  unnamed protein product                                   177     8e-48 


>FAT_DROME unnamed protein product
Length=5147

 Score = 497 bits (1280),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 259/478 (54%), Positives = 338/478 (71%), Gaps = 34/478 (7%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LS+T+TVYCNV+DLNDNAP+F+P + + ++ ENV +   V+   A D+D+G+NGLI Y+I
Sbjct  2007  LSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSI  2066

Query  61    VAGDDNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPR--APAKPLAST---IQIK  115
              AGD + +FG+ +NGTI TRR LDRE +S Y L + ARD     A    L  T   ++ +
Sbjct  2067  TAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYR  2126

Query  116   SHRAYKYT----LVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN  171
             S R Y+ T    L  +    +S+ V               ++T+ + DVND+ P F+S N
Sbjct  2127  SPRKYQQTRQEFLAHQKQQRLSSTV---------------KVTILIKDVNDEVPVFISAN  2171

Query  172   QTSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGE-------VPFALGSVDGVLR  224
             +T++ E VAIN+VV+ VKAVD DEGRNGY++Y +   + E       +PF+L   DG LR
Sbjct  2172  ETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLR  2231

Query  225   VSGPLDREHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENA  284
             V   LDRE RS+Y L +TA+DRGEPP+ T  ++L+ +LDENDNSPVFDP++YSAS+AENA
Sbjct  2232  VVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENA  2291

Query  285   SIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRL  344
             SIGA VLQVSA+D DEGANGR+RYSI  GD N DF+ISED G +RVA++LN+ER   Y L
Sbjct  2292  SIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSL  2351

Query  345   QVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQV  404
              V+AEDCA E   +   D AE+ I++LD+NDN P F DSPYLA VMEN +PP  G+V+ V
Sbjct  2352  TVRAEDCALE---NPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTV  2408

Query  405   KAYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMDT  462
              AYDADTPP N QVRYF+KEGD+DLFRINAS+G+I LL+PLDRE+  EY LTL+AMDT
Sbjct  2409  NAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDT  2466


 Score = 187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 143/432 (33%), Positives = 201/432 (47%), Gaps = 54/432 (13%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFG  70
             ++D NDN+P+F+P   +  + EN ++GA+VL   ATD+D G NG I Y+IV GD N DF 
Sbjct  2268  ILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFS  2327

Query  71    VAAN-GTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRAS  129
             ++ + G +   + L+ E  S Y L + A D                              
Sbjct  2328  ISEDTGVVRVAKNLNYERLSRYSLTVRAED------------------------------  2357

Query  130   SSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFV-STNQTSVTEGVAI--NSVVM  186
                    CA  N    P  D +++T+++ D+ND  P F+ S     V E         V+
Sbjct  2358  -------CALEN----PAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVL  2406

Query  187   VVKAVDRDEG-RNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKD  245
              V A D D    N  V Y L  G  ++ F + +  G + +  PLDRE +S Y L L A D
Sbjct  2407  TVNAYDADTPPLNSQVRYFLKEGDSDL-FRINASSGDIALLKPLDREQQSEYTLTLVAMD  2465

Query  246   RGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGR  305
              G PP      V V V D NDN PVF+ + Y A++ EN   G +VL   A+D+DEG N +
Sbjct  2466  TGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAK  2525

Query  306   LRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAE  365
             LR+++  G+    F I  + G I  A +L+ E    Y L + A+D +     + R     
Sbjct  2526  LRFNLL-GEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSIT---EPRASSVN  2581

Query  366   VIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEG  425
             + ISV DVNDN P F  + Y   V E +      FV   +A D D    N  V Y I   
Sbjct  2582  LTISVSDVNDNIPKFDSTTYNVAVPERI--SKGEFVFGARALDLDDGE-NAVVHYTISGR  2638

Query  426   DTDLFRINASTG  437
             D   F IN  TG
Sbjct  2639  DQHYFDINTKTG  2650


 Score = 186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 145/475 (31%), Positives = 213/475 (45%), Gaps = 74/475 (16%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFG  70
             + D+ND+ P+F+  +    LPE   V        ATD+D GDNG I Y I+ G+    FG
Sbjct  1039  IADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFG  1098

Query  71    VAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRASS  130
             V  +G ++ R  LDRE +  Y L +  RDA     +P  S++                  
Sbjct  1099  VFPDGYLFVRAPLDREERDYYALTVSCRDA----GQPSRSSV------------------  1136

Query  131   SISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFV-STNQTSVTEGVAINSVVMVVK  189
                                   + + + D ND AP+F  ST   S+ E    ++ V  + 
Sbjct  1137  --------------------VPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLT  1176

Query  190   AVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDRE-----------------  232
             AVDRD GRN  + ++L+    +  F + + +G ++   P DRE                 
Sbjct  1177  AVDRDIGRNAELSFTLSSQTQD--FTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGS  1234

Query  233   ----HRSNYE-LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIG  287
                    NY  L  T  D G P      +V V V D NDN+P F    Y  +I+E AS G
Sbjct  1235  LRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEG  1294

Query  288   ANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQ  347
              ++  V   D DEG NG + YS+A G++   F +    G + + R L+ E +  + L V 
Sbjct  1295  THITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVV  1354

Query  348   AEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAY  407
             A+D A +        +A + I VLD NDNAP F  S     V+E    P    +M+ +A 
Sbjct  1355  AKDAALK---HPLSSNASITIVVLDENDNAPEFTQSSSEVSVLET--SPTGTELMRFRAS  1409

Query  408   DADTPPYNDQVRYFIKEGD-TDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             DAD    N QV + I  G+  D F I++ TG ++L +PLD E +  Y L + A D
Sbjct  1410  DADQ-GVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASD  1463


 Score = 177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 146/477 (31%), Positives = 221/477 (46%), Gaps = 68/477 (14%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             L   V V   V D+NDNAP F      V + E  + G  +      D D G NG + Y++
Sbjct  1258  LQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSL  1317

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
               G++ G F + +A G +   R LDRE++ ++ L++ A+DA                   
Sbjct  1318  AKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDA-------------------  1358

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFV-STNQTSVTEG  178
                                    +K P   ++ IT+ + D ND APEF  S+++ SV E 
Sbjct  1359  ----------------------ALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLET  1396

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYE  238
                 + +M  +A D D+G N  V +S++ G     F + S+ G L +  PLD E  ++Y 
Sbjct  1397  SPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYT  1456

Query  239   LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDR  298
             L +TA D G P   T     V V+D+NDN P+F        I E   +   ++ V+A D 
Sbjct  1457  LNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDP  1516

Query  299   DEGANGRLRYSIASGD----DNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPE  354
             D G NG++ Y+I+  +      R F I+ + G I   R ++ E   ++RL V A D A  
Sbjct  1517  DSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQP  1576

Query  355   LGGDARFDHAEVIISVL--DVNDNAPLFRDSPYLAHVMENMLPP-------ASGFVMQVK  405
                  R    E +++V+  D+NDNAP+F        +   +LPP       +S  VMQV 
Sbjct  1577  ---SERQLSTEKLVTVIVEDINDNAPVF------VSMNAAILPPKFSTSKGSSTAVMQVH  1627

Query  406   AYDADTPPYNDQVRYFIKEGDTDLFRINASTGEI-FLLRPLDRERVPEYVLTLLAMD  461
             A DAD+   N  V Y I  G  +LF++  +TG I F   P  ++ V  Y LTL + D
Sbjct  1628  AKDADSSS-NGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEV-RYQLTLKSTD  1682


 Score = 167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 153/478 (32%), Positives = 218/478 (46%), Gaps = 70/478 (15%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LSSTV V   + D+ND  P+F   A    + ENVA+  +V+  +A D D G NG I Y +
Sbjct  2147  LSSTVKVTILIKDVNDEVPVF-ISANETAIMENVAINTVVIAVKAVDNDEGRNGYIDYLM  2205

Query  61    VAGDDNGDFGVA---------ANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLAST  111
                 D  D G +          +G +     LDRE +S Y L + ARD            
Sbjct  2206  KEARDE-DMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARD------------  2252

Query  112   IQIKSHRAYKYTLVIRASSSISANVCAQRNEIKQPPHD-DSQITVSLTDVNDQAPEFVST  170
                                         R E   PP   +SQ+ + + D ND +P F   
Sbjct  2253  ----------------------------RGE---PPQSTESQLLIRILDENDNSPVFDPK  2281

Query  171   NQT-SVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPL  229
               + SV E  +I ++V+ V A D DEG NG + YS+  G     F++    GV+RV+  L
Sbjct  2282  QYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNL  2341

Query  230   DREHRSNYELALTAKDRG-EPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENA--SI  286
             + E  S Y L + A+D   E P      + +N+LD NDN P F    Y A + EN     
Sbjct  2342  NYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPN  2401

Query  287   GANVLQVSASDRDEGA-NGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQ  345
             G  VL V+A D D    N ++RY +  GD +  F I+   G I + + L+ E++  Y L 
Sbjct  2402  GGYVLTVNAYDADTPPLNSQVRYFLKEGDSDL-FRINASSGDIALLKPLDREQQSEYTLT  2460

Query  346   VQAEDC-APELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQV  404
             + A D  +P L G        V + V D+NDN P+F    Y A V EN+  P+   V+  
Sbjct  2461  LVAMDTGSPPLTGTGI-----VRVEVQDINDNDPVFELQSYHATVRENL--PSGTHVLTP  2513

Query  405   KAYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMDT  462
             +A D D    N ++R+ +       F I++ TGEI     LDRE    Y LTL+A D+
Sbjct  2514  RATDKDEG-LNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDS  2570


 Score = 160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 212/501 (42%), Gaps = 93/501 (19%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
             +S   V   V+D ND+ P F       ++ E++ +G  +   RA D D    G + + ++
Sbjct  1804  TSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL--GSVTFLLM  1861

Query  62    AGDDNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYK  121
              G D       + G +     LDRE KS                               K
Sbjct  1862  DGHDGKFLLEPSTGKLILNDTLDRETKS-------------------------------K  1890

Query  122   YTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQT-SVTEGVA  180
             Y L IR S  +               + ++  T+ ++D ND  P F  T  +  + E   
Sbjct  1891  YELRIRVSDGVQ--------------YTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQ  1936

Query  181   INSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELA  240
                 V  + A D D G+N  + Y +        F+L    G+L ++  LD E   +Y L 
Sbjct  1937  RGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILI  1996

Query  241   LTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDE  300
             + A+D G+P   T   V  NVLD NDN+P+FDP  YS+ + EN  I   V+ VSA D D 
Sbjct  1997  VQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDS  2056

Query  301   GANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDAR  360
             G NG + YSI +GD + +F I +  G IR  R+L+ E + +Y L V A DCA E    + 
Sbjct  2057  GNNGLIEYSITAGDVDSEFGI-DSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSE  2115

Query  361   FDHAE--------------------------------VIISVLDVNDNAPLFRDSPYLAH  388
              +  +                                V I + DVND  P+F  +   A 
Sbjct  2116  LEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETA-  2174

Query  389   VMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEG-DTDL-------FRINASTGEIF  440
             +MEN+    +  V+ VKA D D    N  + Y +KE  D D+       F +N + G++ 
Sbjct  2175  IMENV--AINTVVIAVKAVDNDE-GRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLR  2231

Query  441   LLRPLDRERVPEYVLTLLAMD  461
             ++  LDRE    Y+L + A D
Sbjct  2232  VVDALDRELRSSYLLNITARD  2252


 Score = 157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 144/488 (30%), Positives = 213/488 (44%), Gaps = 86/488 (18%)

Query  2    SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
            ++T  +  +V D+ND+ P+FE    +  L E    G+ V    ATD D G N  + Y I+
Sbjct  475  TTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDIL  534

Query  62   AGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAY  120
            +G++   F +    G I T   LDRE +    L + ARD    P               +
Sbjct  535  SGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNP--------------KF  580

Query  121  KYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQ-TSVTEGV  179
             YT                            Q+ V + D ND+AP+F    Q  ++ E  
Sbjct  581  AYT----------------------------QLKVIILDENDEAPQFSQREQNVTLGEDA  612

Query  180  AINSVVMVVKAVDRDEGRNGYVEYSLAPGQGE---VPFALGSVDGVLRVSGPLDREHRSN  236
               ++V ++ A D D+G NG V ++LAP       + FAL ++ G L    PLDRE  S 
Sbjct  613  PPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQ  672

Query  237  YELALTAKDRGEP-PRITAQRVLVNVLDENDNSPVFDPRRYSASIA------------EN  283
            YE+++ A+D+G P P+     V +NV D NDN P F PR Y  S+A            E 
Sbjct  673  YEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEK  732

Query  284  ASIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAI--RVARSLNFERKPS  341
              I   +L V+ASD+D+G N  + Y + SG +   F +    GAI  R     +   KP 
Sbjct  733  ERI---LLHVTASDKDDGDNALIEYRLESGGEGL-FQLDARSGAISLRGDAPASMHWKPH  788

Query  342  YRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPL----FRDSPYLAHVME------  391
            Y+L V A D         R    + I+ ++  +    L     +   Y   ++E      
Sbjct  789  YKLLVSARDAG------QRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQR  842

Query  392  NMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGD-TDLFRINASTGEIFLLRPLDRERV  450
            N  P     ++QVK+ +      N  + Y I +GD    FRI+  +G I   RPLDRE  
Sbjct  843  NSQPNREVGIVQVKSTNGKA---NSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQ  899

Query  451  PEYVLTLL  458
              Y LT+L
Sbjct  900  ANYRLTIL  907


 Score = 157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 151/498 (30%), Positives = 217/498 (44%), Gaps = 99/498 (20%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFG  70
             V D NDN P+FE    + D+PEN   G  V    A D D G N  + Y +V+   N  F 
Sbjct  1912  VSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFS  1971

Query  71    V-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKP-LASTIQIKSHRAYKYTLVIRA  128
             +    G +     LD E    Y L+++A+D      +P L++TI                
Sbjct  1972  LNPQTGMLTLTARLDYEEVQHYILIVQAQDN----GQPSLSTTI----------------  2011

Query  129   SSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTS-VTEGVAINSVVMV  187
               ++  NV                      D+ND AP F   + +S V E V I + V+ 
Sbjct  2012  --TVYCNVL---------------------DLNDNAPIFDPMSYSSEVFENVPIATEVVT  2048

Query  188   VKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKD--  245
             V A D D G NG +EYS+  G  +  F + S +G +R    LDREHRS Y L +TA+D  
Sbjct  2049  VSAKDIDSGNNGLIEYSITAGDVDSEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCA  2107

Query  246   ----------------RGEPPRITAQ------------------RVLVNVLDENDNSPVF  271
                             +   PR   Q                  +V + + D ND  PVF
Sbjct  2108  DEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVF  2167

Query  272   DPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYSIASGDDN-------RDFAISED  324
                  +A I EN +I   V+ V A D DEG NG + Y +    D          F+++  
Sbjct  2168  ISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPT  2226

Query  325   GGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSP  384
              G +RV  +L+ E + SY L + A D     G   +   ++++I +LD NDN+P+F    
Sbjct  2227  DGQLRVVDALDRELRSSYLLNITARD----RGEPPQSTESQLLIRILDENDNSPVFDPKQ  2282

Query  385   YLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDL-FRINASTGEIFLLR  443
             Y A V EN        V+QV A D D    N ++RY I  GD +  F I+  TG + + +
Sbjct  2283  YSASVAENA--SIGAMVLQVSATDVDEGA-NGRIRYSIVLGDQNHDFSISEDTGVVRVAK  2339

Query  444   PLDRERVPEYVLTLLAMD  461
              L+ ER+  Y LT+ A D
Sbjct  2340  NLNYERLSRYSLTVRAED  2357


 Score = 154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 199/459 (43%), Gaps = 47/459 (10%)

Query  7     VYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDA-GDNGLIGYAIVAGDD  65
             +   + D NDNAP FE    +   PE     ALV    ATD D  G N +I Y++     
Sbjct  2999  ITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSL-----  3053

Query  66    NGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLV  125
                                             + +P     P    +  K    +K++  
Sbjct  3054  -------------------------------QQPSPMFSIDPATGEVFSKKAVRFKHSQY  3082

Query  126   IRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTEGVAINSVV  185
             +R+  ++ A      +  K P + +  + +++ D ++  P+F      +     A+    
Sbjct  3083  VRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQR  3142

Query  186   MV-VKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAK  244
             +V V A D+ +     ++YSL        F++G  DG + +  P+     + YEL + A 
Sbjct  3143  IVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRAT  3202

Query  245   DRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANG  304
             DRG PP+    RV++ V  EN ++P F    Y   + EN  +G+ +L V A+D D G NG
Sbjct  3203  DRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNG  3262

Query  305   RLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHA  364
              LRYSI+ G++ +DF++ E  G I + + L+++    Y L +  +D    LG       A
Sbjct  3263  MLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQD----LGYHPLSSVA  3318

Query  365   EVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRY-FIK  423
              + I + DVNDN P+F    Y  ++ EN   P   FV Q  A D D+P  N  + Y F+ 
Sbjct  3319  MLTIILTDVNDNPPVFNHKEYHCYIPENK--PVGTFVFQAHAADKDSPK-NAIIHYAFLP  3375

Query  424   EG-DTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
              G D   F +N S G I      D E    Y L + A +
Sbjct  3376  SGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKN  3414


 Score = 152 bits (384),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 131/452 (29%), Positives = 195/452 (43%), Gaps = 52/452 (12%)

Query  15    NDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFGV-AA  73
             N + P F   +  V +PEN  VG+ +L   ATD D G NG++ Y+I  G++  DF V   
Sbjct  3223  NMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDER  3282

Query  74    NGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRASSSIS  133
              G I  +++LD +    Y L +  +D    P   +A                        
Sbjct  3283  TGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVA------------------------  3318

Query  134   ANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN-QTSVTEGVAINSVVMVVKAVD  192
                                +T+ LTDVND  P F        + E   + + V    A D
Sbjct  3319  ------------------MLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAAD  3360

Query  193   RDEGRNGYVEYSLAP-GQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKDRGEPPR  251
             +D  +N  + Y+  P G     F +   +G +  +   D E R  Y L + AK+      
Sbjct  3361  KDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSME  3420

Query  252   ITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYSIA  311
               A  + V+VL  N+  P F    +   ++E +++G  V  V A+D+D G +GR+ Y + 
Sbjct  3421  SYAN-LYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLV  3479

Query  312   SGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIISVL  371
                +++ F I  + G I VAR L+ E +    L V A++     G D   D A+VIIS+ 
Sbjct  3480  GSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDT--DEAQVIISIQ  3537

Query  372   DVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGD-TDLF  430
             D ND  P F    Y + + E    P    V  VKA D D    N+Q  Y I  G+    F
Sbjct  3538  DGND-PPEFIKHYYTSTISE--AAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSF  3594

Query  431   RINASTGEIFLLRPLDRERVPEYVLTLLAMDT  462
             +I+  TGEI     LDRE    Y L + A+DT
Sbjct  3595  KIDVQTGEISTASRLDREETSTYNLVIGAIDT  3626


 Score = 146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 145/472 (31%), Positives = 203/472 (43%), Gaps = 79/472 (17%)

Query  5    VTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLI-GYAIVAG  63
            + V   V+D+NDN+P F   + A+   E+   G  +L   ATD D G+NG+   Y IVAG
Sbjct  140  IEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAG  199

Query  64   DDNGDFGVAANG-----TIYTRRE----LDREAKSVYGLVLEARDAPRAPAKPLASTIQI  114
            + +  F +         T Y   E    LDRE++  Y L + ARD    P          
Sbjct  200  NVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPP----------  249

Query  115  KSHRAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN-QT  173
                 + Y                             Q+ V++ DVND  P F  ++   
Sbjct  250  ----RFGYL----------------------------QVNVTILDVNDNPPIFDHSDYNV  277

Query  174  SVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREH  233
            S+ E     + V+ V A D D G N  + Y LA  + E  F +    GV+  +  ++   
Sbjct  278  SLNETALPGTPVVTVMASDNDLGDNSKITYYLA--ETEHQFTVNPETGVISTTERVNCPQ  335

Query  234  RSNYE---------LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYS-----AS  279
            ++N +           + A+D G P +     V VN+LD ND+ P+   R +      A+
Sbjct  336  QTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVAT  395

Query  280  IAENASIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISE--DGGAIRVARSLNFE  337
            + ENA  G  V  V+  D D G NGR    I SG++   F + E  D   +RV   L+ E
Sbjct  396  VDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDRE  455

Query  338  RKPSYRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPA  397
                Y L V A D     G  AR   A +II V DVND+ P+F  S Y A + E  L P 
Sbjct  456  EIGKYNLTVVAMD----QGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSE--LAPT  509

Query  398  SGFVMQVKAYDADTPPYNDQVRYFIKEG-DTDLFRINASTGEIFLLRPLDRE  448
              FV  + A D DT   N QV Y I  G +   F ++  TG I    PLDRE
Sbjct  510  GSFVASITATDEDT-GVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDRE  560


 Score = 145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 141/476 (30%), Positives = 207/476 (43%), Gaps = 75/476 (16%)

Query  11    VVDLNDNAPMF------EPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGD  64
             ++DLNDNAP+F      EP    + LPEN AVG  +  +R  D DAG N  I Y++   +
Sbjct  932   IIDLNDNAPVFALDRESEP---TISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLT-NN  987

Query  65    DNGDFGVA-ANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYT  123
              N  F +    G +Y +R +  E  S+  + L A DA   P                   
Sbjct  988   PNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPL------------------  1029

Query  124   LVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTEGVAINS  183
                 +S    + + A  N+   P  D +    SL       PE    N           +
Sbjct  1030  ----SSKLSLSVLIADVND-HTPVFDHTSYETSL-------PETTKVN-----------T  1066

Query  184   VVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTA  243
                 + A D D G NG + Y +  G  E  F +   DG L V  PLDRE R  Y L ++ 
Sbjct  1067  RFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP-DGYLFVRAPLDREERDYYALTVSC  1125

Query  244   KDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGAN  303
             +D G+P R +   V+++V+DENDN+P F    ++ SI ENA     V +++A DRD G N
Sbjct  1126  RDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRN  1185

Query  304   GRLRYSIASGDDNRDFAISEDGGAIRVARSLNFER--KPSYRLQVQAEDCA--PELGGDA  359
               L ++++S    +DF I    G I+  R  + E   K S   +   ED +    + G+ 
Sbjct  1186  AELSFTLSS--QTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNY  1243

Query  360   RF--------------DHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVK  405
                             D  +V + V DVNDNAP F  +PY  HV  +        +  V 
Sbjct  1244  MLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPY--HVTISEGASEGTHITHVF  1301

Query  406   AYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
               DAD     D      K  +   F ++++TG++ L R LDRE    + L ++A D
Sbjct  1302  TQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKD  1357


 Score = 145 bits (365),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 127/471 (27%), Positives = 205/471 (44%), Gaps = 57/471 (12%)

Query  5    VTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGD  64
            + V   ++D+NDN P+F+     V L E    G  V+   A+D D GDN  I Y +   +
Sbjct  254  LQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETE  313

Query  65   DNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTL  124
                F V     + +  E                   R       +     S ++  +T+
Sbjct  314  HQ--FTVNPETGVISTTE-------------------RVNCPQQTNVKSSASQKSCVFTV  352

Query  125  VIRASSSISANVCAQRNEIKQPPHDDSQ--ITVSLTDVNDQAP-----EFVSTNQTSVTE  177
              R   S               P  D +  +TV+L D ND  P      F    + +  +
Sbjct  353  FARDHGS---------------PRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVD  397

Query  178  GVAINSVVMVVKAV-DRDEGRNGYVEYSLAPGQGEVPFALGSVD--GVLRVSGPLDREHR  234
              A+N  V+   AV D D G NG     +  G     F L       ++RV+G LDRE  
Sbjct  398  ENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEI  457

Query  235  SNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVS  294
              Y L + A D+G P R T   ++++V D ND+ PVF+   YSA ++E A  G+ V  ++
Sbjct  458  GKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASIT  517

Query  295  ASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPE  354
            A+D D G N ++ Y I SG++ + F++    G I     L+ E + +  L + A D  P 
Sbjct  518  ATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGP-  576

Query  355  LGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPY  414
               + +F + ++ + +LD ND AP F        + E+  P     +M    +D  T   
Sbjct  577  ---NPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGT---  630

Query  415  NDQVRYFIKEGDTDL----FRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
            N  V + +      L    F ++A TG++   RPLDRE++ +Y ++++A D
Sbjct  631  NGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARD  681


 Score = 139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 126/465 (27%), Positives = 209/465 (45%), Gaps = 54/465 (12%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATD-LDAGDNGLIGYA  59
             L S   V  N+VD ++N P FE       LP++   G  ++   A D  D G N +  Y+
Sbjct  3104  LYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEM-DYS  3162

Query  60    IVAGDDNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             ++  + +  F V  +    T                            L   IQ+  +  
Sbjct  3163  LMTFNLSSIFSVGRHDGWIT----------------------------LVKPIQVPPNT-  3193

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF-VSTNQTSVTEG  178
              +Y LV+RA+           +    P  D++++ + +T  N   P F V++ Q  V E 
Sbjct  3194  -RYELVVRAT-----------DRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPEN  3241

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYE  238
               + S ++ V A D D G NG + YS++ G     F++    G + +   LD +    Y 
Sbjct  3242  EPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYH  3301

Query  239   LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDR  298
             L +T +D G  P  +   + + + D NDN PVF+ + Y   I EN  +G  V Q  A+D+
Sbjct  3302  LNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADK  3361

Query  299   DEGANGRLRYS-IASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGG  357
             D   N  + Y+ + SG D   F +++  G I  A S ++E +  Y LQ++A++  P+   
Sbjct  3362  DSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKN--PDSSM  3419

Query  358   DARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQ  417
             ++   +A + + VL VN+  P F    +   V E         V  V+A D D+   + +
Sbjct  3420  ES---YANLYVHVLGVNEFYPQFLQPVFHFDVSET--SAVGTRVGAVQATDKDSGE-DGR  3473

Query  418   VRYFIKEGDTDL-FRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             V Y +     D  FRI+ +TG I++ R LDRE     VLT++A +
Sbjct  3474  VYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKN  3518


 Score = 138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 126/476 (26%), Positives = 201/476 (42%), Gaps = 67/476 (14%)

Query  7    VYCNVVDLNDNAPM-----FEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
            V  N++D ND+ P+     F  G +   + EN   G +V      D D+G NG     IV
Sbjct  368  VTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIV  427

Query  62   AGDDNGDFGVAANGTIYTRRE---LDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHR  118
            +G++ G F +     ++  R    LDRE    Y L + A D       P  +T       
Sbjct  428  SGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQ----GTPARTTT------  477

Query  119  AYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTEG  178
                                            + + + + DVND  P F  +  ++V   
Sbjct  478  --------------------------------AHLIIDVNDVNDHEPVFEKSEYSAVLSE  505

Query  179  VA-INSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNY  237
            +A   S V  + A D D G N  V Y +  G     F++  + G++  +GPLDRE R   
Sbjct  506  LAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTV  565

Query  238  ELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASD  297
            EL+++A+D G  P+    ++ V +LDEND +P F  R  + ++ E+A     V  ++A+D
Sbjct  566  ELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATD  625

Query  298  RDEGANGRLRYSIASGDDNR---DFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPE  354
             D+G NG + +++A   +      FA+    G +   R L+ E+   Y + V A D    
Sbjct  626  HDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP  685

Query  355  LGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLP-------PASGFVMQVKAY  407
                A    A V ++V DVNDN P F    Y+  + ++               ++ V A 
Sbjct  686  TPQSAT---ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTAS  742

Query  408  DADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLL--RPLDRERVPEYVLTLLAMD  461
            D D    N  + Y ++ G   LF+++A +G I L    P      P Y L + A D
Sbjct  743  DKDDGD-NALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARD  797


 Score = 138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 134/471 (28%), Positives = 219/471 (46%), Gaps = 64/471 (14%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             L+ T  V   V D+NDN P+FE  +    + EN+  G  VL  RATD D G N  + + +
Sbjct  2471  LTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNL  2530

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             + G+    F + +  G I T   LDRE  SVY L L A+D+  +  +P AS++       
Sbjct  2531  L-GEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDS--SITEPRASSV-------  2580

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN-QTSVTEG  178
                                              +T+S++DVND  P+F ST    +V E 
Sbjct  2581  --------------------------------NLTISVSDVNDNIPKFDSTTYNVAVPER  2608

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSN--  236
             ++    V   +A+D D+G N  V Y+++ G+ +  F + +  GV+     L  + +S+  
Sbjct  2609  ISKGEFVFGARALDLDDGENAVVHYTIS-GRDQHYFDINTKTGVVSTKLELKTKTKSHDD  2667

Query  237   --YELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSA-SIAENASIGANVLQV  293
               Y + ++A D+GE   ++++  L  +L   +  P F     S  +++E+   G  + +V
Sbjct  2668  LTYTIVISAMDQGE-QSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKV  2726

Query  294   SASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVAR-SLNFERKPSYRLQVQAEDCA  352
             SA+   +G  G++RY+IA G       +  + G + V +  L++E    Y + ++A D  
Sbjct  2727  SATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAAD--  2784

Query  353   PELGGDARFDHAEVIIS--VLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDAD  410
                 GD     +  +I+  V D NDNAP+     Y A V+E   PP    +  VKA D D
Sbjct  2785  ----GDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQ--LIAVVKASDRD  2838

Query  411   TPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             +   N  V Y ++      F I  S GEI+    LDRE + +Y   + A+D
Sbjct  2839  SGD-NGNVIYRLQNDFDGTFEITES-GEIYTRMRLDREEIGDYAFVVEAVD  2887


 Score = 137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 137/469 (29%), Positives = 207/469 (44%), Gaps = 64/469 (14%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
             +S+V +  +V D+NDN P F+     V +PE ++ G  V G RA DLD G+N ++ Y I 
Sbjct  2577  ASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTI-  2635

Query  62    AGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAY  120
             +G D   F +    G + T+ EL                             + KSH   
Sbjct  2636  SGRDQHYFDINTKTGVVSTKLELK---------------------------TKTKSHDDL  2668

Query  121   KYTLVIRA----SSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF--VSTNQTS  174
              YT+VI A      S+S+   A+   I +PP              +  P F  ++ +  +
Sbjct  2669  TYTIVISAMDQGEQSLSSK--AELTVILRPP--------------ELFPTFAYMANSHFA  2712

Query  175   VTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGP-LDREH  233
             ++E V    ++  V A    +G  G + Y++A G       +    G+L V    LD E 
Sbjct  2713  MSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYEL  2772

Query  234   RSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQV  293
                YE+ + A D   P   +   + +NV D NDN+PV +   Y+A + E  S    +  V
Sbjct  2773  THLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVV  2832

Query  294   SASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCA-  352
              ASDRD G NG + Y + + D +  F I+E  G I     L+ E    Y   V+A D   
Sbjct  2833  KASDRDSGDNGNVIYRLQN-DFDGTFEITE-SGEIYTRMRLDREEIGDYAFVVEAVDQGV  2890

Query  353   PELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTP  412
             P + G      A V++ +LD NDN P F    +  +V EN       FV++V + D D  
Sbjct  2891  PHMTGT-----ASVLLHLLDKNDNPPKFT-RLFSLNVTENA--EIGSFVIRVTSSDLDLG  2942

Query  413   PYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
               N    Y   E   + FRI   +G I +   LDRE+  EY+L ++A D
Sbjct  2943  A-NANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASD  2990


 Score = 136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 147/531 (28%), Positives = 223/531 (42%), Gaps = 82/531 (15%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             L S   +  NV D NDNAP+ E      ++ E  +   L+   +A+D D+GDNG + Y +
Sbjct  2790  LRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRL  2849

Query  61    VAGDDNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQI---KSH  117
                D +G F +  +G IYTR  LDRE    Y  V+EA D         AS +     K+ 
Sbjct  2850  -QNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKND  2908

Query  118   RAYKYT---------------LVIRASSS---ISANVCA----------------QRNEI  143
                K+T                VIR +SS   + AN  A                Q   I
Sbjct  2909  NPPKFTRLFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNI  2968

Query  144   KQPPHDDSQ---------------------ITVSLTDVNDQAPEFVSTNQT-SVTEGVAI  181
                 H D +                     IT+++ D ND APEF  +  + S  E    
Sbjct  2969  TVAGHLDREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQS  3028

Query  182   NSVVMVVKAVDRD-EGRNGYVEYSLA---------PGQGEVPFALGSVDGVLRVSGPLDR  231
              ++V  + A DRD +G N  + YSL          P  GEV     S   V        R
Sbjct  3029  IALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEV----FSKKAVRFKHSQYVR  3084

Query  232   EHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVL  291
                + Y L + A D G+PP  +   V +N++D ++N P F+   Y A + ++A  G  ++
Sbjct  3085  SPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIV  3144

Query  292   QVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDC  351
             +V A+D+ +     + YS+ + + +  F++    G I + + +       Y L V+A D 
Sbjct  3145  RVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATD-  3203

Query  352   APELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADT  411
                 G   + D   V+I V   N + P F  + Y   V EN   P    ++ V A D DT
Sbjct  3204  ---RGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPEN--EPVGSTILTVGATDDDT  3258

Query  412   PPYNDQVRYFIKEGDTDL-FRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
              P N  +RY I  G+    F ++  TG I + + LD + + EY L +   D
Sbjct  3259  GP-NGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQD  3308


 Score = 134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 114/414 (28%), Positives = 182/414 (44%), Gaps = 50/414 (12%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             + S   +Y +V+ +N+  P F       D+ E  AVG  V   +ATD D+G++G + Y +
Sbjct  3419  MESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLL  3478

Query  61    VAGDDNGDFGVAAN-GTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             V   ++  F +  N G IY  R LDRE ++   L + A++                    
Sbjct  3479  VGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNY-------------------  3519

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTS-VTEG  178
                        SI  N             D++Q+ +S+ D ND  PEF+    TS ++E 
Sbjct  3520  ----------GSIRGNDT-----------DEAQVIISIQDGND-PPEFIKHYYTSTISEA  3557

Query  179   VAINSVVMVVKAVDRD-EGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNY  237
               + + V  VKA+D+D   +N    YS+  G  +  F +    G +  +  LDRE  S Y
Sbjct  3558  APVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTY  3617

Query  238   ELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASD  297
              L + A D G PP+  +  V + + D NDN P F P   +  I+EN   G +++ + ASD
Sbjct  3618  NLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASD  3677

Query  298   RDEGANGR-LRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELG  356
              D   NG    Y +  G      ++  + G +R   S + E  P     ++ ED     G
Sbjct  3678  PDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDS----G  3733

Query  357   GDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDAD  410
                +     + I+VLD NDN    R S ++A  + N   P++  +  V+  D D
Sbjct  3734  KPKQKSQHLLTITVLDQNDNPSTTR-SLHIAVSLFNGDLPSNVKLADVRPNDID  3786


 Score = 131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 129/485 (27%), Positives = 208/485 (43%), Gaps = 78/485 (16%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LS+TV     VVD NDN P+F   A    + E + +   ++   A D D+G NG + YAI
Sbjct  1469  LSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAI  1528

Query  61    VAGD----DNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIK  115
                +        FG+    G I+T RE+DRE+   + L + A D  +   + L++     
Sbjct  1529  SKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLST-----  1583

Query  116   SHRAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN----  171
                                               +  +TV + D+ND AP FVS N    
Sbjct  1584  ----------------------------------EKLVTVIVEDINDNAPVFVSMNAAIL  1609

Query  172   --QTSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPL  229
               + S ++G +  + VM V A D D   NG V Y +  G  E+ F L    G++  +   
Sbjct  1610  PPKFSTSKGSS--TAVMQVHAKDADSSSNGLVTYEIVSGPQEL-FKLQRNTGIITFTPGP  1666

Query  230   DREHRSNYELALTAKDRGEPPRITAQRVLVNVLD-----ENDNSPVFDPR-RYSASIAEN  283
               +    Y+L L + D        +  V + ++         + P F+ R + S S+ EN
Sbjct  1667  QFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYEN  1726

Query  284   ASIGANVLQVSASDRDEGANGRLRYSIAS-------GDDNRDFAISEDGGAIRVARSLNF  336
               IG ++L V+A      A+  + Y + +       G  +R F I    G +  A  L+ 
Sbjct  1727  EPIGTSILTVTA----HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDR  1782

Query  337   ERKPSYRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPP  396
             E  P    + + E  A  LGG  R    +V ++VLD ND+ P F D+P++ +V E++   
Sbjct  1783  EAGPE---EYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDL--Q  1837

Query  397   ASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLT  456
                 +  ++A+D DT      V + + +G    F +  STG++ L   LDRE   +Y L 
Sbjct  1838  IGHTISTLRAHDPDTL---GSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELR  1894

Query  457   LLAMD  461
             +   D
Sbjct  1895  IRVSD  1899


 Score = 128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 101/302 (33%), Positives = 145/302 (48%), Gaps = 18/302 (6%)

Query  153   ITVSLTDVNDQAPEFV----STNQTSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLA--  206
             + +++ D+ND AP F     S    S+ E  A+   + + +  DRD G N  + YSL   
Sbjct  928   VNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNN  987

Query  207   PGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKDRGEPPRITAQRVLVNVLDEND  266
             P Q    F +G V GVL +  P+  E  S   + L A D G PP  +   + V + D ND
Sbjct  988   PNQ---QFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVND  1044

Query  267   NSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGG  326
             ++PVFD   Y  S+ E   +      ++A+D D G NGR+ Y I  G+  R F +  D G
Sbjct  1045  HTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPD-G  1103

Query  327   AIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYL  386
              + V   L+ E +  Y L V   D     G  +R     V+I V+D NDNAP F +S + 
Sbjct  1104  YLFVRAPLDREERDYYALTVSCRDA----GQPSRSSVVPVVIHVIDENDNAPQFTNSTFT  1159

Query  387   AHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLD  446
               + EN   PA  FV ++ A D D    N ++ + +     D F I+   G I  LRP D
Sbjct  1160  FSIPENA--PADTFVGKLTAVDRDI-GRNAELSFTLSSQTQD-FTIDTRNGFIKTLRPFD  1215

Query  447   RE  448
             RE
Sbjct  1216  RE  1217


 Score = 116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/333 (29%), Positives = 158/333 (47%), Gaps = 28/333 (8%)

Query  152  QITVSLTDVNDQAPEFVSTN-QTSVTEGVAINSVVMVVKAVDRDEGRNGYV-EYSLAPGQ  209
            ++ + + DVND +PEF   +   S +E     + +++  A D D G NG   +Y +  G 
Sbjct  141  EVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGN  200

Query  210  GEVPFALGSVDG--------VLRVSGPLDREHRSNYELALTAKDRGEPPRITAQRVLVNV  261
             +  F L +            L  +G LDRE R +Y+L ++A+D G PPR    +V V +
Sbjct  201  VDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTI  260

Query  262  LDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAI  321
            LD NDN P+FD   Y+ S+ E A  G  V+ V ASD D G N ++ Y +A  +    F +
Sbjct  261  LDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA--ETEHQFTV  318

Query  322  SEDGGAIRVARSLNFERKPSYRLQVQAEDC-----APELGGDARFDHAEVIISVLDVNDN  376
            + + G I     +N  ++ + +     + C     A + G   +     V +++LD ND+
Sbjct  319  NPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDH  378

Query  377  APL-----FRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDLFR  431
             P+     F D   +A V EN +      V  V   D+D+          +   +   FR
Sbjct  379  DPIISFRFFPDGGKVATVDENAV--NGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFR  436

Query  432  INASTGEIFLLR---PLDRERVPEYVLTLLAMD  461
            +  +  ++ ++R    LDRE + +Y LT++AMD
Sbjct  437  LEEA-ADLHIVRVNGVLDREEIGKYNLTVVAMD  468


 Score = 107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 120/484 (25%), Positives = 204/484 (42%), Gaps = 82/484 (17%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNG---  67
             ++D ND AP F    + V L E+     +V    ATD D G NG + +A+    +     
Sbjct  589   ILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPL  648

Query  68    DFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVI  126
              F + A  G + TRR LDRE  S Y + + ARD  +    P ++T               
Sbjct  649   QFALDALTGQLTTRRPLDREKMSQYEISVIARD--QGAPTPQSAT---------------  691

Query  127   RASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF----------VSTNQTSVT  176
                                     + + +++ DVND  P+F             +   + 
Sbjct  692   ------------------------ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLK  727

Query  177   EGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSG--PLDREHR  234
             + V    +++ V A D+D+G N  +EY L  G GE  F L +  G + + G  P     +
Sbjct  728   KEVEKERILLHVTASDKDDGDNALIEYRLESG-GEGLFQLDARSGAISLRGDAPASMHWK  786

Query  235   SNYELALTAKDRGEPPRITAQRVLVNVLDEND----NSPVFDPRRYSASIAENASIGAN-  289
              +Y+L ++A+D G+  R + Q  +V ++ ++              Y   + E+     N 
Sbjct  787   PHYKLLVSARDAGQ--RRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNS  844

Query  290   -------VLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSY  342
                    ++QV +++    AN  + Y I  GD  ++F I    G I  AR L+ E + +Y
Sbjct  845   QPNREVGIVQVKSTNGK--ANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANY  902

Query  343   RLQVQAEDCAPELGGDARFDHAEVI--ISVLDVNDNAPLF---RDSPYLAHVMENMLPPA  397
             RL + A   +      +   + + I  I+++D+NDNAP+F   R+S     + EN     
Sbjct  903   RLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQ  962

Query  398   SGFVMQVKAYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTL  457
               ++ +V+  DA     N ++ Y +       FRI   TG ++L RP+  E      + L
Sbjct  963   EIYLSRVRDRDAGV---NSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVEL  1019

Query  458   LAMD  461
             +A D
Sbjct  1020  MATD  1023


>STAN_DROME unnamed protein product
Length=3579

 Score = 186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 146/478 (31%), Positives = 222/478 (46%), Gaps = 65/478 (14%)

Query  2    SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
            S T T+  NV+D ND++P FE       + E   VG+ V+  RATD D G N  I Y I 
Sbjct  445  SGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIE  504

Query  62   AGDDNGDFGV----------AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLAST  111
            A  D                + +G I TR  LDRE    Y L++ A D   A ++   +T
Sbjct  505  AVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTAT  564

Query  112  IQIKSHRAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN  171
              ++                                       V + D ND  P+F    
Sbjct  565  ASVQ---------------------------------------VKVLDDNDNYPQFSERT  585

Query  172  QT-SVTE---GVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSG  227
             T  V E   G   ++ V  ++A D D+G N  + Y++  G  +  F++ S+ G + +  
Sbjct  586  YTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVK  645

Query  228  PLDREHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIG  287
            PLD E   +Y L + A+D G P R    ++LVNV+D NDN+P F   ++  S+ EN  +G
Sbjct  646  PLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVG  705

Query  288  ANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQ  347
             N+++V A D DEGAN  + YSI+  DDN   A+    G ++  + L+ E +  +  QV 
Sbjct  706  YNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVV  765

Query  348  AEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAY  407
            A+D     G   +   + V+I+V DVNDN P F    Y A+V E+  PP +  V  V A 
Sbjct  766  AKDG----GVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQ-PPGTP-VTTVTAT  819

Query  408  DADTPPYNDQVRYFIKEGDT-DLFRINASTGE--IFLLRPLDRERVPEYVLTLLAMDT  462
            D D    + ++ Y I  G+T   F I +  G   I + + LD ++   ++LT+ A D+
Sbjct  820  DPDE---DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDS  874


 Score = 167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 143/467 (31%), Positives = 220/467 (47%), Gaps = 71/467 (15%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
             S T TV+ N+ D N+ AP+FE    +  + E+  VG  VL   ATD D G N  I Y++ 
Sbjct  878   SDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLN  937

Query  62    AGDDNG-----DFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIK  115
                 NG      F +    G I T   LDRE  S Y L + A+D                
Sbjct  938   EESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG---------------  982

Query  116   SHRAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVS-TNQTS  174
                          + S+S               D + + + +TDVND AP F S   Q S
Sbjct  983   ------------GNPSLS---------------DTTDVEIGVTDVNDNAPAFKSPLYQAS  1015

Query  175   VTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGE-VPFALGSVDGVLRVSGPLDREH  233
             + E   + + V+ V A D D G NG ++Y L+    E   F +    G +R +  LDRE 
Sbjct  1016  ILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRES  1075

Query  234   RSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQV  293
              + + L   A D+G PP  +   V + + D ND+ P F   + +  + EN+ +G+ V ++
Sbjct  1076  VAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEI  1135

Query  294   SASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIR----VARSLNFE--RKPSYRLQVQ  347
              A D DEG N  + YSI  GDD+  F++    G+ R        L++E  RK   R ++ 
Sbjct  1136  HAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK---RFELV  1192

Query  348   AEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAY  407
                 +P L  DA   H E++++  DVNDNAP+ RD   + +   +  P  SG + ++ A+
Sbjct  1193  VRAASPPLRNDA---HIEILVT--DVNDNAPVLRDFQVIFNNFRDHFP--SGEIGRIPAF  1245

Query  408   DADTPPYNDQVRYFIKEGDT-DLFRINASTGEIFLLRPLDRERVPEY  453
             DAD    +D++ Y I  G+  +L R+N+S+G + +L P     VP++
Sbjct  1246  DADV---SDKLHYRILSGNNANLLRLNSSSGGL-VLSPQLNTNVPKF  1288


 Score = 159 bits (401),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 146/472 (31%), Positives = 216/472 (46%), Gaps = 66/472 (14%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
             S+T  +  NV+D NDNAP F        + ENV VG  ++  +A D D G N  I Y+I 
Sbjct  670   SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSIS  729

Query  62    AGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAY  120
               DDN    V    G + T + LDRE +  +   + A+D    P                
Sbjct  730   ERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKS--------------  775

Query  121   KYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF-VSTNQTSVTEGV  179
                    ASSS+                      +++ DVND  P F     + +V E  
Sbjct  776   -------ASSSV---------------------VITVQDVNDNDPAFNPKYYEANVGEDQ  807

Query  180   AINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDG--VLRVSGPLDREHRSNY  237
                + V  V A D DE  +  + Y +  G     FA+ S +G  ++ ++  LD +    +
Sbjct  808   PPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRF  865

Query  238   ELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASD  297
              L + A D G   R     V +N+ D N+ +P+F+   YSAS+ E+A +G  VL VSA+D
Sbjct  866   LLTVAATDSGG--RSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATD  923

Query  298   RDEGANGRLRYSIASGDDN-----RDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCA  352
              D G N ++ YS+     N       F+I+   GAI     L+ E    Y L V A+D  
Sbjct  924   SDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKD--  981

Query  353   PELGGDARF-DHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADT  411
                GG+    D  +V I V DVNDNAP F+   Y A ++E+ L   S  V+QV A D D 
Sbjct  982   ---GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTS--VIQVAASDPDV  1036

Query  412   PPYNDQVRYFIKEGDTD--LFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
                N +++Y + + D +   F I+ ++G I   + LDRE V  + LT +A+D
Sbjct  1037  -GLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD  1087


 Score = 144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 133/433 (31%), Positives = 192/433 (44%), Gaps = 59/433 (14%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
             S++ +V   V D+NDN P F P     ++ E+   G  V    ATD D  ++  + Y I 
Sbjct  775   SASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSRLHYEIT  832

Query  62    AGDDNGDFGVAA-NGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAY  120
              G+  G F + + NG                GL+             +A ++  K  + +
Sbjct  833   TGNTRGRFAITSQNGR---------------GLIT------------IAQSLDYKQEKRF  865

Query  121   KYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQT-SVTEGV  179
               T+    S   S               D + + +++TD N+ AP F +   + SV E  
Sbjct  866   LLTVAATDSGGRS---------------DTATVHINITDANNFAPIFENAPYSASVFEDA  910

Query  180   AINSVVMVVKAVDRDEGRNGYVEYSLAP----GQGEV-PFALGSVDGVLRVSGPLDREHR  234
              + + V+VV A D D G N  + YSL      G G   PF++    G +  + PLDRE  
Sbjct  911   PVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETT  970

Query  235   SNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVS  294
             S Y L +TAKD G P       V + V D NDN+P F    Y ASI E+A +G +V+QV+
Sbjct  971   SGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVA  1030

Query  295   ASDRDEGANGRLRYSIASGD-DNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAP  353
             ASD D G NGR++Y ++  D ++  F I    G IR  + L+ E    + L   A D   
Sbjct  1031  ASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVD---  1087

Query  354   ELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPP  413
               G        EV I + DVND+ P F       +V EN   P    V ++ A+D D   
Sbjct  1088  -KGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENS--PVGSVVGEIHAHDPDE-G  1143

Query  414   YNDQVRYFIKEGD  426
              N  V Y I  GD
Sbjct  1144  VNAVVHYSIIGGD  1156


 Score = 128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 104/315 (33%), Positives = 150/315 (48%), Gaps = 14/315 (4%)

Query  159  DVNDQAPEF-VSTNQTSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALG  217
            ++ +Q+P F  +    SV E     + V  V+A D ++    Y   SL   + +  F + 
Sbjct  351  ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD  410

Query  218  SVDGVLRVSGPLDREHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYS  277
            S  GV+  S  LDRE    +   + A D   PPR     + VNVLD ND+SP F+  ++ 
Sbjct  411  SRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFE  470

Query  278  ASIAENASIGANVLQVSASDRDEGANGRLRYSIASGDDNRD---------FAISEDGGAI  328
            ASI E A++G+ V+ + A+D+D G N  + Y I +  D            F I    G I
Sbjct  471  ASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVI  530

Query  329  RVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAH  388
                SL+ E   SY L V A D A     + R   A V + VLD NDN P F +  Y   
Sbjct  531  STRSSLDRETSDSYHLLVTAADLA-SAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQ  589

Query  389  VMENMLPPAS-GFVMQVKAYDADTPPYNDQVRYFIKEGDTD-LFRINASTGEIFLLRPLD  446
            V E+         V  ++A DAD    N  +RY I  G+T   F I++ +G++ L++PLD
Sbjct  590  VPEDQWGGTEDNTVAHIRATDADQ-GNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLD  648

Query  447  RERVPEYVLTLLAMD  461
             E V  Y L + A D
Sbjct  649  YESVRSYRLVIRAQD  663


 Score = 93.6 bits (231),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 99/343 (29%), Positives = 145/343 (42%), Gaps = 55/343 (16%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LS T  V   V D+NDNAP F+       + E+  VG  V+   A+D D G NG I Y +
Sbjct  987   LSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL  1046

Query  61    VAGD-DNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHR  118
                D ++G F +   +GTI T + LDRE+ +V+ L   A D     + PL+ST++++   
Sbjct  1047  SDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG---SPPLSSTVEVQ---  1100

Query  119   AYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQT-SVTE  177
                                                 + L DVND  P F S   T  V E
Sbjct  1101  ------------------------------------IRLEDVNDSPPTFASDKITLYVPE  1124

Query  178   GVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFAL----GSVDGVLRVSGPLDREH  233
                + SVV  + A D DEG N  V YS+  G     F+L    GS    L     LD E 
Sbjct  1125  NSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYES  1184

Query  234   -RSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQ  292
              R  +EL + A     PP      + + V D NDN+PV    +   +   +      + +
Sbjct  1185  TRKRFELVVRA---ASPPLRNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGR  1241

Query  293   VSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLN  335
             + A D D   + +L Y I SG++     ++   G + ++  LN
Sbjct  1242  IPAFDAD--VSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLN  1282


>FAT2_DROME unnamed protein product
Length=4699

 Score = 177 bits (449),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 138/465 (30%), Positives = 216/465 (46%), Gaps = 58/465 (12%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
              ++   V  +V D+NDN P        +   E++++G  ++  +A D D   + L  Y  
Sbjct  3047  FTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF-QSKLRFY--  3103

Query  61    VAGDDNGDFGVAA-NGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             ++G    DF +   +G +     LDRE    Y LV   +D      +             
Sbjct  3104  LSGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFTQECF-----------  3152

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF-VSTNQTSVTEG  178
                                            S+I +++ D+ND  P F ++  + SV E 
Sbjct  3153  -------------------------------SEIIITVNDINDNMPIFSMAQYRVSVPED  3181

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYE  238
               +N+++  V A+D+D G N  ++YSL  G+    F +    G++R+   LDRE  S + 
Sbjct  3182  AQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDYFKISKSTGIIRLHKSLDRETISLFN  3240

Query  239   LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDR  298
             L + A+D G P   +   V VN+LD NDN P F  R+YS  I ENA+ G  V +V A+  
Sbjct  3241  LTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSI  3300

Query  299   DEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGD  358
             D G N  + Y I SG++   F +    G + +  +L++E    Y L +QA D     GG 
Sbjct  3301  DIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAID-----GGT  3355

Query  359   ARF-DHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQ  417
                 ++A V IS+LD+NDN+P F  + Y  +V E++   +   ++ VKA D D+   N  
Sbjct  3356  PPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSK--ILDVKATDEDS-DVNGL  3412

Query  418   VRYFIKEGDT-DLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             V Y I+ GD    F I+   G I + RPLDRE +  Y L + A D
Sbjct  3413  VTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD  3457


 Score = 168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 130/460 (28%), Positives = 217/460 (47%), Gaps = 61/460 (13%)

Query  5     VTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGD  64
             V V   +VD NDNAP+F+     + + EN   G +++     D D  +   + + IV+GD
Sbjct  2951  VPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDI-EKQEMDFFIVSGD  3009

Query  65    DNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTL  124
                 F +  +G ++  + LDRE    Y L + A D                     K+T 
Sbjct  3010  KQAQFQIGKSGELFIAKPLDREQLMFYNLSIIATDG--------------------KFT-  3048

Query  125   VIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTN-QTSVTEGVAINS  183
                          A+ N           + + + D+ND  P  +      S  E ++I +
Sbjct  3049  -------------AKAN-----------VEIDVKDINDNTPYCLKPRYHISTNESISIGT  3084

Query  184   VVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTA  243
              ++ VKA+D D      + + L+ G+G   F++G   G+L+V+  LDRE    Y+L    
Sbjct  3085  TLVEVKAIDFD--FQSKLRFYLS-GKGADDFSIGKESGILKVASALDRETTPKYKLVAHV  3141

Query  244   KDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGAN  303
             +D  +  +     +++ V D NDN P+F   +Y  S+ E+A +   + +V A D+D G N
Sbjct  3142  QDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVN  3201

Query  304   GRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCA-PELGGDARFD  362
              +++YS+  G+++  F IS+  G IR+ +SL+ E    + L V+AEDC  P+L   A   
Sbjct  3202  RQIKYSLM-GENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIAT--  3258

Query  363   HAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFI  422
                V +++LD+NDN P F    Y   ++EN        V +V A   D    N  + YFI
Sbjct  3259  ---VAVNILDINDNPPEFSMRQYSCKILENATHGTE--VCKVYATSIDI-GVNADIHYFI  3312

Query  423   KEGDTD-LFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
               G+    F+++++TG++ L   LD E    Y LT+ A+D
Sbjct  3313  MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAID  3352


 Score = 166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 128/427 (30%), Positives = 193/427 (45%), Gaps = 56/427 (13%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFG  70
             V D+NDN P+F      V +PE+  +  L+    A D D G N  I Y+++ G+++  F 
Sbjct  3159  VNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLM-GENHDYFK  3217

Query  71    VA-ANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRAS  129
             ++ + G I   + LDRE  S++ L ++A D        +A+                   
Sbjct  3218  ISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIAT-------------------  3258

Query  130   SSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTS--VTEGVAINSVVMV  187
                                    + V++ D+ND  PEF S  Q S  + E     + V  
Sbjct  3259  -----------------------VAVNILDINDNPPEF-SMRQYSCKILENATHGTEVCK  3294

Query  188   VKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKDRG  247
             V A   D G N  + Y +  G  +  F + S  G L ++  LD E    Y L + A D G
Sbjct  3295  VYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGG  3354

Query  248   EPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLR  307
              PP      V +++LD NDNSP F    Y  ++ E+  +G+ +L V A+D D   NG + 
Sbjct  3355  TPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVT  3414

Query  308   YSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVI  367
             Y+I  GD+   F+I    G I V+R L+ E    Y L++QA D     G   R +   + 
Sbjct  3415  YNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD----QGDPQRCNSVPIN  3470

Query  368   ISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFV-MQVKAYDADTPPYNDQVRYFIKEGD  426
             I++LD NDNAP+F  S Y   + EN L    G+V +  K  DAD  P      + I+ G+
Sbjct  3471  INILDTNDNAPIFSSSNYSVVLQENRLL---GYVFLTFKISDADETPNTTPYTFDIRSGN  3527

Query  427   T-DLFRI  432
                LFR+
Sbjct  3528  EGGLFRL  3534


 Score = 161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 129/456 (28%), Positives = 206/456 (45%), Gaps = 63/456 (14%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             L S  TV  N++D+NDN P F     +  + EN   G  V    AT +D G N  I Y I
Sbjct  3253  LHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFI  3312

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             ++G++ G F + +  G +     LD E    Y L ++A D    P           S+ A
Sbjct  3313  MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPL----------SNNA  3362

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVST-NQTSVTEG  178
             Y                                + +S+ D+ND +P F+    + +V E 
Sbjct  3363  Y--------------------------------VNISILDINDNSPTFLQNLYRINVNED  3390

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYE  238
             + + S ++ VKA D D   NG V Y++  G     F++   +G + VS PLDRE  S+Y 
Sbjct  3391  IFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYT  3450

Query  239   LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDR  298
             L + A D+G+P R  +  + +N+LD NDN+P+F    YS  + EN  +G   L    SD 
Sbjct  3451  LEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDA  3510

Query  299   DEGANGR-LRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAED-CAPELG  356
             DE  N     + I SG++   F + +D G++R A   N   +  + +QV+  D   P L 
Sbjct  3511  DETPNTTPYTFDIRSGNEGGLFRLEQD-GSLRTASRFNHNLQDEFVIQVRVFDNGTPPLY  3569

Query  357   GDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYND  416
              DA      V++ +++ +   P+        +  E+    A  F+ +V A D D     D
Sbjct  3570  SDAW-----VVVKIIEESQYPPIVTPLEVTINSFEDDFSGA--FIGKVHASDQDK---YD  3619

Query  417   QVRYFIKEGDTD------LFRINASTGEIFLLRPLD  446
             ++ + +  G  D      LF I+ +TG+I+ +  LD
Sbjct  3620  ELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLD  3655


 Score = 160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 146/470 (31%), Positives = 218/470 (46%), Gaps = 61/470 (13%)

Query  1     LSSTVTVYCNVVDLNDN--APMFEPGARAVDLPENVAVGALVLGTRATDLDAGD-NGLIG  57
             L+S +++   ++D+N+N  AP F+       + EN   G  V+   A D+D  D N  I 
Sbjct  1066  LTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKIT  1125

Query  58    YAIVAGDDNGDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSH  117
             Y+I  GD  G F V   G+I +  +LD E K+ Y L L A+D    P   L++ +++   
Sbjct  1126  YSITGGDGLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVP---LSNCVEV---  1179

Query  118   RAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTE  177
                 Y  V               NE    P         LTD     P +      +VTE
Sbjct  1180  ----YIQV--------------ENENDNIP---------LTD----KPVYY----VNVTE  1204

Query  178   GVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSG-PLDREHRSN  236
                 N  ++ +KA D D      + Y++  G     F + S  GV++ +   LDRE+++ 
Sbjct  1205  ASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAE  1264

Query  237   YELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSAS  296
             + L +   D G P   +  R++V+VLD NDNSP FD R Y   +  +A++  ++ QV A 
Sbjct  1265  HILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAI  1324

Query  297   DRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCA-PEL  355
             D D G NGR+ YSI SG     F I    G I +A+ L+ + +  + + ++AED   P+ 
Sbjct  1325  DSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDNE--FEIHIKAEDNGIPKK  1382

Query  356   GGDARFDHAEVIISVLDVNDNAPLF--RDSPYLAHVMENMLPPASGF-VMQVKAYDADTP  412
                AR     V++ V   + NAPL   + S  +  + EN  P   GF V Q+ A D D  
Sbjct  1383  SQTAR--VNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKP---GFLVTQILAVDDD--  1435

Query  413   PYNDQVRYFIKEG-DTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
               NDQ+ Y I  G D + F I    G I L + LD E    Y LT+   D
Sbjct  1436  --NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTD  1483


 Score = 157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 136/474 (29%), Positives = 231/474 (49%), Gaps = 39/474 (8%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFG  70
             V D+NDN P FE       + ++  +G  V  T A D DAGD  +I Y +  G+++G F 
Sbjct  603   VKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFN  660

Query  71    V-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIK--------------  115
             +   +G++    +L +   +   L + A D     +  L   + +               
Sbjct  661   LDPTSGSLSISCDLKKTTLTNRILKVSATDGTHF-SDDLIINVHLMPEDLGGDSSILHGF  719

Query  116   -SHRAYKYTLVIRASSSISANVCAQRNEIKQPP---HDDSQITVSLTDVNDQAPEFVSTN  171
              S    +  +  R + ++S    A++N +K        D  +T S    N   PEFV+  
Sbjct  720   GSFECRETGVARRLAETLSL---AEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFP  776

Query  172   Q-TSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLD  230
             Q  S+ E V +   V  ++A DRD G NG + ++++ G  +  F +    G L++ G LD
Sbjct  777   QELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLD  836

Query  231   REHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANV  290
             RE ++ Y L +T  D G P + T++ + + +LD NDN PV      +  + E+A IG  V
Sbjct  837   RERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVV  896

Query  291   LQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAED  350
               + A+D D G N ++ Y+++   +  DF ++   G +R+ + L+ E++ +Y L + A+D
Sbjct  897   HCLHATDADSGINAQVTYALSV--ECSDFTVNATTGCLRLNKPLDREKQDNYALHITAKD  954

Query  351   -CAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDA  409
               +P L  +A      V + V DVNDNAP+F    Y+  V E++  P    +  ++A D 
Sbjct  955   GGSPVLSSEAL-----VYVLVDDVNDNAPVFGVQEYIFKVREDL--PRGTVLAVIEAVDE  1007

Query  410   DTPPYNDQVRYFIKE--GDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             D  P N ++++ +KE   D +LFRI+  TG I     LD E    + L + A+D
Sbjct  1008  DIGP-NAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAID  1060


 Score = 150 bits (380),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 138/459 (30%), Positives = 207/459 (45%), Gaps = 60/459 (13%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFG  70
             ++D+NDN P+ +       L E+  +G +V    ATD D+G N  + YA+    +  DF 
Sbjct  867   ILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSV--ECSDFT  924

Query  71    V-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRAS  129
             V A  G +   + LDRE +  Y L + A+D       P+ S+       A  Y LV    
Sbjct  925   VNATTGCLRLNKPLDREKQDNYALHITAKDG----GSPVLSS------EALVYVLV----  970

Query  130   SSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF-VSTNQTSVTEGVAINSVVMVV  188
                                          DVND AP F V      V E +   +V+ V+
Sbjct  971   ----------------------------DDVNDNAPVFGVQEYIFKVREDLPRGTVLAVI  1002

Query  189   KAVDRDEGRNGYVEYSLAP-GQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKDRG  247
             +AVD D G N  +++SL    Q E  F +    G +R  G LD E++  + L ++A D G
Sbjct  1003  EAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGG  1062

Query  248   EPPRITAQRVLVNVLDENDN--SPVFDPRRYSASIAENASIGANVLQVSASDRDE-GANG  304
             +P   +   +++ ++D N+N  +P FD   Y   + EN   G  V+ V+A D D    N 
Sbjct  1063  DPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNS  1122

Query  305   RLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHA  364
             ++ YSI  GD    FA++ D G+I     L+ E K  Y L + A+DCA     +      
Sbjct  1123  KITYSITGGDGLGIFAVN-DQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNC----V  1177

Query  365   EVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKE  424
             EV I V + NDN PL     Y  +V E  +      ++ +KA+D D  P    + Y I  
Sbjct  1178  EVYIQVENENDNIPLTDKPVYYVNVTEASVENVE--IITLKAFDPDIDP-TQTITYNIVS  1234

Query  425   GD-TDLFRINASTGEIFLL-RPLDRERVPEYVLTLLAMD  461
             G+    F I++ TG I    R LDRE   E++L +   D
Sbjct  1235  GNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISD  1273


 Score = 142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 135/463 (29%), Positives = 210/463 (45%), Gaps = 67/463 (14%)

Query  7     VYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDN  66
             V  +V D NDN P F+    +  + EN      ++   ATD D G NG I Y + +  +N
Sbjct  2846  VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTEN  2905

Query  67    --GDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYT  123
                 F +   +G I     LDRE +S Y   + A D                        
Sbjct  2906  IQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADN-----------------------  2942

Query  124   LVIRASSSISANVCAQRNEIKQPPHD-DSQITVSLTDVNDQAPEF-VSTNQTSVTEGVAI  181
                                   P HD    +T+ + D ND AP F +     SV E    
Sbjct  2943  --------------------GHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALP  2982

Query  182   NSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELAL  241
              +V++ +  +D D  +   +++ +  G  +  F +G   G L ++ PLDRE    Y L++
Sbjct  2983  GTVLINLLLIDPDIEKQE-MDFFIVSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSI  3040

Query  242   TAKDRGEPPRITAQ-RVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDE  300
              A D     + TA+  V ++V D NDN+P     RY  S  E+ SIG  +++V A D D 
Sbjct  3041  IATD----GKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD-  3095

Query  301   GANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDAR  360
                 +LR+ + SG    DF+I ++ G ++VA +L+ E  P Y+L    +D     G D  
Sbjct  3096  -FQSKLRFYL-SGKGADDFSIGKESGILKVASALDRETTPKYKLVAHVQD-----GKDFT  3148

Query  361   FD-HAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVR  419
              +  +E+II+V D+NDN P+F  + Y   V E+     +  + +V A D D    N Q++
Sbjct  3149  QECFSEIIITVNDINDNMPIFSMAQYRVSVPED--AQLNTLITKVHAMDKDF-GVNRQIK  3205

Query  420   YFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMDT  462
             Y +   + D F+I+ STG I L + LDRE +  + LT+ A D 
Sbjct  3206  YSLMGENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDC  3248


 Score = 140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 126/448 (28%), Positives = 192/448 (43%), Gaps = 68/448 (15%)

Query  17    NAPMF--EPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFGVAA-  73
             NAP+   +     VDL EN   G LV    A D    DN  + Y I  G+D+  F +   
Sbjct  1401  NAPLIVRKTSENVVDLTENDKPGFLVTQILAVD---DDNDQLWYNISNGNDDNTFYIGQD  1457

Query  74    NGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRASSSIS  133
             NG I   + LD E +  Y L +   D                +  A+             
Sbjct  1458  NGNILLSKYLDYETQQSYNLTISVTDG---------------TFTAF-------------  1489

Query  134   ANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVS-TNQTSVTEGVAINSVVMVVKAVD  192
                              + + V + D+ND  P+F       +++E +   SV+M + A D
Sbjct  1490  -----------------TNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATD  1532

Query  193   RDEGRNGYVEYSLAPGQGEVPFALGSVD---GVLRVSGPLDREHRSNYELALTAKDRGEP  249
             RDE +  +  Y L   Q     AL  +D   G + V+  LD E  + + L +  KD+G P
Sbjct  1533  RDEDKKLF--YHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAP  1590

Query  250   PRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYS  309
              +    +++VNV D ND+ P F  +   + + E+A+IG+ + +V A DRD G N  ++YS
Sbjct  1591  GKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYS  1650

Query  310   IASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIIS  369
             I +G+    F I    G I +A +LN  +   Y LQV+A D    LG         V I 
Sbjct  1651  IITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVD----LGNPPLSSQIPVHII  1706

Query  370   VLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDL  429
             V    ++ P F  +     + EN+  P   FV QV A  + +  +N      I     + 
Sbjct  1707  VTMSENDPPKFPTNNIAIEIFENL--PIGTFVTQVTARSSSSIFFN-----IISGNINES  1759

Query  430   FRINASTGEIFLLRPLDRERVPEYVLTL  457
             FRIN STG I +   +D E +  + LT+
Sbjct  1760  FRINPSTGVIVINGNIDYESIKVFNLTV  1787


 Score = 132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 130/465 (28%), Positives = 208/465 (45%), Gaps = 57/465 (12%)

Query  7    VYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDN  66
            ++  V+D ND +P+F P    V +PE+      +L   A D D G NG I Y+++   D+
Sbjct  169  IHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLM--DS  226

Query  67   GDFGVA-ANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLV  125
              F +    G I   ++L     S + L + A D          S +  ++H+A K    
Sbjct  227  EYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDR--------GSWVNHQNHQASK----  274

Query  126  IRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTEGVAINSVV  185
                                     +++++S+  VN  APE  +   +SVT     N ++
Sbjct  275  -------------------------TKVSISVKQVNFYAPEIFTKTFSSVTP--TSNPLI  307

Query  186  M-VVKAVDRDEGRNGYV-EYSLAPGQGEVPFALGSVDGV------LRVSGPLDREHRSNY  237
              +V+  D+D G NG +    +  G  +  F L + +        L     L+++H   Y
Sbjct  308  YGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFI-Y  366

Query  238  ELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASD  297
             L L A+D G P R   + V + +  E+ N P+F    Y  SI E A I   V+++  SD
Sbjct  367  NLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSD  426

Query  298  RDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGG  357
             D G N  +   I  G++  +F I+ D G +  A+ L+ E+K SY L V A D A    G
Sbjct  427  PDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANV--G  484

Query  358  DARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQ  417
              +   A+V ISV D+NDN P+F +   +  + EN L  A  FV+++ A D D+   N  
Sbjct  485  SRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNL--AGSFVVKLTAKDRDSGE-NSY  541

Query  418  VRYFIKEGDTDLFRINASTGEIFLLRPLDRERVP-EYVLTLLAMD  461
            + Y I   +   F I+  +G +     LD E +   Y L + A D
Sbjct  542  ISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASD  586


 Score = 132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 138/510 (27%), Positives = 217/510 (43%), Gaps = 79/510 (15%)

Query  18    APMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFGV-AANGT  76
             +P+F+       +PEN+  G  ++  +A+D D G    + Y IV+ +    F +    G 
Sbjct  2548  SPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGV  2607

Query  77    IYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRASSSISANV  136
             I ++   DRE K  Y ++L+  D            I +  +    Y L+      +S  V
Sbjct  2608  ITSKVTFDREKKDEYVVLLKVSDGGGKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTV  2667

Query  137   CAQRNEIKQPPHDDSQI---TVSLTDV---NDQA-PEFVSTNQT-------SVTEGVAIN  182
              A +  +     DD  +   +V    V   ND+A  + +  N+        S  E   +N
Sbjct  2668  EANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVN  2727

Query  183   SVVMVVKAVDRDEGR---------------------------------------------  197
             S    V+A DR E +                                             
Sbjct  2728  SYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM  2787

Query  198   --NGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKDRGEPPRITAQ  255
               N   ++S+A  Q      + S  G L +   LDRE + ++ L + A+    P      
Sbjct  2788  IGNYTFKFSIAADQDHF---MISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYA  2844

Query  256   RVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYSIASGDD  315
              VL++V DENDN P FD   YSAS+AEN+    ++++VSA+D D G NG +RY + S  +
Sbjct  2845  DVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTE  2904

Query  316   NRD--FAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFD-HAEVIISVLD  372
             N    F I    G I +  SL+ E +  Y  +V A D      G  + D    V I ++D
Sbjct  2905  NIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAAD-----NGHPKHDAKVPVTIKIVD  2959

Query  373   VNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDL-FR  431
              NDNAP+F+       V EN LP     ++ +   D D      ++ +FI  GD    F+
Sbjct  2960  YNDNAPVFKLPIEGLSVFENALP--GTVLINLLLIDPDIE--KQEMDFFIVSGDKQAQFQ  3015

Query  432   INASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             I  S GE+F+ +PLDRE++  Y L+++A D
Sbjct  3016  IGKS-GELFIAKPLDREQLMFYNLSIIATD  3044


 Score = 132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 134/519 (26%), Positives = 217/519 (42%), Gaps = 86/519 (17%)

Query  11    VVDLNDNAPMFEPGARAVDLPENVAV------GALVLGTRATDLDAGDNGLIGYAIVAGD  64
             V+D+NDN P+F      V++P    V      G +++  +A DLD+ +NG + Y +  G 
Sbjct  2130  VLDVNDNCPLF------VNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKG-  2182

Query  65    DNGDFGVA--ANGTIYTRRELDREAKSVYGLVLEARDAPRAPAK---PLASTIQIKSHRA  119
              NG+       +G +  ++ ++   ++ Y L + A D    P     PL   +  +S   
Sbjct  2183  -NGELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDGAITPCSSEAPLQVKVIDRSMPV  2240

Query  120   YK---YTLVIRAS----SSISANVCAQR-----------------------------NEI  143
             ++   YT+ ++      S++S ++ A+                              NE+
Sbjct  2241  FEKQFYTVSVKEDVEMYSALSVSIEAESPLGRSLIYTISSESQSFEIDYNTGSIFVVNEL  2300

Query  144   ---KQPPHDDS--------------QITVSLTDVNDQAPEFVS-TNQTSVTEGVAINSVV  185
                K   HD S               ++VS+ DVND  PE  S     ++ E  +  + +
Sbjct  2301  DYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQI  2360

Query  186   MVVKAVDRDEGRNGYVEYSLAPGQGE---VPFALGSVDGVLRVSGPLDREHRSNYELALT  242
             + + A D D G N  + Y +    G+     F +   DG L +  PLD E    + + + 
Sbjct  2361  LKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVN  2420

Query  243   AKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGA  302
              KD G P   +   V + V D NDN+P F    Y   ++  A  G  V    A D+D   
Sbjct  2421  VKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISD  2480

Query  303   NGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDARFD  362
                L Y I  G++ + ++I +  G I +   LNF  K S  L +   D            
Sbjct  2481  TDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSD-------GVHTA  2533

Query  363   HAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFI  422
             +A + IS+L  N  +PLF  S Y A V EN+L   +  ++ VKA D D   Y +     +
Sbjct  2534  YARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHN--IITVKASDGDFGTYANLYYEIV  2591

Query  423   KEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
              E    +F I+ +TG I      DRE+  EYV+ L   D
Sbjct  2592  SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSD  2630


 Score = 131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 134/502 (27%), Positives = 215/502 (43%), Gaps = 103/502 (21%)

Query  17   NAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDNGDFGVAAN-G  75
            N P+F      V +PE   +   V+  + +D D G N L+   IV G++  +F +  + G
Sbjct  396  NIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSG  455

Query  76   TIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVIRASSSISAN  135
             +YT ++LD E KS Y L + A D                                  AN
Sbjct  456  MLYTAKQLDAEKKSSYTLTVSAID---------------------------------QAN  482

Query  136  VCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQT-SVTEGVAINSVVMVVKAVDRD  194
            V +++          +++ +S+ D+ND  P F + N+  S+ E     S V+ + A DRD
Sbjct  483  VGSRK-------QSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRD  535

Query  195  EGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDRE-HRSNYELALTAKDRGEP-PRI  252
             G N Y+ YS+A     VPF +    G+++ +  LD E  + NYEL + A D G P  R 
Sbjct  536  SGENSYISYSIA-NLNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQ  594

Query  253  TAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDEGANGRLRYSIAS  312
            T  ++ + V D NDN P F+       + ++A +G  V   SA D D G    + Y ++ 
Sbjct  595  TEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRLSD  652

Query  313  GDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAED-------------CAPE-LGGD  358
            G+++  F +    G++ ++  L      +  L+V A D               PE LGGD
Sbjct  653  GNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSDDLIINVHLMPEDLGGD  712

Query  359  ARFDH----------------AEV---------------IISVLDV-------NDNAPLF  380
            +   H                AE                + S L +       N + P F
Sbjct  713  SSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEF  772

Query  381  RDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTD-LFRINASTGEI  439
             + P    + E++    +  V  ++A D D   YN ++ + I +GD D +FRI+   GE+
Sbjct  773  VNFPQELSINESVQLGET--VAWIEAKDRDL-GYNGKLVFAISDGDYDSVFRIDPDRGEL  829

Query  440  FLLRPLDRERVPEYVLTLLAMD  461
             ++  LDRER  EYVL +   D
Sbjct  830  QIIGYLDRERQNEYVLNITVYD  851


 Score = 125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 125/470 (27%), Positives = 223/470 (47%), Gaps = 66/470 (14%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LSST  +  +V+D+NDN+P F+     V +P +  V   +    A D D+G+NG I Y+I
Sbjct  1279  LSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSI  1338

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPR-APAKPLASTIQIKSHR  118
              +G     F + +  G I+  + LD + +    +  E    P+ +    +   +   +  
Sbjct  1339  KSGKGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPN  1398

Query  119   AYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTEG  178
             +    L++R +S    NV                  V LT+ ND+ P F+ T        
Sbjct  1399  SQNAPLIVRKTSE---NV------------------VDLTE-NDK-PGFLVTQ-------  1428

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYE  238
                      + AVD D   N  + Y+++ G  +  F +G  +G + +S  LD E + +Y 
Sbjct  1429  ---------ILAVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYN  1476

Query  239   LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDR  298
             L ++  D G     T   +LV V+D NDN P F    Y  +I+EN    + ++Q+ A+DR
Sbjct  1477  LTISVTD-GTFTAFT--NLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDR  1533

Query  299   DEGANGRLRYSIASGDDNRD---FAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPEL  355
             DE  + +L Y + +  D      F I    G + V + L+FE+   + L V  +D     
Sbjct  1534  DE--DKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKD----Q  1587

Query  356   GGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGF---VMQVKAYDADTP  412
             G   + ++A++I++V D ND+ P F      A ++++ +P ++     + +V+A D D+ 
Sbjct  1588  GAPGKRNYAKIIVNVHDHNDHHPEFT-----AKIIQSKVPESAAIGSKLAEVRAIDRDSG  1642

Query  413   PYNDQVRYFIKEGDT-DLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
              +N +++Y I  G+   +F I+ + G I L   L+  ++ EY+L + A+D
Sbjct  1643  -HNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVD  1691


 Score = 121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 132/470 (28%), Positives = 202/470 (43%), Gaps = 62/470 (13%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LSS   VY  V D+NDNAP+F        + E++  G ++    A D D G N  I +++
Sbjct  960   LSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSL  1019

Query  61    V-AGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHR  118
                  D   F +    G I T+  LD E K V+ L++ A D                   
Sbjct  1020  KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDG------------------  1061

Query  119   AYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQ--APEFVS-TNQTSV  175
                         S+++               D  I + + DVN+   APEF     +  V
Sbjct  1062  ---------GDPSLTS---------------DMSIVIMIIDVNENRFAPEFDDFVYEGKV  1097

Query  176   TEGVAINSVVMVVKAVDRDE-GRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHR  234
              E     + VM V A D D    N  + YS+  G G   FA+     +  +S  LD E +
Sbjct  1098  KENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQGSITSLS-QLDAETK  1156

Query  235   SNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVS  294
             + Y L L A+D    P      V + V +ENDN P+ D   Y  ++ E +     ++ + 
Sbjct  1157  NFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLK  1216

Query  295   ASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVA-RSLNFERKPSYRLQVQAED-CA  352
             A D D      + Y+I SG+    F I    G I+   R L+ E +  + L+V   D  +
Sbjct  1217  AFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGS  1276

Query  353   PELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTP  412
             P L   +R     +++SVLD+NDN+P F    Y   V  +     S  + QV A D+D+ 
Sbjct  1277  PVLSSTSR-----IVVSVLDINDNSPEFDQRVYKVQVPSSATVNQS--IFQVHAIDSDSG  1329

Query  413   PYNDQVRYFIKEGD-TDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
               N ++ Y IK G   + FRI++  G I + +PLD +   E+ + + A D
Sbjct  1330  E-NGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSDN--EFEIHIKAED  1376


 Score = 119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 127/473 (27%), Positives = 202/473 (43%), Gaps = 78/473 (16%)

Query  7     VYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIVAGDDN  66
             +  NV D ND+ P F        +PE+ A+G+ +   RA D D+G N  I Y+I+ G+  
Sbjct  1598  IIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGN--  1655

Query  67    GDFGVAANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAYKYTLVI  126
                     G+++       E    +G++             LA  + I  ++  +Y L +
Sbjct  1656  -------VGSVF-------EIDPTFGII------------TLAGNLNI--NKIQEYMLQV  1687

Query  127   RASSSISANVCAQRNEIKQPPHDDSQITVSL--TDVNDQAPEFVSTN-QTSVTEGVAINS  183
             +A             ++  PP   SQI V +  T   +  P+F + N    + E + I +
Sbjct  1688  KAV------------DLGNPPLS-SQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGT  1734

Query  184   VVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYELALTA  243
              V  V A       +  + +++  G     F +    GV+ ++G +D E    + L  T 
Sbjct  1735  FVTQVTA-----RSSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNL--TV  1787

Query  244   KDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRDE---  300
             K        + Q +++++LD NDN P F    Y  ++ E+A+IG+ VL+V  S +D    
Sbjct  1788  KGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTL  1847

Query  301   -------GANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCA-  352
                    G NG + Y I        F I    GAI + R L++E    Y   V   D   
Sbjct  1848  QVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGK  1907

Query  353   PELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASG-FVMQVKAYDADT  411
             P+L        A V I V++VND  P+F +      +    LP     FV QV A DAD 
Sbjct  1908  PKLHSTTT---AHVTIRVINVNDCPPVFNERELNVTL---FLPTFENVFVRQVSAKDAD-  1960

Query  412   PPYNDQVRYFIKEGDT-DLFRINASTGEIFL--LRPLDRERVPEYVLTLLAMD  461
                ND +R+ I +G+T + F+I   TG I       L+ E   +Y L + A D
Sbjct  1961  ---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD  2010


 Score = 112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 121/467 (26%), Positives = 196/467 (42%), Gaps = 64/467 (14%)

Query  5     VTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI--VA  62
             V +  +++D+ND  P  E     + +PEN + G  +L   ATD D+G N  + Y I  + 
Sbjct  2325  VVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESIN  2384

Query  63    GDDNGDFGV--AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRAY  120
             G +N +       +G +Y +  LD E    + +V+  +D                     
Sbjct  2385  GQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKD---------------------  2423

Query  121   KYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQ-TSVTEGV  179
                     S S+S+                S + +++ D+ND AP FV  +  T V+   
Sbjct  2424  ------HGSPSLSSR---------------SNVFITVKDLNDNAPCFVEPSYFTKVSVAA  2462

Query  180   AINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYEL  239
                  V + KA D+D      +EY +  G     +++  + GV+ +   L+   +S+  L
Sbjct  2463  VRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVL  2522

Query  240   ALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDRD  299
              ++  D          R+ +++L EN  SP+FD   Y A + EN   G N++ V ASD D
Sbjct  2523  NISVSD---GVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGD  2579

Query  300   EGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPELGGDA  359
              G    L Y I S +  + F I +  G I    + + E+K  Y + ++  D      G  
Sbjct  2580  FGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSD------GGG  2633

Query  360   RFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVR  419
             +F  A + + V+DVNDN P F    Y   V   +   A+  ++ VKA D D    N  V 
Sbjct  2634  KFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTV--EANQTILTVKAKDDDIVD-NGSVH  2690

Query  420   YFI--KEGD---TDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             + I  K  D    D+  IN  TG+I      +   V  Y   + A D
Sbjct  2691  FQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASD  2737


 Score = 109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 95/319 (30%), Positives = 163/319 (51%), Gaps = 27/319 (8%)

Query  151   SQITVSLTDVNDQAPEFVST-NQTSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQ  209
             + I +S+ DVND  P FV+     +V+      +++M VKA+D D   NG V Y L  G 
Sbjct  2124  TSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGN  2183

Query  210   GEVPFALGSVDGVLRVSGPLDREHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSP  269
             GE+ F L    G L +   ++  H  NYEL + A D    P  +   + V V+D   + P
Sbjct  2184  GEL-FKLDRKSGELSIKQHVEG-HNRNYELTVAAYDGAITPCSSEAPLQVKVIDR--SMP  2239

Query  270   VFDPRRYSASIAENASIGANVLQVSASDRDEGANGR-LRYSIASGDDNRDFAISEDGGAI  328
             VF+ + Y+ S+ E+  + +    +S S   E   GR L Y+I+S  +++ F I  + G+I
Sbjct  2240  VFEKQFYTVSVKEDVEMYS---ALSVSIEAESPLGRSLIYTISS--ESQSFEIDYNTGSI  2294

Query  329   RVARSLNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIISV--LDVNDNAPLFRDSPYL  386
              V   L++E+  S+ + ++A D    L G     +AEV++SV  +DVND  P      Y 
Sbjct  2295  FVVNELDYEKISSHDVSIRATD---SLSG----VYAEVVLSVSIMDVNDCYPEIESDIYN  2347

Query  387   AHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIK----EGDTDLFRINASTGEIFLL  442
               + EN        ++++ A D D+   N ++ Y+I+    + +++LF I+ + G ++L 
Sbjct  2348  LTIPEN--ASFGTQILKINATDNDSGA-NAKLSYYIESINGQNNSELFYIDVTDGNLYLK  2404

Query  443   RPLDRERVPEYVLTLLAMD  461
              PLD E++  + + +   D
Sbjct  2405  TPLDYEQIKYHHIVVNVKD  2423


 Score = 105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 98/361 (27%), Positives = 156/361 (43%), Gaps = 62/361 (17%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LS+   V  +++D+NDN+P F      +++ E++ VG+ +L  +ATD D+  NGL+ Y I
Sbjct  3358  LSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNI  3417

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDA---PRAPAKPLASTIQIKS  116
               GD+ G F +   NGTI   R LDRE  S Y L ++A D     R  + P         
Sbjct  3418  ERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVP---------  3468

Query  117   HRAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSV-  175
                                                 I +++ D ND AP F S+N + V 
Sbjct  3469  ------------------------------------ININILDTNDNAPIFSSSNYSVVL  3492

Query  176   TEGVAINSVVMVVKAVDRDEGRNGY-VEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHR  234
              E   +  V +  K  D DE  N     + +  G     F L   DG LR +   +   +
Sbjct  3493  QENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQ-DGSLRTASRFNHNLQ  3551

Query  235   SNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVS  294
               + + +   D G PP  +   V+V +++E+   P+  P   + +  E+   GA + +V 
Sbjct  3552  DEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVH  3611

Query  295   ASDRDEGANGRLRYSIASGDDN-----RDFAISEDGGAIRVARSLNFERKPSYRLQVQAE  349
             ASD+D+     L +S+ SG D+     + F IS + G I    +L+      Y+L V   
Sbjct  3612  ASDQDK--YDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGL---YKLNVSVS  3666

Query  350   D  350
             D
Sbjct  3667  D  3667


 Score = 103 bits (256),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 135/480 (28%), Positives = 208/480 (43%), Gaps = 78/480 (16%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGT----------RATDLDAG  51
             SS   +  +++D NDN P F        LPE+ A+G+ VL            +  D D G
Sbjct  1796  SSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVG  1855

Query  52    DNGLIGYAIVAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLAS  110
              NG++ Y IV       F + +  G I   R+LD E  + Y   +   D      KP   
Sbjct  1856  VNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDM----GKP---  1908

Query  111   TIQIKSHRAYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVST  170
                 K H      + IR    I+ N C        P  ++ ++ V+L         F+ T
Sbjct  1909  ----KLHSTTTAHVTIRV---INVNDCP-------PVFNERELNVTL---------FLPT  1945

Query  171   NQTSVTEGVAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVL--RVSGP  228
              +         N  V  V A D D   N  + + +  G     F +    G++  R    
Sbjct  1946  FE---------NVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEI  1993

Query  229   LDREHRSNYELALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAEN----A  284
             L+ E+  +Y L + A D G    I    V + VL   D++  F    Y  S  EN    A
Sbjct  1994  LNNENDRDYALHVRASD-GIFSAILI--VKIKVLSAIDSNFAFQRESYRFSAFENNTKVA  2050

Query  285   SIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFER--KPSY  342
             +IG  ++ V  +  DE     + Y I +     D  IS   GA++    + F+R  K  Y
Sbjct  2051  TIG--LVNVIGNTLDEN----VEYRILNPTQLFDIGIS--SGALKTTGVI-FDREVKDLY  2101

Query  343   RLQVQAEDCAPE-LGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFV  401
             RL V+A+    + +  + R     + ISVLDVNDN PLF + PY A V  ++  P    +
Sbjct  2102  RLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATV--SIDDPKGTII  2159

Query  402   MQVKAYDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMD  461
             MQVKA D D+   N +VRY +K+G+ +LF+++  +GE+ + + ++      Y LT+ A D
Sbjct  2160  MQVKAIDLDSAE-NGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYD  2217


 Score = 88.2 bits (217),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 95/366 (26%), Positives = 144/366 (39%), Gaps = 68/366 (19%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LSS + V+  V    ++ P F     A+++ EN+ +G  V     T + A  +  I + I
Sbjct  1697  LSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFV-----TQVTARSSSSIFFNI  1751

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             ++G+ N  F +  + G I     +D E+  V+ L ++  +                    
Sbjct  1752  ISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTN--------------------  1791

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQT-SVTEG  178
                   + A SS                     I + + D ND  P FV      ++ E 
Sbjct  1792  ------MAAESSC------------------QNIIIHILDANDNIPYFVQNEYVGALPES  1827

Query  179   VAINSVVMVV----------KAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGP  228
              AI S V+ V          +  D D G NG VEY +     +  F + S  G + +   
Sbjct  1828  AAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQ  1887

Query  229   LDREHRSNYELALTAKDRGEPP--RITAQRVLVNVLDENDNSPVFDPRRYSASIAENASI  286
             LD E  + Y   +T  D G+P     T   V + V++ ND  PVF+ R  + ++      
Sbjct  1888  LDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFE  1947

Query  287   GANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAI--RVARSLNFERKPSYRL  344
                V QVSA D D   N  LR+ I  G+ N  F I +  G I  R    LN E    Y L
Sbjct  1948  NVFVRQVSAKDAD---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYAL  2004

Query  345   QVQAED  350
              V+A D
Sbjct  2005  HVRASD  2010


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 115/467 (25%), Positives = 181/467 (39%), Gaps = 71/467 (15%)

Query  1     LSSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAI  60
             LSS   V+  V DLNDNAP F   +    +      G  V   +A D D  D   + Y I
Sbjct  2429  LSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKI  2488

Query  61    VAGDDNGDFGV-AANGTIYTRRELDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHRA  119
             V G++   + +    G I  +  L+   KS   L +   D                 H A
Sbjct  2489  VYGNELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDG---------------VHTA  2533

Query  120   YKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEF-VSTNQTSVTEG  178
             Y                              +++ +SL   N  +P F  ST +  V E 
Sbjct  2534  Y------------------------------ARLKISLLPENVYSPLFDQSTYEAQVPEN  2563

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYSLAPGQGEVPFALGSVDGVLRVSGPLDREHRSNYE  238
             +     ++ VKA D D G    + Y +   + +  F +    GV+      DRE +  Y 
Sbjct  2564  LLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYV  2623

Query  239   LALTAKDRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVLQVSASDR  298
             + L   D G   +     + V V+D NDN P F  + Y   ++        +L V A D 
Sbjct  2624  VLLKVSDGG--GKFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDD  2681

Query  299   DEGANGRLRYSIASGDDNRD----FAISEDGGAIRVARSLNFERKPSYRLQVQAEDCAPE  354
             D   NG + + I    +++       I+E  G I            SY+  V+A D    
Sbjct  2682  DIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASD----  2737

Query  355   LGGDARFDHAEVIIS--VLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKAYDADTP  412
               G+ +F H+EV +S  +++ + N P F  S  L  ++E+  PP +   +  K +     
Sbjct  2738  -RGEPQF-HSEVPVSIEIIETDANIPTFEKSSVLLKIIEST-PPGT---VLTKLHMIGNY  2791

Query  413   PYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLA  459
              +      F    D D F I+ S GE+ L + LDRE+   + L ++A
Sbjct  2792  TFK-----FSIAADQDHFMISDS-GELILQQTLDREQQESHNLIVVA  2832


 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 114/476 (24%), Positives = 191/476 (40%), Gaps = 86/476 (18%)

Query  2     SSTVTVYCNVVDLNDNAPMFEPGARAVDLPENVAVGALVLGTRATDLDAGDNGLIGYAIV  61
             ++T  V   V+++ND  P+F      V L         V    A D    DN  + + IV
Sbjct  1913  TTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKD---ADNDTLRFDIV  1969

Query  62    AGDDNGDFGVAANGTIYTRRE---LDREAKSVYGLVLEARDAPRAPAKPLASTIQIKSHR  118
              G+ N  F +     I T R    L+ E    Y L + A D        + S I I    
Sbjct  1970  DGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDG-------IFSAILI----  2018

Query  119   AYKYTLVIRASSSISANVCAQRNEIKQPPHDDSQITVSLTDVNDQAPEFVSTNQTSVTEG  178
                  + I+  S+I +N   QR   +    +++                        T+ 
Sbjct  2019  -----VKIKVLSAIDSNFAFQRESYRFSAFENN------------------------TKV  2049

Query  179   VAINSVVMVVKAVDRDEGRNGYVEYS-LAPGQGEVPFALGSVDGVLRVSGPL-DREHRSN  236
               I  V ++   +D +      VEY  L P Q    F +G   G L+ +G + DRE +  
Sbjct  2050  ATIGLVNVIGNTLDEN------VEYRILNPTQ---LFDIGISSGALKTTGVIFDREVKDL  2100

Query  237   YELALTAKDR-----GEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENASIGANVL  291
             Y L + AK           R     + ++VLD NDN P+F    Y A+++ +   G  ++
Sbjct  2101  YRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIM  2160

Query  292   QVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRLQVQAED-  350
             QV A D D   NG +RY +  G+    F +    G + + + +    + +Y L V A D 
Sbjct  2161  QVKAIDLDSAENGEVRYELKKGNGEL-FKLDRKSGELSIKQHVEGHNR-NYELTVAAYDG  2218

Query  351   ----CAPELGGDARFDHAEVIISVLDVNDNAPLFRDSPYLAHVMENMLPPASGFVMQVKA  406
                 C+ E         A + + V+D   + P+F    Y   V E+ +   S   + ++A
Sbjct  2219  AITPCSSE---------APLQVKVID--RSMPVFEKQFYTVSVKED-VEMYSALSVSIEA  2266

Query  407   YDADTPPYNDQVRYFIKEGDTDLFRINASTGEIFLLRPLDRERVPEYVLTLLAMDT  462
                   P    + Y I   ++  F I+ +TG IF++  LD E++  + +++ A D+
Sbjct  2267  ----ESPLGRSLIYTIS-SESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDS  2317


 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/155 (32%), Positives = 73/155 (47%), Gaps = 7/155 (5%)

Query  229  LDREHRSNYELALTAK----DRGEPPRITAQRVLVNVLDENDNSPVFDPRRYSASIAENA  284
            L+RE    Y + + A     DR      T   + + VLD ND SP+F P +Y+  I E+ 
Sbjct  137  LNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDT  196

Query  285  SIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISEDGGAIRVARSLNFERKPSYRL  344
                ++L+V+A D D G NG + YS+    D+  FAI    G I + + L +     + L
Sbjct  197  PKYQSILKVTADDADLGINGEIYYSLLM--DSEYFAIHPTTGEITLLQQLQYAENSHFEL  254

Query  345  QVQAEDCAPELGG-DARFDHAEVIISVLDVNDNAP  378
             V A D    +   + +    +V ISV  VN  AP
Sbjct  255  TVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAP  289


 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 93/203 (46%), Gaps = 16/203 (8%)

Query  271  FDPRRYSASIAENA---SIGANVLQVSASDRDEGANGRLRYSIASGDDNRDFAISED---  324
            F    Y+ +I EN+   +    VL    +    G N  ++Y I SGD  + F   E    
Sbjct  62   FSHSVYNVTIPENSLGKTYAKGVLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEKLVG  121

Query  325  ---GGAIRVARS---LNFERKPSYRLQVQAEDCAPELGGDARFDHAEVIISVLDVNDNAP  378
                 AIR   +   LN E+   Y ++V+A     +    +    A + I VLD ND +P
Sbjct  122  DFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKVLDRNDLSP  181

Query  379  LFRDSPYLAHVMENMLPPASGFVMQVKAYDADTPPYNDQVRYFIKEGDTDLFRINASTGE  438
            LF  + Y   + E+   P    +++V A DAD    N ++ Y +   D++ F I+ +TGE
Sbjct  182  LFYPTQYTVVIPEDT--PKYQSILKVTADDADL-GINGEIYYSLLM-DSEYFAIHPTTGE  237

Query  439  IFLLRPLDRERVPEYVLTLLAMD  461
            I LL+ L       + LT++A D
Sbjct  238  ITLLQQLQYAENSHFELTVVAYD  260



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000037-PA

Length=2668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

FAT_DROME  unnamed protein product                                    2704    0.0   
FAT2_DROME  unnamed protein product                                   487     4e-138
STAN_DROME  unnamed protein product                                   461     3e-130


>FAT_DROME unnamed protein product
Length=5147

 Score = 2704 bits (7008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1416/2703 (52%), Positives = 1851/2703 (68%), Gaps = 113/2703 (4%)

Query  9     VAFLVVVAGTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDR  68
             +  + +  G+ PLT +G VR+ V D+ND+ P F  Q Y A V ENL  G  V  P ATD+
Sbjct  2459  LTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDK  2518

Query  69    DDGLNAQIRYSLLGDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRAS  128
             D+GLNA++R++LLG+   RF ++S TGEI T   LDRE+  VYHLTL+AQDSS TEPRAS
Sbjct  2519  DEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRAS  2578

Query  129   AANLTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHGK  188
             + NLTISV D NDN P+F S  Y   VP+  SKG+FVFGA+A D D+G+N+ + Y + G+
Sbjct  2579  SVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGR  2638

Query  189   DARRFGVDSRSGVVRALEDLAMGGQN----TYQLQIEASDCGSEPRAVSVDLVVHLWERQ  244
             D   F +++++GVV    +L    ++    TY + I A D G +  +   +L V L   +
Sbjct  2639  DQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPE  2698

Query  245   LFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRT  304
             LFP F     + F + ED   G+++T +SA++PK G   ++ + +AGG +GDSLR++P +
Sbjct  2699  LFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNS  2758

Query  305   GDVVIAS-GFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNAS  363
             G + +   G DYE    YE W+E  D   PSLRSV  + +NVTDANDNAPVM+   YNA 
Sbjct  2759  GLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAE  2818

Query  364   VPEEDYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDREKVS  423
             V EE+ PP  +A V A D DSG+N  + Y L NDFD  F I E SGEI T   LDRE++ 
Sbjct  2819  VLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITE-SGEIYTRMRLDREEIG  2877

Query  424   SYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTRLFNVNVTENSEIGTFVIRITTT  483
              Y  +VEA D+GVP +TGTA+V + +LDKNDNPP+FTRLF++NVTEN+EIG+FVIR+T++
Sbjct  2878  DYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTENAEIGSFVIRVTSS  2937

Query  484   DLDMEHNANVTYSFTENSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVATDRAWITET  543
             DLD+  NAN +YSF+EN   KF I+P SGN+TVAG+LDRE QDEY+LKVVA+D AW  ET
Sbjct  2938  DLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWRAET  2997

Query  544   PLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPS  603
             P+TI++QDQNDN PEFE   Y F FPELQ+ +A +GQ++A+D DK G NS +SYSL QPS
Sbjct  2998  PITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPS  3057

Query  604   DLFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDA  663
              +FSIDPA G+++ KK +R+K+++   SPEN+Y+  V+A DNGKPPL S+ LV +NIVDA
Sbjct  3058  PMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDA  3117

Query  664   NNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEP  723
             +N+ PKFE   YL P+P+     +++ +  A+D++D G N E++Y ++  N S  F V  
Sbjct  3118  HNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTN-EMDYSLMTFNLSSIFSVGR  3176

Query  724   NSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQ  783
             + GWI + K + +    T + +  +ATD+GVP +SDE    ++VTGEN   P F+  SYQ
Sbjct  3177  HDGWITLVKPI-QVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQ  3235

Query  784   VRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYD  843
             V VPENEP  +TILTV A D D+GPNGM+RY IS GNER +FS+   TG I I + LDYD
Sbjct  3236  VIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYD  3295

Query  844   TVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFK  903
              + EY LNIT +DLG+   S+VA L + ++DVNDNPP FN   Y  Y+PEN P   FVF+
Sbjct  3296  LIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQ  3355

Query  904   VVATDIDSPKYSVIQYRII-GGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANP  962
               A D DSPK ++I Y  +  G  + +F + QS G I S  +FDYEE   YTL + A NP
Sbjct  3356  AHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNP  3415

Query  963   DTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGK  1022
             D  S +     + VH+ GVNEFYP+F+QPVFH DVSE++ +GT VG VQATD+D+G DG+
Sbjct  3416  D--SSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGR  3473

Query  1023  VYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQII  1082
             VYYL VGSSND+GF I + TG+I ++R LDRETQNR +LTVMAKN G IRGNDTDEAQ+I
Sbjct  3474  VYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVI  3533

Query  1083  ISIQDGNDPPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGGNVGQA  1142
             ISIQDGNDPPEF+++ Y +++ E    G+K+ TV+A+DKDVR QNNQFSYSII GN+ Q+
Sbjct  3534  ISIQDGNDPPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQS  3593

Query  1143  FKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVFDF  1202
             FKID Q+G++ TA  LDRE   +Y L+IGAIDTG PPQTGS TV IEL DVNDNGP F  
Sbjct  3594  FKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTP  3653

Query  1203  KEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILKTTR  1262
             + + GY+SENEPAGTSIMTL A+DPDLP NG PF+Y+LIGGK    + ++++SG++++T 
Sbjct  3654  EGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTT  3713

Query  1263  SLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSPSSPRSVHVKVYSFNGQTPL  1322
             S DRE TP L+ ++EVEDSG P+  S+H +T+ VLDQND+PS+ RS+H+ V  FNG  P 
Sbjct  3714  SFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSLFNGDLPS  3773

Query  1323  G-KIADVHPNDPDTSGDYTCRILQGSAGP---LNIPAACDLHAGKITPGIGYSLSVSGND  1378
               K+ADV PND D  GDY CR+ +  A     L IP ACDL     T  I    S +GND
Sbjct  3774  NVKLADVRPNDIDIVGDYRCRLQKNPAQSQLQLAIPRACDLITTSHTTPIASVFSYTGND  3833

Query  1379  GRHPDVVSKVSLEFLTFSNATVENTVTMQIVRMKTVDFLGKYYVALLDLLQEELDVGDTL  1438
             G+H DV SKVS+ F +F+N T+ N+V++ +  M    FL  +Y  +L++++  +   D +
Sbjct  3834  GKHGDVSSKVSVAFQSFNNETLANSVSIMVRNMTAYHFLANHYRPILEMIKSRMSNEDEV  3893

Query  1439  GIYSIDE----IDGHTEVYMAMHSSQ-GYRTKHEVKEILTKKSWRIETLLEGANVMIGYS  1493
              +YS+ E       + ++ MA+  ++  Y+    + E L +K      LL+   V++GY 
Sbjct  3894  ILYSLLEGGSGNSTNLQLLMAVRLAKTSYQQPKYLIERLREKRSAFSELLQ-KEVIVGYE  3952

Query  1494  PC-KIDACNNGGVCSDKIVVYEDSR--ITDTPTLILTSPKVAHEMVCKCRDGFTGEKCEK  1550
             PC + D C NGGVCS  + + +     I D+P L+L+ P+V H+  C+C  GF+GE+C +
Sbjct  3953  PCSEPDVCENGGVCSATMRLLDAHSFVIQDSPALVLSGPRVVHDYSCQCTSGFSGEQCSR  4012

Query  1551  KQDPCSPNPCQSGGQCRRVGFDFHCSCSPDREGKLCELERGDACASNPCRNGGVCKESPD  1610
             +QDPC PNPC S  QCRR+G DF C C  +R+GK CE ER D C S PCRNGG C+ SPD
Sbjct  4013  RQDPCLPNPCHSQVQCRRLGSDFQCMCPANRDGKHCEKERSDVCYSKPCRNGGSCQRSPD  4072

Query  1611  GSSFFCLCRTGYRGNHCEVLTDSCRPNPCLHGGLCVSEKPGYRCSCLEGRYGRHCERSTF  1670
             GSS+FCLCR G+RGN CE ++DSCRPNPCLHGGLCVS KPGY+C+C  GRYGRHCER ++
Sbjct  4073  GSSYFCLCRPGFRGNQCESVSDSCRPNPCLHGGLCVSLKPGYKCNCTPGRYGRHCERFSY  4132

Query  1671  SFDELSYMTFPSLDSNTNDVTIVFATTKPNALLLYNYGVQSGGRSDFIVLELVNGKLVFS  1730
              F  LSYMTFP+LD  TND++IVFATTKPN+LLLYNYG+QSGGRSDF+ +ELV+G+  FS
Sbjct  4133  GFQPLSYMTFPALDVTTNDISIVFATTKPNSLLLYNYGMQSGGRSDFLAIELVHGRAYFS  4192

Query  1731  CGGARSAITTLTVKSDKSLADGSWNKVTATRNGRVVSLSVSKCKEHGDLCDDCRPGDGTC  1790
              GGAR+AI+  TV + ++LADG W+KVTATRNGRV+SLSV+KC + GD+C +C PGD +C
Sbjct  4193  SGGARTAIS--TVIAGRNLADGGWHKVTATRNGRVMSLSVAKCADSGDVCTECLPGDSSC  4250

Query  1791  YAEDVGLTGTLNFNKNPLLLGGLVNSDPVLERPGQIHSDDLVGCIHSVSINGRALNLSSP  1850
             YA++VG  GTLNFNK PL++GGL ++DP+LERPGQ+HSDDLVGC+HSV I GRALNLS P
Sbjct  4251  YADEVGPVGTLNFNKQPLMIGGLSSADPILERPGQVHSDDLVGCLHSVHIGGRALNLSLP  4310

Query  1851  LSSRGIKSTCPRSDGGPCSRSREAGNACGQGKCYDKWDKSTCQC-GKVMAPNCQGAVEPI  1909
             L  +GI + C R    P   +   G   GQ  C D+W  S CQC G + +P+C  ++EPI
Sbjct  4311  LQQKGILAGCNRQACQPALAAERCGGFAGQ--CIDRWSSSLCQCGGHLQSPDCSDSLEPI  4368

Query  1910  TLSDGGYVEYEISEKHRRMQLLEYLYGGTTHWHDGLPSRYTEENAISVIPTST----PAK  1965
             TL +G +VE+ ISE +RRMQLL+ LY   + W D    R  E  A+S   T++      K
Sbjct  4369  TLGEGAFVEFRISEIYRRMQLLDNLYNSKSAWLDNQQMR--ERRAVSNFSTASQIYEAPK  4426

Query  1966  SIHLMFRTVKPDGILVYAATNRHYTSIELRHGQISYASLLSSPVNMSGSHEGSLADGRWH  2025
              + ++FRT K  G ++YAATN+ +TS+ LR G++ Y S     +NM+     +L DG+WH
Sbjct  4427  MLSMLFRTYKDQGQILYAATNQMFTSLSLREGRLVYYSKQHLTINMTVQETSTLNDGKWH  4486

Query  2026  NLTLHSYARGLKLYVDEKLSGEELDSAGVHDFLDPYLTLLTVGGVRPDQYMAYDGPPKPF  2085
             N++L S +R L+L VD +  G+ELD AGVHDFLDPYLT+L VGG             + F
Sbjct  4487  NVSLFSESRSLRLIVDGRQVGDELDIAGVHDFLDPYLTILNVGG-------------EAF  4533

Query  2086  EGCLANFTINREVQPFNGSGSIMKDTIYHGKVNHGCRGPIGIAAATAADPLSVGVTLVVI  2145
              GCLAN T+N E+QP NGSGSI  +  YHGK+  GCRG IG  AA  ADPLS+G TLV++
Sbjct  4534  VGCLANVTVNNELQPLNGSGSIFPEVRYHGKIESGCRGDIGQDAAQVADPLSIGFTLVIV  4593

Query  2146  FFVILLVAILASFIIFRLRRQSKEKSATTVVNKNTNAIMTGNTLVGPQSDNIMTRHENTY  2205
             FFVIL+VAIL S++I+R R + ++  + +           G  +   Q D+++ R+ +  
Sbjct  4594  FFVILVVAILGSYVIYRFRGKQEKIGSLSCGVPGFKIKHPGGPVTQSQVDHVLVRNLHPS  4653

Query  2206  ------ITDGSDLR---NISHL-GPELISKKYKE--REM---SAPEHRPQRPDIIEREIS  2250
                   +  G  +R      HL GPEL++KK+KE   EM      + RPQRPDIIERE  
Sbjct  4654  EAPSPPVGAGDHMRPPVGSHHLVGPELLTKKFKEPTAEMPQPQQQQQRPQRPDIIERE--  4711

Query  2251  KSPLIRDEHPPLPPPTQSSLR----SHEHGQEPDLPEHYDLENASSIAPSDIDIVYHYKG  2306
              SPLIR++H    PP          S + G E   PEHYDLENASSIAPSDIDIVYHYKG
Sbjct  4712  -SPLIREDHHLPIPPLHPLPLEHASSVDMGSE--YPEHYDLENASSIAPSDIDIVYHYKG  4768

Query  2307  YRD--GMRKYKATPPSINSYGNHHKHTNQ-------QHRHVGPFPQSRAMAPPPVGQPPV  2357
             YR+  G+RKYKA+ P +++Y  HHKH N        QHRH  PF             PP 
Sbjct  4769  YREAAGLRKYKASVPPVSAY-THHKHQNSGSQQQQQQHRHTAPFVTRNQGG--QPPPPPT  4825

Query  2358  SAPKLLQSTPLARLSPSSELSAQQPRILTLHDISGKPLQSALLATTSSSGGVGKDVMNSN  2417
             SA +  QSTPLARLSPSSELS+QQPRILTLHDISGKPLQSALLATTSSSGGVGKDV +SN
Sbjct  4826  SASRTHQSTPLARLSPSSELSSQQPRILTLHDISGKPLQSALLATTSSSGGVGKDV-HSN  4884

Query  2418  SERSLNSPIMSQLSG--STASRK---VPQSNNKAVNNGVSSGPRGLTAEEIERLNSRPRT  2472
             SERSLNSP+MSQLSG  S+ASR+   VPQ   +  +        GLTAEEIERLN RPRT
Sbjct  4885  SERSLNSPVMSQLSGQSSSASRQKPGVPQQQAQQTS-------MGLTAEEIERLNGRPRT  4937

Query  2473  SSLVSTLDAVSSSSEARGPTHGPLHLHRRHSPPTERLKRRNSSTTNESGNDSFTCSEIEY  2532
              SL+STLDAVSSSSEA   +   LH+          +   +S++T+ESGNDSFTCSEIEY
Sbjct  4938  CSLISTLDAVSSSSEAPRVSSSALHMSLGGD-----VDAHSSTSTDESGNDSFTCSEIEY  4992

Query  2533  DNNSLVGSKRSENIYSKPDD-TVVARAKESPQSTK---------PPLPPSINYDGFDSSF  2582
             DNNSL G  +     S  D  + V+RA    ++++         PP+PP   YDGF+SSF
Sbjct  4993  DNNSLSGDGKYSTSKSLLDGRSPVSRALSGGETSRNPPTTVVKTPPIPPHA-YDGFESSF  5051

Query  2583  RGSLSTLVASDDDMSTHIGGLYRPSSNESPSTSIALSWDYLLNWGPNFESLVGVFIDIAE  2642
             RGSLSTLVASDDD++ H+ G+YR ++  +  ++  L W+YLLNWGP++E+L+GVF DIAE
Sbjct  5052  RGSLSTLVASDDDIANHLSGIYRKANGAASPSATTLGWEYLLNWGPSYENLMGVFKDIAE  5111

Query  2643  LPD  2645
             LPD
Sbjct  5112  LPD  5114


 Score = 435 bits (1119),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 406/1410 (29%), Positives = 644/1410 (46%), Gaps = 109/1410 (8%)

Query  27    VRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLLGDGAE  86
             V + +LDVND+ P F   +Y   + E    G  V   +A+D D G N++I Y  L +   
Sbjct  256   VNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITY-YLAETEH  314

Query  87    RFQVNSSTGEIVTLEPLDREQHDVYH---------LTLVAQDSSPTEPRASAAN-LTISV  136
             +F VN  TG I T E ++  Q               T+ A+D     PR      +T+++
Sbjct  315   QFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHG--SPRQDGRTYVTVNL  372

Query  137   RDSNDNTPRFSSPRY-----TAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRL-HGKDA  190
              D+ND+ P  S   +      A V +    G  V      D D G N R   R+  G + 
Sbjct  373   LDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNEL  432

Query  191   RRFGVDSRSG--VVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQLFPC  248
               F ++  +   +VR    L       Y L + A D G+  R  +  L++ + +      
Sbjct  433   GHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEP  492

Query  249   FGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVV  308
                 +E    L E AP G  V +++A+   TG  +++ + +  GN      ++P TG +V
Sbjct  493   VFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIV  552

Query  309   IASGFDYETLPSYEAWVEVRDSG-NPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEE  367
                  D E   + E  +  RD G NP   +  QL V + D ND AP       N ++ E+
Sbjct  553   TTGPLDREIRDTVELSISARDGGPNPKF-AYTQLKVIILDENDEAPQFSQREQNVTLGED  611

Query  368   DYPPSRVARVSAKDADSGENSEITYHLLNDFDEV----FVIDEFSGEISTNSMLDREKVS  423
               P + VA ++A D D G N  +T+ L    + +    F +D  +G+++T   LDREK+S
Sbjct  612   APPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMS  671

Query  424   SYKLIVEAWDRGVPR-LTGTATVFVTVLDKNDNPPRF----------TRLFNVNVTENSE  472
              Y++ V A D+G P   + TATV++ V D NDN P+F              ++ + +  E
Sbjct  672   QYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVE  731

Query  473   IGTFVIRITTTDLDMEHNANVTYSFTENSSNKFTIDPISGNVTVAGNLDREV--QDEYLL  530
                 ++ +T +D D   NA + Y         F +D  SG +++ G+    +  +  Y L
Sbjct  732   KERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKL  791

Query  531   KVVATD---RAWITETPLTISVQDQNDNPPEFEKQT--YYFHFPELQEKMAH------IG  579
              V A D   R    +  + I ++ + +     + Q   Y F   E  E+  +      +G
Sbjct  792   LVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVG  851

Query  580   QV-VASDEDKLGANSDVSYSLLQ--PSDLFSIDPAMGDIYCKKTM-RYKYTKSRASPENV  635
              V V S   K  ANS + Y ++Q   +  F ID   G I   + + R +    R +   +
Sbjct  852   IVQVKSTNGK--ANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTI--L  907

Query  636   YSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVAS  695
              S    +          + +V + I+D N++AP F       P     P N  V Q +  
Sbjct  908   ASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTI-SLPENAAVGQEIYL  966

Query  696   DR---EDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATDK  752
              R    D GVN+ I Y +   N +  F + P +G +Y+++ +     G++  ++  ATD 
Sbjct  967   SRVRDRDAGVNSRISYSL-TNNPNQQFRIGPVTGVLYLQRPI-RAEPGSLIHVELMATDA  1024

Query  753   GVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMV  812
             G P  S ++  ++++   N H P F   SY+  +PE    NT    + A D D G NG +
Sbjct  1025  GSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRI  1084

Query  813   RYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAVATLIVNV  872
              YEI  GN    F + P  G + +   LD +    Y L ++ RD G  S+S+V  ++++V
Sbjct  1085  SYEIIEGNTERMFGVFP-DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHV  1143

Query  873   SDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNI  932
              D NDN P+F  S +   +PEN+P+  FV K+ A D D  + + + + +   T  + F I
Sbjct  1144  IDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQT--QDFTI  1201

Query  933   EQSTGIIKSKTTFDYEEVNEYTLDVIAANPD--------TNSQVVGATT-----------  973
             +   G IK+   FD E + + + +  A+  D         N  ++ AT            
Sbjct  1202  DTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDK  1261

Query  974   --VLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSS  1031
               V V +T VN+  P+F++  +H+ +SE A  GT +  V   D D G +G VYY     +
Sbjct  1262  VKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGN  1321

Query  1032  NDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQIIISIQDGND-  1090
                 F++ S TG +S+ RRLDRE+Q    L V+AK+A  ++   +  A I I + D ND 
Sbjct  1322  EAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDA-ALKHPLSSNASITIVVLDENDN  1380

Query  1091  PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGGNVGQAFKIDPQSG  1150
              PEF ++  E SV E   TG++++  RA D D +  N+Q  +SI  GN    F ID  +G
Sbjct  1381  APEFTQSSSEVSVLETSPTGTELMRFRASDAD-QGVNSQVVFSISAGNRRDTFHIDSITG  1439

Query  1151  DLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVS  1210
              L   K LD E + SY L I A D G+P  + +    + ++D NDN P+F    IV  + 
Sbjct  1440  SLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIK  1499

Query  1211  ENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKH------SGILKTTRSL  1264
             E  P  T I+T++A DPD   NG   SY +   KQ   +   +H      +G++ T R +
Sbjct  1500  EGIPLKTPIVTVTADDPDSGLNGK-VSYAI--SKQEPQLPQGRHFGINTETGVIHTLREI  1556

Query  1265  DREATPQLDFLVEVEDSGTP---RLSSEHAITVHVLDQNDSPSSPRSVHVKVYSFNGQTP  1321
             DRE+       V   D   P   +LS+E  +TV V D ND+     S++  +      T 
Sbjct  1557  DRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTS  1616

Query  1322  LGK---IADVHPNDPDTS--GDYTCRILQG  1346
              G    +  VH  D D+S  G  T  I+ G
Sbjct  1617  KGSSTAVMQVHAKDADSSSNGLVTYEIVSG  1646


 Score = 427 bits (1098),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 385/1321 (29%), Positives = 599/1321 (45%), Gaps = 73/1321 (6%)

Query  21    LTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSL  80
             L+S+  V IL+ DVND  P F      A +MEN+A+   V    A D D+G N  I Y L
Sbjct  2147  LSSTVKVTILIKDVNDEVPVFISANETA-IMENVAINTVVIAVKAVDNDEGRNGYIDY-L  2204

Query  81    LGDGAER---------FQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAAN  131
             + +  +          F +N + G++  ++ LDRE    Y L + A+D     P+++ + 
Sbjct  2205  MKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRG-EPPQSTESQ  2263

Query  132   LTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRL-HGKDA  190
             L I + D NDN+P F   +Y+A V +  S G  V    A+D DEG N RI Y +  G   
Sbjct  2264  LLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQN  2323

Query  191   RRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSE-PRAVSVDLVVHLWE-RQLFPC  248
               F +   +GVVR  ++L     + Y L + A DC  E P   + +L +++ +     P 
Sbjct  2324  HDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPT  2383

Query  249   FGPGTETRFTLREDAP-EGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDV  307
             F         +    P  G  V T++A    T P +  V         D  RI   +GD+
Sbjct  2384  FLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDI  2443

Query  308   VIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEE  367
              +    D E    Y   +   D+G+P L     + V V D NDN PV ++ +Y+A+V E 
Sbjct  2444  ALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVREN  2503

Query  368   DYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDREKVSSYKL  427
                 + V    A D D G N+++ ++LL +    F ID  +GEIST + LDRE+ S Y L
Sbjct  2504  LPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTATTLDREETSVYHL  2563

Query  428   IVEAWDRGV--PRLTGTATVFVTVLDKNDNPPRF-TRLFNVNVTENSEIGTFVIRITTTD  484
              + A D  +  PR + +  + ++V D NDN P+F +  +NV V E    G FV      D
Sbjct  2564  TLMAQDSSITEPRAS-SVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALD  2622

Query  485   LDMEHNANVTYSFTENSSNKFTIDPISGNVTVAGNLDREVQDE----YLLKVVATD---R  537
             LD   NA V Y+ +    + F I+  +G V+    L  + +      Y + + A D   +
Sbjct  2623  LDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQ  2682

Query  538   AWITETPLTISVQDQNDNPPEFEKQTYYF---HFPELQE-KMAHIGQVVASDEDKLGANS  593
             +  ++  LT+ ++     PPE      Y    HF   ++ +   +   V++   K G   
Sbjct  2683  SLSSKAELTVILR-----PPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVG  2737

Query  594   DVSYSLLQ--PSDLFSIDPAMGDIYC-KKTMRYKYTKSRASPENVYSFYVVAMDNGKPPL  650
              + Y++      D   +DP  G +   +  + Y+ T       ++Y  ++ A D   P L
Sbjct  2738  KIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELT-------HLYEIWIEAADGDTPSL  2790

Query  651   SSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFI  710
              S TL+ +N+ DAN++AP  E   Y   V E     + +A   ASDR D G N  + Y +
Sbjct  2791  RSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDR-DSGDNGNVIYRL  2849

Query  711   VAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGE  770
                N  D  +    SG IY +  +     G  +    +A D+GVP  +      L +  +
Sbjct  2850  --QNDFDGTFEITESGEIYTRMRLDREEIGD-YAFVVEAVDQGVPHMTGTASVLLHLLDK  2906

Query  771   NKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPI  830
             N + P F  + + + V EN    + ++ V + D D G N    Y  S  N   +F I P 
Sbjct  2907  NDNPPKFTRL-FSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSE-NPGEKFRIEPQ  2964

Query  831   TGAITILEALDYDTVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAY  890
             +G IT+   LD +   EY L + A D  + +++ +    + + D NDN P+F  S Y   
Sbjct  2965  SGNITVAGHLDREQQDEYILKVVASDGAWRAETPIT---ITIQDQNDNAPEFEHSFYSFS  3021

Query  891   LPENSPSQHFVFKVVATDIDSP-KYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEE  949
              PE   S   V +++ATD D     SVI Y +        F+I+ +TG + SK    ++ 
Sbjct  3022  FPELQQSIALVGQIIATDRDKQGPNSVISYSL--QQPSPMFSIDPATGEVFSKKAVRFKH  3079

Query  950   V-------NEYTLDVIAANPDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAE  1002
                     N Y L V+A + +    +     V ++I   +   PKF Q  +   + + A 
Sbjct  3080  SQYVRSPENMYALTVLATD-NGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAV  3138

Query  1003  IGTFVGLVQATD-QDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAIL  1061
              G  +  V A D QD G++   Y L   + +   FS+G   G I++ + +      R  L
Sbjct  3139  RGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSI-FSVGRHDGWITLVKPIQVPPNTRYEL  3197

Query  1062  TVMAKNAGGIRGNDTDEAQIIISIQDGN-DPPEFLENLYEASVPEGENTGSKILTVRAVD  1120
              V A + G      +DE +++I +   N D P F  N Y+  VPE E  GS ILTV A D
Sbjct  3198  VVRATDRG--VPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATD  3255

Query  1121  KDVRPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQ  1180
              D  P N    YSI GGN  Q F +D ++G +   + LD + +Q Y L I   D G  P 
Sbjct  3256  DDTGP-NGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPL  3314

Query  1181  TGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRL  1240
             +    + I L DVNDN PVF+ KE   Y+ EN+P GT +    A D D P N       L
Sbjct  3315  SSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFL  3374

Query  1241  IGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQN  1300
               G       + + +G + +  S D E        ++ ++  +  + S   + VHVL  N
Sbjct  3375  PSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS-SMESYANLYVHVLGVN  3433

Query  1301  D  1301
             +
Sbjct  3434  E  3434


 Score = 415 bits (1067),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 389/1367 (28%), Positives = 615/1367 (45%), Gaps = 97/1367 (7%)

Query  27    VRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLLGDGAE  86
             +++++LD ND AP+F ++E    + E+      VA   ATD D G N  + ++L     E
Sbjct  585   LKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFAL-APSVE  643

Query  87    R-----FQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAANLTISVRDSND  141
             R     F +++ TG++ T  PLDRE+   Y ++++A+D     P+++ A + ++V D ND
Sbjct  644   RLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVND  703

Query  142   NTPRFSSPRYTAY----------VPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHGKDAR  191
             N P+F  PR+  Y          +     K   +    ASD D+GDN+ I YRL      
Sbjct  704   NDPQFY-PRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEG  762

Query  192   RFGVDSRSGVVRALEDL--AMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQLFPCF  249
              F +D+RSG +    D   +M  +  Y+L + A D G   R    D +V +  +      
Sbjct  763   LFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQ--RRSQQDAIVEIVLKSKLEML  820

Query  250   GPGTET----RFTLREDAPE------GRVVTTLSASTPKTGPASELVFGMAGGNVGDSLR  299
               G        F + ED  +       R V  +   +      S + + +  G+   + R
Sbjct  821   ECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFR  880

Query  300   IEPRTGDVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVI----QLLVNVT--DANDNAP  353
             I+ R+G +  A   D E   +Y   +    S + S  +      Q +VN+   D NDNAP
Sbjct  881   IDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAP  940

Query  354   VMDMPNYNA---SVPEEDYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGE  410
             V  +   +    S+PE       +     +D D+G NS I+Y L N+ ++ F I   +G 
Sbjct  941   VFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGV  1000

Query  411   ISTNSMLDREKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTRL-FNVNVTE  469
             +     +  E  S   + + A D G P L+   ++ V + D ND+ P F    +  ++ E
Sbjct  1001  LYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPE  1060

Query  470   NSEIGTFVIRITTTDLDMEHNANVTYSFTE-NSSNKFTIDPISGNVTVAGNLDREVQDEY  528
              +++ T    +  TD+D+  N  ++Y   E N+   F + P  G + V   LDRE +D Y
Sbjct  1061  TTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP-DGYLFVRAPLDREERDYY  1119

Query  529   LLKVVATDRAWITET---PLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASD  585
              L V   D    + +   P+ I V D+NDN P+F   T+ F  PE       +G++ A D
Sbjct  1120  ALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVD  1179

Query  586   EDKLGANSDVSYSLLQPSDLFSIDPAMGDI-----YCKKTMRYKYTKSRASPE-------  633
              D +G N+++S++L   +  F+ID   G I     + ++ +      + AS E       
Sbjct  1180  RD-IGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGS  1238

Query  634   ---NVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVA  690
                N         DNG P L  K  V V + D N++AP+F    Y   + EG      + 
Sbjct  1239  MAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHIT  1298

Query  691   QFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKAT  750
                  D  D G+N ++ Y +  GN +  F ++  +G + + + + +  +  +  +   A 
Sbjct  1299  HVFTQD-ADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRL-DRESQEIHHLIVVAK  1356

Query  751   DKGV--PVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDSGP  808
             D  +  P+ S+    T++V  EN +AP F   S +V V E  P  T ++   A D+D G 
Sbjct  1357  DAALKHPLSSNA-SITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGV  1415

Query  809   NGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAVATL  868
             N  V + ISAGN R  F I  ITG++ + + LDY+ +T Y LNITA D G  S S     
Sbjct  1416  NSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLY  1475

Query  869   IVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTGK-  927
              V V D NDNPP F  +     + E  P +  +  V A D DS     + Y I     + 
Sbjct  1476  NVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQL  1535

Query  928   ---EYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIA---ANPDTNSQVVGATTVLVHITGV  981
                 +F I   TG+I +    D E ++ + L V+A   A P +  Q+     V V +  +
Sbjct  1536  PQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQP-SERQLSTEKLVTVIVEDI  1594

Query  982   NEFYPKFIQ---PVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRGFSI  1038
             N+  P F+     +     S S    T V  V A D D+ S+G V Y  V    +  F +
Sbjct  1595  NDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQEL-FKL  1653

Query  1039  GSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQI-IISIQDGNDP---PEF  1094
                TG+I+ +     + + R  LT+ + +        + E  I II+   G      P+F
Sbjct  1654  QRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQF  1713

Query  1095  LE-NLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIG--GNVGQAFKIDPQSGD  1151
              + +    SV E E  G+ ILTV A       +    + +  G  G V + F ID + G 
Sbjct  1714  EQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGI  1773

Query  1152  LETAKHLDRET-VQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVS  1210
             L TA  LDRE   + YE+ + AI  G  P+T  T V++ +LD ND+ P F     V  VS
Sbjct  1774  LSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVS  1833

Query  1211  ENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILKTTRSLDREATP  1270
             E+   G +I TL A DPD        ++ L+ G     + LE  +G L    +LDRE   
Sbjct  1834  EDLQIGHTISTLRAHDPD---TLGSVTFLLMDGHDGKFL-LEPSTGKLILNDTLDRETKS  1889

Query  1271  QLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSPSSPRSVHVKVYSFN  1317
             + +  + V D       +E   T+ V D ND+P         VYSF+
Sbjct  1890  KYELRIRVSDGVQ---YTEAYATIQVSDTNDNPP---LFEDTVYSFD  1930


 Score = 406 bits (1044),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 375/1382 (27%), Positives = 598/1382 (43%), Gaps = 117/1382 (8%)

Query  16    AGTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQ  75
             AG    +S   V I V+D ND+AP+F    +   + EN     +V    A DRD G NA+
Sbjct  1128  AGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAE  1187

Query  76    IRYSLLGDGAERFQVNSSTGEIVTLEPLDRE--------------------QHDVYHLTL  115
             + ++L     + F +++  G I TL P DRE                         ++ L
Sbjct  1188  LSFTL-SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLL  1246

Query  116   VAQDSSPTEPRAS-AANLTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDD  174
              A  S    PR      + + V D NDN P F    Y   + +  S+G  +      D D
Sbjct  1247  EATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDAD  1306

Query  175   EGDNSRIVYRL-HGKDARRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCG-SEPRAV  232
             EG N  + Y L  G +A +F +DS +G +     L    Q  + L + A D     P + 
Sbjct  1307  EGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSS  1366

Query  233   SVDL-VVHLWERQLFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAG  291
             +  + +V L E    P F   + +  ++ E +P G  +    AS    G  S++VF ++ 
Sbjct  1367  NASITIVVLDENDNAPEFTQSS-SEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISA  1425

Query  292   GNVGDSLRIEPRTGDVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDN  351
             GN  D+  I+  TG + +    DYE + SY   +   D G PSL + +   V V D NDN
Sbjct  1426  GNRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDN  1485

Query  352   APVMDMPNYNASVPEEDYPPSRVARVSAKDADSGENSEITYHLLNDFDEV-----FVIDE  406
              P+         + E     + +  V+A D DSG N +++Y +     ++     F I+ 
Sbjct  1486  PPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINT  1545

Query  407   FSGEISTNSMLDREKVSSYKLIVEAWDRGVP---RLTGTATVFVTVLDKNDNPPRFTRLF  463
              +G I T   +DRE + +++L V A DR  P   +L+    V V V D NDN P F  + 
Sbjct  1546  ETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMN  1605

Query  464   NV----NVTENSEIGTFVIRITTTDLDMEHNANVTYSFTENSSNKFTIDPISGNVTVAGN  519
                     + +    T V+++   D D   N  VTY         F +   +G +T    
Sbjct  1606  AAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPG  1665

Query  520   LDREVQDEYLLKVVATDRAWITE--------TPLTISVQDQNDNPPEFEKQT-----YYF  566
                + +  Y L + +TD A  +E        T +T        + P+FE+++      Y 
Sbjct  1666  PQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYE  1725

Query  567   HFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSDLFSIDPAMGDIYCKKTMRYKYT  626
             + P     +     + +++ +    N   + S  Q   LF ID  +G +     +     
Sbjct  1726  NEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAEL-----  1780

Query  627   KSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPSN  686
                A PE  Y   V A+  G  P +S+T V V ++D N+  P+F    +++ V E     
Sbjct  1781  DREAGPEE-YEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIG  1839

Query  687   KKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTIK  746
               ++   A D +  G    + + ++ G+    F +EP++G + +  ++ +  T + + ++
Sbjct  1840  HTISTLRAHDPDTLG---SVTFLLMDGHDGK-FLLEPSTGKLILNDTL-DRETKSKYELR  1894

Query  747   GKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDS  806
              + +D    V+  E +AT+ V+  N + P F    Y   +PEN      +  + A D+D 
Sbjct  1895  IRVSDG---VQYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADL  1951

Query  807   GPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAVA  866
             G N  + Y + +      FS++P TG +T+   LDY+ V  Y L + A+D G  S S   
Sbjct  1952  GQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTI  2011

Query  867   TLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTG  926
             T+  NV D+NDN P F+   Y + + EN P    V  V A DIDS    +I+Y I  G  
Sbjct  2012  TVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDV  2071

Query  927   KEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAAN-------------------------  961
                F I+ S G I+++   D E  + YTL V A +                         
Sbjct  2072  DSEFGID-SNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRK  2130

Query  962   ----------PDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQ  1011
                            ++     V + I  VN+  P FI       + E+  I T V  V+
Sbjct  2131  YQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFIS-ANETAIMENVAINTVVIAVK  2189

Query  1012  ATDQDAGSDGKVYYLF-------VGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVM  1064
             A D D G +G + YL        +G S+   FS+    G + +   LDRE ++  +L + 
Sbjct  2190  AVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNIT  2249

Query  1065  AKNAGGIRGNDTDEAQIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDV  1123
             A++ G      + E+Q++I I D ND  P F    Y ASV E  + G+ +L V A D D 
Sbjct  2250  ARDRG--EPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVD-  2306

Query  1124  RPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGS  1183
                N +  YSI+ G+    F I   +G +  AK+L+ E +  Y L + A D       G 
Sbjct  2307  EGANGRIRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGD  2366

Query  1184  TT-VKIELLDVNDNGPVFDFKEIVGYVSENE--PAGTSIMTLSATDPDLPPNGAPFSYRL  1240
             T  + I +LD+NDN P F     +  V EN   P G  ++T++A D D PP  +   Y L
Sbjct  2367  TAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFL  2426

Query  1241  IGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQN  1300
               G   DL  +   SG +   + LDRE   +    +   D+G+P L+    + V V D N
Sbjct  2427  KEGDS-DLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDIN  2485

Query  1301  DS  1302
             D+
Sbjct  2486  DN  2487


 Score = 401 bits (1031),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 368/1272 (29%), Positives = 588/1272 (46%), Gaps = 93/1272 (7%)

Query  73    NAQIRYSLL-GDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAAN  131
             N+ I Y ++ GD A+ F++++ +G I T  PLDRE+   Y LT++A  SS +   AS+ +
Sbjct  863   NSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVS  922

Query  132   -----LTISVRDSNDNTPRFSSPRY---TAYVPDTTSKGDFVFGAKASDDDEGDNSRIVY  183
                  + I++ D NDN P F+  R    T  +P+  + G  ++ ++  D D G NSRI Y
Sbjct  923   YGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISY  982

Query  184   RLHGKDARRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWER  243
              L     ++F +   +GV+     +     +   +++ A+D GS P +  + L V + + 
Sbjct  983   SLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADV  1042

Query  244   QLFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPR  303
                      T    +L E          L+A+    G    + + +  GN      + P 
Sbjct  1043  NDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFP-  1101

Query  304   TGDVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNAS  363
              G + + +  D E    Y   V  RD+G PS  SV+ ++++V D NDNAP      +  S
Sbjct  1102  DGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFS  1161

Query  364   VPEEDYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDRE---  420
             +PE     + V +++A D D G N+E+++ L +   + F ID  +G I T    DRE   
Sbjct  1162  IPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQD-FTIDTRNGFIKTLRPFDREALV  1220

Query  421   KVSSYK-----------------LIVEAW--DRGVPRLTGTATVFVTVLDKNDNPPRFTR  461
             KVS                    +++EA   D G+PRL     V V V D NDN P F R
Sbjct  1221  KVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLR  1280

Query  462   L-FNVNVTENSEIGTFVIRITTTDLDMEHNANVTYSFTE-NSSNKFTIDPISGNVTVAGN  519
               ++V ++E +  GT +  + T D D   N +V YS  + N + +F +D  +G +++   
Sbjct  1281  APYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRR  1340

Query  520   LDREVQDEYLLKVVATDRAWI----TETPLTISVQDQNDNPPEFEKQTYYFHFPELQEKM  575
             LDRE Q+ + L VVA D A      +   +TI V D+NDN PEF + +      E     
Sbjct  1341  LDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTG  1400

Query  576   AHIGQVVASDEDKLGANSDVSYSLLQPS--DLFSIDPAMGDIYCKKTMRYKYTKSRASPE  633
               + +  ASD D+ G NS V +S+   +  D F ID   G +Y  K + Y+   S     
Sbjct  1401  TELMRFRASDADQ-GVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPLDYEDITS-----  1454

Query  634   NVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFV  693
               Y+  + A D G P LS+  L  V +VD N++ P F   A +  + EG P    +   V
Sbjct  1455  --YTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVT-V  1511

Query  694   ASDREDFGVNAEIEYFIVAGN----GSDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKA  749
              +D  D G+N ++ Y I           +F +   +G I+  + +   +  T F +   A
Sbjct  1512  TADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDT-FRLTVVA  1570

Query  750   TDKGVPVR---SDEIWATLIVTGENKHAPAFAAVSYQVRVPE---NEPANTTILTVNAVD  803
             TD+  P     S E   T+IV   N +AP F +++  +  P+   ++ ++T ++ V+A D
Sbjct  1571  TDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKD  1630

Query  804   SDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKS  863
             +DS  NG+V YEI +G +   F +   TG IT      +     Y+L + + D    S+ 
Sbjct  1631  ADSSSNGLVTYEIVSGPQEL-FKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSER  1689

Query  864   AVATLIVNV-----SDVNDNPPKFNQ-SLYQAYLPENSPSQHFVFKVVATDIDSP-KYSV  916
               + + + +          + P+F Q S     + EN P    +  V A    +  +Y V
Sbjct  1690  RSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEYFV  1749

Query  917   IQYRIIGGTGK--EYFNIEQSTGIIKSKTTFDYEE-VNEYTLDVIA----ANPDTNSQVV  969
                   G  G+    F+I+   GI+ +    D E    EY ++V A      P T+    
Sbjct  1750  TNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSR---  1806

Query  970   GATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVG  1029
               T V V +   N+  P+F+   F  +VSE  +IG  +  ++A D D  + G V +L + 
Sbjct  1807  --TKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPD--TLGSVTFLLM-  1861

Query  1030  SSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQIIISIQDGN  1089
               +D  F +   TG + ++  LDRET+++  L +   +     G    EA   I + D N
Sbjct  1862  DGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD-----GVQYTEAYATIQVSDTN  1916

Query  1090  D-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGGNVGQAFKIDPQ  1148
             D PP F + +Y   +PE    G ++  + A D D+  QN Q SY ++       F ++PQ
Sbjct  1917  DNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADL-GQNAQLSYGVVSDWANDVFSLNPQ  1975

Query  1149  SGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGY  1208
             +G L     LD E VQ Y LI+ A D G P  + + TV   +LD+NDN P+FD       
Sbjct  1976  TGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSE  2035

Query  1209  VSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILKTTRSLDREA  1268
             V EN P  T ++T+SA D D   NG    Y +  G  +D       +G ++T R+LDRE 
Sbjct  2036  VFENVPIATEVVTVSAKDIDSGNNGL-IEYSITAG-DVDSEFGIDSNGTIRTRRNLDREH  2093

Query  1269  TPQLDFLVEVED  1280
                    V   D
Sbjct  2094  RSTYTLTVTARD  2105


 Score = 393 bits (1010),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 384/1393 (28%), Positives = 607/1393 (44%), Gaps = 128/1393 (9%)

Query  9     VAFLVVVAGTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDR  68
             V  +   AG+ PL+S  S+ +L+ DVNDH P F    Y   + E   V        ATD 
Sbjct  1017  VELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDI  1076

Query  69    DDGLNAQIRYSLLGDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEP-RA  127
             D G N +I Y ++    ER       G +    PLDRE+ D Y LT+  +D+   +P R+
Sbjct  1077  DLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAG--QPSRS  1134

Query  128   SAANLTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHG  187
             S   + I V D NDN P+F++  +T  +P+      FV    A D D G N+ + + L  
Sbjct  1135  SVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSS  1194

Query  188   KDARRFGVDSRSGVVRAL-------------------EDLAMGGQ---NTYQLQIEASDC  225
             +  + F +D+R+G ++ L                   ED ++ G    N   L+   SD 
Sbjct  1195  Q-TQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDN  1253

Query  226   GSEPR---AVSVDLVVHLWERQLFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPA  282
             G  PR    V V ++V        P F        T+ E A EG  +T +       G  
Sbjct  1254  GI-PRLQDKVKVKVIVTDVNDNA-PEF-LRAPYHVTISEGASEGTHITHVFTQDADEGLN  1310

Query  283   SELVFGMAGGNVGDSLRIEPRTGDVVIASGFDYETLPSYEAWVEVRDSG-NPSLRSVIQL  341
              ++ + +A GN      ++  TG + +    D E+   +   V  +D+     L S   +
Sbjct  1311  GDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASI  1370

Query  342   LVNVTDANDNAPVMDMPNYNASVPEEDYPPSRVARVSAKDADSGENSEITYHL-LNDFDE  400
              + V D NDNAP     +   SV E     + + R  A DAD G NS++ + +   +  +
Sbjct  1371  TIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRD  1430

Query  401   VFVIDEFSGEISTNSMLDREKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFT  460
              F ID  +G +  +  LD E ++SY L + A D G P L+ T    V V+D NDNPP F 
Sbjct  1431  TFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFP  1490

Query  461   RLFNV-NVTENSEIGTFVIRITTTDLDMEHNANVTYSFTEN-----SSNKFTIDPISGNV  514
                 V  + E   + T ++ +T  D D   N  V+Y+ ++          F I+  +G +
Sbjct  1491  STAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVI  1550

Query  515   TVAGNLDREVQDEYLLKVVATDRA------WITETPLTISVQDQNDNPPEFEKQTYYFHF  568
                  +DRE  D + L VVATDRA        TE  +T+ V+D NDN P F         
Sbjct  1551  HTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILP  1610

Query  569   PELQEKMAH---IGQVVASDEDKLGANSDVSYSLLQ-PSDLFSIDPAMGDIYCKKTMRYK  624
             P+          + QV A D D   +N  V+Y ++  P +LF +    G I      ++K
Sbjct  1611  PKFSTSKGSSTAVMQVHAKDADS-SSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFK  1669

Query  625   YTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVD-----ANNHAPKFEHRAYL-WP  678
                     E  Y   + + D         + VY+ I+      + +  P+FE R+ L   
Sbjct  1670  Q-------EVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGS  1722

Query  679   VPEGYPSNKKVAQFVASDREDFGVNAEIEYFI--VAGNGS-----DYFYVEPNSGWIYIK  731
             V E  P    +    A        +AEIEYF+  V   GS       F ++   G +   
Sbjct  1723  VYENEPIGTSILTVTA-----HLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTA  1777

Query  732   KSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEP  791
               +        + ++  A   G   R+      + V  +N   P F    +   V E+  
Sbjct  1778  AELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQ  1837

Query  792   ANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLN  851
                TI T+ A D D+   G V + +  G++  +F + P TG + + + LD +T ++Y+L 
Sbjct  1838  IGHTISTLRAHDPDTL--GSVTFLLMDGHD-GKFLLEPSTGKLILNDTLDRETKSKYELR  1894

Query  852   ITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDS  911
             I   D G     A AT  + VSD NDNPP F  ++Y   +PEN+   + V ++VA D D 
Sbjct  1895  IRVSD-GVQYTEAYAT--IQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADL  1951

Query  912   PKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTNSQVVGA  971
              + + + Y ++     + F++   TG++      DYEEV  Y L ++ A  +    +   
Sbjct  1952  GQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYIL-IVQAQDNGQPSLSTT  2010

Query  972   TTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSS  1031
              TV  ++  +N+  P F    +  +V E+  I T V  V A D D+G++G + Y      
Sbjct  2011  ITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGD  2070

Query  1032  NDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGG--IRGNDTDEAQ---------  1080
              D  F I S  G I   R LDRE ++   LTV A++        ++ +E Q         
Sbjct  2071  VDSEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPR  2129

Query  1081  -----------------------IIISIQDGNDPPEFLENLYEASVPEGENTGSKILTVR  1117
                                    + I I+D ND      +  E ++ E     + ++ V+
Sbjct  2130  KYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVK  2189

Query  1118  AVDKDVRPQNNQFSYSIIGG---NVGQA----FKIDPQSGDLETAKHLDRETVQSYELII  1170
             AVD D   +N    Y +      ++GQ+    F ++P  G L     LDRE   SY L I
Sbjct  2190  AVDND-EGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNI  2248

Query  1171  GAIDTGSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLP  1230
              A D G PPQ+  + + I +LD NDN PVFD K+    V+EN   G  ++ +SATD D  
Sbjct  2249  TARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEG  2308

Query  1231  PNGAPFSYRLIGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEH  1290
              NG    Y ++ G Q     + + +G+++  ++L+ E   +    V  ED      + + 
Sbjct  2309  ANGR-IRYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDT  2367

Query  1291  A-ITVHVLDQNDS  1302
             A +T+++LD ND+
Sbjct  2368  AELTINILDINDN  2380


 Score = 377 bits (968),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 381/1406 (27%), Positives = 610/1406 (43%), Gaps = 126/1406 (9%)

Query  27    VRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQI-RYSLL-GDG  84
             VRI VLDVND++PEF          E+   G  +    ATD D G N    +Y ++ G+ 
Sbjct  142   VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNV  201

Query  85    AERFQV--------NSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAANLTISV  136
               +F++        ++S   + T   LDRE    Y L + A+D   + PR     + +++
Sbjct  202   DNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGG-SPPRFGYLQVNVTI  260

Query  137   RDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHGKDARRFGVD  196
              D NDN P F    Y   + +T   G  V    ASD+D GDNS+I Y L  +   +F V+
Sbjct  261   LDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL-AETEHQFTVN  319

Query  197   SRSGVVRALEDL---------AMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQ---  244
               +GV+   E +         +   Q +    + A D GS  +     + V+L +     
Sbjct  320   PETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHD  379

Query  245   --LFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEP  302
               +   F P      T+ E+A  G VV  ++     +G        +  GN     R+E 
Sbjct  380   PIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEE  439

Query  303   RTG-DVVIASG-FDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNY  360
                  +V  +G  D E +  Y   V   D G P+  +   L+++V D ND+ PV +   Y
Sbjct  440   AADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEY  499

Query  361   NASVPEEDYPPSRVARVSAKDADSGENSEITYHLLNDFD-EVFVIDEFSGEISTNSMLDR  419
             +A + E     S VA ++A D D+G N+++ Y +L+  + + F +D  +G I T   LDR
Sbjct  500   SAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDR  559

Query  420   EKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFT-RLFNVNVTENSEIGTFVI  478
             E   + +L + A D G         + V +LD+ND  P+F+ R  NV + E++   T V 
Sbjct  560   EIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVA  619

Query  479   RITTTDLDMEHNANVTYSFTENSSN----KFTIDPISGNVTVAGNLDREVQDEYLLKVVA  534
              +T TD D   N +VT++   +       +F +D ++G +T    LDRE   +Y + V+A
Sbjct  620   LMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIA  679

Query  535   TDRAWITETPLT----ISVQDQNDNPPEFEKQTYYFHFPELQ---------EKMAHIGQV  581
              D+   T    T    ++V D NDN P+F  + Y +   +           EK   +  V
Sbjct  680   RDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHV  739

Query  582   VASDEDKLGANSDVSYSLLQPSD-LFSIDPAMGDIYCK----KTMRYKYTKSRASPENVY  636
              ASD+D  G N+ + Y L    + LF +D   G I  +     +M +K       P   Y
Sbjct  740   TASDKDD-GDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWK-------PH--Y  789

Query  637   SFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRA--YLWPVPEGYPS------NKK  688
                V A D G+       +V + +          + +A  Y + + E +        N++
Sbjct  790   KLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNRE  849

Query  689   VAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSM-----AEFNTGTVF  743
             V   V     +   N+ IEY I+ G+ +  F ++  SG I   + +     A +    + 
Sbjct  850   VG-IVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILA  908

Query  744   TIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFA---AVSYQVRVPENEPANTTILTVN  800
             +    ++     V   +    + +   N +AP FA        + +PEN      I    
Sbjct  909   SSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSR  968

Query  801   AVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFA  860
               D D+G N  + Y ++  N   +F I P+TG + +   +  +  +   + + A D G  
Sbjct  969   VRDRDAGVNSRISYSLT-NNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSP  1027

Query  861   SKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYR  920
               S+  +L V ++DVND+ P F+ + Y+  LPE +      F + ATDID      I Y 
Sbjct  1028  PLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYE  1087

Query  921   IIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVI---AANPDTNSQVVGATTVLVH  977
             II G  +  F +    G +  +   D EE + Y L V    A  P  +S V     V++H
Sbjct  1088  IIEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVV----PVVIH  1142

Query  978   ITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRGFS  1037
             +   N+  P+F    F   + E+A   TFVG + A D+D G + ++   F  SS  + F+
Sbjct  1143  VIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELS--FTLSSQTQDFT  1200

Query  1038  IGSETGVISISRRLDRETQNRAILTVMAKNA------GGIRGNDT---------------  1076
             I +  G I   R  DRE      L  +++NA      G +RG+                 
Sbjct  1201  IDTRNGFIKTLRPFDREA-----LVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGI  1255

Query  1077  ----DEAQIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFS  1131
                 D+ ++ + + D ND  PEFL   Y  ++ EG + G+ I  V   D D    N    
Sbjct  1256  PRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDAD-EGLNGDVY  1314

Query  1132  YSIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTG-SPPQTGSTTVKIEL  1190
             YS+  GN    F +D  +G L   + LDRE+ + + LI+ A D     P + + ++ I +
Sbjct  1315  YSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVV  1374

Query  1191  LDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVH  1250
             LD NDN P F        V E  P GT +M   A+D D   N +   + +  G + D  H
Sbjct  1375  LDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVN-SQVVFSISAGNRRDTFH  1433

Query  1251  LEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSPSSPRSVH  1310
             ++  +G L   + LD E        +   D GTP LS+     V V+D ND+P    S  
Sbjct  1434  IDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTA  1493

Query  1311  VKVYSFNGQTPLGK-IADVHPNDPDT  1335
             + V       PL   I  V  +DPD+
Sbjct  1494  I-VRQIKEGIPLKTPIVTVTADDPDS  1518


 Score = 375 bits (962),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 381/1386 (27%), Positives = 626/1386 (45%), Gaps = 72/1386 (5%)

Query  17    GTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQI  76
             G  P ++   + I +LD ND++P F  ++Y A V EN ++GA V    ATD D+G N +I
Sbjct  2254  GEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRI  2313

Query  77    RYSL-LGDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAANLTIS  135
             RYS+ LGD    F ++  TG +   + L+ E+   Y LT+ A+D +   P    A LTI+
Sbjct  2314  RYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTIN  2373

Query  136   VRDSNDNTPRFSSPRYTAYVPDTT--SKGDFVFGAKASDDDEGD-NSRIVYRLHGKDARR  192
             + D NDN P F    Y A V + T    G +V    A D D    NS++ Y L   D+  
Sbjct  2374  ILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDL  2433

Query  193   FGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWE-RQLFPCFGP  251
             F +++ SG +  L+ L    Q+ Y L + A D GS P   +  + V + +     P F  
Sbjct  2434  FRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFEL  2493

Query  252   GTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVVIAS  311
              +    T+RE+ P G  V T  A+    G  ++L F + G ++     I+  TG++  A+
Sbjct  2494  QS-YHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHM-HRFHIDSETGEISTAT  2551

Query  312   GFDYETLPSYEAWVEVRDSGNPSLR-SVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYP  370
               D E    Y   +  +DS     R S + L ++V+D NDN P  D   YN +VPE    
Sbjct  2552  TLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISK  2611

Query  371   PSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDREKVS----SYK  426
                V    A D D GEN+ + Y +       F I+  +G +ST   L  +  S    +Y 
Sbjct  2612  GEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYT  2671

Query  427   LIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTRLFNVN--VTENSEIGTFVIRITTTD  484
             +++ A D+G   L+  A + V +L   +  P F  + N +  ++E+   G  + +++ T 
Sbjct  2672  IVISAMDQGEQSLSSKAELTV-ILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATS  2730

Query  485   LDMEHNANVTYSFTEN-SSNKFTIDPISGNVTVAGN-LDREVQDEYLLKVVATDR---AW  539
                     + Y+       +   +DP SG ++V  + LD E+   Y + + A D    + 
Sbjct  2731  PKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSL  2790

Query  540   ITETPLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSL  599
              + T +T++V D NDN P  E+  Y     E +     I  V ASD D  G N +V Y L
Sbjct  2791  RSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDS-GDNGNVIYRL  2849

Query  600   LQPSD-LFSIDPAMGDIYCKKTMRYKYTKSRASPENV--YSFYVVAMDNGKPPLSSKTLV  656
                 D  F I  + G+I         YT+ R   E +  Y+F V A+D G P ++    V
Sbjct  2850  QNDFDGTFEITES-GEI---------YTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASV  2899

Query  657   YVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGS  716
              ++++D N++ PKF  R +   V E       V +  +SD  D G NA   Y   + N  
Sbjct  2900  LLHLLDKNDNPPKFT-RLFSLNVTENAEIGSFVIRVTSSDL-DLGANANASYSF-SENPG  2956

Query  717   DYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPA  776
             + F +EP SG I +   + +      + +K  A+D        E   T+ +  +N +AP 
Sbjct  2957  EKFRIEPQSGNITVAGHL-DREQQDEYILKVVASDGAWRA---ETPITITIQDQNDNAPE  3012

Query  777   FAAVSYQVRVPENEPANTTILTVNAVDSD-SGPNGMVRYEISAGNERHEFSIHPITGAIT  835
             F    Y    PE + +   +  + A D D  GPN ++ Y +   +    FSI P TG + 
Sbjct  3013  FEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPM--FSIDPATGEVF  3070

Query  836   ILEALDYDTV-------TEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQ  888
               +A+ +            Y L + A D G     +   + +N+ D ++NPPKF Q+ Y 
Sbjct  3071  SKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYL  3130

Query  889   AYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYE  948
             A LP+++     + +V A D      + + Y ++       F++ +  G I         
Sbjct  3131  APLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVP  3190

Query  949   EVNEYTLDVIAANPDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVG  1008
                 Y L V A +     Q    T V++ +TG N   P+F    + + V E+  +G+ + 
Sbjct  3191  PNTRYELVVRATDRGVPPQ-SDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTIL  3249

Query  1009  LVQATDQDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNA  1068
              V ATD D G +G + Y   G +  + FS+   TG I I ++LD +      L +  ++ 
Sbjct  3250  TVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDL  3309

Query  1069  GGIRGNDTDEAQIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQN  1127
             G      +  A + I + D ND PP F    Y   +PE +  G+ +    A DKD  P+N
Sbjct  3310  G--YHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKD-SPKN  3366

Query  1128  NQFSYSIIGGNVGQAFKIDPQS-GDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTV  1186
                 Y+ +     + F I  QS G + +A   D E  + Y L I A +  S  ++ +  +
Sbjct  3367  AIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYA-NL  3425

Query  1187  KIELLDVNDNGPVFDFKEIVGY-VSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQ  1245
              + +L VN+  P F  + +  + VSE    GT +  + ATD D   +G  + Y L+G   
Sbjct  3426  YVHVLGVNEFYPQF-LQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVY-YLLVGSSN  3483

Query  1246  MDLVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRL--SSEHAITVHVLDQNDSP  1303
                  ++ ++G++   R LDRE   ++   V  ++ G+ R   + E  + + + D ND P
Sbjct  3484  DKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGNDPP  3543

Query  1304  SSPRSVHVKVYSFNGQTPLG-KIADVHPNDPDT---SGDYTCRILQGSAGPLNIPAACDL  1359
                +  H    + +   P+G K+  V   D D    +  ++  I+ G+   L      D+
Sbjct  3544  EFIK--HYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGN---LKQSFKIDV  3598

Query  1360  HAGKIT  1365
               G+I+
Sbjct  3599  QTGEIS  3604


 Score = 367 bits (941),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 379/1364 (28%), Positives = 609/1364 (45%), Gaps = 108/1364 (8%)

Query  20    PLTSSGSVRILVLDVNDHAPEFGRQEY---------RAEVMENLAVGAWVANPLATDRDD  70
             P +++ +V + V DVND+ P+F  + Y           ++ + +     + +  A+D+DD
Sbjct  687   PQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDD  746

Query  71    GLNAQIRYSLLGDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAA  130
             G NA I Y L   G   FQ+++ +G I          H   H  L+       + R+   
Sbjct  747   GDNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQD  806

Query  131   NLTISVRDSNDNTPRFSSPRYTAY----VPD----TTSKGDFVFGAKASDDDEGD-NSRI  181
              +   V  S          +   Y    V D      S+ +   G        G  NS I
Sbjct  807   AIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHI  866

Query  182   VYRL-HGKDARRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSV----DL  236
              Y +  G  A+ F +D+RSG +     L    Q  Y+L I AS   S   A S       
Sbjct  867   EYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQC  926

Query  237   VVHLWERQL---FPCFGPGTETR--FTLREDAPEGRVVTTLSASTPKTGPASELVFGMAG  291
             +V++    L    P F    E+    +L E+A  G+ +          G  S + + +  
Sbjct  927   IVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTN  986

Query  292   GNVGDSLRIEPRTGDVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDN  351
              N     RI P TG + +      E        +   D+G+P L S + L V + D ND+
Sbjct  987   -NPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDH  1045

Query  352   APVMDMPNYNASVPEEDYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEI  411
              PV D  +Y  S+PE     +R   ++A D D G+N  I+Y ++    E        G +
Sbjct  1046  TPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYL  1105

Query  412   STNSMLDREKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTR-LFNVNVTEN  470
                + LDRE+   Y L V   D G P  +    V + V+D+NDN P+FT   F  ++ EN
Sbjct  1106  FVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFTNSTFTFSIPEN  1165

Query  471   SEIGTFVIRITTTDLDMEHNANVTYSFTENSSNKFTIDPISGNVTVAGNLDREVQ-----  525
             +   TFV ++T  D D+  NA ++++ +  + + FTID  +G +      DRE       
Sbjct  1166  APADTFVGKLTAVDRDIGRNAELSFTLSSQTQD-FTIDTRNGFIKTLRPFDREALVKVSR  1224

Query  526   -----------------DEYLLKVVATDRA---WITETPLTISVQDQNDNPPEFEKQTYY  565
                              +  LL+   +D        +  + + V D NDN PEF +  Y+
Sbjct  1225  NAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYH  1284

Query  566   FHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSDL--FSIDPAMGDIYCKKTMRY  623
                 E   +  HI  V   D D+ G N DV YSL + ++   F++D A G +   + +  
Sbjct  1285  VTISEGASEGTHITHVFTQDADE-GLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRL--  1341

Query  624   KYTKSRASPENVYSFYVVAMDNG-KPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEG  682
                  R S E ++   VVA D   K PLSS   + + ++D N++AP+F   +    V E 
Sbjct  1342  ----DRESQE-IHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLET  1396

Query  683   YPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTV  742
              P+  ++ +F ASD  D GVN+++ + I AGN  D F+++  +G +Y+ K + ++   T 
Sbjct  1397  SPTGTELMRFRASD-ADQGVNSQVVFSISAGNRRDTFHIDSITGSLYLHKPL-DYEDITS  1454

Query  743   FTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAV  802
             +T+   A+D G P  S  +   ++V  +N + P F + +   ++ E  P  T I+TV A 
Sbjct  1455  YTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTAD  1514

Query  803   DSDSGPNGMVRYEISAGNE-----RHEFSIHPITGAITILEALDYDTVTEYKLNITARDL  857
             D DSG NG V Y IS         RH F I+  TG I  L  +D +++  ++L + A D 
Sbjct  1515  DPDSGLNGKVSYAISKQEPQLPQGRH-FGINTETGVIHTLREIDRESIDTFRLTVVATDR  1573

Query  858   GFASKSAVAT---LIVNVSDVNDNPPKFNQSLYQAYLP----ENSPSQHFVFKVVATDID  910
                S+  ++T   + V V D+NDN P F  S+  A LP     +  S   V +V A D D
Sbjct  1574  AQPSERQLSTEKLVTVIVEDINDNAPVF-VSMNAAILPPKFSTSKGSSTAVMQVHAKDAD  1632

Query  911   SPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTNSQVVG  970
             S    ++ Y I+ G  +E F ++++TGII       +++   Y L + + +    S+   
Sbjct  1633  SSSNGLVTYEIVSGP-QELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRS  1691

Query  971   ATTVLVHIT----GVNEFYPKFIQ-PVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYY  1025
             +   +  IT    G     P+F Q       V E+  IGT   ++  T   A ++ + + 
Sbjct  1692  SEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGT--SILTVTAHLASAEIEYFV  1749

Query  1026  LFVGSSNDRG-----FSIGSETGVISISRRLDRETQNRAI-LTVMAKNAGGIRGNDTDEA  1079
               V ++  RG     F I ++ G++S +  LDRE       + V A   GG     T   
Sbjct  1750  TNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGG--QPRTSRT  1807

Query  1080  QIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGGN  1138
             ++ +++ D ND PP+FL+  +  +V E    G  I T+RA D D        ++ ++ G+
Sbjct  1808  KVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTL---GSVTFLLMDGH  1864

Query  1139  VGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGP  1198
              G+ F ++P +G L     LDRET   YEL I   D     Q       I++ D NDN P
Sbjct  1865  DGK-FLLEPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPP  1920

Query  1199  VFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGIL  1258
             +F+       + EN   G  +  + A D DL  N A  SY ++     D+  L   +G+L
Sbjct  1921  LFEDTVYSFDIPENAQRGYQVGQIVARDADLGQN-AQLSYGVVSDWANDVFSLNPQTGML  1979

Query  1259  KTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDS  1302
               T  LD E       +V+ +D+G P LS+   +  +VLD ND+
Sbjct  1980  TLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDN  2023


 Score = 290 bits (742),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 331/1209 (27%), Positives = 521/1209 (43%), Gaps = 127/1209 (11%)

Query  287   FGMAGGNVGDSLRIEPR---TGD-----VVIASGFDYETLPSYEAWVEVRDSGNPSLRSV  338
             + +  GNV +  R+      +GD     +      D E+  SY+  +  RD G+P     
Sbjct  194   YEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGY  253

Query  339   IQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSRVARVSAKDADSGENSEITYHLLNDF  398
             +Q+ V + D NDN P+ D  +YN S+ E   P + V  V A D D G+NS+ITY+L  + 
Sbjct  254   LQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA-ET  312

Query  399   DEVFVIDEFSGEISTNSMLDREKVSSYK---------LIVEAWDRGVPRLTGTATVFVTV  449
             +  F ++  +G IST   ++  + ++ K           V A D G PR  G   V V +
Sbjct  313   EHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNL  372

Query  450   LDKNDNPPRFT-RLFN-----VNVTENSEIGTFVIRITTTDLDMEHNANVTYSFTE-NSS  502
             LD ND+ P  + R F        V EN+  GT V  +   D D   N   +      N  
Sbjct  373   LDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNEL  432

Query  503   NKFTIDPISG--NVTVAGNLDREVQDEYLLKVVATDR---AWITETPLTISVQDQNDNPP  557
               F ++  +    V V G LDRE   +Y L VVA D+   A  T   L I V D ND+ P
Sbjct  433   GHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEP  492

Query  558   EFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSDL--FSIDPAMGDI  615
              FEK  Y     EL    + +  + A+DED  G N+ V Y +L  ++L  FS+DP  G I
Sbjct  493   VFEKSEYSAVLSELAPTGSFVASITATDEDT-GVNAQVHYDILSGNELKWFSMDPLTGLI  551

Query  616   YCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAY  675
                  +  +         +     + A D G  P  + T + V I+D N+ AP+F  R  
Sbjct  552   VTTGPLDREI-------RDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQ  604

Query  676   LWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDY---FYVEPNSGWIYIKK  732
                + E  P    VA   A+D  D G N  + + +       Y   F ++  +G +  ++
Sbjct  605   NVTLGEDAPPQTIVALMTATD-HDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRR  663

Query  733   SMAEFNTGTVFTIKGKATDKGVPV---RSDEIWATLIVTGENKHAPAF---------AAV  780
              + +    + + I   A D+G P     +  +W  L V   N + P F         A  
Sbjct  664   PL-DREKMSQYEISVIARDQGAPTPQSATATVW--LNVADVNDNDPQFYPRHYIYSLADD  720

Query  781   SYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITIL--E  838
                +++ +       +L V A D D G N ++ Y + +G E   F +   +GAI++    
Sbjct  721   DDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE-GLFQLDARSGAISLRGDA  779

Query  839   ALDYDTVTEYKLNITARDLG--FASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPE---  893
                      YKL ++ARD G   + + A+  +++          +     Y+  + E   
Sbjct  780   PASMHWKPHYKLLVSARDAGQRRSQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHE  839

Query  894   ---NSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEV  950
                NS     V  V     +    S I+Y II G   + F I+  +G I +    D EE 
Sbjct  840   QQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQ  899

Query  951   NEYTLDVIAANPDTNSQVV-----GATTVLVHITGVNEFYPKFI-----QPVFHMDVSES  1000
               Y L ++A++  ++S        G   V + I  +N+  P F      +P   + + E+
Sbjct  900   ANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPT--ISLPEN  957

Query  1001  AEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAI  1060
             A +G  + L +  D+DAG + ++ Y    + N + F IG  TGV+ + R +  E  +   
Sbjct  958   AAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQ-FRIGPVTGVLYLQRPIRAEPGSLIH  1016

Query  1061  LTVMAKNAGGIRGNDTDEAQIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAV  1119
             + +MA +AG    +      ++I+  D ND  P F    YE S+PE     ++   + A 
Sbjct  1017  VELMATDAGSPPLSSKLSLSVLIA--DVNDHTPVFDHTSYETSLPETTKVNTRFFALAAT  1074

Query  1120  DKDVRPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPP  1179
             D D+   N + SY II GN  + F + P  G L     LDRE    Y L +   D G P 
Sbjct  1075  DIDL-GDNGRISYEIIEGNTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPS  1132

Query  1180  QTGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYR  1239
             ++    V I ++D NDN P F        + EN PA T +  L+A D D+  N A  S+ 
Sbjct  1133  RSSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRN-AELSFT  1191

Query  1240  LIGGKQMDLVHLEKHSGILKTTRSLDREATPQLD--------------------FLVE--  1277
             L    Q     ++  +G +KT R  DREA  ++                      L+E  
Sbjct  1192  L--SSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEAT  1249

Query  1278  VEDSGTPRLSSEHAITVHVLDQND-SPSSPRS-VHVKVYSFNGQTPLGKIADVHPNDPD-  1334
             V D+G PRL  +  + V V D ND +P   R+  HV +    G +    I  V   D D 
Sbjct  1250  VSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISE--GASEGTHITHVFTQDADE  1307

Query  1335  -TSGDYTCRILQGS-AGPLNIPAACDLHAGKITPGIGYSLSVSGNDGRHPDVVSK-VSLE  1391
               +GD    + +G+ AG  N+ +A     G+++  +G  L     +  H  VV+K  +L+
Sbjct  1308  GLNGDVYYSLAKGNEAGQFNLDSA----TGQLS--LGRRLDRESQEIHHLIVVAKDAALK  1361

Query  1392  FLTFSNATV  1400
                 SNA++
Sbjct  1362  HPLSSNASI  1370


 Score = 285 bits (728),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 297/1067 (28%), Positives = 485/1067 (45%), Gaps = 86/1067 (8%)

Query  300   IEPRTGDVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPN  359
             ++P TG+V      D E +  +   V +  S  P+    I++ + V D NDN+P    P+
Sbjct  105   LDPVTGEVKTNVVLDREGMRDHYDLVVL--SSQPTYP--IEVRIKVLDVNDNSPEFPEPS  160

Query  360   YNASVPEEDYPPSRVARVSAKDADSGENS-----EITYHLLNDFDEVFVIDEFSGEIS--  412
                S  E     +R+   +A DAD GEN      EI    +++   +      SG+ S  
Sbjct  161   IAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYL  220

Query  413   ---TNSMLDREKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTRL-FNVNVT  468
                T   LDRE   SY+L + A D G P   G   V VT+LD NDNPP F    +NV++ 
Sbjct  221   HLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLN  280

Query  469   ENSEIGTFVIRITTTDLDMEHNANVTYSFTENSSNKFTIDPISGNVTVAGNLD-------  521
             E +  GT V+ +  +D D+  N+ +TY   E + ++FT++P +G ++    ++       
Sbjct  281   ETALPGTPVVTVMASDNDLGDNSKITYYLAE-TEHQFTVNPETGVISTTERVNCPQQTNV  339

Query  522   --REVQDEYLLKVVATDRAWITE---TPLTISVQDQNDNPPEFEKQTYYFHFPE-----L  571
                  Q   +  V A D     +   T +T+++ D ND+ P       +  FP+      
Sbjct  340   KSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIIS----FRFFPDGGKVAT  395

Query  572   QEKMAHIGQVVAS----DEDKLGANSDVSYSLLQPSDL--FSIDPAMGDIYCKKTMRYKY  625
              ++ A  G VVA+    D D  G N   S  ++  ++L  F ++ A  D++    +R   
Sbjct  396   VDENAVNGTVVAAVAVKDSDS-GLNGRTSVRIVSGNELGHFRLEEA-ADLHI---VRVNG  450

Query  626   TKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPS  685
                R      Y+  VVAMD G P  ++   + +++ D N+H P FE   Y   + E  P+
Sbjct  451   VLDREEIGK-YNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPT  509

Query  686   NKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTI  745
                VA   A+D ED GVNA++ Y I++GN   +F ++P +G I     +      TV  +
Sbjct  510   GSFVASITATD-EDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTV-EL  567

Query  746   KGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSD  805
                A D G   +       +I+  EN  AP F+     V + E+ P  T +  + A D D
Sbjct  568   SISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHD  627

Query  806   SGPNGMVRYEISAGNER---HEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFAS-  861
              G NG V + ++   ER    +F++  +TG +T    LD + +++Y++++ ARD G  + 
Sbjct  628   QGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTP  687

Query  862   KSAVATLIVNVSDVNDNPPKFNQSLY---------QAYLPENSPSQHFVFKVVATDIDSP  912
             +SA AT+ +NV+DVNDN P+F    Y            L +    +  +  V A+D D  
Sbjct  688   QSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDG  747

Query  913   KYSVIQYRIIGGTGKEYFNIEQSTGII--KSKTTFDYEEVNEYTLDVIA-------ANPD  963
               ++I+YR+  G G+  F ++  +G I  +            Y L V A       +  D
Sbjct  748   DNALIEYRLESG-GEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQD  806

Query  964   TNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKV  1023
                ++V  + + +   G  +      Q V   +   +++    VG+VQ    +  ++  +
Sbjct  807   AIVEIVLKSKLEMLECGQAQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHI  866

Query  1024  YYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTD----EA  1079
              Y  +     + F I + +G I+ +R LDRE Q    LT++A ++       +     + 
Sbjct  867   EYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQC  926

Query  1080  QIIISIQDGND-PPEFL---ENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSII  1135
              + I+I D ND  P F    E+    S+PE    G +I   R  D+D    N++ SYS+ 
Sbjct  927   IVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDA-GVNSRISYSLT  985

Query  1136  GGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVND  1195
               N  Q F+I P +G L   + +  E      + + A D GSPP +   ++ + + DVND
Sbjct  986   -NNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVND  1044

Query  1196  NGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHS  1255
             + PVFD       + E     T    L+ATD DL  NG   SY +I G    +  +    
Sbjct  1045  HTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGR-ISYEIIEGNTERMFGVFP-D  1102

Query  1256  GILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDS  1302
             G L     LDRE        V   D+G P  SS   + +HV+D+ND+
Sbjct  1103  GYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDN  1149


 Score = 255 bits (651),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 266/968 (27%), Positives = 422/968 (44%), Gaps = 94/968 (10%)

Query  402   FVIDEFSGEISTNSMLDREKVSS-YKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFT  460
             F +D  +GE+ TN +LDRE +   Y L+V +     P       V + VLD NDN P F 
Sbjct  103   FTLDPVTGEVKTNVVLDREGMRDHYDLVVLSSQPTYP-----IEVRIKVLDVNDNSPEFP  157

Query  461   R-LFNVNVTENSEIGTFVIRITTTDLDMEHNANVTYSF---TENSSNKF----TIDPISG  512
                  ++ +E++  GT ++    TD D+  N  VT  +     N  NKF    T +P SG
Sbjct  158   EPSIAISFSESATSGTRLLLDAATDADVGENG-VTDQYEIVAGNVDNKFRLVTTANP-SG  215

Query  513   NVT-----VAGNLDREVQDEYLLKVVATDRA---WITETPLTISVQDQNDNPPEFEKQTY  564
             + +       GNLDRE +  Y L + A D           + +++ D NDNPP F+   Y
Sbjct  216   DTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDY  275

Query  565   YFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSDLFSIDPAMGDIYCKKTM---  621
                  E       +  V+ASD D LG NS ++Y L +    F+++P  G I   + +   
Sbjct  276   NVSLNETALPGTPVVTVMASDND-LGDNSKITYYLAETEHQFTVNPETGVISTTERVNCP  334

Query  622   RYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPE  681
             +    KS AS ++   F V A D+G P    +T V VN++D N+H P    R +    P+
Sbjct  335   QQTNVKSSASQKSCV-FTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFF----PD  389

Query  682   G--------YPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGW------  727
             G           N  V   VA    D G+N      IV+GN   +F +E  +        
Sbjct  390   GGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVN  449

Query  728   -IYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRV  786
              +  ++ + ++N   V      A D+G P R+      + V   N H P F    Y   +
Sbjct  450   GVLDREEIGKYNLTVV------AMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVL  503

Query  787   PENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVT  846
              E  P  + + ++ A D D+G N  V Y+I +GNE   FS+ P+TG I     LD +   
Sbjct  504   SELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRD  563

Query  847   EYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVA  906
               +L+I+ARD G   K A   L V + D ND  P+F+Q      L E++P Q  V  + A
Sbjct  564   TVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTA  623

Query  907   TDIDSPKYSVIQYRIIGGTGKEY---FNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANPD  963
             TD D      + + +     + Y   F ++  TG + ++   D E++++Y + VIA +  
Sbjct  624   TDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQG  683

Query  964   TNSQVVGATTVLVHITGVN----EFYPK-----FIQPVFHMDVSESAEIGTFVGLVQATD  1014
               +      TV +++  VN    +FYP+            + + +  E    +  V A+D
Sbjct  684   APTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASD  743

Query  1015  QDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRA--ILTVMAKNAGGIR  1072
             +D G +  + Y  + S  +  F + + +G IS+          +    L V A++AG  R
Sbjct  744   KDDGDNALIEYR-LESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRR  802

Query  1073  GNDTDEAQIII----------SIQDGNDPPEFLENLYEASVPEGENTGSKILTVRAVDKD  1122
                    +I++            Q G    + +E+ +E       N    I+ V++ +  
Sbjct  803   SQQDAIVEIVLKSKLEMLECGQAQAGGYEFQMVED-HEQQRNSQPNREVGIVQVKSTNGK  861

Query  1123  VRPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELII------GAIDTG  1176
                 N+   Y II G+  Q F+ID +SG + TA+ LDRE   +Y L I       +    
Sbjct  862   A---NSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAA  918

Query  1177  SPPQTGSTTVKIELLDVNDNGPVFDF---KEIVGYVSENEPAGTSIMTLSATDPDLPPNG  1233
             S    G   V I ++D+NDN PVF      E    + EN   G  I      D D   N 
Sbjct  919   SSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVN-  977

Query  1234  APFSYRLIGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAIT  1293
             +  SY L          +   +G+L   R +  E    +   +   D+G+P LSS+ +++
Sbjct  978   SRISYSLTNNPNQQF-RIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLS  1036

Query  1294  VHVLDQND  1301
             V + D ND
Sbjct  1037  VLIADVND  1044


 Score = 179 bits (455),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 184/742 (25%), Positives = 332/742 (45%), Gaps = 61/742 (8%)

Query  596   SYSLLQPSDLFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTL  655
             SY   +P   F++DP  G++     +       R    + Y   V++     P       
Sbjct  93    SYRFNEPPREFTLDPVTGEVKTNVVL------DREGMRDHYDLVVLSSQPTYP-----IE  141

Query  656   VYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEI-EYFIVAGN  714
             V + ++D N+++P+F   +      E   S  ++    A+D  D G N    +Y IVAGN
Sbjct  142   VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATD-ADVGENGVTDQYEIVAGN  200

Query  715   GSDYFYV------EPNSGWIYIKKS--MAEFNTGTVFTIKGKATDKGVPVRSDEIWATLI  766
               + F +        ++ +++++ +  +   + G+ + +   A D G P R   +   + 
Sbjct  201   VDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGS-YQLNISARDGGSPPRFGYLQVNVT  259

Query  767   VTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFS  826
             +   N + P F    Y V + E     T ++TV A D+D G N  + Y ++     H+F+
Sbjct  260   ILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA--ETEHQFT  317

Query  827   IHPITGAITILEALDYDTVTEYK---------LNITARDLGFASKSAVATLIVNVSDVND  877
             ++P TG I+  E ++    T  K           + ARD G   +     + VN+ D ND
Sbjct  318   VNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTND  377

Query  878   NPPKFNQSLYQ-----AYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNI  932
             + P  +   +      A + EN+ +   V  V   D DS        RI+ G    +F +
Sbjct  378   HDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRL  437

Query  933   EQSTG--IIKSKTTFDYEEVNEYTLDVIAANPDTNSQVVGATTVLVHITGVNEFYPKFIQ  990
             E++    I++     D EE+ +Y L V+A +  T ++   A  +++ +  VN+  P F +
Sbjct  438   EEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTA-HLIIDVNDVNDHEPVFEK  496

Query  991   PVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRR  1050
               +   +SE A  G+FV  + ATD+D G + +V+Y  +  +  + FS+   TG+I  +  
Sbjct  497   SEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGP  556

Query  1051  LDRETQNRAILTVMAKNAGGIRGNDTDEAQIIISIQDGNDPPEFLENLYEASVPEGENTG  1110
             LDRE ++   L++ A++ G        + ++II + + ++ P+F +     ++ E     
Sbjct  557   LDREIRDTVELSISARDGGPNPKFAYTQLKVII-LDENDEAPQFSQREQNVTLGEDAPPQ  615

Query  1111  SKILTVRAVDKDVRPQNNQFSYSI---IGGNVGQAFKIDPQSGDLETAKHLDRETVQSYE  1167
             + +  + A D D +  N   ++++   +       F +D  +G L T + LDRE +  YE
Sbjct  616   TIVALMTATDHD-QGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYE  674

Query  1168  LIIGAIDTGSP-PQTGSTTVKIELLDVNDNGPVFDFKEIVGYVS--------ENEPAGTS  1218
             + + A D G+P PQ+ + TV + + DVNDN P F  +  +  ++        + E     
Sbjct  675   ISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKER  734

Query  1219  IMT-LSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGI--LKTTRSLDREATPQLDFL  1275
             I+  ++A+D D   N A   YRL  G +  L  L+  SG   L+          P    L
Sbjct  735   ILLHVTASDKDDGDN-ALIEYRLESGGE-GLFQLDARSGAISLRGDAPASMHWKPHYKLL  792

Query  1276  VEVEDSGTPRLSSEHAITVHVL  1297
             V   D+G  R S + AI   VL
Sbjct  793   VSARDAGQ-RRSQQDAIVEIVL  813


>FAT2_DROME unnamed protein product
Length=4699

 Score = 487 bits (1254),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 496/1879 (26%), Positives = 827/1879 (44%), Gaps = 187/1879 (10%)

Query  31    VLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRY---SLLG-DGAE  86
             ++DVND  PE     Y   + EN + G  +    ATD D G NA++ Y   S+ G + +E
Sbjct  2331  IMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSE  2390

Query  87    RFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQD-SSPTEPRASAANLTISVRDSNDNTPR  145
              F ++ + G +    PLD EQ   +H+ +  +D  SP+   +S +N+ I+V+D NDN P 
Sbjct  2391  LFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPS--LSSRSNVFITVKDLNDNAPC  2448

Query  146   FSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRL-HGKDARRFGVDSRSGVVRA  204
             F  P Y   V     +G FV   KA D D  D   + Y++ +G + + + +D  +GV+  
Sbjct  2449  FVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISL  2508

Query  205   LEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQLF-PCFGPGTETRFTLREDA  263
                L    +++  L I  SD      A    L + L    ++ P F   T     + E+ 
Sbjct  2509  QNMLNFTDKSSTVLNISVSDGVHTAYA---RLKISLLPENVYSPLFDQST-YEAQVPENL  2564

Query  264   PEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVVIASGFDYETLPSYEA  323
               G  + T+ AS    G  + L + +    +     I+  TG +     FD E    Y  
Sbjct  2565  LHGHNIITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVV  2624

Query  324   WVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSRVARVSAKDAD  383
              ++V D G         L V V D NDN P   +  Y   V         +  V AKD D
Sbjct  2625  LLKVSDGGGK--FGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDD  2682

Query  384   SGENSEITYHLL---ND--FDEVFVIDEFSGEISTNSMLDREKVSSYKLIVEAWDRGVPR  438
               +N  + + ++   ND    +V  I+E +G+I   S  +   V+SY+  V A DRG P+
Sbjct  2683  IVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQ  2742

Query  439   LTGTATVFVTVLDKNDNPPRFTRL-FNVNVTENSEIGTFVIRITTTDLDMEHNANVTYSF  497
                   V + +++ + N P F +    + + E++  GT + ++           N T+ F
Sbjct  2743  FHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI-------GNYTFKF  2795

Query  498   TENSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVA---TDRAWITETPLTISVQDQND  554
             +  +     +   SG + +   LDRE Q+ + L VVA   T   +     + I V+D+ND
Sbjct  2796  SIAADQDHFMISDSGELILQQTLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDEND  2855

Query  555   NPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSD----LFSIDP  610
             N P+F+   Y     E  EK+  + +V A+D D  G N D+ Y L   ++    +F ID 
Sbjct  2856  NYPKFDNTFYSASVAENSEKVISLVKVSATDADT-GPNGDIRYYLESDTENIQNIFDIDI  2914

Query  611   AMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKF  670
               G I    ++  +        ++ Y+F V+A DNG P   +K  V + IVD N++AP F
Sbjct  2915  YSGWITLLTSLDREV-------QSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVF  2967

Query  671   EHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYI  730
             +       V E       +   +  D +      E+++FIV+G+    F +   SG ++I
Sbjct  2968  KLPIEGLSVFENALPGTVLINLLLIDPD--IEKQEMDFFIVSGDKQAQFQI-GKSGELFI  3024

Query  731   KKSMAE----FNTGTVFTIKGKATDKG-VPVRSDEIWATLIVTGENKHAPAFAAVSYQVR  785
              K +      F   ++    GK T K  V +   +I         N + P      Y + 
Sbjct  3025  AKPLDREQLMFYNLSIIATDGKFTAKANVEIDVKDI---------NDNTPYCLKPRYHIS  3075

Query  786   VPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTV  845
               E+    TT++ V A+D D      +R+ +S G    +FSI   +G + +  ALD +T 
Sbjct  3076  TNESISIGTTLVEVKAIDFDF--QSKLRFYLS-GKGADDFSIGKESGILKVASALDRETT  3132

Query  846   TEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVV  905
              +YKL    +D    ++   + +I+ V+D+NDN P F+ + Y+  +PE++     + KV 
Sbjct  3133  PKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVH  3192

Query  906   ATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTN  965
             A D D      I+Y ++G    +YF I +STGII+   + D E ++ + L V A +    
Sbjct  3193  AMDKDFGVNRQIKYSLMG-ENHDYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGV-  3250

Query  966   SQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYY  1025
              ++    TV V+I  +N+  P+F    +   + E+A  GT V  V AT  D G +  ++Y
Sbjct  3251  PKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHY  3310

Query  1026  LFVGSSNDRG-FSIGSETGVISISRRLDRETQNRAILTVMAKNAGG--IRGNDTDEAQII  1082
              F+ S N++G F + S TG + ++  LD E      LT+ A + G   +  N    A + 
Sbjct  3311  -FIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNN----AYVN  3365

Query  1083  ISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSI-IGGNVG  1140
             ISI D ND  P FL+NLY  +V E    GSKIL V+A D+D    N   +Y+I  G N+G
Sbjct  3366  ISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDED-SDVNGLVTYNIERGDNIG  3424

Query  1141  QAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVF  1200
             Q F IDP++G +  ++ LDRET+  Y L I A D G P +  S  + I +LD NDN P+F
Sbjct  3425  Q-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIF  3483

Query  1201  DFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILKT  1260
                     + EN   G   +T   +D D  PN  P+++ +  G +  L  LE+  G L+T
Sbjct  3484  SSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQ-DGSLRT  3542

Query  1261  TRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSPSSPRSVHVKVYSFNGQT  1320
                 +     +    V V D+GTP L S+  + V +++++  P     + V + SF    
Sbjct  3543  ASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDF  3602

Query  1321  PLGKIADVHPNDPDTSGDYTCRILQG------SAGPLNIPAACDLHAGKITP----GIG-  1369
                 I  VH +D D   +    ++ G      S+   NI      + GKI       IG 
Sbjct  3603  SGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISN----NTGKIYAISNLDIGL  3658

Query  1370  YSLSVSGNDGR-HPDVVSKVSLEFLTFSNATVENTVTMQIVRMKTVDFLGKYYVALLDLL  1428
             Y L+VS +DG+ H   + K+++E +T  N  ++ +V ++  R+   +FL  +    +   
Sbjct  3659  YKLNVSVSDGKFHVFSIVKINVELVT--NDMLKESVVIRFRRISASEFLLSHRKTFMR--  3714

Query  1429  QEELDVGDTLGIYSIDEIDGHTEVYMAMHSSQGYRTKHEVKEILTKKSWRIETLLEGANV  1488
                        I +I        + + + S     ++H V       + R  ++    NV
Sbjct  3715  ----------SIRNIMRCRQKDVILITLQSDYQKASQHAVG------NRRARSIDSDLNV  3758

Query  1489  MIGYSPCKIDACNNGGVCSDKIVVYEDSRITDTPTLILTSPKVAHEMVCKCRDGFTGEKC  1548
             +      +I   ++    SD+I            TLI    ++ +E      D      C
Sbjct  3759  VFAVRKQQIIPDSDEFFTSDEI----------RQTLIDKKNEIENETNLVVEDVLPS-TC  3807

Query  1549  EKKQDPCSPNPCQSGGQCRR--VGFDFH---------------CSCSPDREGKLCELERG  1591
             +  ++ C    C+   Q  +  V   F                C C P  +GK C+ E  
Sbjct  3808  QSNKNDCVHGECKQILQILKNNVTTTFTDVISFAAPSYIPVNTCVCRPGFDGKHCK-ETV  3866

Query  1592  DACASNPCRNGGVCKESPDGSSFFCLCRTGYRGNHCEVLTDSCRPNPCLHGGLCVSEKPG  1651
             +AC+++PC    +C  S     + C+C  G+ G +CE  +  C    C  G        G
Sbjct  3867  NACSTDPCSPQRICMPSGSALGYQCVCPKGFSGTYCERKSSKCSNESCDMGLFTAVSFGG  3926

Query  1652  YRCSCLEGRYGRHCERSTFSFDE-LSYMTFPSLDSNTNDVTIVFATTKPNALLLYNYGVQ  1710
                +     Y  +  ++ F+ +   SY             ++   T +    LLY     
Sbjct  3927  KSYA----HYKINKVKAKFTLENGFSY-------------SLQIRTVQQTGTLLY-----  3964

Query  1711  SGGRSDFIVLELVNGKLV--FSCGGARSAITTLTVKSDKSLADGSWNKVTATRNGRVVSL  1768
             + G+ D+ +LE++NG +   F  G     I+  ++    +++DG W++++  R     SL
Sbjct  3965  ASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSI----NISDGEWHQISLER-----SL  4015

Query  1769  SVSKCKEHGDLCDDCRPGDGTCYAEDVGLTGTLNFNKNPLLLGGLVNSDPVLERPGQIHS  1828
             + +K      + D+     G+      G+ G LN   N + +G  V   P +     I  
Sbjct  4016  NSAKV-----MVDNKHVSHGSA----PGVNGILNIQSNDIFVGAEVRPHPSIIGYEDIQR  4066

Query  1829  DDLVGCIHSVSINGRALNL  1847
                +GC+ ++ I   +L L
Sbjct  4067  -GFIGCMANIKIAKESLPL  4084


 Score = 421 bits (1082),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 390/1363 (29%), Positives = 606/1363 (44%), Gaps = 123/1363 (9%)

Query  23    SSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLLG  82
             SS  V+I V D+ND+ P F        + EN   G++V    A DRD G N+ I YS+  
Sbjct  489   SSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGENSYISYSIAN  548

Query  83    DGAERFQVNSSTGEIVTLEPLDREQHDV-YHLTLVAQDSSPTEPRASAANLTISVRDSND  141
               A  F+++  +G + T   LD E     Y L + A D      R +   L+I V+D ND
Sbjct  549   LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDIND  608

Query  142   NTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLH-GKDARRFGVDSRSG  200
             N P+F        V  +   G  VF   A D D GD   I YRL  G +   F +D  SG
Sbjct  609   NRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAGD--IISYRLSDGNEDGCFNLDPTSG  666

Query  201   VVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLV--VHLWERQL------------F  246
              +    DL         L++ A+D G+     S DL+  VHL    L            F
Sbjct  667   SLSISCDLKKTTLTNRILKVSATD-GTH---FSDDLIINVHLMPEDLGGDSSILHGFGSF  722

Query  247   PCFGPGTETRF----------------------------------------------TLR  260
              C   G   R                                               ++ 
Sbjct  723   ECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSIN  782

Query  261   EDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVVIASGFDYETLPS  320
             E    G  V  + A     G   +LVF ++ G+     RI+P  G++ I    D E    
Sbjct  783   ESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNE  842

Query  321   YEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSRVARVSAK  380
             Y   + V D GNP+  +   L + + D NDN PV+        + E     + V  + A 
Sbjct  843   YVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHAT  902

Query  381   DADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDREKVSSYKLIVEAWDRGVPRLT  440
             DADSG N+++TY L  +  + F ++  +G +  N  LDREK  +Y L + A D G P L+
Sbjct  903   DADSGINAQVTYALSVECSD-FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLS  961

Query  441   GTATVFVTVLDKNDNPPRF-TRLFNVNVTENSEIGTFVIRITTTDLDMEHNANVTYSFTE  499
               A V+V V D NDN P F  + +   V E+   GT +  I   D D+  NA + +S  E
Sbjct  962   SEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKE  1021

Query  500   NSSNK--FTIDPISGNVTVAGNLDREVQDEYLLKVVATDR---AWITETPLTISVQDQND  554
              + ++  F ID  +G +   G LD E +  + L V A D    +  ++  + I + D N+
Sbjct  1022  ETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNE  1081

Query  555   N--PPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSDL--FSIDP  610
             N   PEF+   Y     E + K   +  V A D D +  NS ++YS+     L  F+++ 
Sbjct  1082  NRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVND  1141

Query  611   AMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKF  670
               G I          ++  A  +N Y   + A D    PLS+   VY+ + + N++ P  
Sbjct  1142  -QGSI-------TSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLT  1193

Query  671   EHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYI  730
             +   Y   V E    N ++    A D  D      I Y IV+GN   YF ++  +G I  
Sbjct  1194  DKPVYYVNVTEASVENVEIITLKAFD-PDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKT  1252

Query  731   KKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENE  790
              +   +        ++   +D G PV S      + V   N ++P F    Y+V+VP + 
Sbjct  1253  TERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA  1312

Query  791   PANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKL  850
               N +I  V+A+DSDSG NG + Y I +G  +++F I    G I I + LD D   E+++
Sbjct  1313  TVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEI  1370

Query  851   NITARDLGFASKSAVA---TLIVNVSDVNDNPPKFNQSLYQAY--LPENSPSQHFVFKVV  905
             +I A D G   KS  A    ++V V+  + N P   +   +    L EN      V +++
Sbjct  1371  HIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQIL  1430

Query  906   ATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTN  965
             A D D+ +   + Y I  G     F I Q  G I      DYE    Y L +      T+
Sbjct  1431  AVDDDNDQ---LWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISV----TD  1483

Query  966   SQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYY  1025
                   T +LV +  +N+  P+F + V+H+++SE+ E  + +  + ATD+D   D K++Y
Sbjct  1484  GTFTAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRD--EDKKLFY  1541

Query  1026  LFVGSSNDRG---FSIGSETGVISISRRLDRETQNRAILTVMAKNAG--GIRGNDTDEAQ  1080
                 + +      F I S +G + +++RLD E   + IL V  K+ G  G R    + A+
Sbjct  1542  HLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQGAPGKR----NYAK  1597

Query  1081  IIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGGNV  1139
             II+++ D ND  PEF   + ++ VPE    GSK+  VRA+D+D    N +  YSII GNV
Sbjct  1598  IIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRD-SGHNAEIQYSIITGNV  1656

Query  1140  GQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPV  1199
             G  F+IDP  G +  A +L+   +Q Y L + A+D G+PP +    V I +    ++ P 
Sbjct  1657  GSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPK  1716

Query  1200  FDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILK  1259
             F    I   + EN P GT +  ++A       + +   + +I G   +   +   +G++ 
Sbjct  1717  FPTNNIAIEIFENLPIGTFVTQVTAR------SSSSIFFNIISGNINESFRINPSTGVIV  1770

Query  1260  TTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDS  1302
                ++D E+     F + V+ +     SS   I +H+LD ND+
Sbjct  1771  INGNIDYESIKV--FNLTVKGTNMAAESSCQNIIIHILDANDN  1811


 Score = 407 bits (1045),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 385/1323 (29%), Positives = 591/1323 (45%), Gaps = 80/1323 (6%)

Query  16    AGTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQ  75
              G+  L+S   V +LV DVND+AP FG QEY  +V E+L  G  +A   A D D G NA+
Sbjct  955   GGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAE  1014

Query  76    IRYSLLGD--GAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPR-ASAANL  132
             I++SL  +    E F+++  TG I T   LD E   V++L + A D    +P   S  ++
Sbjct  1015  IQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGG--DPSLTSDMSI  1072

Query  133   TISVRDSNDN--TPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGD-NSRIVYRLHGKD  189
              I + D N+N   P F    Y   V +   KG FV    A D D  D NS+I Y + G D
Sbjct  1073  VIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGD  1132

Query  190   ARRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQLFPCF  249
                    +  G + +L  L    +N Y L + A DC   P +  V++ + +         
Sbjct  1133  GLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPL  1192

Query  250   GPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDV-V  308
                      + E + E   + TL A  P   P   + + +  GN+     I+ +TG +  
Sbjct  1193  TDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKT  1252

Query  309   IASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEED  368
                  D E    +   V + D+G+P L S  +++V+V D NDN+P  D   Y   VP   
Sbjct  1253  TERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSA  1312

Query  369   YPPSRVARVSAKDADSGENSEITYHLLN-DFDEVFVIDEFSGEISTNSMLDREKVSSYKL  427
                  + +V A D+DSGEN  ITY + +      F ID   G I     LD +  + +++
Sbjct  1313  TVNQSIFQVHAIDSDSGENGRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEI  1370

Query  428   IVEAWDRGVPRLTGTA---TVFVTVLDKNDNPPRFTRLFNVNV---TENSEIGTFVIRIT  481
              ++A D G+P+ + TA    V V V   + N P   R  + NV   TEN + G  V +I 
Sbjct  1371  HIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQIL  1430

Query  482   TTDLDMEHNANVTYSFTE-NSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVATDRAWI  540
               D D   N  + Y+ +  N  N F I   +GN+ ++  LD E Q  Y L +  TD  + 
Sbjct  1431  AVDDD---NDQLWYNISNGNDDNTFYIGQDNGNILLSKYLDYETQQSYNLTISVTDGTFT  1487

Query  541   TETPLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLL  600
               T L + V D NDNPP+F K  Y+ +  E  E+ + I Q+ A+D D+   +  + Y L 
Sbjct  1488  AFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE---DKKLFYHLH  1544

Query  601   QPSD-----LFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTL  655
                D     LF ID   G++   + + ++ T         +   V   D G P   +   
Sbjct  1545  ATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQ-------HILIVFVKDQGAPGKRNYAK  1597

Query  656   VYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNG  715
             + VN+ D N+H P+F  +     VPE      K+A+  A DR D G NAEI+Y I+ GN 
Sbjct  1598  IIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDR-DSGHNAEIQYSIITGNV  1656

Query  716   SDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAP  775
                F ++P  G I +  ++   N    + ++ KA D G P  S +I   +IVT      P
Sbjct  1657  GSVFEIDPTFGIITLAGNL-NINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPP  1715

Query  776   AFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAIT  835
              F   +  + + EN P  T +  V A  S S     + + I +GN    F I+P TG I 
Sbjct  1716  KFPTNNIAIEIFENLPIGTFVTQVTARSSSS-----IFFNIISGNINESFRINPSTGVIV  1770

Query  836   ILEALDYDTVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENS  895
             I   +DY+++  +  N+T +    A++S+   +I+++ D NDN P F Q+ Y   LPE++
Sbjct  1771  INGNIDYESIKVF--NLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESA  1828

Query  896   PSQHFVFKV----------VATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTF  945
                 +V KV             D D     +++Y I+    K +F I+ +TG I+     
Sbjct  1829  AIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQL  1888

Query  946   DYEEVNEYTLDVIAAN---PDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAE  1002
             DYE    YT DV  ++   P  +S      T  + +  VN+  P F +   ++ +     
Sbjct  1889  DYETNAGYTFDVTVSDMGKPKLHSTTTAHVT--IRVINVNDCPPVFNERELNVTLFLPTF  1946

Query  1003  IGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILT  1062
                FV  V A  +DA +D   + +  G++N+  F I   TG+I+         +N     
Sbjct  1947  ENVFVRQVSA--KDADNDTLRFDIVDGNTNE-CFQIEKYTGIITTRNFEILNNENDRDYA  2003

Query  1063  VMAKNAGGIRGNDTDEAQIIISIQDGNDPPEFLENLYEASVPEGENTGSKILTVRAVDKD  1122
             +  + + GI          ++S  D N    F    Y  S  E     +K+ T+  V+  
Sbjct  2004  LHVRASDGIFSAILIVKIKVLSAIDSN--FAFQRESYRFSAFEN---NTKVATIGLVNVI  2058

Query  1123  VRPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKHL-DRETVQSYELIIGAID-----TG  1176
                 +    Y I+  N  Q F I   SG L+T   + DRE    Y L + A         
Sbjct  2059  GNTLDENVEYRIL--NPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMN  2116

Query  1177  SPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPF  1236
             S  +   T++ I +LDVNDN P+F        VS ++P GT IM + A D D   NG   
Sbjct  2117  SNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGE-V  2175

Query  1237  SYRLIGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHV  1296
              Y L  G   +L  L++ SG L   + ++       +  V   D      SSE  + V V
Sbjct  2176  RYELKKGNG-ELFKLDRKSGELSIKQHVEGH-NRNYELTVAAYDGAITPCSSEAPLQVKV  2233

Query  1297  LDQ  1299
             +D+
Sbjct  2234  IDR  2236


 Score = 382 bits (981),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 364/1271 (29%), Positives = 586/1271 (46%), Gaps = 84/1271 (7%)

Query  35    NDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLL-GDGAERFQVNSS  93
             N H PEF        + E++ +G  VA   A DRD G N ++ +++  GD    F+++  
Sbjct  766   NVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSVFRIDPD  825

Query  94    TGEIVTLEPLDREQHDVYHLTLVAQD-SSPTEPRASAANLTISVRDSNDNTPRFSSPRYT  152
              GE+  +  LDRE+ + Y L +   D  +PT  ++++  L I++ D NDN P       T
Sbjct  826   RGELQIIGYLDRERQNEYVLNITVYDLGNPT--KSTSKMLPITILDVNDNRPVIQKTLAT  883

Query  153   AYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHGKDARRFGVDSRSGVVRALEDLAMGG  212
               + ++   G  V    A+D D G N+++ Y L   +   F V++ +G +R  + L    
Sbjct  884   FRLTESARIGTVVHCLHATDADSGINAQVTYAL-SVECSDFTVNATTGCLRLNKPLDREK  942

Query  213   QNTYQLQIEASDCGSEPRAVSVDLVVHLWE--RQLFPCFGPGTETRFTLREDAPEGRVVT  270
             Q+ Y L I A D GS P   S  LV  L +      P FG   E  F +RED P G V+ 
Sbjct  943   QDNYALHITAKDGGS-PVLSSEALVYVLVDDVNDNAPVFGV-QEYIFKVREDLPRGTVLA  1000

Query  271   TLSASTPKTGPASELVFGMAGGNVGDSL-RIEPRTGDVVIASGFDYETLPSYEAWVEVRD  329
              + A     GP +E+ F +      + L RI+  TG +      DYE    +   V   D
Sbjct  1001  VIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAID  1060

Query  330   SGNPSLRSVIQLLVNVTDANDN--APVMDMPNYNASVPEEDYPPSRVARVSAKDADSGE-  386
              G+PSL S + +++ + D N+N  AP  D   Y   V E     + V  V+A+D D+ + 
Sbjct  1061  GGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDL  1120

Query  387   NSEITYHLL-NDFDEVFVIDEFSGEISTNSMLDREKVSSYKLIVEAWDRGVPRLTGTATV  445
             NS+ITY +   D   +F +++  G I++ S LD E  + Y L + A D  +  L+    V
Sbjct  1121  NSKITYSITGGDGLGIFAVND-QGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEV  1179

Query  446   FVTVLDKNDNPPRFTR-LFNVNVTENSEIGTFVIRITTTDLDMEHNANVTYSFTE-NSSN  503
             ++ V ++NDN P   + ++ VNVTE S     +I +   D D++    +TY+    N   
Sbjct  1180  YIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVG  1239

Query  504   KFTIDPISGNV-TVAGNLDREVQDEYLLKVVATDR---AWITETPLTISVQDQNDNPPEF  559
              F ID  +G + T    LDRE Q E++L+V  +D       + + + +SV D NDN PEF
Sbjct  1240  YFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF  1299

Query  560   EKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLL--QPSDLFSIDPAMGDIYC  617
             +++ Y    P        I QV A D D  G N  ++YS+   +  + F ID   G I+ 
Sbjct  1300  DQRVYKVQVPSSATVNQSIFQVHAIDSDS-GENGRITYSIKSGKGKNKFRIDSQRGHIHI  1358

Query  618   KKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKT---LVYVNIVDANNHAPKFEHRA  674
              K +           +N +  ++ A DNG P  S      +V V +   + +AP    + 
Sbjct  1359  AKPL---------DSDNEFEIHIKAEDNGIPKKSQTARVNIVVVPVNPNSQNAPLIVRKT  1409

Query  675   Y--LWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKK  732
                +  + E       V Q +A D +    N ++ Y I  GN  + FY+  ++G I + K
Sbjct  1410  SENVVDLTENDKPGFLVTQILAVDDD----NDQLWYNISNGNDDNTFYIGQDNGNILLSK  1465

Query  733   SMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPA  792
              + ++ T   + +    TD      ++ +   + +   N + P FA   Y V + EN   
Sbjct  1466  YL-DYETQQSYNLTISVTDGTFTAFTNLLVQVIDI---NDNPPQFAKDVYHVNISENIEE  1521

Query  793   NTTILTVNAVDSDSGPNGMVRYEISAGNERHE---FSIHPITGAITILEALDYDTVTEYK  849
              + I+ ++A D D   +  + Y + A  +      F I  I+G + + + LD++   ++ 
Sbjct  1522  ESVIMQLHATDRDE--DKKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHI  1579

Query  850   LNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDI  909
             L +  +D G   K   A +IVNV D ND+ P+F   + Q+ +PE++     + +V A D 
Sbjct  1580  LIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDR  1639

Query  910   DSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAA---NPDTNS  966
             DS   + IQY II G     F I+ + GII      +  ++ EY L V A    NP  +S
Sbjct  1640  DSGHNAEIQYSIITGNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSS  1699

Query  967   QVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYL  1026
             Q+     V + +T      PKF      +++ E+  IGTFV  V A      S   +++ 
Sbjct  1700  QI----PVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTAR-----SSSSIFFN  1750

Query  1027  FVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQIIISIQ  1086
              +  + +  F I   TGVI I+  +D E+     LTV   N       ++    III I 
Sbjct  1751  IISGNINESFRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAA----ESSCQNIIIHIL  1806

Query  1087  DGNDP-PEFLENLYEASVPEGENTGSKILTVRAVDKD-----VRPQ----NNQFSYSIIG  1136
             D ND  P F++N Y  ++PE    GS +L V    KD     V+      N    Y I+ 
Sbjct  1807  DANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVD  1866

Query  1137  GNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTT--VKIELLDVN  1194
                   FKID  +G +E  + LD ET   Y   +   D G P    +TT  V I +++VN
Sbjct  1867  DLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVN  1926

Query  1195  DNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKH  1254
             D  PVF+ +E+   +         +  +SA D D         + ++ G   +   +EK+
Sbjct  1927  DCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD----NDTLRFDIVDGNTNECFQIEKY  1982

Query  1255  SGILKTTRSLD  1265
             +GI+ TTR+ +
Sbjct  1983  TGII-TTRNFE  1992


 Score = 373 bits (958),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 378/1376 (27%), Positives = 623/1376 (45%), Gaps = 132/1376 (10%)

Query  23    SSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLLG  82
             +  ++ I VLD ND +P F   +Y   + E+      +    A D D G+N +I YSLL 
Sbjct  165   TEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLM  224

Query  83    DGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDS----SPTEPRASAANLTISVRD  138
             D +E F ++ +TGEI  L+ L   ++  + LT+VA D     +    +AS   ++ISV+ 
Sbjct  225   D-SEYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQ  283

Query  139   SNDNTPRFSSPRYTAYVPDTTSKGDFVFG-AKASDDDEGDNSRIVYRLHGKDARRFG---  194
              N   P   +  +++  P   +    ++G  + +D D G N  I  RL   D    G   
Sbjct  284   VNFYAPEIFTKTFSSVTP---TSNPLIYGIVRVNDKDTGINGNI-GRLEIVDGNPDGTFL  339

Query  195   ---VDSRSGVVRALEDLAMGGQN--TYQLQIEASDCGSEPRAVSVDLVVHLW-ERQLFPC  248
                 +++      L   A   Q    Y L + A D G+  R     + + +  E +  P 
Sbjct  340   LKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPI  399

Query  249   FGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVV  308
             F        ++ E AP    V  L  S P  G  + +   + GGN GD  RI P +G + 
Sbjct  400   FTQEI-YEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLY  458

Query  309   IASGFDYETLPSYEAWVEVRDSGNPSLR--SVIQLLVNVTDANDNAPVMDMPNYNASVPE  366
              A   D E   SY   V   D  N   R  S  ++ ++V D NDN P+ +  N   S+ E
Sbjct  459   TAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINE  518

Query  367   EDYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDREKVS-SY  425
              +   S V +++AKD DSGENS I+Y + N     F ID FSG + T S+LD E +  +Y
Sbjct  519   NNLAGSFVVKLTAKDRDSGENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRNY  578

Query  426   KLIVEAWDRGVP-RLTGTATVFVTVLDKNDNPPRFTRLFNV-NVTENSEIGTFVIRITTT  483
             +LI+ A D G+P R      + + V D NDN P+F R+     VT+++ +GT V    T+
Sbjct  579   ELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEV--FVTS  636

Query  484   DLDMEHNANVTYSFTE-NSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVATDRAWITE  542
              +D +    ++Y  ++ N    F +DP SG+++++ +L +      +LKV ATD    ++
Sbjct  637   AIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFSD  696

Query  543   TPL------------------------------------TISVQDQND------------  554
               +                                    T+S+ ++N+            
Sbjct  697   DLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDL  756

Query  555   --NPPEFEKQTY---YFHFP-ELQ-EKMAHIGQVVASDEDK---LGANSDVSYSLLQP--  602
                P  + +  +   + +FP EL   +   +G+ VA  E K   LG N  + +++     
Sbjct  757   SLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDY  816

Query  603   SDLFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVD  662
               +F IDP  G++   + + Y   + R   +N Y   +   D G P  S+  ++ + I+D
Sbjct  817   DSVFRIDPDRGEL---QIIGY-LDRER---QNEYVLNITVYDLGNPTKSTSKMLPITILD  869

Query  663   ANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVE  722
              N++ P  +     + + E       V    A+D  D G+NA++ Y  ++   SD F V 
Sbjct  870   VNDNRPVIQKTLATFRLTESARIGTVVHCLHATD-ADSGINAQVTY-ALSVECSD-FTVN  926

Query  723   PNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSY  782
               +G + + K +        + +   A D G PV S E    ++V   N +AP F    Y
Sbjct  927   ATTGCLRLNKPLDREKQDN-YALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEY  985

Query  783   QVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHE-FSIHPITGAITILEALD  841
               +V E+ P  T +  + AVD D GPN  +++ +    +  E F I   TGAI     LD
Sbjct  986   IFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLD  1045

Query  842   YDTVTEYKLNITARDLGFASKSAVATLIVNVSDVNDN--PPKFNQSLYQAYLPENSPSQH  899
             Y+    + L ++A D G  S ++  ++++ + DVN+N   P+F+  +Y+  + EN P   
Sbjct  1046  YENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGT  1105

Query  900   FVFKVVATDIDSPKY-SVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVI  958
             FV  V A D+D+    S I Y I GG G   F +    G I S +  D E  N Y L + 
Sbjct  1106  FVMNVTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLC  1164

Query  959   AAN----PDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATD  1014
             A +    P +N        V + +   N+  P   +PV++++V+E++     +  ++A D
Sbjct  1165  AQDCAIVPLSN-----CVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFD  1219

Query  1015  QDAGSDGKVYYLFVGSSNDRGFSIGSETGVISIS-RRLDRETQNRAILTVMAKNAGGIRG  1073
              D      + Y  V  +    F I S+TGVI  + R+LDRE Q   IL V   + G    
Sbjct  1220  PDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVL  1279

Query  1074  NDTDEAQIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSY  1132
             + T  ++I++S+ D ND  PEF + +Y+  VP        I  V A+D D   +N + +Y
Sbjct  1280  SST--SRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSD-SGENGRITY  1336

Query  1133  SIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGST---TVKIE  1189
             SI  G     F+ID Q G +  AK LD +    +E+ I A D G P ++ +     V + 
Sbjct  1337  SIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVNIVVVP  1394

Query  1190  LLDVNDNGPVFDFK--EIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMD  1247
             +   + N P+   K  E V  ++EN+  G  +  + A D D         Y +  G   +
Sbjct  1395  VNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD----NDQLWYNISNGNDDN  1450

Query  1248  LVHLEKHSGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSP  1303
               ++ + +G +  ++ LD E     +  + V D GT   ++   + V V+D ND+P
Sbjct  1451  TFYIGQDNGNILLSKYLDYETQQSYNLTISVTD-GT--FTAFTNLLVQVIDINDNP  1503


 Score = 352 bits (902),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 360/1340 (27%), Positives = 591/1340 (44%), Gaps = 96/1340 (7%)

Query  22    TSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLL  81
             ++S  + I +LDVND+ P   +      + E+  +G  V    ATD D G+NAQ+ Y+L 
Sbjct  858   STSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALS  917

Query  82    GDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDS-SPTEPRASAANLTISVRDSN  140
              + ++ F VN++TG +   +PLDRE+ D Y L + A+D  SP    +S A + + V D N
Sbjct  918   VECSD-FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPV--LSSEALVYVLVDDVN  974

Query  141   DNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRL--HGKDARRFGVDSR  198
             DN P F    Y   V +   +G  +   +A D+D G N+ I + L    +D   F +D  
Sbjct  975   DNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKH  1034

Query  199   SGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVS----VDLVVHLWERQLFPCFGPGTE  254
             +G +R    L    +  + L + A D G +P   S    V +++ + E +  P F     
Sbjct  1035  TGAIRTQGYLDYENKQVHNLIVSAID-GGDPSLTSDMSIVIMIIDVNENRFAPEFDDFV-  1092

Query  255   TRFTLREDAPEGRVVTTLSASTPKTGPA-SELVFGMAGGNVGDSLRIEPRTGDVVIASGF  313
                 ++E+ P+G  V  ++A    T    S++ + + GG+ G  +      G +   S  
Sbjct  1093  YEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGD-GLGIFAVNDQGSITSLSQL  1151

Query  314   DYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSR  373
             D ET   Y   +  +D     L + +++ + V + NDN P+ D P Y  +V E       
Sbjct  1152  DAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVE  1211

Query  374   VARVSAKDADSGENSEITYHLLN-DFDEVFVIDEFSGEI-STNSMLDREKVSSYKLIVEA  431
             +  + A D D      ITY++++ +    F ID  +G I +T   LDRE  + + L V  
Sbjct  1212  IITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAI  1271

Query  432   WDRGVPRLTGTATVFVTVLDKNDNPPRF-TRLFNVNVTENSEIGTFVIRITTTDLDMEHN  490
              D G P L+ T+ + V+VLD NDN P F  R++ V V  ++ +   + ++   D D   N
Sbjct  1272  SDNGSPVLSSTSRIVVSVLDINDNSPEFDQRVYKVQVPSSATVNQSIFQVHAIDSDSGEN  1331

Query  491   ANVTYSFTE-NSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVATDRAWITETPLT---  546
               +TYS       NKF ID   G++ +A  LD +  +E+ + + A D     ++      
Sbjct  1332  GRITYSIKSGKGKNKFRIDSQRGHIHIAKPLDSD--NEFEIHIKAEDNGIPKKSQTARVN  1389

Query  547   ---ISVQDQNDNPPEFEKQTY--YFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQ  601
                + V   + N P   ++T        E  +    + Q++A D+D    N  + Y++  
Sbjct  1390  IVVVPVNPNSQNAPLIVRKTSENVVDLTENDKPGFLVTQILAVDDD----NDQLWYNISN  1445

Query  602   PSD--LFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVN  659
              +D   F I    G+I   K + Y+  +S       Y+  +   D      ++ T + V 
Sbjct  1446  GNDDNTFYIGQDNGNILLSKYLDYETQQS-------YNLTISVTDG---TFTAFTNLLVQ  1495

Query  660   IVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSD--  717
             ++D N++ P+F    Y   + E       + Q  A+DR++   + ++ Y + A       
Sbjct  1496  VIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDE---DKKLFYHLHATQDPSSL  1552

Query  718   -YFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPA  776
               F ++  SG + + + + +F       +     D+G P + +     + V   N H P 
Sbjct  1553  ALFRIDSISGNVIVTQRL-DFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPE  1611

Query  777   FAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITI  836
             F A   Q +VPE+    + +  V A+D DSG N  ++Y I  GN    F I P  G IT+
Sbjct  1612  FTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITGNVGSVFEIDPTFGIITL  1671

Query  837   LEALDYDTVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSP  896
                L+ + + EY L + A DLG    S+   + + V+   ++PPKF  +     + EN P
Sbjct  1672  AGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLP  1731

Query  897   SQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLD  956
                FV +V A        S I + II G   E F I  STG+I      DYE +  + L 
Sbjct  1732  IGTFVTQVTAR-----SSSSIFFNIISGNINESFRINPSTGVIVINGNIDYESIKVFNLT  1786

Query  957   VIAANPDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLV------  1010
             V   N    S       +++HI   N+  P F+Q  +   + ESA IG++V  V      
Sbjct  1787  VKGTNMAAES---SCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKD  1843

Query  1011  ----QATDQDAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAK  1066
                 Q  D D G +G V Y  V       F I S TG I + R+LD ET       V   
Sbjct  1844  HLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVS  1903

Query  1067  NAGGIRGNDTDEAQIIISIQDGND-PPEFLENLYEAS--VPEGENTGSKILTVRAVDKDV  1123
             + G  + + T  A + I + + ND PP F E     +  +P  EN   + ++ +  D   
Sbjct  1904  DMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKDAD---  1960

Query  1124  RPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKH--LDRETVQSYELIIGAIDTGSPPQT  1181
                N+   + I+ GN  + F+I+  +G + T     L+ E  + Y L + A D      +
Sbjct  1961  ---NDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASDG---IFS  2014

Query  1182  GSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLI  1241
                 VKI++L   D+   F  +       EN     +I  ++     L  N     YR++
Sbjct  2015  AILIVKIKVLSAIDSNFAFQRESYRFSAFENNTKVATIGLVNVIGNTLDEN---VEYRIL  2071

Query  1242  GGKQMDLVHLEKHSGILKTTRSL-DREATPQLDFLVEVEDSGTPRLSSE-----HAITVH  1295
                Q  L  +   SG LKTT  + DRE        VE +      ++S       +I + 
Sbjct  2072  NPTQ--LFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDIS  2129

Query  1296  VLDQNDSPSSPRSVHVKVYS  1315
             VLD ND  + P  V++  Y+
Sbjct  2130  VLDVND--NCPLFVNMPYYA  2147


 Score = 338 bits (866),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 344/1362 (25%), Positives = 622/1362 (46%), Gaps = 82/1362 (6%)

Query  20    PLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYS  79
             P +S   +++ V+D +   P F +Q Y   V E+  V  + A  ++ + +  L   + Y+
Sbjct  2222  PCSSEAPLQVKVIDRS--MPVFEKQFYTVSVKED--VEMYSALSVSIEAESPLGRSLIYT  2277

Query  80    LLGDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAANLTISVRDS  139
             +  + ++ F+++ +TG I  +  LD E+   + +++ A DS       +   L++S+ D 
Sbjct  2278  ISSE-SQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDS--LSGVYAEVVLSVSIMDV  2334

Query  140   NDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHG----KDARRFGV  195
             ND  P   S  Y   +P+  S G  +    A+D+D G N+++ Y +       ++  F +
Sbjct  2335  NDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYI  2394

Query  196   DSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWE-RQLFPCF-GPGT  253
             D   G +     L       + + +   D GS   +   ++ + + +     PCF  P  
Sbjct  2395  DVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSY  2454

Query  254   ETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVVIASGF  313
              T+ ++   A  G+ V    A          L + +  GN   +  I+  TG + + +  
Sbjct  2455  FTKVSVA--AVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTYSIDKLTGVISLQNML  2512

Query  314   DYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSR  373
             ++    S    + V D  + +     +L +++   N  +P+ D   Y A VPE       
Sbjct  2513  NFTDKSSTVLNISVSDGVHTAYA---RLKISLLPENVYSPLFDQSTYEAQVPENLLHGHN  2569

Query  374   VARVSAKDADSGENSEITYHLLN-DFDEVFVIDEFSGEISTNSMLDREKVSSYKLIVEAW  432
             +  V A D D G  + + Y +++ +  ++F+ID+ +G I++    DREK   Y ++++  
Sbjct  2570  IITVKASDGDFGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVS  2629

Query  433   DRGVPRLTGTATVFVTVLDKNDNPPRF-TRLFNVNVTENSEIGTFVIRITTTDLDMEHNA  491
             D G     G A++ V V+D NDN P F  + + + V+   E    ++ +   D D+  N 
Sbjct  2630  DGGGK--FGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNG  2687

Query  492   NVTYSFTENSSNKFTIDPI-----SGNVTVAGNLDREVQDEYLLKVVATDRA---WITET  543
             +V +   + S++K   D I     +G++      +    + Y   V A+DR    + +E 
Sbjct  2688  SVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEV  2747

Query  544   PLTISVQDQNDNPPEFEKQTYYFHFPE------LQEKMAHIGQVVASDEDKLGANSDVSY  597
             P++I + + + N P FEK +      E      +  K+  IG            N    +
Sbjct  2748  PVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIG------------NYTFKF  2795

Query  598   SLLQPSDLFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVY  657
             S+    D F I  + G++  ++T+  +  +S       ++  VVA  +  P   +   V 
Sbjct  2796  SIAADQDHFMISDS-GELILQQTLDREQQES-------HNLIVVAETSTVPVFFAYADVL  2847

Query  658   VNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAG--NG  715
             +++ D N++ PKF++  Y   V E       + +  A+D  D G N +I Y++ +   N 
Sbjct  2848  IDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATD-ADTGPNGDIRYYLESDTENI  2906

Query  716   SDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAP  775
              + F ++  SGWI +  S+ +    + +  K  A D G P    ++  T+ +   N +AP
Sbjct  2907  QNIFDIDIYSGWITLLTSL-DREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAP  2965

Query  776   AFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAIT  835
              F      + V EN    T ++ +  +D D     M  + I +G+++ +F I   +G + 
Sbjct  2966  VFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEM-DFFIVSGDKQAQFQIGK-SGELF  3023

Query  836   ILEALDYDTVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENS  895
             I + LD + +  Y L+I A D  F +K+ V    ++V D+NDN P   +  Y     E+ 
Sbjct  3024  IAKPLDREQLMFYNLSIIATDGKFTAKANVE---IDVKDINDNTPYCLKPRYHISTNESI  3080

Query  896   PSQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTL  955
                  + +V A D D    S +++  + G G + F+I + +GI+K  +  D E   +Y L
Sbjct  3081  SIGTTLVEVKAIDFDFQ--SKLRFY-LSGKGADDFSIGKESGILKVASALDRETTPKYKL  3137

Query  956   DVIAANPDTNSQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQ  1015
                  +    +Q    + +++ +  +N+  P F    + + V E A++ T +  V A D+
Sbjct  3138  VAHVQDGKDFTQEC-FSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDK  3196

Query  1016  DAGSDGKVYYLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGND  1075
             D G + ++ Y  +G ++D  F I   TG+I + + LDRET +   LTV A++ G  + + 
Sbjct  3197  DFGVNRQIKYSLMGENHDY-FKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHS  3255

Query  1076  TDEAQIIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSI  1134
                A + ++I D ND PPEF    Y   + E    G+++  V A   D+   N    Y I
Sbjct  3256  I--ATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDI-GVNADIHYFI  3312

Query  1135  IGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVN  1194
             + GN    FK+D  +GDL     LD E  + Y L I AID G+PP + +  V I +LD+N
Sbjct  3313  MSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDIN  3372

Query  1195  DNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKH  1254
             DN P F        V+E+   G+ I+ + ATD D   NG   +Y +  G  +    ++  
Sbjct  3373  DNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGL-VTYNIERGDNIGQFSIDPK  3431

Query  1255  SGILKTTRSLDREATPQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSP----SSPRSVH  1310
             +G +  +R LDRE        ++  D G P+  +   I +++LD ND+     SS  SV 
Sbjct  3432  NGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVV  3491

Query  1311  VKVYSFNGQTPLG-KIADVHPNDPDTSGDYTCRILQGSAGPL  1351
             ++     G   L  KI+D     P+T+  YT  I  G+ G L
Sbjct  3492  LQENRLLGYVFLTFKISDADET-PNTTP-YTFDIRSGNEGGL  3531


 Score = 310 bits (794),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 307/1155 (27%), Positives = 507/1155 (44%), Gaps = 48/1155 (4%)

Query  22    TSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLL  81
             T+   ++I +L  N ++P F +  Y A+V ENL  G  +    A+D D G  A + Y ++
Sbjct  2532  TAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIV  2591

Query  82    GDGAER-FQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAANLTISVRDSN  140
              +  ++ F ++ +TG I +    DRE+ D Y + L   D      +   A+L + V D N
Sbjct  2592  SEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGG---KFGFASLKVIVVDVN  2648

Query  141   DNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHGKDARR-----FGV  195
             DN P F    Y   V  T      +   KA DDD  DN  + +++  K   +       +
Sbjct  2649  DNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEI  2708

Query  196   DSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQL-FPCFGPGTE  254
             + ++G +         G N+YQ  + ASD G       V + + + E     P F   + 
Sbjct  2709  NEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSS-  2767

Query  255   TRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVVIASGFD  314
                 + E  P G V+T L      T       F +A     D   I   +G++++    D
Sbjct  2768  VLLKIIESTPPGTVLTKLHMIGNYT-----FKFSIAADQ--DHFMISD-SGELILQQTLD  2819

Query  315   YETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSRV  374
              E   S+   V    S  P   +   +L++V D NDN P  D   Y+ASV E       +
Sbjct  2820  REQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISL  2879

Query  375   ARVSAKDADSGENSEITYHLLND---FDEVFVIDEFSGEISTNSMLDREKVSSYKLIVEA  431
              +VSA DAD+G N +I Y+L +D      +F ID +SG I+  + LDRE  S Y   V A
Sbjct  2880  VKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIA  2939

Query  432   WDRGVPRLTGTATVFVTVLDKNDNPPRFTR-LFNVNVTENSEIGTFVIRITTTDLDMEHN  490
              D G P+      V + ++D NDN P F   +  ++V EN+  GT +I +   D D+E  
Sbjct  2940  ADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQ  2999

Query  491   ANVTYSFTENSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVATDRAWITETPLTISVQ  550
                 +  + +   +F I   SG + +A  LDRE    Y L ++ATD  +  +  + I V+
Sbjct  3000  EMDFFIVSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLSIIATDGKFTAKANVEIDVK  3058

Query  551   DQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLL-QPSDLFSID  609
             D NDN P   K  Y+    E       + +V A D D     S + + L  + +D FSI 
Sbjct  3059  DINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGADDFSIG  3115

Query  610   PAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPK  669
                G +     +  + T         Y       D         + + + + D N++ P 
Sbjct  3116  KESGILKVASALDRETTPK-------YKLVAHVQDGKDFTQECFSEIIITVNDINDNMPI  3168

Query  670   FEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIY  729
             F    Y   VPE    N  + +  A D+ DFGVN +I+Y ++ G   DYF +  ++G I 
Sbjct  3169  FSMAQYRVSVPEDAQLNTLITKVHAMDK-DFGVNRQIKYSLM-GENHDYFKISKSTGIIR  3226

Query  730   IKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPEN  789
             + KS+ +  T ++F +  KA D GVP         + +   N + P F+   Y  ++ EN
Sbjct  3227  LHKSL-DRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILEN  3285

Query  790   EPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYK  849
                 T +  V A   D G N  + Y I +GNE+ +F +   TG + +   LDY+    Y 
Sbjct  3286  ATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYF  3345

Query  850   LNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDI  909
             L I A D G    S  A + +++ D+NDN P F Q+LY+  + E+      +  V ATD 
Sbjct  3346  LTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDE  3405

Query  910   DSPKYSVIQYRIIGGTGKEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTNSQVV  969
             DS    ++ Y I  G     F+I+   G I      D E ++ YTL++ A +   + Q  
Sbjct  3406  DSDVNGLVTYNIERGDNIGQFSIDPKNGTISVSRPLDRETISHYTLEIQACD-QGDPQRC  3464

Query  970   GATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVG  1029
              +  + ++I   N+  P F    + + + E+  +G      + +D D   +   Y   + 
Sbjct  3465  NSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIR  3524

Query  1030  SSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQIIISIQDGN  1089
             S N+ G     + G +  + R +   Q+  ++ V   +  G     +D   ++  I++  
Sbjct  3525  SGNEGGLFRLEQDGSLRTASRFNHNLQDEFVIQVRVFD-NGTPPLYSDAWVVVKIIEESQ  3583

Query  1090  DPPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGG-----NVGQAFK  1144
              PP         +  E + +G+ I  V A D+D   + ++ ++S++ G        + F 
Sbjct  3584  YPPIVTPLEVTINSFEDDFSGAFIGKVHASDQD---KYDELNFSLVSGPDDMYQSSKLFN  3640

Query  1145  IDPQSGDLETAKHLD  1159
             I   +G +    +LD
Sbjct  3641  ISNNTGKIYAISNLD  3655


 Score = 306 bits (784),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 365/1347 (27%), Positives = 589/1347 (44%), Gaps = 119/1347 (9%)

Query  10    AFLVVVAGT--LPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANP----  63
              F + V GT     +S  ++ I +LD ND+ P F + EY   + E+ A+G++V       
Sbjct  1782  VFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSS  1841

Query  64    ------LATDRDDGLNAQIRYSLLGDGAERF-QVNSSTGEIVTLEPLDREQHDVYHLTLV  116
                      D D G+N  + Y ++ D A+ F +++S+TG I  L  LD E +  Y   + 
Sbjct  1842  KDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVT  1901

Query  117   AQD-SSPTEPRASAANLTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDE  175
               D   P     + A++TI V + ND  P F+       +   T +  FV    A D   
Sbjct  1902  VSDMGKPKLHSTTTAHVTIRVINVNDCPPVFNERELNVTLFLPTFENVFVRQVSAKD---  1958

Query  176   GDNSRIVYRL-HGKDARRFGVDSRSGVV--RALEDLAMGGQNTYQLQIEASDCGSEPRAV  232
              DN  + + +  G     F ++  +G++  R  E L       Y L + ASD        
Sbjct  1959  ADNDTLRFDIVDGNTNECFQIEKYTGIITTRNFEILNNENDRDYALHVRASD-----GIF  2013

Query  233   SVDLVVHLWERQLFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGG  292
             S  L+V +             ++ F  + ++         SA    T  A+  +  + G 
Sbjct  2014  SAILIVKIK-------VLSAIDSNFAFQRESYR------FSAFENNTKVATIGLVNVIGN  2060

Query  293   NVGDSLR---IEP-RTGDVVIASG--------FDYETLPSYEAWVEVR----DSGNPSLR  336
              + +++    + P +  D+ I+SG        FD E    Y  +VE +    D  N ++R
Sbjct  2061  TLDENVEYRILNPTQLFDIGISSGALKTTGVIFDREVKDLYRLFVEAKSMLYDGMNSNVR  2120

Query  337   -SVIQLLVNVTDANDNAPV-MDMPNYNASVPEEDYPPSRVARVSAKDADSGENSEITYHL  394
              +V  + ++V D NDN P+ ++MP Y A+V  +D   + + +V A D DS EN E+ Y L
Sbjct  2121  RAVTSIDISVLDVNDNCPLFVNMP-YYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYEL  2179

Query  395   LNDFDEVFVIDEFSGEISTNSMLDREKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKND  454
                  E+F +D  SGE+S    ++     +Y+L V A+D  +   +  A + V V+D+  
Sbjct  2180  KKGNGELFKLDRKSGELSIKQHVEGHN-RNYELTVAAYDGAITPCSSEAPLQVKVIDR--  2236

Query  455   NPPRFTRLF-NVNVTENSEIGTFVIRITTTDLDMEHNANVTYSFTENS-SNKFTIDPISG  512
             + P F + F  V+V E+ E+ + +    +  ++ E     +  +T +S S  F ID  +G
Sbjct  2237  SMPVFEKQFYTVSVKEDVEMYSAL----SVSIEAESPLGRSLIYTISSESQSFEIDYNTG  2292

Query  513   NVTVAGNLDREVQDEYLLKVVATD--RAWITETPLTISVQDQNDNPPEFEKQTYYFHFPE  570
             ++ V   LD E    + + + ATD       E  L++S+ D ND  PE E   Y    PE
Sbjct  2293  SIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPE  2352

Query  571   LQEKMAHIGQVVASDEDKLGANSDVSYSL-----LQPSDLFSIDPAMGDIYCKKTMRYKY  625
                    I ++ A+D D  GAN+ +SY +        S+LF ID   G++Y K  + Y+ 
Sbjct  2353  NASFGTQILKINATDNDS-GANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQ  2411

Query  626   TKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPS  685
              K      NV        D+G P LSS++ V++ + D N++AP F   +Y   V      
Sbjct  2412  IKYHHIVVNV-------KDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVR  2464

Query  686   NKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTI  745
              + VA   A D+ D      +EY IV GN    + ++  +G I + ++M  F T    T+
Sbjct  2465  GQFVALPKAYDK-DISDTDSLEYKIVYGNELQTYSIDKLTGVISL-QNMLNF-TDKSSTV  2521

Query  746   KGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSD  805
                +   GV      +  +L+   EN ++P F   +Y+ +VPEN      I+TV A D D
Sbjct  2522  LNISVSDGVHTAYARLKISLL--PENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGD  2579

Query  806   SGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAV  865
              G    + YEI +   +  F I   TG IT     D +   EY + +   D G   K   
Sbjct  2580  FGTYANLYYEIVSEEMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGG--GKFGF  2637

Query  866   ATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGT  925
             A+L V V DVNDN P F    Y+  +     +   +  V A D D      + ++I+  +
Sbjct  2638  ASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKS  2697

Query  926   G----KEYFNIEQSTGIIKSKTTFDYEEVNEYTLDVIAAN---PDTNSQVVGATTVLVHI  978
                  K+   I + TG I  K+  +   VN Y   V A++   P  +S+V     V + I
Sbjct  2698  NDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFFVRASDRGEPQFHSEV----PVSIEI  2753

Query  979   TGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRGFSI  1038
                +   P F +    + + ES   GT +  +          G   + F  +++   F I
Sbjct  2754  IETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMI-------GNYTFKFSIAADQDHFMI  2806

Query  1039  GSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQIIISIQDGNDP-PEFLEN  1097
              S++G + + + LDRE Q    L V+A+ +          A ++I ++D ND  P+F   
Sbjct  2807  -SDSGELILQQTLDREQQESHNLIVVAETSTVPVF--FAYADVLIDVRDENDNYPKFDNT  2863

Query  1098  LYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGG--NVGQAFKIDPQSGDLETA  1155
              Y ASV E       ++ V A D D  P N    Y +     N+   F ID  SG +   
Sbjct  2864  FYSASVAENSEKVISLVKVSATDADTGP-NGDIRYYLESDTENIQNIFDIDIYSGWITLL  2922

Query  1156  KHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPA  1215
               LDRE    Y   + A D G P       V I+++D NDN PVF        V EN   
Sbjct  2923  TSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALP  2982

Query  1216  GTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFL  1275
             GT ++ L   DPD+      F   ++ G +     + K SG L   + LDRE     +  
Sbjct  2983  GTVLINLLLIDPDIEKQEMDF--FIVSGDKQAQFQIGK-SGELFIAKPLDREQLMFYNLS  3039

Query  1276  VEVEDSGTPRLSSEHAITVHVLDQNDS  1302
             +   D    + +++  + + V D ND+
Sbjct  3040  IIATDG---KFTAKANVEIDVKDINDN  3063


 Score = 302 bits (774),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 349/1302 (27%), Positives = 551/1302 (42%), Gaps = 145/1302 (11%)

Query  145   RFSSPRYTAYVPD-----TTSKGDFVFGAKASDDDEGDNSRIVYRL-HGKDARRFGVDSR  198
             RFS   Y   +P+     T +KG  V   + +    G N+ + YR+  G   + F  + +
Sbjct  61    RFSHSVYNVTIPENSLGKTYAKG--VLHERLAGLRVGLNAEVKYRIISGDKEKLFKAEEK  118

Query  199   SGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQ--------------  244
                   + D A     T    +  +   +E   + V   VHL +R               
Sbjct  119   -----LVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRNVSSYETEANIHIKV  173

Query  245   -----LFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLR  299
                  L P F P T+    + ED P+ + +  ++A     G   E+ + +      +   
Sbjct  174   LDRNDLSPLFYP-TQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMD--SEYFA  230

Query  300   IEPRTGDVVIASGFDYETLPSYEAWVEVRDSGN-----PSLRSVIQLLVNVTDANDNAPV  354
             I P TG++ +     Y     +E  V   D G+         S  ++ ++V   N  AP 
Sbjct  231   IHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVNFYAPE  290

Query  355   MDMPNYNASVPEEDYPPSRVARVSAKDADSGENSEITYHLLNDF--DEVFVI------DE  406
             +    +++  P  +  P     V   D D+G N  I    + D   D  F++      DE
Sbjct  291   IFTKTFSSVTPTSN--PLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDE  348

Query  407   FSGEISTNSMLDREKVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTR-LFNV  465
             +  E++  + L+++    Y L + A D G PR     +V + +  ++ N P FT+ ++ V
Sbjct  349   YYIELNQFAHLNQQHFI-YNLTLLAEDLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEV  407

Query  466   NVTENSEIGTFVIRITTTDLDMEHNANVTYSFTE-NSSNKFTIDPISGNVTVAGNLDREV  524
             ++ E + I   VIR+  +D D+  NA V       N  ++F I+P SG +  A  LD E 
Sbjct  408   SIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEK  467

Query  525   QDEYLLKVVATDRAWI-----TETPLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIG  579
             +  Y L V A D+A +     +   + ISVQD NDN P FE         E     + + 
Sbjct  468   KSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVV  527

Query  580   QVVASDEDKLGANSDVSYSLLQPSDL-FSIDPAMGDIYCKKTMRYKYTKSRASPENVYSF  638
             ++ A D D  G NS +SYS+   + + F ID   G +     + ++  K        Y  
Sbjct  528   KLTAKDRDS-GENSYISYSIANLNAVPFEIDHFSGIVKTTSLLDFETMKRN------YEL  580

Query  639   YVVAMDNGKPPLSSKTLVYVNIV--DANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASD  696
              + A D G P    +T + ++IV  D N++ P+FE       V +  P   +V  FV S 
Sbjct  581   IIRASDWGLP-YRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEV--FVTS-  636

Query  697   REDFGVNAEIEYFIVAGNGSDYFYVEPNSGWIYIKKSMAEFNTGTVFTIKGKATD-----  751
               DF     I Y +  GN    F ++P SG + I   + +  T T   +K  ATD     
Sbjct  637   AIDFDAGDIISYRLSDGNEDGCFNLDPTSGSLSISCDLKK-TTLTNRILKVSATDGTHFS  695

Query  752   -------------------------------KGVPVRSDE----------------IWAT  764
                                             GV  R  E                +++ 
Sbjct  696   DDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSD  755

Query  765   LIVT----GENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGN  820
             L +T    G+N H P F     ++ + E+     T+  + A D D G NG + + IS G+
Sbjct  756   LSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGD  815

Query  821   ERHEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPP  880
                 F I P  G + I+  LD +   EY LNIT  DLG  +KS    L + + DVNDN P
Sbjct  816   YDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRP  875

Query  881   KFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTGIIK  940
                ++L    L E++     V  + ATD DS   + + Y +        F +  +TG ++
Sbjct  876   VIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL--SVECSDFTVNATTGCLR  933

Query  941   SKTTFDYEEVNEYTLDVIAANPDTNSQVVGA-TTVLVHITGVNEFYPKFIQPVFHMDVSE  999
                  D E+ + Y L + A   D  S V+ +   V V +  VN+  P F    +   V E
Sbjct  934   LNKPLDREKQDNYALHITAK--DGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVRE  991

Query  1000  SAEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRG-FSIGSETGVISISRRLDRETQNR  1058
                 GT + +++A D+D G + ++ +     + D   F I   TG I     LD E +  
Sbjct  992   DLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQV  1051

Query  1059  AILTVMAKNAGGIRGNDTDEAQIIISIQDGND---PPEFLENLYEASVPEGENTGSKILT  1115
               L V A + G    + T +  I+I I D N+    PEF + +YE  V E +  G+ ++ 
Sbjct  1052  HNLIVSAIDGGD--PSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMN  1109

Query  1116  VRAVDKDVRPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKHLDRETVQSYELIIGAIDT  1175
             V A D D    N++ +YSI GG+    F ++ Q G + +   LD ET   Y L + A D 
Sbjct  1110  VTARDMDTVDLNSKITYSITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLCAQDC  1168

Query  1176  GSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAP  1235
                P +    V I++ + NDN P+ D       V+E       I+TL A DPD+ P    
Sbjct  1169  AIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQT-  1227

Query  1236  FSYRLIGGKQMDLVHLEKHSGILKTT-RSLDREATPQLDFLVEVEDSGTPRLSSEHAITV  1294
              +Y ++ G  +    ++  +G++KTT R LDRE   +    V + D+G+P LSS   I V
Sbjct  1228  ITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVV  1287

Query  1295  HVLDQND-SPSSPRSVHVKVYSFNGQTPLGKIADVHPNDPDT  1335
              VLD ND SP   + V+ KV   +  T    I  VH  D D+
Sbjct  1288  SVLDINDNSPEFDQRVY-KVQVPSSATVNQSIFQVHAIDSDS  1328


 Score = 264 bits (674),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 248/879 (28%), Positives = 385/879 (44%), Gaps = 55/879 (6%)

Query  12    LVVVA--GTLPLT-SSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDR  68
             L+VVA   T+P+  +   V I V D ND+ P+F    Y A V EN      +    ATD 
Sbjct  2828  LIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDA  2887

Query  69    DDGLNAQIRYSLLGDG---AERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEP  125
             D G N  IRY L  D       F ++  +G I  L  LDRE    Y+  ++A D+   + 
Sbjct  2888  DTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKH  2947

Query  126   RASAANLTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRL  185
              A    +TI + D NDN P F  P     V +    G  +      D D        + +
Sbjct  2948  DAKVP-VTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIV  3006

Query  186   HGKDARRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWERQL  245
              G    +F +  +SG +   + L       Y L I A+D G      +V++ V       
Sbjct  3007  SGDKQAQFQI-GKSGELFIAKPLDREQLMFYNLSIIATD-GKFTAKANVEIDVKDINDNT  3064

Query  246   FPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTG  305
               C  P    R+ +  +       T +          S+L F ++G    D   I   +G
Sbjct  3065  PYCLKP----RYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKG-ADDFSIGKESG  3119

Query  306   DVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVP  365
              + +AS  D ET P Y+    V+D  + +     ++++ V D NDN P+  M  Y  SVP
Sbjct  3120  ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVP  3179

Query  366   EEDYPPSRVARVSAKDADSGENSEITYHLLNDFDEVFVIDEFSGEISTNSMLDREKVSSY  425
             E+    + + +V A D D G N +I Y L+ +  + F I + +G I  +  LDRE +S +
Sbjct  3180  EDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTGIIRLHKSLDRETISLF  3239

Query  426   KLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFT-RLFNVNVTENSEIGTFVIRITTTD  484
              L V+A D GVP+L   ATV V +LD NDNPP F+ R ++  + EN+  GT V ++  T 
Sbjct  3240  NLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATS  3299

Query  485   LDMEHNANVTYSFTE-NSSNKFTIDPISGNVTVAGNLDREVQDEYLLKVVATDRA---WI  540
             +D+  NA++ Y     N   KF +D  +G++ +   LD E+   Y L + A D       
Sbjct  3300  IDIGVNADIHYFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLS  3359

Query  541   TETPLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLL  600
                 + IS+ D NDN P F +  Y  +  E     + I  V A+DED    N  V+Y++ 
Sbjct  3360  NNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDS-DVNGLVTYNIE  3418

Query  601   QPSDL--FSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYV  658
             +  ++  FSIDP  G I   + +  + T S       Y+  + A D G P   +   + +
Sbjct  3419  RGDNIGQFSIDPKNGTISVSRPLD-RETISH------YTLEIQACDQGDPQRCNSVPINI  3471

Query  659   NIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDY  718
             NI+D N++AP F    Y   + E          F  SD ++        + I +GN    
Sbjct  3472  NILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGL  3531

Query  719   FYVEPNSGWIYIKKSMAEFNTGTV--FTIKGKATDKGVPVRSDEIWATLIVTGENKHAPA  776
             F +E +       ++ + FN      F I+ +  D G P    + W  + +  E+++ P 
Sbjct  3532  FRLEQDGSL----RTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPI  3587

Query  777   FAAVSYQVRVPENEPANTTILTVNAVDSD----------SGPNGMVRYEISAGNERHEFS  826
                +   +   E++ +   I  V+A D D          SGP+ M  Y+ S       F+
Sbjct  3588  VTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDM--YQSSK-----LFN  3640

Query  827   IHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAV  865
             I   TG I  +  LD   +  YKLN++  D  F   S V
Sbjct  3641  ISNNTGKIYAISNLD---IGLYKLNVSVSDGKFHVFSIV  3676


 Score = 120 bits (300),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 90/193 (47%), Gaps = 27/193 (14%)

Query  1474  KKSWRIETLLEGANVMIGYSPCKIDACNNGGVCSDKIVVYEDSRITDTPTLILTSPKVAH  1533
             K+   +E   + +NV++    C    C N G+C +           DT            
Sbjct  4096  KRFTNVEFKCDPSNVLVRLGICGSQPCANSGICKE----------LDTDVF---------  4136

Query  1534  EMVCKCRDGFTGEKCEKKQDPCSPNPCQSGGQCRRVG-FDFHCSCSPDREGKLCELERGD  1592
                C C+  ++G+ CE   DPCS  PC  GG+C   G  ++ C+C     GK CE   G 
Sbjct  4137  --ECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDYHGPNNYSCTCPIHLSGKRCEY--GK  4192

Query  1593  ACASNPCRNGGVCKESPDGSSFFCLCRTGYRGNHCEVLTDSCRPNPCLHGGLCVSEKPGY  1652
              C  NPC+NGG+C+E  DG S  C+CR GY G  CE+  D C   PC +G  C++E   +
Sbjct  4193  FCTPNPCKNGGICEEG-DGISH-CMCR-GYTGPTCEIDVDECENQPCGNGATCINEPGSF  4249

Query  1653  RCSCLEGRYGRHC  1665
             RC C     G  C
Sbjct  4250  RCICPSYLTGASC  4262


 Score = 92.4 bits (228),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 117/493 (24%), Positives = 206/493 (42%), Gaps = 38/493 (8%)

Query  860   ASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSV---  916
             A +   ATL   + +   +  +F+ S+Y   +PENS  + +   V+   +   +  +   
Sbjct  40    ADEKHTATLEYRLENQLQDLYRFSHSVYNVTIPENSLGKTYAKGVLHERLAGLRVGLNAE  99

Query  917   IQYRIIGGTGKEYFNIEQ------STGIIKSKT---TFDYEEVNEYTLDVIAANPDTNSQ  967
             ++YRII G  ++ F  E+      +   I+++T     + E+  EY + V A     +  
Sbjct  100   VKYRIISGDKEKLFKAEEKLVGDFAFLAIRTRTNNVVLNREKTEEYVIRVKAHVHLHDRN  159

Query  968   VVGATT---VLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVY  1024
             V    T   + + +   N+  P F    + + + E       +  V A D D G +G++Y
Sbjct  160   VSSYETEANIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIY  219

Query  1025  YLFVGSSNDRGFSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEA---QI  1081
             Y  +  S    F+I   TG I++ ++L     +   LTV+A + G    +   +A   ++
Sbjct  220   YSLLMDS--EYFAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKV  277

Query  1082  IISIQDGN-DPPEFLENLYEASVPEGENTGSKIL--TVRAVDKDVRPQNNQFSYSIIGGN  1138
              IS++  N   PE     + +  P    T + ++   VR  DKD     N     I+ GN
Sbjct  278   SISVKQVNFYAPEIFTKTFSSVTP----TSNPLIYGIVRVNDKDTGINGNIGRLEIVDGN  333

Query  1139  VGQAFKI------DPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLD  1192
                 F +      D    +L    HL+++    Y L + A D G+P +    +V I++  
Sbjct  334   PDGTFLLKAAETKDEYYIELNQFAHLNQQHF-IYNLTLLAEDLGTPRRFAYKSVPIQIKP  392

Query  1193  VNDNGPVFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLE  1252
              + N P+F  +     + E  P    ++ L  +DPDL  N   +   ++GG + D   + 
Sbjct  393   ESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVY-LEIVGGNEGDEFRIN  451

Query  1253  KHSGILKTTRSLDREATPQLDFLVEVEDSGT--PRLSSEHAITVHVLDQNDSPSSPRSVH  1310
               SG+L T + LD E        V   D      R  S   + + V D ND+     +V+
Sbjct  452   PDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVN  511

Query  1311  VKVYSFNGQTPLG  1323
              KV S N     G
Sbjct  512   -KVISINENNLAG  523


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 41/84 (49%), Gaps = 2/84 (2%)

Query  1588  LERGDACASNPCRNGGVCKESPDGSSFFCLCRTGYRGNHCEVLTDSCRPNPCLHGGLCVS  1647
             L R   C S PC N G+CKE  D   F C C+  Y G HCE+  D C   PCL GG C  
Sbjct  4111  LVRLGICGSQPCANSGICKE-LDTDVFECACQPRYSGKHCEIDLDPCSSGPCLFGGRCDY  4169

Query  1648  EKP-GYRCSCLEGRYGRHCERSTF  1670
               P  Y C+C     G+ CE   F
Sbjct  4170  HGPNNYSCTCPIHLSGKRCEYGKF  4193


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 110/260 (42%), Gaps = 32/260 (12%)

Query  1858  STC---PRSDGGPCSRSREAGNACGQGKCYDKWDKSTCQCGKVMAPNCQGAVEPITLSDG  1914
             +TC   P  DG  C   +E  NAC    C  +  +     G  +   C   V P   S G
Sbjct  3849  NTCVCRPGFDGKHC---KETVNACSTDPCSPQ--RICMPSGSALGYQC---VCPKGFS-G  3899

Query  1915  GYVEYEISEKHRR---MQLLEYL-YGGTTHWH---DGLPSRYTEENAISVIPTSTPAKSI  1967
              Y E + S+       M L   + +GG ++ H   + + +++T EN  S           
Sbjct  3900  TYCERKSSKCSNESCDMGLFTAVSFGGKSYAHYKINKVKAKFTLENGFSY----------  3949

Query  1968  HLMFRTVKPDGILVYAATNRHYTSIELRHGQISYASLLSSPVNMSGSHEGSLADGRWHNL  2027
              L  RTV+  G L+YA+    Y  +E+ +G + Y   L S   +      +++DG WH +
Sbjct  3950  SLQIRTVQQTGTLLYASGKVDYNILEIINGAVQYRFDLGSGEGVISVSSINISDGEWHQI  4009

Query  2028  TLHSYARGLKLYVDEKLSGEELDSAGVHDFLDPYLTLLTVGG-VRPD-QYMAYDGPPKPF  2085
             +L       K+ VD K       + GV+  L+     + VG  VRP    + Y+   + F
Sbjct  4010  SLERSLNSAKVMVDNKHVSHG-SAPGVNGILNIQSNDIFVGAEVRPHPSIIGYEDIQRGF  4068

Query  2086  EGCLANFTINREVQPFNGSG  2105
              GC+AN  I +E  P   SG
Sbjct  4069  IGCMANIKIAKESLPLYISG  4088


>STAN_DROME unnamed protein product
Length=3579

 Score = 461 bits (1187),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 477/1757 (27%), Positives = 754/1757 (43%), Gaps = 233/1757 (13%)

Query  452   KNDNPPRFTRLFNVNVTENSEIGTFVIRITTTDLDMEHNANVTYSFTE----NSSNKFTI  507
             +N +P     L+  +V E    G  V  +   D +   ++ V YS        S + F +
Sbjct  353   RNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPE---DSPVVYSMVSLLDSRSQSLFKV  409

Query  508   DPISGNVTVAGNLDREVQDEYLLKVVATDRAWITE---TPLTISVQDQNDNPPEFEKQTY  564
             D  +G VT + +LDRE+ D +  +VVATD ++      T L ++V D ND+ P FE + +
Sbjct  410   DSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQF  469

Query  565   YFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPSD-----------LFSIDPAMG  613
                  E     + +  + A+D+D +G N+++ Y +   +D           +F ID   G
Sbjct  470   EASIREGATVGSTVITLRATDQD-IGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSG  528

Query  614   DIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTL---VYVNIVDANNHAPKF  670
              I  + ++  + + S       Y   V A D        +T    V V ++D N++ P+F
Sbjct  529   VISTRSSLDRETSDS-------YHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQF  581

Query  671   EHRAYLWPVPE---GYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSDYFYVEPNSGW  727
               R Y   VPE   G   +  VA   A+D  D G NA I Y I+ GN    F ++  SG 
Sbjct  582   SERTYTVQVPEDQWGGTEDNTVAHIRATD-ADQGNNAAIRYAIIGGNTQSQFSIDSMSGD  640

Query  728   IYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAVSYQVRVP  787
             + + K + ++ +   + +  +A D G P RS+     + V   N +AP F    +Q  V 
Sbjct  641   VSLVKPL-DYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVL  699

Query  788   ENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGAITILEALDYDTVTE  847
             EN P    I+ V A DSD G N  + Y IS  ++    ++ P TG +  ++ LD +    
Sbjct  700   ENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGR  759

Query  848   YKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVAT  907
             +   + A+D G   KSA +++++ V DVNDN P FN   Y+A + E+ P    V  V AT
Sbjct  760   FAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTAT  819

Query  908   DIDSPKYSVIQYRIIGGTGKEYFNI--EQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTN  965
             D D  + S + Y I  G  +  F I  +   G+I    + DY++   + L V A +    
Sbjct  820   DPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGR  877

Query  966   SQVVGATTVLVHITGVNEFYPKFIQPVFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYY  1025
             S      TV ++IT  N F P F    +   V E A +GT V +V ATD D G + ++ Y
Sbjct  878   SDTA---TVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITY  934

Query  1026  -LFVGSSNDRG----FSIGSETGVISISRRLDRETQNRAILTVMAKNAGGIRGNDTDEAQ  1080
              L   S N  G    FSI  +TG I  +  LDRET +  +LTV AK+ G    +DT + +
Sbjct  935   SLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVE  994

Query  1081  IIISIQDGND-PPEFLENLYEASVPEGENTGSKILTVRAVDKDVRPQNNQFSYSIIGGNV  1139
               I + D ND  P F   LY+AS+ E    G+ ++ V A D DV   N +  Y +   ++
Sbjct  995   --IGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDV-GLNGRIKYLLSDRDI  1051

Query  1140  GQ-AFKIDPQSGDLETAKHLDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGP  1198
                +F IDP SG + T K LDRE+V  + L   A+D GSPP + +  V+I L DVND+ P
Sbjct  1052  EDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPP  1111

Query  1199  VFDFKEIVGYVSENEPAGTSIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSG--  1256
              F   +I  YV EN P G+ +  + A DPD   N A   Y +IGG   +   L    G  
Sbjct  1112  TFASDKITLYVPENSPVGSVVGEIHAHDPDEGVN-AVVHYSIIGGDDSNAFSLVTRPGSE  1170

Query  1257  --ILKTTRSLDREAT-PQLDFLVEVEDSGTPRLSSEHAITVHVLDQNDSPSSPRSVHVKV  1313
                L T   LD E+T  + + +V    + +P L ++  I + V D ND+    R   V  
Sbjct  1171  RAQLLTMTELDYESTRKRFELVVR---AASPPLRNDAHIEILVTDVNDNAPVLRDFQVIF  1227

Query  1314  YSFNGQTPLGKIADVHPNDPDTSGDYTCRILQG----------SAGPLNIPAACDLHAGK  1363
              +F    P G+I  +   D D S     RIL G          S+G L +    + +  K
Sbjct  1228  NNFRDHFPSGEIGRIPAFDADVSDKLHYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPK  1287

Query  1364  ITPGIGYSLSVSGNDG-RHPDVVSKVSLEFLTFSNATVENTVTMQIVRMKTVDFLGKYYV  1422
                    ++ VS +DG      + ++S+  +T     + N+VT+++  M    FL     
Sbjct  1288  FA-----TMEVSVSDGINEAKAIMQLSVRLIT--EDMLFNSVTVRLNEMTEEAFLSPLLN  1340

Query  1423  ALLDLLQEELDV-GDTLGIYSI-DEIDGHTEVYMAMHSSQGYRTKHE---VKEILTKKSW  1477
               LD L   +    + + ++SI D+ D  + +     S++     HE     + L ++ +
Sbjct  1341  FFLDGLAAIIPCPKEHIFVFSIQDDTDVSSRILNVSFSARRPDVSHEEFYTPQYLQERVY  1400

Query  1478  RIETLLEGANVM----IGYSPCKIDACNNGGVCSDKIVVYEDSRITDTPTLILTSPKVAH  1533
                 +L     +       + C  + C N   C   +     S    + T++       +
Sbjct  1401  LNRAILARLATVEVLPFDDNLCVREPCLNFEECLTVLKFGNASEFIHSDTVLFRPIYPVN  1460

Query  1534  EMVCKCRDGFTGEK----CEKKQDPCSPNPCQSGGQCRRVGFDFHCSCSPDREGKLCELE  1589
                C C +GFTG K    C+ + D C  +PCQ+GG C R    + C C     G+ CE  
Sbjct  1461  TFACSCPEGFTGSKEHYLCDTEVDLCYSDPCQNGGTCVRREGGYTCVCPSTHTGQNCETG  1520

Query  1590  RGDACASNPCRNGGVCKESPDGSSFFCLCRTGYRGNHCEVLTDSCRPNPCLHGGL-CVSE  1648
              G      PC                                    P+    GGL C+S 
Sbjct  1521  VGHL---RPC------------------------------------PSETCEGGLSCLSN  1541

Query  1649  KPGYRCSCLEGRYGRHCERSTFSFDELSYMTFPSLDSNTN-DVTIVFATTKPNALLLYNY  1707
              P    S     Y   CE    +F   S++TF SL      ++ + FAT + N LLLYN 
Sbjct  1542  YP----SSQPPPYTATCELRARAFGRNSFLTFESLKQRHRFNLKLRFATVQENGLLLYN-  1596

Query  1708  GVQSGGR----SDFIVLELVNGKLVFSCGGARSAITTLTVKSDKSLADGSWNKVTATRNG  1763
                  GR     DFI LE+  G + FS      +   ++V  +  ++DG W++V      
Sbjct  1597  -----GRYNELHDFIALEIHEGHVSFSFSLGDHS-ERISVIQEAKVSDGKWHQVEVVYLN  1650

Query  1764  RVVSLSVSKCKE----HGDLCDDCRPGDGTCYAEDVG---LTGTLNFNKN---PLLLGGL  1813
             R V+L +  C       G L D     + T    D     LT T +   +   PL +GGL
Sbjct  1651  RSVTLVLDNCDTAIALSGQLGDRWSCANRTTLKLDKRCSLLTETCHRFLDLTGPLQVGGL  1710

Query  1814  VNSDPVLERPGQIHSDDLVGCIHSVSINGRALNLSSPLSSRGIKSTCPRSDGGPCSRSRE  1873
                 P +     + + D VGCI  + I+ R ++L+S ++  G  + CP+    P  +S  
Sbjct  1711  ----PRIPAHFPVTNRDFVGCISDLRIDDRFVDLNSYVADNGTLAGCPQK--APLCQSEP  1764

Query  1874  AGNACGQGKCYDKWDKSTCQCGKVMAPN-CQGAVEPITLSDGGYVEYEISEKHRRMQLLE  1932
               N    G C + W   +C+C +  A N CQ  +                          
Sbjct  1765  CFNG---GTCREGWGTYSCECPEGYAGNSCQDNIPA------------------------  1797

Query  1933  YLYGGTTHWHDGLPSRYTEENAISVIPTSTPAK---SIHLMFRTVKPDGILVYAATNRHY  1989
                          P R++ + ++S  P   P +   +     RT + +  L+     ++ 
Sbjct  1798  -------------PWRFSGDGSLSFNPLLRPIQLPWTTSFSLRTRQKEAFLLQIQIGQNS  1844

Query  1990  T-SIELRHGQISYASLLSSPVNMSGSHEGSLADGRWHNLTLHSYARGLKLY--VDE-KLS  2045
             + ++ LR G + Y      P+ ++G+    L+DG WH + +  + +G +++  VD  + S
Sbjct  1845  SAAVCLRQGVLYYI-FDGEPMYLAGAF---LSDGEWHRVEIR-WQQGSEIHFSVDYGQRS  1899

Query  2046  GEELDSAGVHDFLDPYLTLLTVGGVRPDQYMAYDGPPKPFEGCLANFTINREVQPFNGSG  2105
             G    S  V      Y+  + +G   PD  +       PFEGC+ +  I        G+G
Sbjct  1900  GSVPMSQKVQGL---YVGKIVMGS--PDGSIGAVPEASPFEGCIQDVRI--------GAG  1946

Query  2106  -SIMKDTIYHGKVNHGC  2121
              S++        V  GC
Sbjct  1947  QSVLSRPTIRENVEDGC  1963


 Score = 337 bits (865),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 286/946 (30%), Positives = 441/946 (47%), Gaps = 64/946 (7%)

Query  33    DVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYSLLGDGAER-FQVN  91
             ++ + +P F +  Y A V+E    GA V    A D +D        SLL   ++  F+V+
Sbjct  351   ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVSLLDSRSQSLFKVD  410

Query  92    SSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAANLTISVRDSNDNTPRFSSPRY  151
             S TG + T   LDRE  DV++  +VA D S   PR+    L ++V D ND++P F + ++
Sbjct  411   SRTGVVTTSASLDRELMDVHYFRVVATDDS-FPPRSGTTTLQVNVLDCNDHSPTFEAEQF  469

Query  152   TAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYRLHG----------KDARRFGVDSRSGV  201
              A + +  + G  V   +A+D D G N+ I Y +            ++   F +DSRSGV
Sbjct  470   EASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV  529

Query  202   VRALEDLAMGGQNTYQLQIEASDCGS---EPRAVSVDLVVH-LWERQLFPCFGPGTETRF  257
             +     L     ++Y L + A+D  S   E R  +  + V  L +   +P F   T T  
Sbjct  530   ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYT-V  588

Query  258   TLRED---APEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPRTGDVVIASGFD  314
              + ED     E   V  + A+    G  + + + + GGN      I+  +GDV +    D
Sbjct  589   QVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLD  648

Query  315   YETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNASVPEEDYPPSRV  374
             YE++ SY   +  +D G+PS  +  QLLVNV DANDNAP      +  SV E       +
Sbjct  649   YESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNI  708

Query  375   ARVSAKDADSGENSEITYHLLNDFDEV-FVIDEFSGEISTNSMLDREKVSSYKLIVEAWD  433
              RV A D+D G N+EITY +    D     +D  +G + T   LDRE+   +   V A D
Sbjct  709   IRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKD  768

Query  434   RGVPRLTGTATVFVTVLDKNDNPPRFT-RLFNVNVTENSEIGTFVIRITTTDLDMEHNAN  492
              GVP  + +++V +TV D NDN P F  + +  NV E+   GT V  +T TD D   ++ 
Sbjct  769   GGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD--EDSR  826

Query  493   VTYSFTE-NSSNKFTIDPISGN--VTVAGNLDREVQDEYLLKVVATDRAWITETP-LTIS  548
             + Y  T  N+  +F I   +G   +T+A +LD + +  +LL V ATD    ++T  + I+
Sbjct  827   LHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHIN  886

Query  549   VQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLGANSDVSYSLLQPS-----  603
             + D N+  P FE   Y     E       +  V A+D D +G N+ ++YSL + S     
Sbjct  887   ITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD-VGVNAQITYSLNEESINGLG  945

Query  604   --DLFSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNGKPPLSSKTLVYVNIV  661
               D FSI+P  G I     +  + T         Y   V A D G P LS  T V + + 
Sbjct  946   SPDPFSINPQTGAIVTNAPLDRETTSG-------YLLTVTAKDGGNPSLSDTTDVEIGVT  998

Query  662   DANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEIEYFIVAGNGSD-YFY  720
             D N++AP F+   Y   + E       V Q  ASD  D G+N  I+Y +   +  D  F 
Sbjct  999   DVNDNAPAFKSPLYQASILEDALVGTSVIQVAASD-PDVGLNGRIKYLLSDRDIEDGSFV  1057

Query  721   VEPNSGWIYIKKSMAEFNTGTVFTIKGKATDKGVPVRSDEIWATLIVTGENKHAPAFAAV  780
             ++P SG I   K + +  +  VF +   A DKG P  S  +   + +   N   P FA+ 
Sbjct  1058  IDPTSGTIRTNKGL-DRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASD  1116

Query  781   SYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNERHEFSIHPITGA----ITI  836
                + VPEN P  + +  ++A D D G N +V Y I  G++ + FS+    G+    +  
Sbjct  1117  KITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLT  1176

Query  837   LEALDYD-TVTEYKLNITARDLGFASKSAVATLIVNVSDVNDNPPKFNQSLYQAYLPENS  895
             +  LDY+ T   ++L + A      + + +  L   V+DVNDN P      +Q     N+
Sbjct  1177  MTELDYESTRKRFELVVRAASPPLRNDAHIEIL---VTDVNDNAPVLRD--FQVIF--NN  1229

Query  896   PSQHF----VFKVVATDIDSPKYSVIQYRIIGGTGKEYFNIEQSTG  937
                HF    + ++ A D D      + YRI+ G       +  S+G
Sbjct  1230  FRDHFPSGEIGRIPAFDADVSDK--LHYRILSGNNANLLRLNSSSG  1273


 Score = 295 bits (755),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 272/943 (29%), Positives = 436/943 (46%), Gaps = 64/943 (7%)

Query  20    PLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQIRYS  79
             P + + ++++ VLD NDH+P F  +++ A + E   VG+ V    ATD+D G NA+I Y 
Sbjct  443   PRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYG  502

Query  80    L--LGDGAER--------FQVNSSTGEIVTLEPLDREQHDVYHLTLVAQD--SSPTEPRA  127
             +  + DGA          F+++S +G I T   LDRE  D YHL + A D  S+ +E R 
Sbjct  503   IEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRT  562

Query  128   SAANLTISVRDSNDNTPRFSSPRYTAYVPDTTSKG---DFVFGAKASDDDEGDNSRIVYR  184
             + A++ + V D NDN P+FS   YT  VP+    G   + V   +A+D D+G+N+ I Y 
Sbjct  563   ATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYA  622

Query  185   LHGKDAR-RFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHLWER  243
             + G + + +F +DS SG V  ++ L      +Y+L I A D GS  R+ +  L+V++ + 
Sbjct  623   IIGGNTQSQFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDA  682

Query  244   QLFPCFGPGTETRFTLREDAPEGRVVTTLSASTPKTGPASELVFGMAGGNVGDSLRIEPR  303
                      ++ + ++ E+ P G  +  + A     G  +E+ + ++  +    L ++PR
Sbjct  683   NDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPR  742

Query  304   TGDVVIASGFDYETLPSYEAWVEVRDSGNPSLRSVIQLLVNVTDANDNAPVMDMPNYNAS  363
             TG V      D E    +   V  +D G P   +   +++ V D NDN P  +   Y A+
Sbjct  743   TGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEAN  802

Query  364   VPEEDYPPSRVARVSAKDADSGENSEITYHLLN-DFDEVFVIDEFSGE--ISTNSMLDRE  420
             V E+  P + V  V+A D D  E+S + Y +   +    F I   +G   I+    LD +
Sbjct  803   VGEDQPPGTPVTTVTATDPD--EDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYK  860

Query  421   KVSSYKLIVEAWDRGVPRLTGTATVFVTVLDKNDNPPRFTRL-FNVNVTENSEIGTFVIR  479
             +   + L V A D G    + TATV + + D N+  P F    ++ +V E++ +GT V+ 
Sbjct  861   QEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLV  918

Query  480   ITTTDLDMEHNANVTYSFTENSSN------KFTIDPISGNVTVAGNLDREVQDEYLLKVV  533
             ++ TD D+  NA +TYS  E S N       F+I+P +G +     LDRE    YLL V 
Sbjct  919   VSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVT  978

Query  534   ATDR---AWITETPLTISVQDQNDNPPEFEKQTYYFHFPELQEKMAHIGQVVASDEDKLG  590
             A D    +    T + I V D NDN P F+   Y     E       + QV ASD D +G
Sbjct  979   AKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPD-VG  1037

Query  591   ANSDVSYSLLQPSDL----FSIDPAMGDIYCKKTMRYKYTKSRASPENVYSFYVVAMDNG  646
              N  + Y LL   D+    F IDP  G I   K +  +          V+    +A+D G
Sbjct  1038  LNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVA-------VFHLTAIAVDKG  1089

Query  647   KPPLSSKTLVYVNIVDANNHAPKFEHRAYLWPVPEGYPSNKKVAQFVASDREDFGVNAEI  706
              PPLSS   V + + D N+  P F        VPE  P    V +  A D  D GVNA +
Sbjct  1090  SPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHD-PDEGVNAVV  1148

Query  707   EYFIVAGNGSDYFYVEPNSGWIYIK-KSMAEFN---TGTVFTIKGKATDKGVPVRSDEIW  762
              Y I+ G+ S+ F +    G    +  +M E +   T   F +  +A     P+R+D   
Sbjct  1149  HYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASP--PLRNDA-H  1205

Query  763   ATLIVTGENKHAPAFAAVSYQVRVPENEPANTTILTVNAVDSDSGPNGMVRYEISAGNER  822
               ++VT  N +AP             +   +  I  + A D+D   +  + Y I +GN  
Sbjct  1206  IEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADV--SDKLHYRILSGNNA  1263

Query  823   HEFSIHPITGAITILEALDYDTVTEYKLNITARDLGFASKSAVATLIVNVSD----VNDN  878
             +   ++  +G + +   L+ +      + ++  D G     A+  L V +       N  
Sbjct  1264  NLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD-GINEAKAIMQLSVRLITEDMLFNSV  1322

Query  879   PPKFNQSLYQAYLPENSPSQHFVFKVVATDIDSPKYSVIQYRI  921
               + N+   +A+L   SP  +F    +A  I  PK  +  + I
Sbjct  1323  TVRLNEMTEEAFL---SPLLNFFLDGLAAIIPCPKEHIFVFSI  1362


 Score = 196 bits (497),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 146/477 (31%), Positives = 232/477 (49%), Gaps = 21/477 (4%)

Query  874   DVNDNPPKFNQSLYQAYLPENSPSQHFVFKVVATD-IDSP-KYSVIQYRIIGGTGKEYFN  931
             ++ +  P F Q+LY A + E  P+   V  V A D  DSP  YS++   ++    +  F 
Sbjct  351   ELRNQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSPVVYSMVS--LLDSRSQSLFK  408

Query  932   IEQSTGIIKSKTTFDYEEVNEYTLDVIAANPDTNSQVVGATTVLVHITGVNEFYPKFIQP  991
             ++  TG++ +  + D E ++ +   V+A + D+     G TT+ V++   N+  P F   
Sbjct  409   VDSRTGVVTTSASLDRELMDVHYFRVVATD-DSFPPRSGTTTLQVNVLDCNDHSPTFEAE  467

Query  992   VFHMDVSESAEIGTFVGLVQATDQDAGSDGKVYYLFVGSSNDRG---------FSIGSET  1042
              F   + E A +G+ V  ++ATDQD G + ++ Y     ++  G         F I S +
Sbjct  468   QFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRS  527

Query  1043  GVISISRRLDRETQNRAILTVMAKN-AGGIRGNDTDEAQIIISIQDGNDP-PEFLENLYE  1100
             GVIS    LDRET +   L V A + A       T  A + + + D ND  P+F E  Y 
Sbjct  528   GVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYT  587

Query  1101  ASVPEGENTGSK---ILTVRAVDKDVRPQNNQFSYSIIGGNVGQAFKIDPQSGDLETAKH  1157
               VPE +  G++   +  +RA D D +  N    Y+IIGGN    F ID  SGD+   K 
Sbjct  588   VQVPEDQWGGTEDNTVAHIRATDAD-QGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKP  646

Query  1158  LDRETVQSYELIIGAIDTGSPPQTGSTTVKIELLDVNDNGPVFDFKEIVGYVSENEPAGT  1217
             LD E+V+SY L+I A D GSP ++ +T + + ++D NDN P F   +    V EN P G 
Sbjct  647   LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGY  706

Query  1218  SIMTLSATDPDLPPNGAPFSYRLIGGKQMDLVHLEKHSGILKTTRSLDREATPQLDFLVE  1277
             +I+ + A D D   N A  +Y +        + ++  +G ++T + LDRE   +  F V 
Sbjct  707   NIIRVQAYDSDEGAN-AEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVV  765

Query  1278  VEDSGTPRLSSEHAITVHVLDQNDSPSSPRSVHVKVYSFNGQTPLGKIADVHPNDPD  1334
              +D G P  S+  ++ + V D ND+  +    + +      Q P   +  V   DPD
Sbjct  766   AKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPD  822


 Score = 105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 72/194 (37%), Positives = 106/194 (55%), Gaps = 8/194 (4%)

Query  16    AGTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDGLNAQ  75
              G   L+ +  V I V DVND+AP F    Y+A ++E+  VG  V    A+D D GLN +
Sbjct  982   GGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGR  1041

Query  76    IRYSL----LGDGAERFQVNSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPRASAAN  131
             I+Y L    + DG+  F ++ ++G I T + LDRE   V+HLT +A D   + P +S   
Sbjct  1042  IKYLLSDRDIEDGS--FVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG-SPPLSSTVE  1098

Query  132   LTISVRDSNDNTPRFSSPRYTAYVPDTTSKGDFVFGAKASDDDEGDNSRIVYR-LHGKDA  190
             + I + D ND+ P F+S + T YVP+ +  G  V    A D DEG N+ + Y  + G D+
Sbjct  1099  VQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDS  1158

Query  191   RRFGVDSRSGVVRA  204
               F + +R G  RA
Sbjct  1159  NAFSLVTRPGSERA  1172


 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 110/246 (45%), Gaps = 21/246 (9%)

Query  12    LVVVAGTLPLTSSGSVRILVLDVNDHAPEFGRQEYRAEVMENLAVGAWVANPLATDRDDG  71
             + V  G+ PL+S+  V+I + DVND  P F   +    V EN  VG+ V    A D D+G
Sbjct  1084  IAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEG  1143

Query  72    LNAQIRYSLL-GDGAERFQV----NSSTGEIVTLEPLDREQHDVYHLTLVAQDSSPTEPR  126
             +NA + YS++ GD +  F +     S   +++T+  LD E        LV + +SP  P 
Sbjct  1144  VNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTR-KRFELVVRAASP--PL  1200

Query  127   ASAANLTISVRDSNDNTPRFSSPR-----YTAYVPDTTSKGDFVFGAKASDDDEGDNSRI  181
              + A++ I V D NDN P     +     +  + P         F A  SD       ++
Sbjct  1201  RNDAHIEILVTDVNDNAPVLRDFQVIFNNFRDHFPSGEIGRIPAFDADVSD-------KL  1253

Query  182   VYR-LHGKDARRFGVDSRSGVVRALEDLAMGGQNTYQLQIEASDCGSEPRAVSVDLVVHL  240
              YR L G +A    ++S SG +     L         +++  SD  +E +A+    V  +
Sbjct  1254  HYRILSGNNANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSDGINEAKAIMQLSVRLI  1313

Query  241   WERQLF  246
              E  LF
Sbjct  1314  TEDMLF  1319


 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 97/281 (35%), Gaps = 49/281 (17%)

Query  1634  CRPNPCLHGGLCVSEKPGYRCSCLEGRYGRHCERST---FSFDELSYMTF-PSLDSNTND  1689
             C+  PC +GG C      Y C C EG  G  C+ +    + F     ++F P L      
Sbjct  1760  CQSEPCFNGGTCREGWGTYSCECPEGYAGNSCQDNIPAPWRFSGDGSLSFNPLLRPIQLP  1819

Query  1690  VTIVFA--TTKPNALLLYNYGVQSGGRSDFIVLELVNGKLVFSCGGARSAITTLTVKSDK  1747
              T  F+  T +  A LL    +Q G  S   V  L  G L +   G    +      +  
Sbjct  1820  WTTSFSLRTRQKEAFLLQ---IQIGQNSSAAVC-LRQGVLYYIFDGEPMYL------AGA  1869

Query  1748  SLADGSWNKVTAT-RNGRVVSLSVSKCKEHGDLCDDCRPGDGTCYAEDVGLTGTLNFNKN  1806
              L+DG W++V    + G  +  SV   +  G +                     ++    
Sbjct  1870  FLSDGEWHRVEIRWQQGSEIHFSVDYGQRSGSV--------------------PMSQKVQ  1909

Query  1807  PLLLGGLVNSDPVLERPGQIHSDDLVGCIHSVSINGRALNLSSPLSSRGIKSTCPRSDGG  1866
              L +G +V   P         +    GCI  V I      LS P     ++  C      
Sbjct  1910  GLYVGKIVMGSPDGSIGAVPEASPFEGCIQDVRIGAGQSVLSRPTIRENVEDGCE-----  1964

Query  1867  PCSRSREAGNACGQGKCYDKWDKSTCQC-----GKVMAPNC  1902
               SR++   +      C   WD STC+C     G   AP C
Sbjct  1965  --SRAQCPDHCPNHSSCQSSWDLSTCECDSGYVGTDCAPIC  2003


 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 60/157 (38%), Gaps = 25/157 (16%)

Query  1537  CKCRDGFTGEKCEKKQDPCSPNPCQSGGQCRR-----VGFDFHCSCSPDREGKLCELERG  1591
             C+C  G+ G  C      C+  PC SG  CR       G+D  C+ S  R G  CE E  
Sbjct  1988  CECDSGYVGTDCAPI---CTVRPCASG-VCRANTSLPRGYDCECNSS-SRHGDYCEKELQ  2042

Query  1592  DAC--------ASNPCRNGGVCKESPD--GSSFFCLCRTGYRGNHCEVLTDSCRPNPCLH  1641
               C           PCR        PD   ++  C C+T +     E    SC    C  
Sbjct  2043  QPCPGGWWGERVCGPCRCDLAQGYHPDCNKTTGQCYCKTNHYQPPNETACLSC---DCYS  2099

Query  1642  -GGLCVSEKP-GYRCSCLEGRYGRHCERSTFSFDELS  1676
              G    +  P   +C C EG  GR C+  +  + E++
Sbjct  2100  IGSFSGACNPLTGQCECREGVIGRRCDSCSNPYAEVT  2136



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000038-PA

Length=297
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0E8W1_DROME  unnamed protein product                                 31.2    1.1  
RUVB1_CAEEL  unnamed protein product                                  30.4    2.2  
Q9VED8_DROME  unnamed protein product                                 28.9    5.0  


>Q0E8W1_DROME unnamed protein product
Length=499

 Score = 31.2 bits (69),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 33/75 (44%), Gaps = 12/75 (16%)

Query  33   DAYEGLWNTLSPEER---NQAVDETIIQPEVALKYASNKLESSKDY-----PDYYPKLRI  84
            DAY  LW  L+  +R   N  +D      E    Y  + ++  + Y     PD  P+ R+
Sbjct  410  DAYSSLWAMLNESDRKNFNMDMDPE----ETVPMYIESCVQGGRQYLMKESPDSLPRARL  465

Query  85   QTGLKYMIDETGSTL  99
            Q  L Y++D    TL
Sbjct  466  QLKLMYILDRACKTL  480


>RUVB1_CAEEL unnamed protein product
Length=476

 Score = 30.4 bits (67),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 34/70 (49%), Gaps = 4/70 (6%)

Query  22   KRIGEDVTATKDAYEGLWNTLSPEER--NQAVDETIIQPEVALKYA--SNKLESSKDYPD  77
            + IG  V  TKD YEG    LSP E   N  + +TI    ++LK A  S +L+      D
Sbjct  137  RAIGLRVKETKDVYEGEVTELSPVEASDNSGMGKTISHLVLSLKTAKGSKQLKLDPSIYD  196

Query  78   YYPKLRIQTG  87
               K R++ G
Sbjct  197  SILKQRVEVG  206


>Q9VED8_DROME unnamed protein product
Length=366

 Score = 28.9 bits (63),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 14/39 (36%), Positives = 21/39 (54%), Gaps = 0/39 (0%)

Query  13   YFYSINPLAKRIGEDVTATKDAYEGLWNTLSPEERNQAV  51
            ++Y  NPLA R  E   + + A  G W T SP +++  V
Sbjct  183  FYYQRNPLATRSDELFPSLERALHGQWRTESPFQKDLEV  221



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000039-PA

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OBSTE_DROME  unnamed protein product                                  192     1e-58
Q9VR79_DROME  unnamed protein product                                 125     3e-33
Q9VNL0_DROME  unnamed protein product                                 107     2e-26


>OBSTE_DROME unnamed protein product
Length=249

 Score = 192 bits (487),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 125/213 (59%), Gaps = 10/213 (5%)

Query  144  SNLGNLARNSGLCPERNGRFVVSNQCDAYIECIDGVPEQKLCPDGLLFNPDARFNYPCGY  203
            +  G++A  S  CP  NGRF   +QCD+Y EC DG P +KLCPDGLLF+   +    C Y
Sbjct  13   AMFGSMALGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTY  72

Query  204  PNDVQCIGRATLQPAQPTDECPHQYGYFKIGDRRNCGQFMNCVDGRGYTFNCPEGLAFNS  263
                 C  RA LQPA  T+ECP Q+G++  GD   CG + NC  G      CPEGLAFN 
Sbjct  73   APYSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNE  132

Query  264  EHYRCDWPDQVDDCDAEAFLGFSCPTTENAVFGSG----------IKTYKSPRDCQHYFL  313
            E Y+CDWPD V+ C+AEA+LGF+CP  ++A   +           ++ Y+ P+ C+ YF+
Sbjct  133  ETYQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFV  192

Query  314  CVNDRPRLQNCGEGQAFNEVIGVCDAAENVTGC  346
            CVN  PRL NCG+  AFN    +CD    V  C
Sbjct  193  CVNGHPRLYNCGKYLAFNSQTKLCDFYNKVPEC  225


 Score = 45.1 bits (105),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 15/126 (12%)

Query  166  SNQCDAYIECIDGVPEQKLCPDGLLFNPDARFNYPCGYPNDVQ-CIGRATLQPAQPTDEC  224
            + +C  Y  C  GV     CP+GL FN +    Y C +P+ V+ C   A L    P  + 
Sbjct  105  ATKCGVYRNCAHGVASLTKCPEGLAFNEE---TYQCDWPDLVESCNAEAYLGFNCPAADS  161

Query  225  PHQYGYFKI-----GDRR------NCGQFMNCVDGRGYTFNCPEGLAFNSEHYRCDWPDQ  273
                    +     G+ R       C ++  CV+G    +NC + LAFNS+   CD+ ++
Sbjct  162  ADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDFYNK  221

Query  274  VDDCDA  279
            V +C A
Sbjct  222  VPECYA  227


>Q9VR79_DROME unnamed protein product
Length=237

 Score = 125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/202 (38%), Positives = 104/202 (51%), Gaps = 10/202 (5%)

Query  156  CPERNGRFVVSNQCDAYIECIDGVPEQKLCPDGLLFNPDARFNYPCGYPNDVQCIGRATL  215
            CP+ NG+F    QCD +  C DGV + KLCPDGL+F+P  R    C  P +V C  R  L
Sbjct  25   CPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRKFNKCDQPFNVDCEDRTEL  84

Query  216  QPAQPTDECPHQYGYFKIGDRRNCGQFMNCVDGRGYTFNCPEGLAFNSEHYRCDWPDQV-  274
            Q  + +  CP + G+F   D   C  F NC++G      C  GL F+     C WPD   
Sbjct  85   QEPKSSKYCPRKNGFFAHPDPAVCNIFYNCIEGDALETKCTVGLHFDEYSGTCVWPDTAK  144

Query  275  -DDCDAE---AFLGFSCPTTENAVFGSG-IKT---YKSPRDCQHYFLCVN-DRPRLQNCG  325
             + C+ E   +  GF CP  +      G + T   Y  P DCQ +++C+N + PR   C 
Sbjct  145  REGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHPTDCQKFYVCLNGEDPRDLGCQ  204

Query  326  EGQAFNEVIGVCDAAENVTGCE  347
             G+ +N+   +CDA ENV GCE
Sbjct  205  LGEVYNDATEMCDAPENVPGCE  226


>Q9VNL0_DROME unnamed protein product
Length=258

 Score = 107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 98/206 (48%), Gaps = 9/206 (4%)

Query  149  LARNSGLCPERNGRFVVSNQCDAYIECIDGVPEQKLCPDGLLFNP-DARF-NYPCGYPND  206
            +A++S  CP+  G +     CD Y +C +GV E K C +GL F+  D+++    C Y ++
Sbjct  16   VAQSSFKCPDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHN  75

Query  207  VQCIGRATLQPAQPTDECPHQYGYFKIGDRRNCGQFMNCVDGRGYTFNCPEGLAFNSEHY  266
            V C  R  L+P   T  C   YG F   D   C  F NC +G    + C  GLA++ +  
Sbjct  76   VDCGDRTELEPPITTPHCSRLYGIFP--DENKCDVFWNCWNGEPSRYQCSPGLAYDRDAR  133

Query  267  RCDWPDQVDDCDAEAFL-GFSCPTTENAVFGSGIKTYKSPRDCQHYFLCVNDRPRLQNCG  325
             C W DQV +C  E    GFSCP             +  P DC+ Y++C+    R   C 
Sbjct  134  VCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCP  193

Query  326  EGQAF----NEVIGVCDAAENVTGCE  347
             G  F    ++  G C+  E+V GCE
Sbjct  194  IGTVFKIGDSDGTGNCEDPEDVPGCE  219



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000040-PA

Length=245
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DTBP1_DROME  unnamed protein product                                  111     2e-29
DTBP1_CAEEL  unnamed protein product                                  31.6    0.37 
Q95PV6_CAEEL  unnamed protein product                                 30.4    1.5  


>DTBP1_DROME unnamed protein product
Length=288

 Score = 111 bits (278),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/209 (33%), Positives = 123/209 (59%), Gaps = 1/209 (0%)

Query  37   IKNKVNYNAGADLLHHFQMEWNNLHELAEDNAEKAQEADVLIASIHEKLEFQWNNFNVLN  96
            + + +N  AG  LL  ++ +W  +H   E NAEKA +    I+ I ++   Q    + LN
Sbjct  77   VPSHLNVAAGCSLLAKYEDDWQQIHGANEKNAEKAAQIANQISGIQDQASHQHRIMSELN  136

Query  97   NTLASIPQINNTIQGLMDQIGSLQEQFEEVHNALFELEDLQEILDLQSSQLDHRFQLALY  156
            ++LA IP +   +Q     + SL+E  +++   L +LEDL+E  +LQ   L+ +FQL+ +
Sbjct  137  SSLAGIPTLIAQLQNSSQVLNSLEEMGKQLEIELEKLEDLREECELQEFILEQQFQLSRH  196

Query  157  KEKKLSELKNIREKLSNDHSIKVLRHEKQQEKILKERQHTFGEAFNEEMNEYKKTGSVPK  216
            K+KKL+EL+  R++++  H  K+   E+   K+ +ERQ  F +AF E+M EYK+ G + K
Sbjct  197  KQKKLNELEQYRQQIAQKHQSKIKDQEQTLLKLQRERQAVFDDAFREDMEEYKQRGQLTK  256

Query  217  TPLNTQKGLSLEEIILDSDSADYDEFLKE  245
                + K L+LEE++L+++  +  + L++
Sbjct  257  IQTTSNK-LALEEVVLEANEVETKDALEQ  284


>DTBP1_CAEEL unnamed protein product
Length=210

 Score = 31.6 bits (70),  Expect = 0.37, Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 8/82 (10%)

Query  1   MFGTIRDKFQSIQEGLSASLRGLTLAESS---KPKKLIT--IKNKVNYNAGADLLHHFQM  55
           M  T+RD   S+Q  LS  +  L +  S+     +K+ T  +   +N +AG +LL +FQ 
Sbjct  3   MLNTLRDTLSSVQAELSTGVEKLRMNVSANIVAQQKVSTESVNEILNTSAGNELLQNFQ-  61

Query  56  EWNNLHELAEDNAEKAQEADVL  77
             N + E+ E+ AE  + A++ 
Sbjct  62  --NLITEVEENGAEGGRLANLC  81


>Q95PV6_CAEEL unnamed protein product
Length=537

 Score = 30.4 bits (67),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 21/88 (24%), Positives = 35/88 (40%), Gaps = 2/88 (2%)

Query  52   HFQMEWNNLHELAEDNAE--KAQEADVLIASIHEKLEFQWNNFNVLNNTLASIPQINNTI  109
            H  M       L     E   A E  V  +S+H +L    N    L    A+ P++   +
Sbjct  388  HMTMSHGYPPPLVAAPVEEKPAPEQPVNASSLHNELRVISNAICELKAQQAATPRVEQAL  447

Query  110  QGLMDQIGSLQEQFEEVHNALFELEDLQ  137
              +  ++G L+   E   N+++ L  LQ
Sbjct  448  TYIDSRVGKLERSLETALNSIYTLVQLQ  475



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


Query= CFLO000041-PA

Length=509
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBC4_DROME  unnamed protein product                                 422     4e-134
O77268_DROME  unnamed protein product                                 346     2e-106
Q9W532_DROME  unnamed protein product                                 346     3e-106


>A1ZBC4_DROME unnamed protein product
Length=1471

 Score = 422 bits (1086),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 245/502 (49%), Positives = 303/502 (60%), Gaps = 83/502 (17%)

Query  1    LAKIFREVSIMKRLRHPHIIRLYQVMETEKMIYLVTELASGGEIFDYLVKNGKMSEPEAR  60
            L K FRE++I+K LRHPHI RLY+VME++ MIYLVTE A  GEIFD+LV NG+M EPEA 
Sbjct  82   LNKTFREIAILKSLRHPHITRLYEVMESQSMIYLVTEYAPNGEIFDHLVANGRMKEPEAA  141

Query  61   RVFHQIIQAVAYLHKKGIVHRDLKSENVLLDADNNVKLVDFGFSNEYTPGVLLTTWCGSP  120
            RVF Q++ AV Y H++G+VHRDLK+ENVLLD D N+KL DFGFSN Y  G  L TWCGSP
Sbjct  142  RVFTQLVSAVHYCHRRGVVHRDLKAENVLLDKDMNIKLADFGFSNHYEEGATLKTWCGSP  201

Query  121  PYAAPEIFQGRQYDGPKVDIWSLGVVLYVLVCGALPFNGPTMHLLTSAVFSGKFRVPFFM  180
            PYAAPE+FQG +YDGPK DIWSLGVVLY LVCGALPF+G T+  L S V  GKFR+PFFM
Sbjct  202  PYAAPEVFQGLEYDGPKSDIWSLGVVLYALVCGALPFDGKTILELKSRVVLGKFRIPFFM  261

Query  181  SQDCEHLLKHMLVPDPERRYSIPQILAHRWMG------------GD---GSGQPVESVID  225
            SQ+CE L+++MLV +P+RRY+I QI+ HRW+             GD   GSG   +S   
Sbjct  262  SQECEQLIRNMLVVEPDRRYTIKQIIKHRWLSEWQSEMQEQERFGDMSPGSGTVSKSAST  321

Query  226  MPDTTASTLP--LNQLVIESMLTLPGLDLDTLLQSVQGNAFNHISAIYNLLVDQLE----  279
                +AS  P  L+ +V+  ML LPGL  D + QSV    F++I AIYNLL D+L+    
Sbjct  322  SSLGSASDSPPQLDSVVMTHMLQLPGLTADMIAQSVHEQRFDNIYAIYNLLHDKLQQRRR  381

Query  280  ------------------NAVT---------------------SVPSIQSFSAGYVSDDD  300
                               ++T                     S  +  S + G+   D 
Sbjct  382  ENQRLQHHASLAYSRSRKTSITTGVVDRSEPVKQESLDRLSPLSNANASSSALGFGWSDV  441

Query  301  AHQLEKFGETEGGETEERSGLQLPSNQPY---HA--------TRRHTVGPGDTAHQPQGV  349
            A  LEK+G+ E  E   RS    P N  +   HA        TRRHTVGPGD AH+ Q +
Sbjct  442  AVDLEKYGDFE-LECLARSN-DPPVNAQHLSAHAGGGVNGANTRRHTVGPGDVAHE-QAL  498

Query  350  PYTRYYGYSPGYAPHLLQ-PLNAELPLLPHTNLALNLPLVQNQPPQNFQIKDQYLLKPPS  408
                    +P   P   + P     P  P     +NLP++QNQP  N  IKDQ+LLKPP 
Sbjct  499  -------ANPNVPPIDFKCPPQCSDPTQPVPYYPVNLPMLQNQPLHNLTIKDQHLLKPPV  551

Query  409  AMGATSSFGRRASDGGANLYVF  430
             MGA SSFGRRASDGGANL+++
Sbjct  552  VMGA-SSFGRRASDGGANLHIY  572


>O77268_DROME unnamed protein product
Length=1398

 Score = 346 bits (887),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 208/280 (74%), Gaps = 0/280 (0%)

Query  1    LAKIFREVSIMKRLRHPHIIRLYQVMETEKMIYLVTELASGGEIFDYLVKNGKMSEPEAR  60
            L K++REV IMKRL+HPHII+LYQVMET+ MIY+V+E AS GEIFDY+ K G+MSE  AR
Sbjct  182  LQKVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAAR  241

Query  61   RVFHQIIQAVAYLHKKGIVHRDLKSENVLLDADNNVKLVDFGFSNEYTPGVLLTTWCGSP  120
              F QII AV Y HKKGIVHRDLK+EN+LLD + N+K+ DFGFSN + PG LL TWCGSP
Sbjct  242  FKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSP  301

Query  121  PYAAPEIFQGRQYDGPKVDIWSLGVVLYVLVCGALPFNGPTMHLLTSAVFSGKFRVPFFM  180
            PYAAPE+F+G+QY GP++DIWSLGVVLYVLVCGALPF+G T+  L   V SG+FR+PFFM
Sbjct  302  PYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFM  361

Query  181  SQDCEHLLKHMLVPDPERRYSIPQILAHRWMGGDGSGQPVESVIDMPDTTASTLPLNQLV  240
            S +CEHL++ MLV +P RRY+I QI  HRWM  +     + +  ++     +++  ++ +
Sbjct  362  SSECEHLIRRMLVLEPTRRYTIDQIKRHRWMCPELLEHVLIAKYNLGAERQTSVEPSEDI  421

Query  241  IESMLTLPGLDLDTLLQSVQGNAFNHISAIYNLLVDQLEN  280
            +  M    G+  D    S++ N ++H++AIY LL D++ +
Sbjct  422  LRIMAEYVGIGSDKTRASLKKNTYDHVAAIYLLLQDRVSH  461


>Q9W532_DROME unnamed protein product
Length=1398

 Score = 346 bits (887),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/280 (56%), Positives = 208/280 (74%), Gaps = 0/280 (0%)

Query  1    LAKIFREVSIMKRLRHPHIIRLYQVMETEKMIYLVTELASGGEIFDYLVKNGKMSEPEAR  60
            L K++REV IMKRL+HPHII+LYQVMET+ MIY+V+E AS GEIFDY+ K G+MSE  AR
Sbjct  182  LQKVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGRMSESAAR  241

Query  61   RVFHQIIQAVAYLHKKGIVHRDLKSENVLLDADNNVKLVDFGFSNEYTPGVLLTTWCGSP  120
              F QII AV Y HKKGIVHRDLK+EN+LLD + N+K+ DFGFSN + PG LL TWCGSP
Sbjct  242  FKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSP  301

Query  121  PYAAPEIFQGRQYDGPKVDIWSLGVVLYVLVCGALPFNGPTMHLLTSAVFSGKFRVPFFM  180
            PYAAPE+F+G+QY GP++DIWSLGVVLYVLVCGALPF+G T+  L   V SG+FR+PFFM
Sbjct  302  PYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFM  361

Query  181  SQDCEHLLKHMLVPDPERRYSIPQILAHRWMGGDGSGQPVESVIDMPDTTASTLPLNQLV  240
            S +CEHL++ MLV +P RRY+I QI  HRWM  +     + +  ++     +++  ++ +
Sbjct  362  SSECEHLIRRMLVLEPTRRYTIDQIKRHRWMCPELLEHVLIAKYNLGAERQTSVEPSEDI  421

Query  241  IESMLTLPGLDLDTLLQSVQGNAFNHISAIYNLLVDQLEN  280
            +  M    G+  D    S++ N ++H++AIY LL D++ +
Sbjct  422  LRIMAEYVGIGSDKTRASLKKNTYDHVAAIYLLLQDRVSH  461



Lambda      K        H
   0.321    0.134    0.409 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4408034910


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 4, 2020  4:51 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= CFLO000042-PA

Length=93
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBC4_DROME  unnamed protein product                                 63.9    3e-13
Q9W532_DROME  unnamed protein product                                 51.2    9e-09
O77268_DROME  unnamed protein product                                 51.2    9e-09


>A1ZBC4_DROME unnamed protein product
Length=1471

 Score = 63.9 bits (154),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 36/41 (88%), Gaps = 0/41 (0%)

Query  53  SSSQFPVSKLIRVGYYDLEMTIGKGNFAVVKMATHIVTNSK  93
           S+S+  V KL+RVGYY+LE TIGKGNFAVVK+AT+IVT +K
Sbjct  26  STSKISVDKLLRVGYYELEKTIGKGNFAVVKLATNIVTKTK  66


>Q9W532_DROME unnamed protein product
Length=1398

 Score = 51.2 bits (121),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)

Query  63   IRVGYYDLEMTIGKGNFAVVKMATHIVTNSK  93
            +RVG+YD+E TIGKGNFAVVK+A H +T ++
Sbjct  136  MRVGFYDIERTIGKGNFAVVKLARHRITKNE  166


>O77268_DROME unnamed protein product
Length=1398

 Score = 51.2 bits (121),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)

Query  63   IRVGYYDLEMTIGKGNFAVVKMATHIVTNSK  93
            +RVG+YD+E TIGKGNFAVVK+A H +T ++
Sbjct  136  MRVGFYDIERTIGKGNFAVVKLARHRITKNE  166



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000043-PA

Length=516
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ASNS_DICDI  unnamed protein product                                   296     4e-94
Q57V01_TRYB2  unnamed protein product                                 32.0    1.3  
PUR1_DROME  unnamed protein product                                   31.2    2.3  


>ASNS_DICDI unnamed protein product
Length=557

 Score = 296 bits (759),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 200/521 (38%), Positives = 290/521 (56%), Gaps = 58/521 (11%)

Query  23   TKISHRGPDAFKIEHDSRVKNAYLGFHRLSIVDSLCGMQPIRLYQYPLLFLLCNGEIYNC  82
            +++ HRGPD   I   S   ++ L   RL+IV    G QP+ L +   + L  NGEIYN 
Sbjct  26   SRLRHRGPDWNGIYQSS---DSILTHERLAIVGLENGAQPL-LNEDETIALTVNGEIYNH  81

Query  83   KRLGEEY----GFQFSTKCDIEVLLHVYATKGPDAVCRSLDGVFAFCLLDVEKKKILIGR  138
            ++L E+        F T  D E +LH+Y  KG D V   LDG FAF + + +    L  R
Sbjct  82   EKLREDLVATGKHTFKTHSDCEPILHLYEDKGDDFV-HMLDGDFAFVVYNKKANSFLAAR  140

Query  139  DPYGVRPLFRFSTPDGQLAVSSESKALVGIAKLLSNDDF--VEPFPPGTYEEYDILENGL  196
            DP GV PL+     DG +  SSE KA+         DD    +PFPPG Y       +  
Sbjct  141  DPIGVVPLYIGWHKDGSIWFSSEMKAI--------KDDCYKFQPFPPGHY-----FSSKT  187

Query  197  VKLFRKEKYHEP----GQKPSFTPFVPWNEISSENVHENVRKLFSAAVDKRLMADRRIGC  252
             +  R   Y++P    G  PS          S E V   +++ F  AV  R+M+D   G 
Sbjct  188  KEFVR---YYKPNWIMGDSPSGVL------KSEEQVLPAIKEAFEQAVVSRMMSDVPYGV  238

Query  253  LLSGGLDSSLVAALLVKYS--------KERKFSYKIQSFSIGMEGSPDILAARQVAAHIG  304
            LLSGGLDSSLVA+++ +++        K R +  +I SF IG++ +PD+ AAR VA ++ 
Sbjct  239  LLSGGLDSSLVASIVSRHAEQRVEDHEKSRAWWPRIHSFCIGLKDAPDLKAARDVADYLQ  298

Query  305  TDHHEIIITQQDILEVLDKVIYQLETFDITTIRASIGMYLISRYIKKNTESTVIFSGEGA  364
            T HHE   T Q+ ++ L  VI  LET+D+TTIRAS  MY +SR IK      ++ SGEG+
Sbjct  299  TVHHEYHFTVQEGIDALPDVIKHLETYDVTTIRASTPMYFLSRKIKA-MGVKMVLSGEGS  357

Query  365  DELAQGYIYFRDAPSAYDAHIESLRLLKDIYLYDGLRADRTTSAFSLELRVPFLDLQFTN  424
            DE+  GY+YF +AP A + H+E  R +K ++ +D LRA+++T+A+ +E+RVPFLD +F +
Sbjct  358  DEIFGGYLYFHNAPDANEFHVECCRRIKALHSFDCLRANKSTAAWGVEVRVPFLDQRFLD  417

Query  425  YYLSLPSTAR-----QPQNGVEKHLLRSAFD-KTG---LLPSNILWRGKEAFSDGVTSVK  475
              +++  + +     Q +  +EK++LR AF+ K G    LPS++LWR KE FSDGV    
Sbjct  418  VAMNIDPSHKVCHDDQGKKRMEKYILRKAFETKEGEKPYLPSSVLWRQKEQFSDGVGY--  475

Query  476  KSLFQIIDEIVQDKVKDDELVKAYETYPHCTPKTKEAYYYR  516
             S    + E  +++V D+E  K    +P  TP TKEA+ YR
Sbjct  476  -SWIDGLKENAENEVSDEEFAKRESYFPDDTPTTKEAFLYR  515


>Q57V01_TRYB2 unnamed protein product
Length=658

 Score = 32.0 bits (71),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (54%), Gaps = 1/63 (2%)

Query  240  VDKRLMADRRIGCLLSGGLDSSLVAALLVK-YSKERKFSYKIQSFSIGMEGSPDILAARQ  298
            + +R    +++ CL SGG+DS++ A LL+K    ER     I    + +  S +++AA +
Sbjct  215  IRERTTQGQKVLCLASGGVDSTVCAVLLLKALGPERVVCIHIDHGFMRLNESQEVVAALR  274

Query  299  VAA  301
             A 
Sbjct  275  AAG  277


>PUR1_DROME unnamed protein product
Length=546

 Score = 31.2 bits (69),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 85/258 (33%), Gaps = 74/258 (29%)

Query  2    CGLWALFGFENDSLTCVCDNFTKISHRGPDAFKIE-----------------------HD  38
            CG W     + D    +C     + HRG ++  I                        +D
Sbjct  62   CGDWPT---QMDIAHVICLGLVALQHRGQESAGIATSEGKCSKNFNVHKGMGMISTLFND  118

Query  39   SRVK----NAYLGFHRLSIV--DSLCGMQPIRLYQ-YPLLFLLCNGEIYNCKRLGEEY--  89
              +K    N  +G  R S      +   QP  ++  +  L L  NGE+ N + L  E   
Sbjct  119  DSMKKLRGNLGIGHTRYSTAGGSGVVNCQPFEVHTTHGALALAHNGELVNNESLRREVLA  178

Query  90   -GFQFSTKCDIEVLLH--------VYATKGPDAVCR----SLDGVFAFCLLDVEKKKILI  136
             G   ST  D E++          V    GP+   R     +    ++ L+ + K KI  
Sbjct  179  RGVGLSTHSDSELIAQSLCCAPEDVSELDGPNWPARIRHFMMLAPLSYSLVIMLKDKIYA  238

Query  137  GRDPYGVRPLF-------------RFSTPDGQLAVSSESKALVGIAKLLSNDDFVEPFPP  183
             RD YG RPL                 TP     VSSES   + I        +V    P
Sbjct  239  VRDTYGNRPLCIGKIVPINAGHGNNLDTPADGWVVSSESCGFLSIGA-----RYVREVEP  293

Query  184  G--------TYEEYDILE  193
            G         Y   DI+E
Sbjct  294  GEIVELSRSGYRTVDIVE  311



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000044-PA

Length=84
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VDV4_DROME  unnamed protein product                                 29.3    0.28 
A0A0B4JCY1_DROME  unnamed protein product                             29.3    0.28 
Q8IN71_DROME  unnamed protein product                                 29.3    0.30 


>Q9VDV4_DROME unnamed protein product
Length=1075

 Score = 29.3 bits (64),  Expect = 0.28, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  7    LYFALIMKKTEMVFLLLIVG-ICFVASQVSDQKQLKPINRWCRQPGCNDEIC  57
            LYFA +   T M+ L  IVG ICF+ S  S  K   P+   C+    N  +C
Sbjct  417  LYFAWLGYYTYMLLLASIVGVICFLYSWFS-LKNYVPVKDICQSGNTNITMC  467


>A0A0B4JCY1_DROME unnamed protein product
Length=1099

 Score = 29.3 bits (64),  Expect = 0.28, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  7    LYFALIMKKTEMVFLLLIVG-ICFVASQVSDQKQLKPINRWCRQPGCNDEIC  57
            LYFA +   T M+ L  IVG ICF+ S  S  K   P+   C+    N  +C
Sbjct  441  LYFAWLGYYTYMLLLASIVGVICFLYSWFS-LKNYVPVKDICQSGNTNITMC  491


>Q8IN71_DROME unnamed protein product
Length=926

 Score = 29.3 bits (64),  Expect = 0.30, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  7    LYFALIMKKTEMVFLLLIVG-ICFVASQVSDQKQLKPINRWCRQPGCNDEIC  57
            LYFA +   T M+ L  IVG ICF+ S  S  K   P+   C+    N  +C
Sbjct  268  LYFAWLGYYTYMLLLASIVGVICFLYSWFS-LKNYVPVKDICQSGNTNITMC  318



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000045-PA

Length=735
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JVY2_DROME  unnamed protein product                                 407     1e-131
Q86S68_CAEEL  unnamed protein product                                 78.2    1e-14 


>Q7JVY2_DROME unnamed protein product
Length=743

 Score = 407 bits (1046),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 286/799 (36%), Positives = 442/799 (55%), Gaps = 123/799 (15%)

Query  1    MSQPSVAAYFTSRKRPAQEE---LKNKAKVLLLGDDEQRQQALPS-LILPSEKPVKAESG  56
            M+QPSVAA+FT+RKR A ++   +KN            R+   P+  + P+  P +  +G
Sbjct  1    MAQPSVAAFFTNRKRAALDDAISIKN------------RRLVEPAETVSPASAPSQLPAG  48

Query  57   KEKFYFTSMTMTKMDFKKDLVARNLLSDLSSKPGRLSKTRTTKSKKPSANEDVRQQNIDS  116
             +            D      A   +   S +  RL  T   +SKK +      + +I  
Sbjct  49   DQD----------ADLDTLKAAATGMRTRSGRTARLIVTAAQESKKKTPAAAKMEPHI--  96

Query  117  MFKLKEPSDGTCVFAKLGNLSPKKSVKT---------HASKSSKTHQKVSGKATQTTQTE  167
                K+P      F K G LSP+K  ++          +S  S+   KV+   T T+Q  
Sbjct  97   ----KQPK--LVQFIKKGTLSPRKQAQSSKLDEEELQQSSAISEHTPKVNF--TITSQQN  148

Query  168  EKNLQEAEACKTPTKEPAIFKTPTKEPTIFKTPTKNSVR-ELSYDEIKGKVLVSARLKEL  226
              N+Q               +TPTK+     +P K  +R +L++DE+K KV  SA+L+EL
Sbjct  149  ADNVQRG------------LRTPTKQILKDASPIKADLRRQLTFDEVKTKVSRSAKLQEL  196

Query  227  RAKIAQFQNSEKKLESLEEAHKKKKEEM---TKDEERVRIKKFDHIEIEIPVSPQKAFSS  283
            +A +A     E+K +  EE ++K ++     +K +  V++K+FD IE+E+ +SP K F +
Sbjct  197  KAVLALKAALEQKRKEQEERNRKLRDAGPSPSKSKMSVQLKEFDTIELEVLISPLKTFKT  256

Query  284  P----------NKLFSPQKTISALSPMASPVRRLLFEPKE--EPASLVKASPTKTPAYQR  331
            P          ++L SP+ T  +        +RLLF P +   P  LV+      PAY+R
Sbjct  257  PTKIPPPTPDKHELMSPRHTDVS--------KRLLFSPAKNGSPVKLVE-----VPAYKR  303

Query  332  YQSL-SIAEGKELPLPYKYRFLLEIFRSIDTISAMLYNRREMITFKKLKPAVQELMRRNF  390
            Y SL   +   +LPLPYKYR LL++F+ +D++ AM +NR+E ITFKKLKPAVQ ++R+NF
Sbjct  304  YASLVESSRAGQLPLPYKYRHLLDVFKGLDSVVAMFHNRKETITFKKLKPAVQRMLRKNF  363

Query  391  TLDNVAQIKTVWPDAFSFRYEKMRSFGT-SNSEKYELVITPNI------QQEKKSSGRNT  443
            T  ++AQIK ++PDAF F   K R+FG+ S ++ ++L+I PN+      QQ +K      
Sbjct  364  TETHLAQIKHIYPDAFIFSQVKTRNFGSVSKADYFQLIIAPNVEPLPEQQQSEKPQHFTK  423

Query  444  PNEEDVIKSANDTNMNPQILLKRRHIFMKLLLEKVKDEHEEYLQSLEVPLLVSRDKITKW  503
             NE+DV+ SA  T+MNP ++  R   F  LLL++    H+++L+S + P+++ +  +T+W
Sbjct  424  INEDDVLASAQSTSMNPHVMTARMQRFQSLLLDRAMRAHDQFLRSQDPPIIIEK-ALTRW  482

Query  504  HPAFDLESCKDIDKADLPKEPIMDKFNSARGVLEAANNMFNKNSRMQRAL----------  553
            HP FDLESC +++ + LP+ P ++K++SA+ +L  A N+FN  + M+RA+          
Sbjct  483  HPQFDLESCPEVELSPLPQPPNVEKYSSAKDILSTARNLFNCATPMERAMDRYEAKLESE  542

Query  554  --EILVTNK--TEVSSPTVTDVKTSI-------GDSQLKLNSSVVDTPPATPNSQPK---  599
              +   +NK   E  +  VT   T+I       G S    N +V +T   T  ++P    
Sbjct  543  KQQAAESNKKTEEQQAGEVTRTSTAIQTSQEVPGISGSSKNPTVPETTNQTETAKPTVKD  602

Query  600  ----DLSNSMLSGIPASLLEKIRAKQAAKALELMTRSEDAHKEAAMHARLPSMAKIVRNI  655
                D S+++L G+P SL+EKIRAKQAAKALE MTR     +EA  ++RLP +A+ +RN+
Sbjct  603  CTVPDASSNLLKGLPKSLIEKIRAKQAAKALEAMTRRPSQDQEATKYSRLPELARHLRNV  662

Query  656  FVTEKKNVLPLEQVVQKLDDSFRTKLTTNKLEEHLKLLCKLLPLWINLVVVRNVKYVKLA  715
            FVTE+K VL LE +++K+ +SFR  LT  ++E HLKLL K LP W +   VR   Y+K+A
Sbjct  663  FVTERKGVLTLEVIIKKIQNSFRANLTPQEIEAHLKLLAKELPSWASFHEVRKTMYLKVA  722

Query  716  RDCDMVKIIHRLEVLAEEK  734
            +D DM KII +LE +A  K
Sbjct  723  KDMDMNKIIEKLESVANAK  741


>Q86S68_CAEEL unnamed protein product
Length=684

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 90/403 (22%), Positives = 170/403 (42%), Gaps = 58/403 (14%)

Query  345  LPYKYRFLLEIFRSIDTISAMLYNRREMITFKKLKPAVQELMRRNFTLDNVAQIKTVWPD  404
            LP  Y  L + F+ ID I+A+   +       +L   V+    ++F+ ++++QI  V+P 
Sbjct  255  LPTAYEHLADTFKRIDQITAIFIGQNRSCVVPELIKNVKNTSGKDFSNEHLSQILHVYPQ  314

Query  405  AFSFRY-EKMRSFGTSNSEKYELVITPNIQQEKKS------------------------S  439
            ++     E+ ++FG     KYEL + PN+ ++ +                         S
Sbjct  315  SYHIEMREQRKAFGQGG--KYELEVRPNLVEDLRGYIYEKSPTDGDTEDLPLVCPSKLLS  372

Query  440  GRNTPNEEDVIKSANDTNMNPQILLK------RRHIFMKLLLEKVKDEHEEYLQSLEVPL  493
             + +P ++ V  +     ++ +I L       R H+F   L   V   H E+L+S     
Sbjct  373  PKKSPRKQ-VQPALRKPEVDGRIRLDAARQRDRAHVFRYKLASIVTKCHTEFLESQG---  428

Query  494  LVSRDKITKWHPAFDLE-SCKDIDKADLPKEPIMDKFNSARGVLEAANNMFNKNSRMQRA  552
            L +   I + HP F L+  C  + +  LP EP + K +   G+ EA +   +        
Sbjct  429  LCASSNIKRMHPLFRLDKHCPSLPQVKLP-EPPLQKSSIHIGMKEALDKYMD--------  479

Query  553  LEILVTNKTEVSSPTVTDVKTSIGDSQLKLNSSVVDTPPATPNSQPKDLSNSMLSGIPAS  612
                     +VS P+          S LK  +    T P +P  +  ++     S    S
Sbjct  480  ---------QVSLPSFVQKAYQDLKSPLKSTTGASGTVPISPK-KFSEMQKEQKSQGAMS  529

Query  613  LLEKIRAKQAAK-ALELMTRSEDAHKEAAMHARLPSMAKIVRNIFVTEKKNVLPLEQVVQ  671
            LLE+IRAK+A K A E     +   ++  +        +IV N +  ++   + ++ + +
Sbjct  530  LLERIRAKEAIKKAAEACIDKDLERRKQRLTLLRDRYVRIVCNHYTAKRAQTMEIDVICK  589

Query  672  KLDDSFRTKLTTNKLEEHLKLLCKLLPLWINLVVVRNVKYVKL  714
             +  S     +   + +HL+LLC++ P++I+   + N KY + 
Sbjct  590  FVQFSSSNSSSIPDIMDHLRLLCEVAPMYISEASLMNKKYFRF  632



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000046-PA

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVZ0_DROME  unnamed protein product                                 30.4    4.7  
Q9VTZ1_DROME  unnamed protein product                                 30.0    6.4  


>Q9VVZ0_DROME unnamed protein product
Length=769

 Score = 30.4 bits (67),  Expect = 4.7, Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 78/158 (49%), Gaps = 6/158 (4%)

Query  261  ARTKNSEETIMFYIKKIEDIIEKQRPDLNDWLPLALEV-RKLEVLQSELQKEVEKLEEQL  319
            AR       ++F + K +D+I + +     + P  LE+ +K + ++ E  K V  L+E++
Sbjct  334  ARDPEKNRDLLFDLLKPKDLIPQDKNVWKKFPPKLLELAQKPDFVEPEPWKSV--LDEKI  391

Query  320  PIDTVIEDDVLEQLTSQIKTMDSKTADC-VQEIKIAFGRLKSSGLLITKTRECLSSELEK  378
            PID ++E +  E+ T  I+    K     V++IK    + +    +    ++C  +  ++
Sbjct  392  PIDNILEKEP-EKETPFIENKPEKPVILEVKDIKPLPPKPEDEADIQGWLQQCSETISQQ  450

Query  379  LQLVLTSEESNWSDIDLSSELVVFNNEIDVNALRKIIL  416
            LQL++  + S+ +D     E + F +EI    L+  +L
Sbjct  451  LQLLINEDSSSKTD-SAEPEGIDFESEISKQQLKPRVL  487


>Q9VTZ1_DROME unnamed protein product
Length=813

 Score = 30.0 bits (66),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 62/143 (43%), Gaps = 14/143 (10%)

Query  435  IVVEIKNRNDSITNLPILRVPIYYLVDLYKTFIVNVTLGRQINEENLDVQDDDSLEQLKN  494
             V++ + RN  + N+PI   P    +   K   V   L ++I +E  D    ++L+ L  
Sbjct  371  FVIQQRKRNQEVANVPI--GPSAASIGGNKRTSVGEPLHKRIKKEPTDRPSSENLDDLPA  428

Query  495  ----RPLTDICSSS------ILQLLRLTDETNQRT--LQHVDEFEHILRTWSNQTVQETV  542
                R +  +  S       IL  + ++ + N +    +   EF  +  + +    ++TV
Sbjct  429  DVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVVGNSLTKPVDKQTV  488

Query  543  TRIFGDQVVFGYKLEEWQRRFNS  565
              + G Q+VF Y+L E  R + S
Sbjct  489  LWLLGLQLVFAYQLPEMPREYIS  511



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000047-PA

Length=173
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VWF5_DROME  unnamed protein product                                 301     3e-106
M9PI14_DROME  unnamed protein product                                 295     9e-104
DAF31_CAEEL  unnamed protein product                                  103     4e-28 


>Q9VWF5_DROME unnamed protein product
Length=175

 Score = 301 bits (772),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 140/173 (81%), Positives = 154/173 (89%), Gaps = 0/173 (0%)

Query  1    MSTLRPFTCDDLFRFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPSGEIMGYIMGK  60
            M+TLRPFTCDDLF+FNNVN DPLTETYGLSFY QYLA WPEYFQ+AESPSG+IMGYIMGK
Sbjct  1    MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGK  60

Query  61   AEGVGEDWHGHVTALTVSPDYRRLGLAAALMKFLEDVSEKKQAYFVDLFVRVSNKVAIKM  120
             EG  ++WHGHVTALTVSPDYRRLGLAA LM FLED+SEKK+AYFVDLFVR SN+VAI M
Sbjct  61   VEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINM  120

Query  121  YQQLGYIVYRTVLEYYSGDPDEDAYDMRKALSKDVKRKSVIPLEHPVRPEDVD  173
            Y  LGYI+YRT+LEYYSGD DEDAYDMRKALS+DV +KSVIP   PVR E +D
Sbjct  121  YTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQPVRLEHID  173


>M9PI14_DROME unnamed protein product
Length=180

 Score = 295 bits (755),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 136/167 (81%), Positives = 150/167 (90%), Gaps = 0/167 (0%)

Query  1    MSTLRPFTCDDLFRFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPSGEIMGYIMGK  60
            M+TLRPFTCDDLF+FNNVN DPLTETYGLSFY QYLA WPEYFQ+AESPSG+IMGYIMGK
Sbjct  1    MTTLRPFTCDDLFKFNNVNFDPLTETYGLSFYTQYLAKWPEYFQLAESPSGQIMGYIMGK  60

Query  61   AEGVGEDWHGHVTALTVSPDYRRLGLAAALMKFLEDVSEKKQAYFVDLFVRVSNKVAIKM  120
             EG  ++WHGHVTALTVSPDYRRLGLAA LM FLED+SEKK+AYFVDLFVR SN+VAI M
Sbjct  61   VEGHLDNWHGHVTALTVSPDYRRLGLAALLMSFLEDISEKKRAYFVDLFVRKSNQVAINM  120

Query  121  YQQLGYIVYRTVLEYYSGDPDEDAYDMRKALSKDVKRKSVIPLEHPV  167
            Y  LGYI+YRT+LEYYSGD DEDAYDMRKALS+DV +KSVIP   P+
Sbjct  121  YTNLGYIIYRTILEYYSGDQDEDAYDMRKALSRDVNKKSVIPYTQPI  167


>DAF31_CAEEL unnamed protein product
Length=182

 Score = 103 bits (257),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/163 (37%), Positives = 91/163 (56%), Gaps = 5/163 (3%)

Query  3    TLRPFTCDDLFRFNNVNLDPLTETYGLSFYMQYLAHWPEYFQVAESPSGEIMGYIMGK-A  61
             +R    DDL    N NL  L E Y + +Y  +   WP+   +AE   G ++GY++ K  
Sbjct  2    NIRCARVDDLMSMQNANLMCLPENYQMKYYFYHALSWPQLSYIAEDHKGNVVGYVLAKME  61

Query  62   EGVGEDWHGHVTALTVSPDYRRLGLAAALM-KFLEDVSEKKQAYFVDLFVRVSNKVAIKM  120
            E  GE+ HGH+T+L V   YRRLGLA  +M +    + E   A +V L VRVSN+ A+ +
Sbjct  62   EDPGEEPHGHITSLAVKRSYRRLGLANKMMDQTARAMVETYNAKYVSLHVRVSNRAALNL  121

Query  121  YQQ-LGYIVYRTVLEYYSGDPDEDAYDMRKALSKDVKRKSVIP  162
            Y+  L + +  T  +YY+    EDAY MR+ L+K  + +++ P
Sbjct  122  YKNTLKFEIVDTEPKYYAD--GEDAYAMRRDLAKWAEERNIEP  162



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000048-PA

Length=301
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9Y0Y5_DROME  unnamed protein product                                 210     1e-66
COPE_CAEEL  unnamed protein product                                   182     9e-56
Q381U5_TRYB2  unnamed protein product                                 63.5    3e-11


>Q9Y0Y5_DROME unnamed protein product
Length=306

 Score = 210 bits (535),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/299 (42%), Positives = 182/299 (61%), Gaps = 8/299 (3%)

Query  1    MARQQPNNDVDE-LFDVRNNFYIHNFQQCINEA-QRIKVSSPELELEKDVFMYRAYIAQR  58
            M+RQQ   D +  LFD RN +YI NF   IN        + PEL      +MY +Y+A  
Sbjct  1    MSRQQNEEDTNSVLFDARNEYYIGNFMGSINFVLPEQGTAGPELL----SYMYLSYLAID  56

Query  59   KFRIVLDEINDSSQEELQPLKLLAEYFAYPQRRKEIVAKI-DEQAEVQPKTYNFMIVAAT  117
              RIV  +I + +   LQ L+L+ E F  P R +E++ K+ D+ A  + +T  + +  A 
Sbjct  57   SGRIVASDIKEGNSTPLQALRLVHEAFEQPSRTEELLEKLTDKVAGEEDETNIWHLATAI  116

Query  118  IYYHEDNLESALRVIYKADNLECSALSVQIYLKMDRVDLAAKEVKTMQERDDDATLTQLA  177
            +Y H+   E+AL++++ + NLE  ALSVQ  L++ RVDLA + V  MQE  DDATLTQLA
Sbjct  117  VYCHDGQFENALKILHGSTNLESMALSVQCLLRLQRVDLAKQLVAKMQEISDDATLTQLA  176

Query  178  LAWVNLATGNDKYQEAFYIFQEMIDKYSSTTMLLNGKATSLLLQQKYDDAESVLQESLEK  237
             AWV LA G ++ Q+AF+I+QE  +K+  T  LLNG+A   L  ++Y++A+SVL+ESL K
Sbjct  177  QAWVALAQGTEQMQDAFHIYQEFCEKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLK  236

Query  238  DSNNPDTLINMIVLSQHMGKSQEA-NRYLTQLKDAHTEHPFVKDYLQKEIEFDQLAAKY  295
              N+ DTLIN++V +   GK  EA  R L QL+  + +  FV D  +K  EFD+L  +Y
Sbjct  237  KHNDYDTLINLMVHAHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQY  295


>COPE_CAEEL unnamed protein product
Length=292

 Score = 182 bits (462),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 111/287 (39%), Positives = 173/287 (60%), Gaps = 3/287 (1%)

Query  10   VDELFDVRNNFYIHNFQQCINEAQRIKVSSPELELEKDVFMYRAYIAQRKFRIVLDEIND  69
             D+LF +RN F++ ++Q CI EA +    + E + EKDV++YR+YIAQ +  I L EI  
Sbjct  2    ADKLFSIRNYFFLGSYQSCIGEALKFSSKNEEEKQEKDVYLYRSYIAQGQAFIPLKEIPA  61

Query  70   SSQE-ELQPLKLLAEYFAYPQRRKEIVAKIDEQ-AEVQPKTYNFMIVAATIYYHEDNLES  127
            +++  +L  ++  AE+   P  +K+I+A++ E+ A    K+    ++AATI    D  + 
Sbjct  62   ATKSADLAAVRRYAEFRNNPAAKKKILAEVQEEVASRNIKSEIAAVLAATILNEADLSQD  121

Query  128  ALRVIYKADNLECSALSVQIYLKMDRVDLAAKEVKTMQERDDDATLTQLALAWVNLATGN  187
            A R + + + LE  A  V I +KM++  LA  EVK M + D+DATL+QLA A V     +
Sbjct  122  AFRAVSRFEGLEARASKVFILIKMNKRKLAIGEVKKMNQIDEDATLSQLANALVTSFGAS  181

Query  188  DKYQEAFYIFQEMIDKYSSTTMLLNGKATSLLLQQKYDDAESVLQESLEKDSNNPDTLIN  247
             K ++A YI+ EM DKY  TT L   +A   +L Q Y  AE +L+ +LE+D+ + D LIN
Sbjct  182  GKVKDALYIYSEMSDKYGRTTDLEMHQAVVSILTQDYAAAEELLESALERDNKDADVLIN  241

Query  248  MIVLSQHMGKSQE-ANRYLTQLKDAHTEHPFVKDYLQKEIEFDQLAA  293
             IV +Q   K  +   R+++QLK  H  HP+V D+ +KE EFD++A+
Sbjct  242  SIVSAQLNEKDDDVVERFISQLKHEHPNHPWVIDFNEKEAEFDRVAS  288


>Q381U5_TRYB2 unnamed protein product
Length=324

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/304 (23%), Positives = 125/304 (41%), Gaps = 41/304 (13%)

Query  11   DELFDVRNNFYIHNFQQCINEAQRIKVSSPELE------LEKDVFMYRAYIAQRKFRIVL  64
            D  +D RN   + N+ Q + EA   K  + + E       EK+V +  A     +   V+
Sbjct  3    DPFYDARNALALGNYHQAVAEASGTKTDARKAEDIAAFHAEKEVLLALAQTGLGQGDAVV  62

Query  65   DEINDSSQEELQPLKLLAEYFAYPQRRKEIVA-------------KIDEQAEV-QPKTYN  110
             ++  ++   L  ++   E+  +    K +               K+ E AEV  P    
Sbjct  63   AQLKAATCPILVAVR---EWAVFCSAMKNLSGDIQSDPVICMQLKKLTEAAEVIDPARTQ  119

Query  111  FMIVAATIYYHEDNLESALRVIYKADN--------------LECSALSVQIYLKMDRVDL  156
              ++AA       +   AL++  +  N              +E   + V+  L+M R ++
Sbjct  120  IAVLAAAALLAVGDNAGALKLSKEWLNDQRHSRENSLLRLHMELRVIVVEALLRMGRTEM  179

Query  157  AAKEVKTMQERDDDATLTQLALAWVNLATG---NDKYQEAFYIFQEMIDKYSSTTMLLNG  213
            A  EVK M++ D+++ LT L     NL  G    + YQ A   F+E+      + +  N 
Sbjct  180  ARSEVKAMEQADEESMLTVLCSGITNLYEGIKTKEAYQTALRRFKELTMSCGQSVLASNL  239

Query  214  KATSLLLQQKYDDAESVLQESLEKDSNNPDTLINMIVLSQHMGKSQEANRYLTQLKDAHT  273
             A + +   +Y +AE  L + L   S + DT  N+ V+S H GK  ++    T+ +   T
Sbjct  240  TALAQIQLGEYTEAERTLLDVLAMKSGDSDTTANLAVISAHSGKGLDSTGLYTR-QAVAT  298

Query  274  EHPF  277
              P+
Sbjct  299  SGPW  302



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000049-PA

Length=329
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MQ08_CAEEL  unnamed protein product                                 30.8    1.9  
DIG1_CAEEL  unnamed protein product                                   30.8    1.9  
LAMC1_DROME  unnamed protein product                                  28.9    8.3  


>Q8MQ08_CAEEL unnamed protein product
Length=12250

 Score = 30.8 bits (68),  Expect = 1.9, Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 42/88 (48%), Gaps = 6/88 (7%)

Query  128    IGPGLGRDPKVF--ENVSKLIKTCFRLS-KPLVIDADGLFLVGQNTSLIKNYPGLVLTPN  184
              I P +G D K+   +N+ K++    R    PL  D+ G+F+ G  T + +N  G  + P+
Sbjct  10858  IYPAVGSDEKILPTDNLGKVVYPITRPDGSPLATDSTGVFVTGDGTIVERNEEGKPIGPD  10917

Query  185    AMEFTRLVQA-FLHKTVQP--TPVASDA  209
                  T      +++  + P   P+ +DA
Sbjct  10918  GQVLTTDNSGNYIYPVIGPDGEPLGTDA  10945


>DIG1_CAEEL unnamed protein product
Length=13100

 Score = 30.8 bits (68),  Expect = 1.9, Method: Composition-based stats.
 Identities = 23/88 (26%), Positives = 42/88 (48%), Gaps = 6/88 (7%)

Query  128    IGPGLGRDPKVF--ENVSKLIKTCFRLS-KPLVIDADGLFLVGQNTSLIKNYPGLVLTPN  184
              I P +G D K+   +N+ K++    R    PL  D+ G+F+ G  T + +N  G  + P+
Sbjct  10921  IYPAVGSDEKILPTDNLGKVVYPITRPDGSPLATDSTGVFVTGDGTIVERNEEGKPIGPD  10980

Query  185    AMEFTRLVQA-FLHKTVQP--TPVASDA  209
                  T      +++  + P   P+ +DA
Sbjct  10981  GQVLTTDNSGNYIYPVIGPDGEPLGTDA  11008


>LAMC1_DROME unnamed protein product
Length=1639

 Score = 28.9 bits (63),  Expect = 8.3, Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 20/34 (59%), Gaps = 0/34 (0%)

Query  203   TPVASDALIKELAKAIGTQVIVVAKGAEDKIGDG  236
             TPV +D   +   KA+  +V V+A+ A D  GDG
Sbjct  1081  TPVTNDDEFEAKLKAVQEKVAVLAQDARDNSGDG  1114



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000050-PA

Length=1049
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTW8_DROME  unnamed protein product                                 976     0.0  
M9PCA7_DROME  unnamed protein product                                 971     0.0  
M9PI37_DROME  unnamed protein product                                 967     0.0  


>Q9VTW8_DROME unnamed protein product
Length=1171

 Score = 976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/1032 (49%), Positives = 696/1032 (67%), Gaps = 61/1032 (6%)

Query  62    DVVPRLDHYR--LS-RRAKRPSLAELHEGN-PAKNPMHMANLEAGHSEAPGGQGAAAGTP  117
             + +PRLD+YR  +S + A RP+L ELH      KN   +   +   S    G        
Sbjct  157   EALPRLDNYRNMMSIQAAYRPTLDELHNATLVGKNTHSLTRNQDPESGILNGV-------  209

Query  118   SHHHEGIKLGWIQGVLIPCLLNIWGVMLFLRLSWVVAQAGIIYSCIIIAMSYFVCVITTL  177
                   +K GWI+GVL+ CLLNIWGVMLFLRLSWVV QAG+I   ++I  +  V  IT L
Sbjct  210   ------LKFGWIKGVLVRCLLNIWGVMLFLRLSWVVGQAGVIEGFVLILTTTAVTTITAL  263

Query  178   SLCAISTNGEVKGGGIYFIISRSLGPEFGASVGIVFAFANAVSASMNTIGFCDSLNTLLK  237
             S+ AISTNG +KGGG Y++ISRSLGPEFG S+G++F+ ANAV+ +M  +GFC+S+  ++ 
Sbjct  264   SMSAISTNGVIKGGGTYYMISRSLGPEFGGSIGLIFSLANAVACAMYVVGFCESMLAMMT  323

Query  238   DNDLKIIDNAQMDVRIVGTVAIIVMIMVCAVGMEWESKAQNFLIAVIVGAIFDFLIGALI  297
                 +IID    DVRI+G + I++++++  VGMEWE+KAQ  L+ +++ AI DF+IG+ I
Sbjct  324   TFGWEIIDGGVQDVRIIGCITILLLLIIVVVGMEWEAKAQIGLLIILLVAIGDFVIGSFI  383

Query  298   GPTNLEQRAEGFVGFSTATFMNNSFPDYRNWEG-VNHNFFSVFAIFFPSVTGIQAGANIS  356
             GP +  + A+GF+G++   F NN F DYR  +G + H+FFSVFAIFFP+ TGI AGANIS
Sbjct  384   GPKSDAEMAKGFLGYNATLFKNNLFADYRPEKGGIQHDFFSVFAIFFPAATGILAGANIS  443

Query  357   GDLKDPASSIPIGTLLSLLISMISYVTFVLVAGGAGLRDTN---HKVVNGTI--VECLAG  411
             GDLKDP  SIP GT+L+++I+  +Y+  VL  G    RD       VVNGT   ++C  G
Sbjct  444   GDLKDPQKSIPKGTILAIVITTGTYLIMVLQCGATVARDATGNLSDVVNGTFAFLDCQPG  503

Query  412   ECTSGLHTSYKMMQLMSYWGPFIYAGCFAATLSTALTNLLSVPRLIQALGEDRIYPGLIF  471
             EC  GL  S+++++L+S +GP IYAGC+AATLS+AL +L+S P++ QAL +D +YP +++
Sbjct  504   ECNYGLQNSFQVIELVSAFGPLIYAGCYAATLSSALASLVSAPKVFQALCKDELYPKIVW  563

Query  472   FSKGYGKNNEPYRGYVLTFVVAGVFLLIADLNAVAPLISNFYLASYALINFCTFHAALVR  531
             F+KGYGKNNEP RGYVLTF++A  F+LI +LN +APLISNF+LA+Y LINF TFHA+L +
Sbjct  564   FAKGYGKNNEPVRGYVLTFIIACAFILIGELNLIAPLISNFFLAAYMLINFSTFHASLAK  623

Query  532   PLGWRPTFKYYNTWLSLLGFIACVAIMFLIDWSTSLVTFVIIFALYLIVVYRKPDVNWGS  591
             P+GWRPTFKYYN WLSLLG I CVA+MFLI W+T+L+TF  + ALYLIV YRKPDVNWGS
Sbjct  624   PVGWRPTFKYYNMWLSLLGAILCVAVMFLISWATALITFAAVLALYLIVAYRKPDVNWGS  683

Query  592   STQAQTYKTALTIAYRLNSIDDHVKNYCPQILALSGTPNARPALVHLANLITKNNSLLIC  651
             +TQAQTYK AL    +LN++++HVKNY PQIL LSG PN RP LV LA ++TKN SLL+C
Sbjct  684   TTQAQTYKNALMSVQQLNNVEEHVKNYRPQILVLSGLPNTRPVLVDLAYMLTKNLSLLVC  743

Query  652   GEIYPTRMSYRVRSAHLRNGYTWLQRHRIKSFYHVVEELSLEKGASAMMQTSGVGKLAPN  711
             G +     S + R+        W ++HR+K FY +V+    E G  A+MQ +G+GKL PN
Sbjct  744   GHVLKGSSSQKYRTYLQERAGNWFRKHRVKGFYALVDGEDFESGTRALMQATGIGKLKPN  803

Query  712   VVLMGYKTHWNSCSYKELQEYFNVLHNAFDHRLAVAILRIADGLDCSNANGNLD------  765
             ++LMGYKT W +C +KEL +YFNV+H A D  L+VAILR+  GLDCS   G+ D      
Sbjct  804   IILMGYKTDWQTCDHKELDQYFNVMHKALDMYLSVAILRVPQGLDCSQVLGSQDGWKTVS  863

Query  766   DDQQIIQSNYDLAGSTLMHADSDL--SMSGS--GITR--VQSVPTIGTHFVPPDATTPMR  819
             D  + +Q N   +   L   DS +   +SGS   ++R   Q+  T    F+  + +  + 
Sbjct  864   DVPRTLQPNE--SSGDLQAVDSSVRNGLSGSIDSLSRNVSQASSTSDLSFIAGNQSKDVS  921

Query  820   DSPTHWNAREH-------LKNKKRHNAEKMLMNNKQNGLTVIPEY----LTIFQKKHKTG  868
               P   +A+          K+K +H+    L   K  G   +P+     LT F +K    
Sbjct  922   GMPDPLDAKSANLVSNSLRKSKLKHDDPASLY--KGPGGAELPKEVLADLTQFTRKRSHA  979

Query  869   IIDVWWLYDDGGLTILLPYIISTRSNWEHCKMRIFALSNNKQDIVAQEKEMAEIITKFRI  928
             +IDVWWLYDDGGLT+LLPYIISTR  W+ CK+R++AL+N   ++  +++ MA +++KFRI
Sbjct  980   VIDVWWLYDDGGLTLLLPYIISTRRTWQSCKLRVYALANKNSELEFEQRSMASLLSKFRI  1039

Query  929   KYTSLKMVDDISVQPQQETQKFFDRIISEF---RKNEANESS--------ECFVTDEELQ  977
              Y+ L ++ DI+ +PQ+ + +FF+ +I +F    K+  N +S        +  +TD++L 
Sbjct  1040  DYSDLTLIPDITKKPQETSTQFFNELIKDFVVTEKDGENGTSSRATLNEDDALITDDDLL  1099

Query  978   NLREKTFRQLRLRELLLEHSSQSTLVFMSLPMPRKGAVSAPLYMAWLEALTRDMPPTLLV  1037
              +++KT R LRLRE L E S++S LV M+LPMPRK  VSAPLYMAWLE+L+RDMPP L V
Sbjct  1100  AVQDKTNRYLRLREYLREQSTKSDLVVMTLPMPRKNIVSAPLYMAWLESLSRDMPPFLFV  1159

Query  1038  RGNHSSVLTFYS  1049
             RGN +SVLTFYS
Sbjct  1160  RGNQTSVLTFYS  1171


>M9PCA7_DROME unnamed protein product
Length=1191

 Score = 971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/1052 (48%), Positives = 697/1052 (66%), Gaps = 81/1052 (8%)

Query  62    DVVPRLDHYR--LS-RRAKRPSLAELHEGN-PAKNPMHMANLEAGHSEAPGGQGAAAGTP  117
             + +PRLD+YR  +S + A RP+L ELH      KN   +   +   S    G        
Sbjct  157   EALPRLDNYRNMMSIQAAYRPTLDELHNATLVGKNTHSLTRNQDPESGILNGV-------  209

Query  118   SHHHEGIKLGWIQGVLIPCLLNIWGVMLFLRLSWVVAQAGIIYSCIIIAMSYFVCVITTL  177
                   +K GWI+GVL+ CLLNIWGVMLFLRLSWVV QAG+I   ++I  +  V  IT L
Sbjct  210   ------LKFGWIKGVLVRCLLNIWGVMLFLRLSWVVGQAGVIEGFVLILTTTAVTTITAL  263

Query  178   SLCAISTNGEVKGGGIYFIISRSLGPEFGASVGIVFAFANAVSASMNTIGFCDSLNTLLK  237
             S+ AISTNG +KGGG Y++ISRSLGPEFG S+G++F+ ANAV+ +M  +GFC+S+  ++ 
Sbjct  264   SMSAISTNGVIKGGGTYYMISRSLGPEFGGSIGLIFSLANAVACAMYVVGFCESMLAMMT  323

Query  238   DNDLKIIDNAQMDVRIVGTVAIIVMIMVCAVGMEWESKAQNFLIAVIVGAIFDFLIGALI  297
                 +IID    DVRI+G + I++++++  VGMEWE+KAQ  L+ +++ AI DF+IG+ I
Sbjct  324   TFGWEIIDGGVQDVRIIGCITILLLLIIVVVGMEWEAKAQIGLLIILLVAIGDFVIGSFI  383

Query  298   GPTNLEQRAEGFVGFSTATFMNNSFPDYRNWEG-VNHNFFSVFAIFFPSVTGIQAGANIS  356
             GP +  + A+GF+G++   F NN F DYR  +G + H+FFSVFAIFFP+ TGI AGANIS
Sbjct  384   GPKSDAEMAKGFLGYNATLFKNNLFADYRPEKGGIQHDFFSVFAIFFPAATGILAGANIS  443

Query  357   GDLKDPASSIPIGTLLSLLISMISYVTFVLVAGGAGLRDTN---HKVVNGTI--VECLAG  411
             GDLKDP  SIP GT+L+++I+  +Y+  VL  G    RD       VVNGT   ++C  G
Sbjct  444   GDLKDPQKSIPKGTILAIVITTGTYLIMVLQCGATVARDATGNLSDVVNGTFAFLDCQPG  503

Query  412   ECTSGLHTSYKMMQLMSYWGPFIYAGCFAATLSTALTNLLSVPRLIQALGEDRIYPGLIF  471
             EC  GL  S+++++L+S +GP IYAGC+AATLS+AL +L+S P++ QAL +D +YP +++
Sbjct  504   ECNYGLQNSFQVIELVSAFGPLIYAGCYAATLSSALASLVSAPKVFQALCKDELYPKIVW  563

Query  472   FSKGYGKNNEPYRGYVLTFVVAGVFLLIADLNAVAPLISNFYLASYALINFCTFHAALVR  531
             F+KGYGKNNEP RGYVLTF++A  F+LI +LN +APLISNF+LA+Y LINF TFHA+L +
Sbjct  564   FAKGYGKNNEPVRGYVLTFIIACAFILIGELNLIAPLISNFFLAAYMLINFSTFHASLAK  623

Query  532   PLGWRPTFKYYNTWLSLLGFIACVAIMFLIDWSTSLVTFVIIFALYLIVVYRKPDVNWGS  591
             P+GWRPTFKYYN WLSLLG I CVA+MFLI W+T+L+TF  + ALYLIV YRKPDVNWGS
Sbjct  624   PVGWRPTFKYYNMWLSLLGAILCVAVMFLISWATALITFAAVLALYLIVAYRKPDVNWGS  683

Query  592   STQAQTYKTALTIAYRLNSIDDHVKNYCPQILALSGTPNARPALVHLANLITKNNSLLIC  651
             +TQAQTYK AL    +LN++++HVKNY PQIL LSG PN RP LV LA ++TKN SLL+C
Sbjct  684   TTQAQTYKNALMSVQQLNNVEEHVKNYRPQILVLSGLPNTRPVLVDLAYMLTKNLSLLVC  743

Query  652   GEIYPTRMSYRVRSAHLRNGYTWLQRHRIKSFYHVVEELSLEKGASAMMQTSGVGKLAPN  711
             G +     S + R+        W ++HR+K FY +V+    E G  A+MQ +G+GKL PN
Sbjct  744   GHVLKGSSSQKYRTYLQERAGNWFRKHRVKGFYALVDGEDFESGTRALMQATGIGKLKPN  803

Query  712   VVLMGYKTHWNSCSYKELQEYFNVLHNAFDHRLAVAILRIADGLDCSNANGNLD------  765
             ++LMGYKT W +C +KEL +YFNV+H A D  L+VAILR+  GLDCS   G+ D      
Sbjct  804   IILMGYKTDWQTCDHKELDQYFNVMHKALDMYLSVAILRVPQGLDCSQVLGSQDGWKTVS  863

Query  766   DDQQIIQSNYDLAGSTLMHADSDL--SMSGS--GITR----------------------V  799
             D  + +Q N   +   L   DS +   +SGS   ++R                      V
Sbjct  864   DVPRTLQPNE--SSGDLQAVDSSVRNGLSGSIDSLSRNVSQEDRNRNQLVHSEQNSLKIV  921

Query  800   QSVPTIGTHFVPPDATTPMRDSPTHWNAREH-------LKNKKRHNAEKMLMNNKQNGLT  852
             +S  T    F+  + +  +   P   +A+          K+K +H+    L   K  G  
Sbjct  922   KSSSTSDLSFIAGNQSKDVSGMPDPLDAKSANLVSNSLRKSKLKHDDPASLY--KGPGGA  979

Query  853   VIPEY----LTIFQKKHKTGIIDVWWLYDDGGLTILLPYIISTRSNWEHCKMRIFALSNN  908
              +P+     LT F +K    +IDVWWLYDDGGLT+LLPYIISTR  W+ CK+R++AL+N 
Sbjct  980   ELPKEVLADLTQFTRKRSHAVIDVWWLYDDGGLTLLLPYIISTRRTWQSCKLRVYALANK  1039

Query  909   KQDIVAQEKEMAEIITKFRIKYTSLKMVDDISVQPQQETQKFFDRIISEF---RKNEANE  965
               ++  +++ MA +++KFRI Y+ L ++ DI+ +PQ+ + +FF+ +I +F    K+  N 
Sbjct  1040  NSELEFEQRSMASLLSKFRIDYSDLTLIPDITKKPQETSTQFFNELIKDFVVTEKDGENG  1099

Query  966   SS--------ECFVTDEELQNLREKTFRQLRLRELLLEHSSQSTLVFMSLPMPRKGAVSA  1017
             +S        +  +TD++L  +++KT R LRLRE L E S++S LV M+LPMPRK  VSA
Sbjct  1100  TSSRATLNEDDALITDDDLLAVQDKTNRYLRLREYLREQSTKSDLVVMTLPMPRKNIVSA  1159

Query  1018  PLYMAWLEALTRDMPPTLLVRGNHSSVLTFYS  1049
             PLYMAWLE+L+RDMPP L VRGN +SVLTFYS
Sbjct  1160  PLYMAWLESLSRDMPPFLFVRGNQTSVLTFYS  1191


>M9PI37_DROME unnamed protein product
Length=1207

 Score = 967 bits (2500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/1068 (48%), Positives = 698/1068 (65%), Gaps = 97/1068 (9%)

Query  62    DVVPRLDHYR--LS-RRAKRPSLAELHEGN-PAKNPMHMANLEAGHSEAPGGQGAAAGTP  117
             + +PRLD+YR  +S + A RP+L ELH      KN   +   +   S    G        
Sbjct  157   EALPRLDNYRNMMSIQAAYRPTLDELHNATLVGKNTHSLTRNQDPESGILNGV-------  209

Query  118   SHHHEGIKLGWIQGVLIPCLLNIWGVMLFLRLSWVVAQAGIIYSCIIIAMSYFVCVITTL  177
                   +K GWI+GVL+ CLLNIWGVMLFLRLSWVV QAG+I   ++I  +  V  IT L
Sbjct  210   ------LKFGWIKGVLVRCLLNIWGVMLFLRLSWVVGQAGVIEGFVLILTTTAVTTITAL  263

Query  178   SLCAISTNGEVKGGGIYFIISRSLGPEFGASVGIVFAFANAVSASMNTIGFCDSLNTLLK  237
             S+ AISTNG +KGGG Y++ISRSLGPEFG S+G++F+ ANAV+ +M  +GFC+S+  ++ 
Sbjct  264   SMSAISTNGVIKGGGTYYMISRSLGPEFGGSIGLIFSLANAVACAMYVVGFCESMLAMMT  323

Query  238   DNDLKIIDNAQMDVRIVGTVAIIVMIMVCAVGMEWESKAQNFLIAVIVGAIFDFLIGALI  297
                 +IID    DVRI+G + I++++++  VGMEWE+KAQ  L+ +++ AI DF+IG+ I
Sbjct  324   TFGWEIIDGGVQDVRIIGCITILLLLIIVVVGMEWEAKAQIGLLIILLVAIGDFVIGSFI  383

Query  298   GPTNLEQRAEGFVGFSTATFMNNSFPDYRNWEG-VNHNFFSVFAIFFPSVTGIQAGANIS  356
             GP +  + A+GF+G++   F NN F DYR  +G + H+FFSVFAIFFP+ TGI AGANIS
Sbjct  384   GPKSDAEMAKGFLGYNATLFKNNLFADYRPEKGGIQHDFFSVFAIFFPAATGILAGANIS  443

Query  357   GDLKDPASSIPIGTLLSLLISMISYVTFVLVAGGAGLRDTN---HKVVNGTI--VECLAG  411
             GDLKDP  SIP GT+L+++I+  +Y+  VL  G    RD       VVNGT   ++C  G
Sbjct  444   GDLKDPQKSIPKGTILAIVITTGTYLIMVLQCGATVARDATGNLSDVVNGTFAFLDCQPG  503

Query  412   ECTSGLHTSYKMMQLMSYWGPFIYAGCFAATLSTALTNLLSVPRLIQALGEDRIYPGLIF  471
             EC  GL  S+++++L+S +GP IYAGC+AATLS+AL +L+S P++ QAL +D +YP +++
Sbjct  504   ECNYGLQNSFQVIELVSAFGPLIYAGCYAATLSSALASLVSAPKVFQALCKDELYPKIVW  563

Query  472   FSKGYGKNNEPYRGYVLTFVVAGVFLLIADLNAVAPLISNFYLASYALINFCTFHAALVR  531
             F+KGYGKNNEP RGYVLTF++A  F+LI +LN +APLISNF+LA+Y LINF TFHA+L +
Sbjct  564   FAKGYGKNNEPVRGYVLTFIIACAFILIGELNLIAPLISNFFLAAYMLINFSTFHASLAK  623

Query  532   PLGWRPTFKYYNTWLSLLGFIACVAIMFLIDWSTSLVTFVIIFALYLIVVYRKPDVNWGS  591
             P+GWRPTFKYYN WLSLLG I CVA+MFLI W+T+L+TF  + ALYLIV YRKPDVNWGS
Sbjct  624   PVGWRPTFKYYNMWLSLLGAILCVAVMFLISWATALITFAAVLALYLIVAYRKPDVNWGS  683

Query  592   STQAQTYKTALTIAYRLNSIDDHVKNYCPQILALSGTPNARPALVHLANLITKNNSLLIC  651
             +TQAQTYK AL    +LN++++HVKNY PQIL LSG PN RP LV LA ++TKN SLL+C
Sbjct  684   TTQAQTYKNALMSVQQLNNVEEHVKNYRPQILVLSGLPNTRPVLVDLAYMLTKNLSLLVC  743

Query  652   GEIYPTRMSYRVRSAHLRNGYTWLQRHRIKSFYHVVEELSLEKGASAMMQTSGVGKLAPN  711
             G +     S + R+        W ++HR+K FY +V+    E G  A+MQ +G+GKL PN
Sbjct  744   GHVLKGSSSQKYRTYLQERAGNWFRKHRVKGFYALVDGEDFESGTRALMQATGIGKLKPN  803

Query  712   VVLMGYKTHWNSCSYKELQEYFNVLHNAFDHRLAVAILRIADGLDCSNANGNLD------  765
             ++LMGYKT W +C +KEL +YFNV+H A D  L+VAILR+  GLDCS   G+ D      
Sbjct  804   IILMGYKTDWQTCDHKELDQYFNVMHKALDMYLSVAILRVPQGLDCSQVLGSQDGWKTVS  863

Query  766   DDQQIIQSNYDLAGSTLMHADSDL--SMSGS-----------------------------  794
             D  + +Q N   +   L   DS +   +SGS                             
Sbjct  864   DVPRTLQPNE--SSGDLQAVDSSVRNGLSGSIDSLSRNVSQEDRNRNQLVHSEQNSLKIV  921

Query  795   ------GITRVQSVP-----TIGTHFVPPDATTPMRDSPTHWNAREH-------LKNKKR  836
                   G+ R++S P     T    F+  + +  +   P   +A+          K+K +
Sbjct  922   KLRFKQGLRRMRSWPGAASSTSDLSFIAGNQSKDVSGMPDPLDAKSANLVSNSLRKSKLK  981

Query  837   HNAEKMLMNNKQNGLTVIPEY----LTIFQKKHKTGIIDVWWLYDDGGLTILLPYIISTR  892
             H+    L   K  G   +P+     LT F +K    +IDVWWLYDDGGLT+LLPYIISTR
Sbjct  982   HDDPASLY--KGPGGAELPKEVLADLTQFTRKRSHAVIDVWWLYDDGGLTLLLPYIISTR  1039

Query  893   SNWEHCKMRIFALSNNKQDIVAQEKEMAEIITKFRIKYTSLKMVDDISVQPQQETQKFFD  952
               W+ CK+R++AL+N   ++  +++ MA +++KFRI Y+ L ++ DI+ +PQ+ + +FF+
Sbjct  1040  RTWQSCKLRVYALANKNSELEFEQRSMASLLSKFRIDYSDLTLIPDITKKPQETSTQFFN  1099

Query  953   RIISEF---RKNEANESS--------ECFVTDEELQNLREKTFRQLRLRELLLEHSSQST  1001
              +I +F    K+  N +S        +  +TD++L  +++KT R LRLRE L E S++S 
Sbjct  1100  ELIKDFVVTEKDGENGTSSRATLNEDDALITDDDLLAVQDKTNRYLRLREYLREQSTKSD  1159

Query  1002  LVFMSLPMPRKGAVSAPLYMAWLEALTRDMPPTLLVRGNHSSVLTFYS  1049
             LV M+LPMPRK  VSAPLYMAWLE+L+RDMPP L VRGN +SVLTFYS
Sbjct  1160  LVVMTLPMPRKNIVSAPLYMAWLESLSRDMPPFLFVRGNQTSVLTFYS  1207



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000051-PA

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961B0_DROME  unnamed protein product                                 81.6    5e-16
Q9Y1T2_DROME  unnamed protein product                                 81.6    5e-16
Q9VAS9_DROME  unnamed protein product                                 73.9    2e-13


>Q961B0_DROME unnamed protein product
Length=1067

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 74/132 (56%), Gaps = 17/132 (13%)

Query  225  QTPLMFSRCSSLGSLSGYEQQSLLDDRSSVISDFSRRTSEVVSPSELPDSPAQFIHSGQL  284
            +TPLMFSR SS+ SL G ++    +D  SVIS++SR  S V+SPSELPDSP Q +     
Sbjct  654  ETPLMFSRRSSMDSLVGDDETVACEDNGSVISEYSRMQSGVISPSELPDSPTQSMPQSPR  713

Query  285  RDKRL-TRKKLQQIRDKPQTSETFLGQQEGSKYSVFEDNLAIFKEESTPVKFQSVAASSL  343
            RD+++ T+  L     KP T              VFED L  F  E TP  F    A+SL
Sbjct  714  RDRKVSTQNNLDTPEQKPST--------------VFEDKLNRFHVEHTPAAFS--CATSL  757

Query  344  SSLTIDDEYDVD  355
            S+L++ D+ + +
Sbjct  758  SNLSMMDDSNAN  769


>Q9Y1T2_DROME unnamed protein product
Length=1067

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 74/132 (56%), Gaps = 17/132 (13%)

Query  225  QTPLMFSRCSSLGSLSGYEQQSLLDDRSSVISDFSRRTSEVVSPSELPDSPAQFIHSGQL  284
            +TPLMFSR SS+ SL G ++    +D  SVIS++SR  S V+SPSELPDSP Q +     
Sbjct  654  ETPLMFSRRSSMDSLVGDDETVACEDNGSVISEYSRMQSGVISPSELPDSPTQSMPQSPR  713

Query  285  RDKRL-TRKKLQQIRDKPQTSETFLGQQEGSKYSVFEDNLAIFKEESTPVKFQSVAASSL  343
            RD+++ T+  L     KP T              VFED L  F  E TP  F    A+SL
Sbjct  714  RDRKVSTQNNLDTPEQKPST--------------VFEDKLNRFHVEHTPAAFS--CATSL  757

Query  344  SSLTIDDEYDVD  355
            S+L++ D+ + +
Sbjct  758  SNLSMMDDSNAN  769


>Q9VAS9_DROME unnamed protein product
Length=2417

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 73/130 (56%), Gaps = 11/130 (8%)

Query  225   QTPLMFSRCSSLGSLSGYEQQSL--LDDRSSVISDFSRRTSEVVSPSELPDSPAQFIHSG  282
             +TPLMFSR SS+ SL       +   DD+SSV+SDFSR  S V+SPSE+PDSP Q +   
Sbjct  974   ETPLMFSRRSSMDSLVHDPDVDVANCDDKSSVVSDFSRLASGVISPSEIPDSPTQSMPQS  1033

Query  283   QLRDKRLTRKKLQQIRDKPQTSETFLGQQEGSKYSVFEDNLAIFKEESTPVKFQSVAASS  342
               R+        Q +   P      L        SVFED+L+ F  E TP +F +  A+S
Sbjct  1034  PRRNS--VAGSGQNVDSPPVVIPASLQPLR----SVFEDDLSSFNVEHTPAQFST--ATS  1085

Query  343   LSSLTI-DDE  351
             LS+L+I DDE
Sbjct  1086  LSNLSIVDDE  1095



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000052-PA

Length=184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBM2_DROME  unnamed protein product                                 28.5    3.2  
Q7K1S6_DROME  unnamed protein product                                 28.1    4.4  


>A1ZBM2_DROME unnamed protein product
Length=244

 Score = 28.5 bits (62),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query  84   ESLQLGCEMSKNPELLNGD------NNNDTKMKNAGNGTELEEHVKKTHSTFNGNKSILK  137
            E L  GC  +   ++  GD      +NND ++    N   L  HV  + +TF+ + + ++
Sbjct  45   EILTGGCAGTMKVQVFKGDTCVSTMDNNDAQLGYYANSDGLRLHVVDSFATFSFDSAPVE  104

Query  138  -------QYQRNRKSDKRPLKLLPTSFYTTAKI-HTEEKKRWIA  173
                   QY++   S +  LK+     Y   ++   EEKKR  A
Sbjct  105  KFELSKDQYEQRTDSVRNYLKINRMGKYNDEEMQQAEEKKRLQA  148


>Q7K1S6_DROME unnamed protein product
Length=271

 Score = 28.1 bits (61),  Expect = 4.4, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 46/104 (44%), Gaps = 14/104 (13%)

Query  84   ESLQLGCEMSKNPELLNGD------NNNDTKMKNAGNGTELEEHVKKTHSTFNGNKSILK  137
            E L  GC  +   ++  GD      +NND ++    N   L  HV  + +TF+ + + ++
Sbjct  72   EILTGGCAGTMKVQVFKGDTCVSTMDNNDAQLGYYANSDGLRLHVVDSFATFSFDSAPVE  131

Query  138  -------QYQRNRKSDKRPLKLLPTSFYTTAKI-HTEEKKRWIA  173
                   QY++   S +  LK+     Y   ++   EEKKR  A
Sbjct  132  KFELSKDQYEQRTDSVRNYLKINRMGKYNDEEMQQAEEKKRLQA  175



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000053-PA

Length=300
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q17962_CAEEL  unnamed protein product                                 39.3    0.003
FBXW7_DROME  unnamed protein product                                  35.4    0.058
YKK7_CAEEL  unnamed protein product                                   34.7    0.086


>Q17962_CAEEL unnamed protein product
Length=384

 Score = 39.3 bits (90),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 44/201 (22%), Positives = 74/201 (37%), Gaps = 49/201 (24%)

Query  33   IIHSVIIPDELLLSIFYAMDAKSLLHCHMVCRHWRYLI-RNRVWYKKAELTVGQSLPLSD  91
            II +  +P+E    IF  +D KSLL+C + C  +  LI  +  W + A +     L +S+
Sbjct  21   IIDAETVPNECFSPIFRRLDKKSLLNCQLACHRFNDLISSDSFWIEYARI-----LNISN  75

Query  92   KIPWTAYCFICANKPFYKNLVKNHSREEGLFKYWKVTDNG--------------------  131
             +P   +      K F  N           F   K+  +G                    
Sbjct  76   VLPSLEWRRAATQKKFVGNEDNEIDTSSFNFNIKKIVLSGRGYSPITPLFISHFENARDN  135

Query  132  ----------------GAGWDIECP-PQGVKPLPADPVFENKQFCFVTSFGRCCMEQTID  174
                            G+G  +E     G +P P      +   CFV SF    +   ID
Sbjct  136  TISGTLRSDDFSIRANGSGIHMERDGGNGCEPHP------DVSKCFVFSFTESSISVFID  189

Query  175  LIDEGMNEYLLGFLQPTIHFS  195
            L++ G++ ++L  ++P I  +
Sbjct  190  LVNSGIDPWILDHVRPRIRIT  210


>FBXW7_DROME unnamed protein product
Length=1326

 Score = 35.4 bits (80),  Expect = 0.058, Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 1/56 (2%)

Query  38   IIPDELLLSIFYAMDAKSLLHCHMVCRHWRYLI-RNRVWYKKAELTVGQSLPLSDK  92
            ++P EL L +   ++ K LL     CR WR+L   N +W +K       + P SD+
Sbjct  894  LLPRELALFVLSYLEPKDLLRAAQTCRSWRFLCDDNLLWKEKCRKAQILAEPRSDR  949


>YKK7_CAEEL unnamed protein product
Length=466

 Score = 34.7 bits (78),  Expect = 0.086, Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (2%)

Query  29   INGSIIHSVIIPDELLLSIFYAMDAKSLLHCHMVCRHWRYLIRNRVWYKKAEL  81
            ++ S+I+ V+ P E+LL +F  +D K+L     VCR W  L  +   +++ +L
Sbjct  51   VDNSLINRVL-PKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDL  102



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000054-PA

Length=1325
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01485_CAEEL  unnamed protein product                                 768     0.0  
Q38CF6_TRYB2  unnamed protein product                                 35.4    0.44 
Q583M5_TRYB2  unnamed protein product                                 32.3    4.1  


>O01485_CAEEL unnamed protein product
Length=2076

 Score = 768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/1300 (38%), Positives = 752/1300 (58%), Gaps = 75/1300 (6%)

Query  47    FGQIFPRVANKHRLQMLDHFSECIKHAK-SGRQEAVQMNVFTAVLSGLKGLNEAKT-GFG  104
             +G++FP V NKH++Q+ +HF + I+ +K +GR++A+ +N  TA L   K L E +     
Sbjct  806   YGKVFPLVNNKHKVQITEHFWDTIQKSKNAGRKQAILVNALTAKLLSYKTLCEQRGHKLD  865

Query  105   QEDVKKAATNLIIGSLSSHNAILRWAAGEAVGRMAQVISDAKFTAEMAQTSFDRLKSARD  164
              E +++A+ +LI  SLS+   + R    EA+ R++Q ++   F A +AQ  FD+L S +D
Sbjct  866   NETLQRASFDLISSSLSNSCPMTRLVGAEALARLSQAVNSPPFVASIAQYCFDKLNSCKD  925

Query  165   VVTRTGHSLALGCLHKYVGGMGSSQHLNTSVSILLALAQDNSSPVVQVWALHALALIADS  224
              + R+GH LALGCLH++VG +GS QHLNT VS++LALA+++  P VQ  AL A+ALIA++
Sbjct  926   EINRSGHVLALGCLHRHVGSLGSGQHLNTGVSVVLALAEESKMPKVQTCALVAMALIAET  985

Query  225   GGPMFRGYVEPTLSLCLTLLLNVPHSYIDVHQCIGKVLSALITVIGPELQGNTSSICMAR  284
             G  MFR +VE TLS CL LL++ P   +DV Q I K L+ALIT +GPEL      I   R
Sbjct  986   GSGMFRVFVETTLSSCLKLLISTPTFVVDVVQGISKCLTALITCVGPELSC-PGVIDGVR  1044

Query  285   SSFLCACAIMQDHQDSLVQAEATGCLQQLHLFAPRHVNLSSLVPTLCRTLSSNHLLLRKA  344
             +S L ACAI   H D  VQAEA   LQQ+HLFAPR+V+++ LV  +   LSS HL++R+ 
Sbjct  1045  TSLLAACAIQLSHSDPFVQAEAISGLQQMHLFAPRYVHMAQLVVDISSLLSSTHLVIRRQ  1104

Query  345   AISCLRQLAQREAKEVCEHAMTLANES-RDTNVVEGLVITETGLPGVLFSMLDTETDSQL  403
             ++SCLRQL QRE+KEV  HA  L  +   DTN  +   + E+GL G LF MLDTE + +L
Sbjct  1105  SVSCLRQLVQRESKEVRNHAQVLVPQGIVDTNK-KKFALPESGLEGALFGMLDTEVNKEL  1163

Query  404   IKEIHDTLTSMLQILASNNLSPWLSLCKDVLTVATESSTL---DEAANINPEETSGDNEN  460
                + +TL S++Q  +   L+ WL L K++L  + +   +   +E  +   ++   D++ 
Sbjct  1164  RCHLQETLISLVQGTSGELLNNWLMLSKEILATSNDHGLVRKKEEKKDRGEDDADDDDDE  1223

Query  461   VDGEGDDDQAEFHADESSKQRQMISPRWPTRVFAAQCVRRIITACANDKQVHFDLAMAKE  520
                +  +        E  K +  + PRWPT+VF  + V R+++ C + ++ H D+A+AKE
Sbjct  1224  DGDDDTNLAGISSLMEEDKGK--VQPRWPTKVFTMEIVNRLMSVC-DTERAHLDMALAKE  1280

Query  521   MQNTK-GKGDFLVLYLSDLVRMAFMAATSDCDSLRLEGLKTLQETIDKFAKVPEPEFPGH  579
             +Q T  GK D+LVL+LSDLVRM+FMAATSD   LR+ GLK+L+E I +F+  PEPEFPGH
Sbjct  1281  LQITSAGKNDYLVLHLSDLVRMSFMAATSDNSLLRIAGLKSLEEVIIRFSSCPEPEFPGH  1340

Query  580   LLLEQFQAQVGAALRPAFSAETSPHVTAAACEACSAWIGSGVARDLNDLRRVHQLLVSSL  639
             ++LEQFQAQVGAALRPAF+ +T  +VT+ AC+ CS WIGSGVARDL+DL+RVHQLLVSSL
Sbjct  1341  MILEQFQAQVGAALRPAFTDDTPSNVTSVACQVCSTWIGSGVARDLSDLKRVHQLLVSSL  1400

Query  640   EKLREGHARPQLYNESLSTLERLAILKAWAEVYVVAMIKDGSALDNREITNKNNNQENNE  699
              KL+ G    QLY+ES +TLE+L+ILKAWAEVYV A+ +D           KN N E  +
Sbjct  1401  NKLKHGSINVQLYSESAATLEKLSILKAWAEVYVTAIEQD---------RMKNENVEARD  1451

Query  700   E-DGEGFGEFEFQNESLLSLVQPELPSLSQHWLAALRDHALLSLPPEFASQLPHDGGAFY  758
               D  G G       SLLSLV+PE  SL  +WLA L D ALL+LP  ++ Q  + GGAF+
Sbjct  1452  HYDYNGSG-------SLLSLVEPEANSLIAYWLAMLNDSALLALPAHYSDQFLNRGGAFF  1504

Query  759   TTDTMELARPYYLNSWAPILYAATLWLNVRGFELNETTDLNAKKSDGTNNNHTVKTGSNK  818
                + E  R YY   W PIL A + WL+   FEL    +L+++ +         +   N 
Sbjct  1505  NAHSAEACREYYQICWPPILLACSTWLSKNNFELPSGIELSSETAA------VWRDEGNV  1558

Query  819   ERFHLLYGICMEALCSPRSSESTQNIETCLSALYTLLDSLWARKVLVVNKSLPIELCNVL  878
              RF+LL GI +E+L +       + I+  + +L  LL   W +  L+ +    IE+  VL
Sbjct  1559  SRFYLLIGIAVESLSNKTRQIEDETIQMSVKSLTRLLSCEWCQLHLMSDVPAVIEILYVL  1618

Query  879   HRLLLTNEIYSIQIMVMEVLKQVIKANQEDLTERKKAKLRELTSDDDETKD----VPELD  934
             HR +LT +  S Q+  +E +  +I A Q  L  R  A  R++++ + E++D    +P + 
Sbjct  1619  HRSVLTRDCLSTQLQCIECVGSIIDAAQ--LAIRICAS-RDISNGNLESEDTLRKIPNVL  1675

Query  935   CLGE--GEDASELMPG-KSLVFAVLEVCLCLLVRQIPPLNPNPGGATAI----LSQRGYL  987
               GE  G+D +    G K++ +A+LE+ +C + +Q+P +N       ++    L + G L
Sbjct  1676  FAGEEGGKDGNINKDGVKTISYAILELAVCAIFKQMPQINSAQLKTNSLAALHLRKVGRL  1735

Query  988   PTDESGKLIAAALSVMETLPNLCSPTGSVMILPTLLYLTTGVVRETAVRSENNYIKTGTD  1047
             P  E   L+  ++ ++  +P+LCSP   V +LP ++YL  G VRE+A R +   I+  TD
Sbjct  1736  PA-EGTHLVIKSMQILVQIPSLCSPHSRVTVLPVIMYLLLGFVRESA-RLDEGSIQ--TD  1791

Query  1048  TPVHAALHCLKNL----AIHKYSRDPRSQNQWTAHLQSALAKIIDLAKTGSDETKMDEVA  1103
                H +      +    +I     D  +   W   +++A   ++++++  ++  ++D+  
Sbjct  1792  RAGHLSAIAAAAIQSIRSIVSQQPDDDTAVSWKTIMRNAFYSVLNMSE-DNERIQLDKCI  1850

Query  1104  MMLGIAVFVLHALPEVVSPPNLQF-PCINHFRLVIQSENIYIRLKCVQTLRTIFLQQDRS  1162
             +M+   VF   A  +VV      F   I   +  +QS+N+ + +K +Q+L +IF +  + 
Sbjct  1851  IMVTAVVFTTSAPVDVVLGHQESFNKLIVLLKRHLQSDNVSVVMKTLQSLASIFGR--KG  1908

Query  1163  ISTPYIHALA----PRIVEYLYS-DQSKQVTNDEELQFTLECITTVDSLIALAEPTRRIQ  1217
                 ++  L     P +  YL   D   +   + +L    EC+  ++ L   A+  +RIQ
Sbjct  1909  FGGIFVKHLGKEIMPVVKRYLSKVDCENEKITESDLVILQECVKVIEVLAMSAKDGKRIQ  1968

Query  1218  ILTLLVPVLINYLLEGD--ELQKGTKHQISLHQHSFQWLNKIGPKYPQVWTEFKTLMSQS  1275
             +++LLV +L+  L      E +K    +  LH+ +   LN     +P    EFK ++  +
Sbjct  1969  VISLLVQLLVRLLRATSHTEWRKVGPIEKKLHEMAIGRLNAAASMWP---AEFKKVIEWN  2025

Query  1276  TELKTKLENAVRLTHQQQAQKQTKTLETTKSQLKVPTPSI  1315
              ELKT+LE+A+ L    Q+ +    +   K+Q    TP +
Sbjct  2026  NELKTRLESALLL----QSTRHAHQISMAKTQEAKTTPVV  2061


>Q38CF6_TRYB2 unnamed protein product
Length=1719

 Score = 35.4 bits (80),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (46%), Gaps = 15/81 (19%)

Query  169  TGHSLALGCLHKYVGGMGSSQHLNTSVSILLALAQDNSSPVVQVWALHALALIADSGGPM  228
            +GH+  + CL +Y G  G         ++L + + D +   V+ W  +  A     GGPM
Sbjct  193  SGHNNTVRCLCQYAGDTG---------AVLFSGSDDGT---VRAWDPYLPARKGKDGGPM  240

Query  229  ---FRGYVEPTLSLCLTLLLN  246
               F G+ +  LSL L  + N
Sbjct  241  MHIFTGHTQGVLSLELVTVSN  261


>Q583M5_TRYB2 unnamed protein product
Length=1621

 Score = 32.3 bits (72),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 7/93 (8%)

Query  592  ALRPAFSAETSPHVTAAA---CEACSAWIGSGVARDLNDLRRVHQLLVSSLEKLREGHAR  648
            A++P F+ + +P V   A   C  C ++IG+GV   L DLR V    +  LEK  E    
Sbjct  182  AMQPLFN-DPNPQVRKEAANLCCHCYSYIGAGVKSCLTDLREVQ---LQELEKQFENIVL  237

Query  649  PQLYNESLSTLERLAILKAWAEVYVVAMIKDGS  681
             ++   ++  +E    +K+ A +  +A   D S
Sbjct  238  GRVPRRNIKGIETSTPIKSVAPIVGIASRTDRS  270



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000055-PA

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

R9PY22_DROME  unnamed protein product                                 218     8e-64
A8JNI3_DROME  unnamed protein product                                 218     3e-63
Q9VM10_DROME  unnamed protein product                                 156     5e-41


>R9PY22_DROME unnamed protein product
Length=517

 Score = 218 bits (554),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 135/447 (30%), Positives = 228/447 (51%), Gaps = 24/447 (5%)

Query  66   LKMSPTSLTFSIWQKPPIAVYVYVYIFNVTNTDAFLSGEEKLKIEEIGPFVYQEILENQN  125
            L++   +L++  WQ+P +     +YI+NVTN D FL GE K  ++E+GPFVY+E ++  N
Sbjct  12   LRLWNDTLSYHYWQRPGVIRLTKLYIYNVTNPDGFLRGE-KPHLQEVGPFVYREDMQKVN  70

Query  126  VTWHDNG-TLTYIPKRSVEFKPEMSIGIPEEIYVSVPNIVMLGVSSALHDAGFLVNYPFI  184
            V +H+N  T++Y  K+ ++F PE+SI   ++  ++ PNI +L ++S     G+L++    
Sbjct  71   VKFHENNYTVSYQHKKILQFVPELSID--KDTPITTPNIPLLTLTSLSPKLGYLLSKTIS  128

Query  185  QLSNFLDAMPILNITVQDYLWGYDDPMVYLAGSVVPKYIT-FRKFGLLDRMYDEGTNVIN  243
             +       P +N+T +   +GYDD +V LA    PK++    + GLL  +   GT    
Sbjct  129  VVVTAAQFKPFINVTAEQLAFGYDDALVSLAHRFYPKHMRPMERMGLL--LGRNGTLTEV  186

Query  244  MNVKGNEDMLEERGRYLSIESYNGNPGLSIWGYVKEEGNQTRPENTKCNRIQGATEGTVF  303
             +VK   D +++ G    I+  NG   L  W                C  I G +EG+ F
Sbjct  187  SSVKTGMDSMDQFGY---IDQLNGLDHLPHWS------------EPPCTSIAG-SEGSFF  230

Query  304  P-TMMDRRAVFRVFRKAFCRPMPIAFVKEVNLDGLPGYQYGIPDNFADPPEQNPDNECFC  362
            P   + +  V  ++ K  CR +P+ +V+ +  DG+    + +P+N       NP+N+C+ 
Sbjct  231  PPRELTKSEVVHIYDKDLCRIIPLKYVESLEKDGIAADLFRLPNNSYGDSAHNPENKCYD  290

Query  363  RDRTCLKRGLLDLTPCYYNIPAAASLPHFLNADPSVSDGIEGLNPDPEKHETVIILQPNL  422
                   +GL +++PC Y  P   S PHF  + P + + +EGL P+ EKHET   +QP L
Sbjct  291  TSEYEPIQGLQNISPCQYGAPVYISNPHFFESHPDLLNSVEGLKPEREKHETYFKIQPKL  350

Query  423  GIPMYVHSRLQTNLMMKETYYNSKIKPFNNLTVPLFWTDLVIPEIPPNLMFLLRLAITIA  482
            G+P+    R+Q NL +        ++ F +   P+ W +  I E+ P +   + L   IA
Sbjct  351  GVPLEGKVRIQLNLKVTRAKDVYPVRDFRDFVFPVMWLEEGISELTPAIKRWIYLGTVIA  410

Query  483  PVGQTIFAIVFGVFGLGVICWSLARAF  509
            P    I + +  + G   I +S  RA+
Sbjct  411  PSAVPIGSYLMILGGAFAIIFSFVRAY  437


>A8JNI3_DROME unnamed protein product
Length=615

 Score = 218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 135/447 (30%), Positives = 228/447 (51%), Gaps = 24/447 (5%)

Query  66   LKMSPTSLTFSIWQKPPIAVYVYVYIFNVTNTDAFLSGEEKLKIEEIGPFVYQEILENQN  125
            L++   +L++  WQ+P +     +YI+NVTN D FL GE K  ++E+GPFVY+E ++  N
Sbjct  110  LRLWNDTLSYHYWQRPGVIRLTKLYIYNVTNPDGFLRGE-KPHLQEVGPFVYREDMQKVN  168

Query  126  VTWHDNG-TLTYIPKRSVEFKPEMSIGIPEEIYVSVPNIVMLGVSSALHDAGFLVNYPFI  184
            V +H+N  T++Y  K+ ++F PE+SI   ++  ++ PNI +L ++S     G+L++    
Sbjct  169  VKFHENNYTVSYQHKKILQFVPELSID--KDTPITTPNIPLLTLTSLSPKLGYLLSKTIS  226

Query  185  QLSNFLDAMPILNITVQDYLWGYDDPMVYLAGSVVPKYIT-FRKFGLLDRMYDEGTNVIN  243
             +       P +N+T +   +GYDD +V LA    PK++    + GLL  +   GT    
Sbjct  227  VVVTAAQFKPFINVTAEQLAFGYDDALVSLAHRFYPKHMRPMERMGLL--LGRNGTLTEV  284

Query  244  MNVKGNEDMLEERGRYLSIESYNGNPGLSIWGYVKEEGNQTRPENTKCNRIQGATEGTVF  303
             +VK   D +++ G    I+  NG   L  W                C  I G +EG+ F
Sbjct  285  SSVKTGMDSMDQFG---YIDQLNGLDHLPHW------------SEPPCTSIAG-SEGSFF  328

Query  304  P-TMMDRRAVFRVFRKAFCRPMPIAFVKEVNLDGLPGYQYGIPDNFADPPEQNPDNECFC  362
            P   + +  V  ++ K  CR +P+ +V+ +  DG+    + +P+N       NP+N+C+ 
Sbjct  329  PPRELTKSEVVHIYDKDLCRIIPLKYVESLEKDGIAADLFRLPNNSYGDSAHNPENKCYD  388

Query  363  RDRTCLKRGLLDLTPCYYNIPAAASLPHFLNADPSVSDGIEGLNPDPEKHETVIILQPNL  422
                   +GL +++PC Y  P   S PHF  + P + + +EGL P+ EKHET   +QP L
Sbjct  389  TSEYEPIQGLQNISPCQYGAPVYISNPHFFESHPDLLNSVEGLKPEREKHETYFKIQPKL  448

Query  423  GIPMYVHSRLQTNLMMKETYYNSKIKPFNNLTVPLFWTDLVIPEIPPNLMFLLRLAITIA  482
            G+P+    R+Q NL +        ++ F +   P+ W +  I E+ P +   + L   IA
Sbjct  449  GVPLEGKVRIQLNLKVTRAKDVYPVRDFRDFVFPVMWLEEGISELTPAIKRWIYLGTVIA  508

Query  483  PVGQTIFAIVFGVFGLGVICWSLARAF  509
            P    I + +  + G   I +S  RA+
Sbjct  509  PSAVPIGSYLMILGGAFAIIFSFVRAY  535


>Q9VM10_DROME unnamed protein product
Length=563

 Score = 156 bits (395),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 120/507 (24%), Positives = 230/507 (45%), Gaps = 47/507 (9%)

Query  22   TMKSPIEIQQYRRCILLFLIGITCSIVALLIHV--VDPVKMIVQHKLKMSPTSLTFSIWQ  79
            T  S +  Q+  R +++ + G    +  +L  +  VD    I+  ++ ++P +  +  W+
Sbjct  3    TQNSAMWGQKSNRKLIIGIFGFCLGLFGILCGMFWVDLFDWIMHKEMALAPDTRVYENWK  62

Query  80   KPPIAVYVYVYIFNVTNTDAFLSGEEKLKIEEIGPFVYQEILENQNVTWH-DNGTLTYIP  138
             PPI + + +Y++N TN + F +   K  +E++GP+ + E  +  ++ WH +N ++TY  
Sbjct  63   SPPIDLSLDIYLYNWTNPEDFGNLSTKPILEQVGPYRFIERPDKVDIHWHPENASVTYRR  122

Query  139  KRSVEFKPEMSIGIPEEIYVSVPNIVMLG---------VSSALHDAGFLVNYPFIQLSNF  189
            +    F    S G  ++   ++  + +           V  +L D G  +    + +   
Sbjct  123  RSLFYFDAAGSNGSLDDEITTLNAVALSAAATAKYWPPVKRSLVDVGLKMYGAEMSVQKS  182

Query  190  LDAMPILNITVQDYLWGYDDPMVYLAGSVVPKY-----ITFRKFGLLDRMYDEGTNVINM  244
            +D +            GY+D M+ +A   +P +     + F KFG               
Sbjct  183  IDEL---------LFTGYNDAMIDVA-MAMPIFGDEVKVPFDKFGWFYTRNGSADLTGVF  232

Query  245  NVKGNEDMLEERGRYLSIESYNGNPGLSIWGYVKEEGNQTRPENTKCNRIQGATEGTVFP  304
            NV    D L + G+  S            W Y +  G      ++ C    G+  G   P
Sbjct  233  NVFTGADQLAKLGQMHS------------WNYQENTGF----FDSYCGMTNGSA-GEFQP  275

Query  305  TMMDRRAVFRVFRKAFCRPMPIAFVKEVNLDGLPGYQYGIPDNFADPPEQNPDNECFCRD  364
              +       +F    CR +P+ +V+ V+++GL GY++       D   Q P+N CFC  
Sbjct  276  QHLKPGDSVGLFTPDMCRTIPLDYVETVDIEGLEGYKFSGGPRSVDNGTQYPENLCFCGG  335

Query  365  RTCLKRGLLDLTPCYYNIPAAASLPHFLNADPSVSDGIEGLNPDPEKHETVIILQPNLGI  424
            + C+  G+++++ C +  P   S PHF NADP   D +EGL+P+ + HE  +++QP+ GI
Sbjct  336  Q-CVPSGVMNISSCRFGSPVFMSYPHFFNADPYYPDQVEGLSPNQKDHEFYMVVQPSTGI  394

Query  425  PMYVHSRLQTNLMMKETYYNSKIKPFNNLTVPLFWTDLVIPEIPPNLMFLLRLAITIAPV  484
            P+ V +R Q N++++     S       +  PL W +  +  I P++   L++ + I  +
Sbjct  395  PLEVAARFQVNMLVEPIQGISLYTGIPRIFFPLVWFEQKV-RITPDMADQLKV-LPIVML  452

Query  485  GQTIFAIVFGVFGLGVICWSLARAFLV  511
               IFA +  + G+ ++CW+  +  L 
Sbjct  453  SGHIFAGICLIVGITLLCWTPVQILLA  479



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000056-PA

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01485_CAEEL  unnamed protein product                                 524     5e-165
Q7JZ62_DROME  unnamed protein product                                 32.7    1.1   
Q585B8_TRYB2  unnamed protein product                                 30.8    4.9   


>O01485_CAEEL unnamed protein product
Length=2076

 Score = 524 bits (1350),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 297/786 (38%), Positives = 480/786 (61%), Gaps = 36/786 (5%)

Query  2    MELSHSLTLNEDALNQIPEAKRPVFVFEWLRFLDKVLVAAQKNDIKGCQQKLVEQLTRHM  61
            M+ +HSL LNE+AL   PE KRPVF++EWLR+LD++L   Q+ D+K  Q++L +QL   +
Sbjct  1    MDETHSLLLNEEALEACPEQKRPVFIYEWLRYLDRILPITQREDLKNVQKELQQQLESRL  60

Query  62   QGAPGPPTRRLIARCLATLFSV-GDTFLLFDTVNKCNDILKNKDDSPSFLPTKLAAICCV  120
                GPPTR+LIARC+  ++++ GD   L   +N CND LK KD+SP  + +KLAA+ C+
Sbjct  61   HTVVGPPTRKLIARCIGRVYALTGDIVSLNTLLNSCNDTLKVKDESPKAVQSKLAALACL  120

Query  121  GCMYEKLGRMMGRSYEETVQILIKSLRNAESQTRIEIMHTLEKVCAGMGSAVTNVHKEIY  180
              +Y+ +GRM GRS E+T+ I+   +  A + ++  IM+TL  +   +GS     HK+I+
Sbjct  121  SAVYDSMGRMAGRSIEDTLAIVKNWMSTAVAHSQAHIMNTLTSMVKALGSGDYVTHKKIH  180

Query  181  KVCRHCLTDRVMA----VRCAAAKCILEMLHHAPFLYTTEIESVATLCFRAFEGSNYEVR  236
             + ++ L DR +     V+ A+ +C+  ++     +YTTE+E+  T+C +  EGS YE+R
Sbjct  181  SIAKNSLQDRTLCKTPNVKIASLECLTALVQFHTPIYTTELEASCTMCIKILEGSTYELR  240

Query  237  CAVAKLLGTLVAMTQLPAPKGQNPSVVQNKNIKQI----SKLEEVLNILMSGFLRGGVG-  291
            CAVAK    L+A +  P P     +V++ K+ + +    + + + LN+L SGFLRGG+G 
Sbjct  241  CAVAKFTAQLLATSMKPPPG----AVIKAKSNQTVPVRPASVTDTLNLLASGFLRGGIGG  296

Query  292  FLKGPGEIIKGSSGVNREVRVGVTHAYVIFVQMLGSTWLERHIGTLVAHVLDL------V  345
            FLKG       S+    ++R+GV+  YV  V+ +GS WLE+H+  +  H++DL      +
Sbjct  297  FLKGSSSTF--STMGRSDIRIGVSICYVEMVREMGSAWLEKHLIAVCCHMVDLASKCGHL  354

Query  346  ANPKAASSHVDAVYSRKCINFMLRGTIGKLLGEGAQAAACKEIAHIILKQMNSIDF-SPE  404
            A  + AS   +A+  R+CI+F+LR TIG LLGE AQ  ACK +  ++ + ++ +   + +
Sbjct  355  AYTQNASHVSEALTIRRCISFILRQTIGSLLGENAQTLACKHLGVLLSQYVDLVSIGTGD  414

Query  405  NAKDCNQETLFGQ-HLLVCALQEMGNLILGLGTTAFNILNDQSLNLIETTMTVLLHPCKA  463
            N       + +G  + ++  LQE+  L+  +GT+  ++  + +  ++E     L HP  +
Sbjct  415  NLDSSVDSSDYGSGYAIIVILQEISVLVRQIGTSVMSLFTEAT-GIMEHIFKCLTHPLAS  473

Query  464  ARLAAAWCLRCICVAVPSQITPLIDRCVESIENMRSSPEAITGYSSALAAVLG-SVRFSP  522
            AR AAAWCLRCI  AVP+ +TPLIDRC+  ++ + SS  AI+G+S AL+A+L  S   S 
Sbjct  474  ARYAAAWCLRCIATAVPNLMTPLIDRCLPRLDQLSSSSRAISGFSMALSALLAASTDSSK  533

Query  523  LGVPHTKGKIIFNTAEELLRSASQNSRLSWDRTHAGWLLIGAIMTLGTAVVKGLLPRMLL  582
            LG+P+ K   + + AEE+LR+++Q  +L+  +  +GW LI A++ LG +V+K  LPR++ 
Sbjct  534  LGIPYAKPLKVLDLAEEMLRTSTQQPKLTIAKLESGWNLIYALIHLGPSVMKEHLPRVIK  593

Query  583  LWRNSFPRSNKELESEKARGDAFTWKVTLEGRAGALSAMHSFLLHCPELVN-DDITRRLL  641
            LW+ +F RS KE ESE +RGDAF+W+  +  +AGALS M +     PEL + ++    + 
Sbjct  594  LWKAAFARSAKEAESENSRGDAFSWQCAMIAQAGALSVMEAVASQ-PELSSTNNALDAMK  652

Query  642  SPIESALGMLTNMTTVLKCYEQQLKALTAMVRLRLYETLLLLPPHTFESSYTHLLRMLVS  701
             PIE +L M++ +  ++K Y  +++   ++VR+RLY  LLLLP  +FE SY  LLR LV+
Sbjct  653  VPIECSLVMMSQVGNLIKSYGNEMRQANSVVRIRLYRLLLLLPHKSFEGSYAALLRELVA  712

Query  702  EFTLADNPSNTTTTSLLRTVCHANDSVILGTWLQETDHRTIEDQMEP--------NRKAD  753
            + TL+DN  +T TTSL  +     + +++      TD+  +ED ++         N + D
Sbjct  713  DITLSDNSQSTLTTSLPISQFTGVEKILISPVYDATDYSMVEDLLQTPISSVSLGNIEED  772

Query  754  LEHFIK  759
            L + I+
Sbjct  773  LSNLIR  778


>Q7JZ62_DROME unnamed protein product
Length=301

 Score = 32.7 bits (73),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 30/67 (45%), Gaps = 9/67 (13%)

Query  113  KLAAICCVGCMYE------KLGRMMGRSYEETVQILIKSLRNAESQTRIEIMHTLEKVCA  166
            K+A +CC   +Y       K+     R YEET+Q+L+   RNA  Q   E+M        
Sbjct  211  KVAEVCCTSIVYATDRKHTKVEFPEARIYEETLQVLLYENRNAPDQ---ELMQATSSARV  267

Query  167  GMGSAVT  173
            G  S  +
Sbjct  268  GSASGTS  274


>Q585B8_TRYB2 unnamed protein product
Length=899

 Score = 30.8 bits (68),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 46/95 (48%), Gaps = 4/95 (4%)

Query  116  AICCVGCMYEKLGRMMGRSYEETVQILIKS-LRNAESQTRIEIMHTLEKVCAGMGSAVTN  174
            A+ C+     ++G    R+Y + +Q+L+++ LR+A    + E      ++C      V +
Sbjct  109  AVLCMETFPHEIG---PRNYIDFLQVLLENCLRDAYPDLKKEACRACVRLCEIEPVQVKH  165

Query  175  VHKEIYKVCRHCLTDRVMAVRCAAAKCILEMLHHA  209
            V   + KV ++CL  +   VR  AA+ +  ++   
Sbjct  166  VSLPLAKVVKNCLLHKHSVVRAEAARTLASLIQRG  200



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000057-PA

Length=307
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JVP2_DROME  unnamed protein product                                 455     7e-163
M9PF85_DROME  unnamed protein product                                 446     2e-159
Q18224_CAEEL  unnamed protein product                                 395     7e-139


>Q7JVP2_DROME unnamed protein product
Length=304

 Score = 455 bits (1171),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 224/293 (76%), Positives = 248/293 (85%), Gaps = 13/293 (4%)

Query  15   DREKIYSWIIELSNPEMRQNALLELSKKREVVPDLAPMLWHSFGTVSSLLQEIINIYPAI  74
            ++EK+Y WI EL++P+ R+ ALLELSKKRE   DLAPMLW+SFGT  +LLQEI+NIYP+I
Sbjct  25   EQEKVYQWINELAHPDTRETALLELSKKRET--DLAPMLWNSFGTACALLQEIVNIYPSI  82

Query  75   NPATLTAHQSNRVCNALALLQCFASHPETRSAFLQAHIPLFLYPFLHTVNKTRPFEYLRL  134
             P TLTAHQSNRVCNALALLQC ASHPETR+AFLQA IPL+LYPFL T +KTRPFEYLRL
Sbjct  83   TPPTLTAHQSNRVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRL  142

Query  135  TSLGVIGALVKTDEQEVVTFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDSGLS  194
            TSLGVIGALVKTDEQEV+TFLLTTEI+PLCL IM+SGSELSKTVATFI+QKILLD+SGLS
Sbjct  143  TSLGVIGALVKTDEQEVITFLLTTEIVPLCLSIMDSGSELSKTVATFIIQKILLDESGLS  202

Query  195  YICQTYDRFSHVAMILGKMVLSLAKDPSARLLKHVVRCYLRLSDNPRALLALRQCLPDQL  254
            YICQTY+RFSHVA+ LGKMV+ LAKDP ARLLKHVVRCYLRLSDN RA  AL QCLPDQL
Sbjct  203  YICQTYERFSHVAITLGKMVIQLAKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQL  262

Query  255  RDNTFASCLQEDVSTEHWLNQLLKNLEAGPQQVPSSQPGQPDPRSIGMSPLTS  307
            RD TFA CLQED ST+ WL  LLKNLE G             P+ IGMSPL S
Sbjct  263  RDGTFALCLQEDKSTKQWLQMLLKNLELG-----------ATPQQIGMSPLGS  304


>M9PF85_DROME unnamed protein product
Length=301

 Score = 446 bits (1147),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 221/286 (77%), Positives = 242/286 (85%), Gaps = 13/286 (5%)

Query  22   WIIELSNPEMRQNALLELSKKREVVPDLAPMLWHSFGTVSSLLQEIINIYPAINPATLTA  81
            WI EL++P+ R+ ALLELSKKRE   DLAPMLW+SFGT  +LLQEI+NIYP+I P TLTA
Sbjct  29   WINELAHPDTRETALLELSKKRET--DLAPMLWNSFGTACALLQEIVNIYPSITPPTLTA  86

Query  82   HQSNRVCNALALLQCFASHPETRSAFLQAHIPLFLYPFLHTVNKTRPFEYLRLTSLGVIG  141
            HQSNRVCNALALLQC ASHPETR+AFLQA IPL+LYPFL T +KTRPFEYLRLTSLGVIG
Sbjct  87   HQSNRVCNALALLQCVASHPETRTAFLQAQIPLYLYPFLSTTSKTRPFEYLRLTSLGVIG  146

Query  142  ALVKTDEQEVVTFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDSGLSYICQTYD  201
            ALVKTDEQEV+TFLLTTEI+PLCL IM+SGSELSKTVATFI+QKILLD+SGLSYICQTY+
Sbjct  147  ALVKTDEQEVITFLLTTEIVPLCLSIMDSGSELSKTVATFIIQKILLDESGLSYICQTYE  206

Query  202  RFSHVAMILGKMVLSLAKDPSARLLKHVVRCYLRLSDNPRALLALRQCLPDQLRDNTFAS  261
            RFSHVA+ LGKMV+ LAKDP ARLLKHVVRCYLRLSDN RA  AL QCLPDQLRD TFA 
Sbjct  207  RFSHVAITLGKMVIQLAKDPCARLLKHVVRCYLRLSDNTRARKALGQCLPDQLRDGTFAL  266

Query  262  CLQEDVSTEHWLNQLLKNLEAGPQQVPSSQPGQPDPRSIGMSPLTS  307
            CLQED ST+ WL  LLKNLE G             P+ IGMSPL S
Sbjct  267  CLQEDKSTKQWLQMLLKNLELG-----------ATPQQIGMSPLGS  301


>Q18224_CAEEL unnamed protein product
Length=330

 Score = 395 bits (1016),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 199/299 (67%), Positives = 230/299 (77%), Gaps = 24/299 (8%)

Query  7    PASLQASIDREKIYSWIIELSNPEMRQNALLELSKKREVVPDLAPMLWHSFGTVSSLLQE  66
            P+S    I+ ++I  WII+L +P  R+ ALLELSKKR+ VPDL   LWHSFGT+S+LLQE
Sbjct  18   PSSANLDINTDEIMQWIIDLRDPPKREAALLELSKKRDSVPDLPIWLWHSFGTMSALLQE  77

Query  67   IINIYPAINPATLTAHQSNRVCNALALLQCFASHPETRSAFLQAHIPLFLYPFLHTVNKT  126
            ++ IYPAI PA LTA QSNRVCNALAL+QC ASH +TR  FL AHIPL+LYPFLHT   +
Sbjct  78   VVAIYPAIMPANLTAAQSNRVCNALALMQCVASHRDTRGPFLHAHIPLYLYPFLHTTKVS  137

Query  127  RPFEYLRLTSLGVIGALVKTDEQE----VVTFLLTTEIIPLCLRIMESGSELSKTVATFI  182
            R FEYLRLTSLGVIGALVKTD++E    V+ FLL+TEIIPLCLRIME G+ELSKTVATFI
Sbjct  138  RSFEYLRLTSLGVIGALVKTDDKEQLLIVINFLLSTEIIPLCLRIMEQGTELSKTVATFI  197

Query  183  LQKILLDDSGLSYICQTYDRFSHVAMILGKMVLSLAKDPSARLLKHVVRCYLRLSDNP--  240
            LQKILLDD+GL YICQTY+RFSHV +ILGKMV+ L ++PS RLLKHVVRCY RLSDNP  
Sbjct  198  LQKILLDDTGLLYICQTYERFSHVVLILGKMVMKLTREPSVRLLKHVVRCYSRLSDNPTL  257

Query  241  ------------------RALLALRQCLPDQLRDNTFASCLQEDVSTEHWLNQLLKNLE  281
                              RA LAL+QCLPDQL+D TF S L+ED ST +WL QLL  LE
Sbjct  258  TIDAPRGQGAAPGQIVKMRASLALKQCLPDQLKDLTFKSLLKEDPSTMNWLRQLLTTLE  316



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000058-PA

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961B0_DROME  unnamed protein product                                 78.2    1e-14
Q9Y1T2_DROME  unnamed protein product                                 78.2    1e-14
P91667_DROME  unnamed protein product                                 78.2    1e-14


>Q961B0_DROME unnamed protein product
Length=1067

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 125/302 (41%), Gaps = 67/302 (22%)

Query  138  DQPMNYALCYDEQN--------LEEEKKECRSKNELLCMEEAIEEEKIEITKPKGSNGKE  189
            DQP +++  Y E+         L+ E  E RSK               E+   K S+  E
Sbjct  524  DQPTDFSARYKERRSAQTAQPELKSETNEIRSK---------------ELQLTKSSSATE  568

Query  190  SRNKKEMFVSSRSFKEIFNFFKDRDKKRSHESSKSGSSEGSKVLKTSESYDQKFDRSSQS  249
             RN   +   S + ++I    +    +R     + G+  GS      +S +   ++  + 
Sbjct  569  LRNSPGLVAVSAAKQKIATETETETAERPINYCEEGT-PGS--FSRFDSLNSLTEKPEKC  625

Query  250  TQSSTEQNEKELELKSDSQGPQ------QTPLIFSRRSSLGSLAGQDQNFVNDDRSSIVS  303
                T      L +  D   PQ      +TPL+FSRRSS+ SL G D+    +D  S++S
Sbjct  626  MPPKTPTKTAVLPVHVDGNTPQNIDSALETPLMFSRRSSMDSLVGDDETVACEDNGSVIS  685

Query  304  DFSHKTSGRVSPNELPDSPVQFTPSSAKLQQKCQIGCFGKKKIATVQQDQSKIHQQSVVS  363
            ++S   SG +SP+ELPDSP Q  P S +  +K                            
Sbjct  686  EYSRMQSGVISPSELPDSPTQSMPQSPRRDRK----------------------------  717

Query  364  NDIPYQQSENNPRLNPFSKSSVFEDYVTSFKDESTPTKLHSVAASSLSSLTIDDDDDFEL  423
              +  Q + + P   P   S+VFED +  F  E TP       A+SLS+L++ DD +   
Sbjct  718  --VSTQNNLDTPEQKP---STVFEDKLNRFHVEHTPAAFS--CATSLSNLSMMDDSNANA  770

Query  424  VK  425
            ++
Sbjct  771  IR  772


>Q9Y1T2_DROME unnamed protein product
Length=1067

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/302 (26%), Positives = 125/302 (41%), Gaps = 67/302 (22%)

Query  138  DQPMNYALCYDEQN--------LEEEKKECRSKNELLCMEEAIEEEKIEITKPKGSNGKE  189
            DQP +++  Y E+         L+ E  E RSK               E+   K S+  E
Sbjct  524  DQPTDFSARYKERRSAQTAQPELKSETNEIRSK---------------ELQLTKSSSATE  568

Query  190  SRNKKEMFVSSRSFKEIFNFFKDRDKKRSHESSKSGSSEGSKVLKTSESYDQKFDRSSQS  249
             RN   +   S + ++I    +    +R     + G+  GS      +S +   ++  + 
Sbjct  569  LRNSPGLVAVSAAKQKIATETETETAERPINYCEEGT-PGS--FSRFDSLNSLTEKPEKC  625

Query  250  TQSSTEQNEKELELKSDSQGPQ------QTPLIFSRRSSLGSLAGQDQNFVNDDRSSIVS  303
                T      L +  D   PQ      +TPL+FSRRSS+ SL G D+    +D  S++S
Sbjct  626  MPPKTPTKTAVLPVHVDGNTPQNIDSALETPLMFSRRSSMDSLVGDDETVACEDNGSVIS  685

Query  304  DFSHKTSGRVSPNELPDSPVQFTPSSAKLQQKCQIGCFGKKKIATVQQDQSKIHQQSVVS  363
            ++S   SG +SP+ELPDSP Q  P S +  +K                            
Sbjct  686  EYSRMQSGVISPSELPDSPTQSMPQSPRRDRK----------------------------  717

Query  364  NDIPYQQSENNPRLNPFSKSSVFEDYVTSFKDESTPTKLHSVAASSLSSLTIDDDDDFEL  423
              +  Q + + P   P   S+VFED +  F  E TP       A+SLS+L++ DD +   
Sbjct  718  --VSTQNNLDTPEQKP---STVFEDKLNRFHVEHTPAAFS--CATSLSNLSMMDDSNANA  770

Query  424  VK  425
            ++
Sbjct  771  IR  772


>P91667_DROME unnamed protein product
Length=2416

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 83/155 (54%), Gaps = 30/155 (19%)

Query  272   QTPLIFSRRSSLGSLA-GQDQNFVN-DDRSSIVSDFSHKTSGRVSPNELPDSPVQFTPSS  329
             +TPL+FSRRSS+ SL    D +  N DD+SS+VSDFS   SG +SP+E+PDSP Q  P S
Sbjct  974   ETPLMFSRRSSMDSLVHDPDVDVANCDDKSSVVSDFSRLASGVISPSEIPDSPTQSMPQS  1033

Query  330   AKLQQKCQIGCFGKKKIATVQQDQSKIHQQSVVSNDIPYQQSENNPRLNPFSKSSVFEDY  389
              +           +  +A   Q+   +    VV   IP         L P    SVFED 
Sbjct  1034  PR-----------RNSVAGSGQN---VDSPPVV---IPAS-------LQPL--RSVFEDD  1067

Query  390   VTSFKDESTPTKLHSVAASSLSSLTIDDDDDFELV  424
             ++SF  E TP +  +  A+SLS+L+I DD+    V
Sbjct  1068  LSSFNVEHTPAQFST--ATSLSNLSIVDDEKAPAV  1100



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000059-PA

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLR8_DROME  unnamed protein product                                 426     7e-142
A0A0B4LHY2_DROME  unnamed protein product                             347     6e-111
Q95SK1_DROME  unnamed protein product                                 347     7e-111


>Q9VLR8_DROME unnamed protein product
Length=600

 Score = 426 bits (1095),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 242/607 (40%), Positives = 358/607 (59%), Gaps = 62/607 (10%)

Query  44   HFDILDSIVFAGMLGVSAIVGVYQA--YKSRKSVNAVE---------------------E  80
             F  +D  VF GM+ +S   G+Y     KS+  +   E                     E
Sbjct  13   RFGSVDYAVFLGMIVLSTSTGIYFGCIKKSKVKLEEAEPTLPTTTPKRRKHDFGSEKMSE  72

Query  81   YLVGGQNMSIFPISMSLIASYISGIALLGLPAEMYVYGTQLWSIVIADCFVSLTMAVVYL  140
            YL+G +N+ +FP++MSLIASYISG+ +LG  +E+Y YGTQ W I IA     + ++ VY+
Sbjct  73   YLLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGTQYWFIAIAIMLQGIAVSYVYI  132

Query  141  PVFYGLKITSSYEYLEMRFNHVTRLIGSFIFLLKMLLYIPLVIYVPALAFNQVTGVNLHM  200
            PVF  L++ SSYEYLEMRF+ V R I SF+F+L  +L++P ++YVPA+A NQV+G+NLH+
Sbjct  133  PVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIALNQVSGINLHV  192

Query  201  IASIVCAVCIFYTTLGGLKAVVWTDAIQTIVMFGGVIVVAVLGTSRVGSVAEVWKRNLDT  260
            IA ++  VC+FYT +GG+KAVV TDA Q +VMF  V+ VA+L T     +  ++      
Sbjct  193  IAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLNVLFDDAAKG  252

Query  261  GRIEFFNCVLDVCSMDPNPTVRHTFWTVVIGNYLNWLATCSVNQAMVQRCLAMPNLRKSN  320
            GR+ F N        +P+P VRHT W+V+IG +  W +  +VNQ MVQR +++P+L+K+ 
Sbjct  253  GRLIFNNT-------NPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYMSLPSLKKAR  305

Query  321  ITIMIMAIGITTLVSLSCYTGIVIFAAFHDCDPLTTKQIRKPDQLLPYFVMELSRLIPGL  380
             ++ I  IG+   VS+ CY G++I+  + DCDPL+   I   DQLLP FV++    I G+
Sbjct  306  ASMAIFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQSVGHIYGM  365

Query  381  PGLFISGVFSAALSEDKLLECLFDTRLLTILLYKYDVNELPIATMFRFYLIYEDMIKPCL  440
             GLFI+G+F AALS    L  + ++  L IL                     ED+++ C 
Sbjct  366  SGLFIAGIFGAALSS---LSVVLNSTSLVIL---------------------EDIVRGCF  401

Query  441  NKPMSDTNASRIMKITVVVIGIVCVALVLLVEKLSGLIQAGKSLSGITAGPLLGVFTLGM  500
                S+  ++ ++K TV+V+G V ++LV ++E+LSG++    S++ I AG   G+FTLGM
Sbjct  402  KMQPSERASTILVKSTVIVLGFVALSLVFVLEQLSGILSICTSMTAIAAGTTFGLFTLGM  461

Query  501  FSPYANSQGAIAGALASLCFVAWISFGSQAAVATGKIHFPVKPVSTAGCPEALRSTVANL  560
              P+AN+ G   G +AS     WISFG+Q  +A G+++    PVS  GC       V N+
Sbjct  462  LVPWANTVGTAVGGIASALLAGWISFGTQFTIAAGELNSQKLPVSVEGC-------VGNV  514

Query  561  TVIMETAV-KEQPFPLYRMSYLWYTWVGFLTAIVVGSLISWLTGPNKYKPEDAKLYTPII  619
            T+     V +EQ FPLYR+SY W   +G  T IVVG+L+S +T P   K  D  L +P+I
Sbjct  515  TLRENIWVDEEQVFPLYRLSYHWINPIGVATVIVVGALVSLVTKPTNMKTLDPDLISPVI  574

Query  620  RNLLNRK  626
               L ++
Sbjct  575  HRFLPKE  581


>A0A0B4LHY2_DROME unnamed protein product
Length=621

 Score = 347 bits (890),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 203/616 (33%), Positives = 337/616 (55%), Gaps = 58/616 (9%)

Query  44   HFDILDSIVFAGMLGVSAIVGVYQAYKSRKSVNAVEEYLVGGQNMSIFPISMSLIASYIS  103
            HF + D IVF+ ML  SA +GVY  + S K+ N  EEYL GG+ M   P+++SL++S +S
Sbjct  24   HFSLTDYIVFSLMLSASAGIGVYFGFFS-KAKNTTEEYLQGGKRMPTLPVAISLVSSQLS  82

Query  104  GIALLGLPAEMYVYGTQLWSIVIADCFVSLTMAVVYLPVFYGLKITSSYEYLEMRFNHVT  163
            G+A++ +PAE Y +G  +  +V A       +  + +PVFY   +++ YEYLE+RF+  T
Sbjct  83   GVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRT  142

Query  164  RLIGSFIFLLKMLLYIPLVIYVPALAFNQVTGVNLHMIASIVCAVCIFYTTLGGLKAVVW  223
            R + +  F+L   L +P+ ++VP+LAF+QVTG N+H+I ++V ++C+FYT LGG+KAVVW
Sbjct  143  RQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVW  202

Query  224  TDAIQTIVMFGGVIVVAVLGTSRVGSVAEVWKRNLDTGRIEFFNCVLDVCSMDPNPTVRH  283
            TD +Q  VM   V++VA+LGTS  G +  V +   + GR +F        S   +P +R 
Sbjct  203  TDVVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFDF--------SFGIDPRLRL  254

Query  284  TFWTVVIGNYLNWLATCSVNQAMVQRCLAMPNLRKSNITIMIMAIGITTLVSLSCYTGIV  343
            TF + +    L W     ++Q+ VQR +++P+   +   +++  +G   ++S +C+TGI+
Sbjct  255  TFISGMASGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGII  314

Query  344  IFAAFHDCDPLTTKQIRKPDQLLPYFVMELSRLIPGLPGLFISGVFSAALSEDKLLECLF  403
            +FA ++ CDP+    + KPD+L+P+F+ ++   + G+PG+FIS VFSA+LS        F
Sbjct  315  MFAYYYGCDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSF  374

Query  404  DTRLLTILLYKYDVNELPIATMFRFYLIYEDMIKPCLNKPMSDTNASRIMKITVVVIGIV  463
                                      ++Y D IKP +N   +  NA+  MK+ +VV+G  
Sbjct  375  AG------------------------VVYFDYIKPRINHSEAKANAT--MKLVIVVMGAY  408

Query  464  CVALVLLVEKLSGLIQAGKSLSGITAGPLLGVFTLGMFSPYANSQGAIAGALASLCFVAW  523
            C+    +V+  + +IQ   +++GI  G ++GVF LGMF P  N++ A++G   S   + W
Sbjct  409  CIVGGFIVQNFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLW  468

Query  524  ISFGSQAAVATGKIHFPVKPVSTAGCPEA-----LRSTVANLTVIMETAV----------  568
            I    Q     G I +   P     C        L +   N+T +  TA+          
Sbjct  469  IIINGQMNFKAGLIKYDPLPNGLDQCEAKGFEVILNAINKNVTNVGTTAIPSLEAPKELT  528

Query  569  ----KEQPFPLYRMSYLWYTWVGFLTAIVVGSLISWLTGPNKYKPEDAKLYTPIIRNLLN  624
                  + F +Y  S+ WY  +G L        +S++   +K + ++ KLY+P +R++LN
Sbjct  529  TAFDSNRDFSIYDTSFYWYKVLGALLVFAWAIPMSYVWPLDKEEKQNPKLYSPFVRSMLN  588

Query  625  RKFAKKTTDLKMEEKP  640
                K +  L++EE P
Sbjct  589  ----KPSPVLELEELP  600


>Q95SK1_DROME unnamed protein product
Length=622

 Score = 347 bits (889),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 204/619 (33%), Positives = 340/619 (55%), Gaps = 63/619 (10%)

Query  44   HFDILDSIVFAGMLGVSAIVGVYQAYKSRKSVNAVEEYLVGGQNMSIFPISMSLIASYIS  103
            HF + D IVF+ ML  SA +GVY  + S K+ N  EEYL GG+ M   P+++SL++S +S
Sbjct  24   HFSLTDYIVFSLMLSASAGIGVYFGFFS-KAKNTTEEYLQGGKRMPTLPVAISLVSSQLS  82

Query  104  GIALLGLPAEMYVYGTQLWSIVIADCFVSLTMAVVYLPVFYGLKITSSYEYLEMRFNHVT  163
            G+A++ +PAE Y +G  +  +V A       +  + +PVFY   +++ YEYLE+RF+  T
Sbjct  83   GVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRT  142

Query  164  RLIGSFIFLLKMLLYIPLVIYVPALAFNQVTGVNLHMIASIVCAVCIFYTTLGGLKAVVW  223
            R + +  F+L   L +P+ ++VP+LAF+QVTG N+H+I ++V ++C+FYT LGG+KAVVW
Sbjct  143  RQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVW  202

Query  224  TDAIQTIVMFGGVIVVAVLGTSRVGSVAEVWKRNLDTGRIEFFNCVLDVCSMDPNPTVRH  283
            TD +Q  VM   V++VA+LGTS  G +  V +   + GR +F        S   +P +R 
Sbjct  203  TDVVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFDF--------SFGIDPRLRL  254

Query  284  TFWTVVIGNYLNWLATCSVNQAMVQRCLAMPNLRKSNITIMIMAIGITTLVSLSCYTGIV  343
            TF + +    L W     ++Q+ VQR +++P+   +   +++  +G   ++S +C+TGI+
Sbjct  255  TFISGMASGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGII  314

Query  344  IFAAFHDCDPLTTKQIRKPDQLLPYFVMELSRLIPGLPGLFISGVFSAALSEDKLLECLF  403
            +FA ++ CDP+    + KPD+L+P+F+ ++   + G+PG+FIS VFSA+LS        F
Sbjct  315  MFAYYYGCDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSF  374

Query  404  DTRLLTILLYKYDVNELPIATMFRFYLIYEDMIKPCLNKPMSDTNASRIMKITVVVIGIV  463
                                      ++Y D IKP +N   +  NA+  MK+ +VV+G  
Sbjct  375  AG------------------------VVYFDYIKPRINHSEAKANAT--MKLVIVVMGAY  408

Query  464  CVALVLLVEKLSGLIQAGKSLSGITAGPLLGVFTLGMFSPYANSQGAIAGALASLCFVAW  523
            C+    +V+  + +IQ   +++GI  G ++GVF LGMF P  N++ A++G   S   + W
Sbjct  409  CIVGGFIVQNFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLW  468

Query  524  ISFGSQAAVATGKIHFPVKPVSTAGCP--------EALRSTVANLTVIMETAV-------  568
            I    Q  +  G I +   P     C          A+R+   N+T +  TA+       
Sbjct  469  IIINGQMNLKAGLIKYDPLPNGLDQCEAKGFEVILNAIRN--KNVTNVGTTAIPSLEAPK  526

Query  569  -------KEQPFPLYRMSYLWYTWVGFLTAIVVGSLISWLTGPNKYKPEDAKLYTPIIRN  621
                     + F +Y  S+ WY  +G L        +S++   +K + ++ KLY+P +R+
Sbjct  527  ELTTAFDSNRDFSIYDTSFYWYKVLGALLVFAWAIPMSYVWPLDKEEKQNPKLYSPFVRS  586

Query  622  LLNRKFAKKTTDLKMEEKP  640
            +LN    K +  L++EE P
Sbjct  587  MLN----KPSPVLELEELP  601



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


Query= CFLO000060-PA

Length=967
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z7F4_DROME  unnamed protein product                                 585     0.0  
B7YZT0_DROME  unnamed protein product                                 584     0.0  
A0A0B4KF15_DROME  unnamed protein product                             584     0.0  


>A1Z7F4_DROME unnamed protein product
Length=1095

 Score = 585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/944 (36%), Positives = 505/944 (53%), Gaps = 132/944 (14%)

Query  21   ANVTGDIILGGLFPIHRKGSGSKPCGKIQMEDGIQPLEAMLYAVGQINGNPDILPGVRLG  80
            A + GD+ILGGL  +H +   S  CG I  + GIQ LEAMLY + Q+N    +LP V LG
Sbjct  69   AVLEGDVILGGLMMVHSR-EDSITCGPIMPQGGIQALEAMLYTLDQVNKQ-QLLPNVTLG  126

Query  81   VLAYDSCDNPSYALEQTLNFVKGELSFIAHVNEHHKPEFQCTDGSLPKYRGGDFDRVVAV  140
                D CD  +Y LE  ++F+KG +S I         E+ C    + K        V++ 
Sbjct  127  AHLLDDCDKDTYGLEMAVDFIKGSISNI------DDAEYHCNKTQVRK--------VISG  172

Query  141  LAEQSSSVTIQVSLHDDLNFLPLFDKWRTNRQVAALLRMFAMPQISYMSTTPSLSSRDRY  200
            +   +SSVT                    + QVA LLR+F +PQ+SY ST+P LS++ R+
Sbjct  173  VVGAASSVT--------------------SIQVANLLRLFRIPQVSYFSTSPELSNKQRF  212

Query  201  PHFFRTVPNDVNQAHAMLEILREYRWTYVSLIYSNTEYGVNGYETLLSLASSYKVCFTSP  260
             +F RT+P+D  Q  AM+EI++   W+YVS+IY  + YG+  +E L  L + + +C    
Sbjct  213  EYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIK  272

Query  261  QRVDKDAFGPQD--YDKVINFIRKKTNVRATIKLVLILTLLFAEKVSSLRVMDAARRLKL  318
            +++ KD+   +D  YD ++  +  K   R  I        +F       +VM A RR   
Sbjct  273  EKLVKDSGVAEDIAYDNIVQKLLTKPRARGAI--------IFGSDQEVRQVMRAVRRANA  324

Query  319  GSYFVWIGSDAWSTNNR-RDFLNPQPSRRKDPDKQVVLEGALAVQPLSHNVFGFDEYIGS  377
               F WIGSD WS  N   D   P+            +EG L+VQP ++ V GF+EY  S
Sbjct  325  TGSFSWIGSDGWSARNLVSDDYEPE------------VEGTLSVQPQANPVRGFEEYFLS  372

Query  378  LGLEHEAVDPWFREFWHEYHKCDDTNPTVVDEDYDEVEDKVGCSSESAPRVS-QETGFKQ  436
            L +E+   +PWF EFW ++ +C    P      Y+    +  C+++   R+S Q T F+ 
Sbjct  373  LTVENNQRNPWFVEFWEDHFQC--RYPGSTSTPYNNYTKQ--CTTKE--RLSRQNTDFED  426

Query  437  NKFAHFVRDAVYAVANALHNLYVDRCGRGHRGMCQAMRHIDGSTLIGYLANVTFKGSPFS  496
                 FV DAV A A AL +++ D CG G   +C+AM+   G+ L+ YL  V F+G    
Sbjct  427  Q--LQFVSDAVMAFAYALRDMHRDLCG-GGPSLCEAMKPTKGADLLKYLRKVEFEGL---  480

Query  497  FNVSALGLPMYTYTDEANNMFRFINGTDGPPRYTILNYQRSTNGSYHWHVVGNYTQKEDG  556
                            + + FRF    DGP RY I+++++S  G YHW  VG YT+ E  
Sbjct  481  ----------------SGDEFRFDGNGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGE--  522

Query  557  TSKLVLNKEKLKYRGTEVNGFPSSRCQEPCKPTQIMIREKLDTCCGHCRNCGIYQYKV--  614
               L LN  ++K++       P S C  PC   Q     + ++CC HC NC  YQ +   
Sbjct  523  ---LRLNMTEVKFKRLSPKP-PESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPD  578

Query  615  GEHTCEDCPRGFRPTKDKLKCSPIPEEFVDLTSPWALSAVAAAVVESNTWLIEKVALEGV  674
             E  C+ C  G  P   K  C PIPE ++   S WA+ A+A +                 
Sbjct  579  DETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSA----------------  622

Query  675  SDDRKAFVAFRKLFNGILLTSFALSVFWLYQTTPIIKAAGRELSYVLLFGTFSSFLMTFA  734
                           GIL+T F + VF  +  TPI++A+GRELSY+LL G F  + +TFA
Sbjct  623  --------------TGILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFA  668

Query  735  IIRQPDSETCAITRFGIGLCCTLCYAALVTKTNRIYRIFNNVTNSPRKPRFTSPESQLLI  794
            ++ +P +  CAI RFG+G C T+ YAAL+TKTNRI RIF     S ++P F SP+SQL+I
Sbjct  669  LVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVI  728

Query  795  TFLITSPELAINAIWLKKAPAEVVNSYPTRDRNYKICKGFDDSSYMIGFIYPIFLTFLCS  854
               + S ++ IN +W+  AP+  ++ YPTR+ N  +C  + D+SYMI F YPIFL  +C+
Sbjct  729  CACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICT  788

Query  855  LYAVKTRKCPEGFNEARYIAFTNYTTMLLWMAFVPLYLSSTSNA-IRAVMLALSLSLGAF  913
            +YAV TRK PE FNE+++I FT YTT ++W+AFVPLY  + ++  +R   +++++SL A 
Sbjct  789  VYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSAS  848

Query  914  VQLACLFFPKIYIVLRKPEKNTKQLVM-----STHRNSSYLPTS  952
            V +ACLF PK+YI+L +PE+N +Q +M     + HR +   P+S
Sbjct  849  VTIACLFSPKLYIILIRPERNVRQSMMPPRYGNMHRTAGTGPSS  892


>B7YZT0_DROME unnamed protein product
Length=1415

 Score = 584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/944 (36%), Positives = 505/944 (53%), Gaps = 132/944 (14%)

Query  21    ANVTGDIILGGLFPIHRKGSGSKPCGKIQMEDGIQPLEAMLYAVGQINGNPDILPGVRLG  80
             A V GD+ILGGL  +H +   S  CG I  + GIQ LEAML+ + +IN    +LP + LG
Sbjct  389   AIVEGDVILGGLMMVHSR-EDSITCGPIMPQGGIQALEAMLFTIDRIN-REQLLPNITLG  446

Query  81    VLAYDSCDNPSYALEQTLNFVKGELSFIAHVNEHHKPEFQCTDGSLPKYRGGDFDRVVAV  140
                 D CD  SY LE  ++F+KG +S I         E+ C    + K        V++ 
Sbjct  447   AHILDDCDKDSYGLEMAVDFIKGSISNI------DDAEYHCNKTQVRK--------VISG  492

Query  141   LAEQSSSVTIQVSLHDDLNFLPLFDKWRTNRQVAALLRMFAMPQISYMSTTPSLSSRDRY  200
             +   +SSVT                    + QVA LLR+F +PQ+SY ST+P LS++ R+
Sbjct  493   VVGAASSVT--------------------SIQVANLLRLFRIPQVSYFSTSPELSNKQRF  532

Query  201   PHFFRTVPNDVNQAHAMLEILREYRWTYVSLIYSNTEYGVNGYETLLSLASSYKVCFTSP  260
              +F RT+P+D  Q  AM+EI++   W+YVS+IY  + YG+  +E L  L + + +C    
Sbjct  533   EYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIK  592

Query  261   QRVDKDAFGPQD--YDKVINFIRKKTNVRATIKLVLILTLLFAEKVSSLRVMDAARRLKL  318
             +++ KD+   +D  YD ++  +  K   R  I        +F       +VM A RR   
Sbjct  593   EKLVKDSGVAEDIAYDNIVQKLLTKPRARGAI--------IFGSDQEVRQVMRAVRRANA  644

Query  319   GSYFVWIGSDAWSTNNR-RDFLNPQPSRRKDPDKQVVLEGALAVQPLSHNVFGFDEYIGS  377
                F WIGSD WS  N   D   P+            +EG L+VQP ++ V GF+EY  S
Sbjct  645   TGSFSWIGSDGWSARNLVSDDYEPE------------VEGTLSVQPQANPVRGFEEYFLS  692

Query  378   LGLEHEAVDPWFREFWHEYHKCDDTNPTVVDEDYDEVEDKVGCSSESAPRVS-QETGFKQ  436
             L +E+   +PWF EFW ++ +C    P      Y+    +  C+++   R+S Q T F+ 
Sbjct  693   LTVENNQRNPWFVEFWEDHFQC--RYPGSTSTPYNNYTKQ--CTTKE--RLSRQNTDFED  746

Query  437   NKFAHFVRDAVYAVANALHNLYVDRCGRGHRGMCQAMRHIDGSTLIGYLANVTFKGSPFS  496
                  FV DAV A A AL +++ D CG G   +C+AM+   G+ L+ YL  V F+G    
Sbjct  747   Q--LQFVSDAVMAFAYALRDMHRDLCGGG-PSLCEAMKPTKGADLLKYLRKVEFEGL---  800

Query  497   FNVSALGLPMYTYTDEANNMFRFINGTDGPPRYTILNYQRSTNGSYHWHVVGNYTQKEDG  556
                             + + FRF    DGP RY I+++++S  G YHW  VG YT+ E  
Sbjct  801   ----------------SGDEFRFDGNGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGE--  842

Query  557   TSKLVLNKEKLKYRGTEVNGFPSSRCQEPCKPTQIMIREKLDTCCGHCRNCGIYQYKV--  614
                L LN  ++K++       P S C  PC   Q     + ++CC HC NC  YQ +   
Sbjct  843   ---LRLNMTEVKFKRLSPKP-PESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPD  898

Query  615   GEHTCEDCPRGFRPTKDKLKCSPIPEEFVDLTSPWALSAVAAAVVESNTWLIEKVALEGV  674
              E  C+ C  G  P   K  C PIPE ++   S WA+ A+A +                 
Sbjct  899   DETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSAT---------------  943

Query  675   SDDRKAFVAFRKLFNGILLTSFALSVFWLYQTTPIIKAAGRELSYVLLFGTFSSFLMTFA  734
                            GIL+T F + VF  +  TPI++A+GRELSY+LL G F  + +TFA
Sbjct  944   ---------------GILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFA  988

Query  735   IIRQPDSETCAITRFGIGLCCTLCYAALVTKTNRIYRIFNNVTNSPRKPRFTSPESQLLI  794
             ++ +P +  CAI RFG+G C T+ YAAL+TKTNRI RIF     S ++P F SP+SQL+I
Sbjct  989   LVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVI  1048

Query  795   TFLITSPELAINAIWLKKAPAEVVNSYPTRDRNYKICKGFDDSSYMIGFIYPIFLTFLCS  854
                + S ++ IN +W+  AP+  ++ YPTR+ N  +C  + D+SYMI F YPIFL  +C+
Sbjct  1049  CACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICT  1108

Query  855   LYAVKTRKCPEGFNEARYIAFTNYTTMLLWMAFVPLYLSSTSNA-IRAVMLALSLSLGAF  913
             +YAV TRK PE FNE+++I FT YTT ++W+AFVPLY  + ++  +R   +++++SL A 
Sbjct  1109  VYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSAS  1168

Query  914   VQLACLFFPKIYIVLRKPEKNTKQLVM-----STHRNSSYLPTS  952
             V +ACLF PK+YI+L +PE+N +Q +M     + HR +   P+S
Sbjct  1169  VTIACLFSPKLYIILIRPERNVRQSMMPPRYGNMHRTAGTGPSS  1212


 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query  21   ANVTGDIILGGLFPIHRKGSGSKPCGKIQMEDGIQPLEAMLYAVGQINGNPDILPGVRLG  80
            A + GD+ILGGL  +H +   S  CG I  + GIQ LEAMLY + Q+N    +LP V LG
Sbjct  69   AVLEGDVILGGLMMVHSR-EDSITCGPIMPQGGIQALEAMLYTLDQVNKQ-QLLPNVTLG  126

Query  81   VLAYDSCDNPSYALEQTLNFVKGELSF  107
                D CD  +Y LE  ++F+K  +  
Sbjct  127  AHLLDDCDKDTYGLEMAVDFIKAHIQI  153


>A0A0B4KF15_DROME unnamed protein product
Length=1472

 Score = 584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/944 (36%), Positives = 505/944 (53%), Gaps = 132/944 (14%)

Query  21    ANVTGDIILGGLFPIHRKGSGSKPCGKIQMEDGIQPLEAMLYAVGQINGNPDILPGVRLG  80
             A V GD+ILGGL  +H +   S  CG I  + GIQ LEAML+ + +IN    +LP + LG
Sbjct  389   AIVEGDVILGGLMMVHSR-EDSITCGPIMPQGGIQALEAMLFTIDRIN-REQLLPNITLG  446

Query  81    VLAYDSCDNPSYALEQTLNFVKGELSFIAHVNEHHKPEFQCTDGSLPKYRGGDFDRVVAV  140
                 D CD  SY LE  ++F+KG +S I         E+ C    + K        V++ 
Sbjct  447   AHILDDCDKDSYGLEMAVDFIKGSISNI------DDAEYHCNKTQVRK--------VISG  492

Query  141   LAEQSSSVTIQVSLHDDLNFLPLFDKWRTNRQVAALLRMFAMPQISYMSTTPSLSSRDRY  200
             +   +SSVT                    + QVA LLR+F +PQ+SY ST+P LS++ R+
Sbjct  493   VVGAASSVT--------------------SIQVANLLRLFRIPQVSYFSTSPELSNKQRF  532

Query  201   PHFFRTVPNDVNQAHAMLEILREYRWTYVSLIYSNTEYGVNGYETLLSLASSYKVCFTSP  260
              +F RT+P+D  Q  AM+EI++   W+YVS+IY  + YG+  +E L  L + + +C    
Sbjct  533   EYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELLARHNICIAIK  592

Query  261   QRVDKDAFGPQD--YDKVINFIRKKTNVRATIKLVLILTLLFAEKVSSLRVMDAARRLKL  318
             +++ KD+   +D  YD ++  +  K   R  I        +F       +VM A RR   
Sbjct  593   EKLVKDSGVAEDIAYDNIVQKLLTKPRARGAI--------IFGSDQEVRQVMRAVRRANA  644

Query  319   GSYFVWIGSDAWSTNNR-RDFLNPQPSRRKDPDKQVVLEGALAVQPLSHNVFGFDEYIGS  377
                F WIGSD WS  N   D   P+            +EG L+VQP ++ V GF+EY  S
Sbjct  645   TGSFSWIGSDGWSARNLVSDDYEPE------------VEGTLSVQPQANPVRGFEEYFLS  692

Query  378   LGLEHEAVDPWFREFWHEYHKCDDTNPTVVDEDYDEVEDKVGCSSESAPRVS-QETGFKQ  436
             L +E+   +PWF EFW ++ +C    P      Y+    +  C+++   R+S Q T F+ 
Sbjct  693   LTVENNQRNPWFVEFWEDHFQC--RYPGSTSTPYNNYTKQ--CTTKE--RLSRQNTDFED  746

Query  437   NKFAHFVRDAVYAVANALHNLYVDRCGRGHRGMCQAMRHIDGSTLIGYLANVTFKGSPFS  496
                  FV DAV A A AL +++ D CG G   +C+AM+   G+ L+ YL  V F+G    
Sbjct  747   Q--LQFVSDAVMAFAYALRDMHRDLCGGG-PSLCEAMKPTKGADLLKYLRKVEFEGL---  800

Query  497   FNVSALGLPMYTYTDEANNMFRFINGTDGPPRYTILNYQRSTNGSYHWHVVGNYTQKEDG  556
                             + + FRF    DGP RY I+++++S  G YHW  VG YT+ E  
Sbjct  801   ----------------SGDEFRFDGNGDGPARYNIIHFKQSQAGQYHWVKVGEYTEGE--  842

Query  557   TSKLVLNKEKLKYRGTEVNGFPSSRCQEPCKPTQIMIREKLDTCCGHCRNCGIYQYKV--  614
                L LN  ++K++       P S C  PC   Q     + ++CC HC NC  YQ +   
Sbjct  843   ---LRLNMTEVKFKRLSPKP-PESVCSLPCLVGQAKKYVEGESCCWHCFNCTTYQIRHPD  898

Query  615   GEHTCEDCPRGFRPTKDKLKCSPIPEEFVDLTSPWALSAVAAAVVESNTWLIEKVALEGV  674
              E  C+ C  G  P   K  C PIPE ++   S WA+ A+A +                 
Sbjct  899   DETHCKLCKLGTLPDAHKQYCRPIPEIYLRPESAWAIGAMAFSAT---------------  943

Query  675   SDDRKAFVAFRKLFNGILLTSFALSVFWLYQTTPIIKAAGRELSYVLLFGTFSSFLMTFA  734
                            GIL+T F + VF  +  TPI++A+GRELSY+LL G F  + +TFA
Sbjct  944   ---------------GILVTLFVMGVFVRHNDTPIVRASGRELSYILLAGIFMCYGVTFA  988

Query  735   IIRQPDSETCAITRFGIGLCCTLCYAALVTKTNRIYRIFNNVTNSPRKPRFTSPESQLLI  794
             ++ +P +  CAI RFG+G C T+ YAAL+TKTNRI RIF     S ++P F SP+SQL+I
Sbjct  989   LVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQLVI  1048

Query  795   TFLITSPELAINAIWLKKAPAEVVNSYPTRDRNYKICKGFDDSSYMIGFIYPIFLTFLCS  854
                + S ++ IN +W+  AP+  ++ YPTR+ N  +C  + D+SYMI F YPIFL  +C+
Sbjct  1049  CACLVSVQILINGVWMVIAPSHAMHHYPTREDNLLVCDSYIDASYMIAFSYPIFLIVICT  1108

Query  855   LYAVKTRKCPEGFNEARYIAFTNYTTMLLWMAFVPLYLSSTSNA-IRAVMLALSLSLGAF  913
             +YAV TRK PE FNE+++I FT YTT ++W+AFVPLY  + ++  +R   +++++SL A 
Sbjct  1109  VYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFVPLYFGTANHVPLRITSMSVTISLSAS  1168

Query  914   VQLACLFFPKIYIVLRKPEKNTKQLVM-----STHRNSSYLPTS  952
             V +ACLF PK+YI+L +PE+N +Q +M     + HR +   P+S
Sbjct  1169  VTIACLFSPKLYIILIRPERNVRQSMMPPRYGNMHRTAGTGPSS  1212


 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query  21   ANVTGDIILGGLFPIHRKGSGSKPCGKIQMEDGIQPLEAMLYAVGQINGNPDILPGVRLG  80
            A + GD+ILGGL  +H +   S  CG I  + GIQ LEAMLY + Q+N    +LP V LG
Sbjct  69   AVLEGDVILGGLMMVHSR-EDSITCGPIMPQGGIQALEAMLYTLDQVNKQ-QLLPNVTLG  126

Query  81   VLAYDSCDNPSYALEQTLNFVKGELSF  107
                D CD  +Y LE  ++F+K  +  
Sbjct  127  AHLLDDCDKDTYGLEMAVDFIKAHIQI  153



Lambda      K        H
   0.309    0.119    0.333 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 435603000


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 4, 2020  4:51 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= CFLO000061-PA

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCI4_DROME  unnamed protein product                                 94.0    5e-20
Q8MQQ3_DROME  unnamed protein product                                 31.2    2.9  
Q9VHK1_DROME  unnamed protein product                                 31.2    3.3  


>Q9VCI4_DROME unnamed protein product
Length=619

 Score = 94.0 bits (232),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 99/400 (25%), Positives = 159/400 (40%), Gaps = 47/400 (12%)

Query  88   CEFPAQWRGNWF--QSGENTLIAINGTRLSHKGECV-----KKNNDMFIIYDKNGRCNRC  140
            C  P   +G+WF  ++G  TL  I+ T +S +G C+     K +   F+  +++  C  C
Sbjct  29   CIIPKILQGSWFSWETGLPTLTVIDATSMSSRGYCINYMRHKGDEYSFVFKERSKDCYHC  88

Query  141  VVMYERHPNVIQYKETICRSDDSAD------LCNQLDGDAALLSLFRYNASPTPC--PFP  192
            V    R  NV +  E  C    +        +C  +  D  L++LF  N  P  C     
Sbjct  89   VRTIIRTLNVFEKFEGPCVGIPAGQEPTVDYVCRGVKDDQQLITLFNENFVPINCRSSLE  148

Query  193  GPLEFLYM-RSDDHKACTAPLSQADAC--------TQDSKLFLRYMACADVPGTESYNVE  243
            G   F Y  R      C  P ++  +C         Q+ K  + Y  C  + GT +  VE
Sbjct  149  GVWHFTYQNRFRFTGVCDKPDARIQSCQTAGTQFLIQNQKFNVTYQQCEGMEGTFTGTVE  208

Query  244  MECLATWKEGSTQYLVARLNGTGIVNDEGRYRCFAYAKSGNTWNLAQSGDASCSGLLSPT  303
              CL  W  G   Y  A  N      DE +YRCF   +  + + +  S  A C+ L +P 
Sbjct  209  FSCLGDWFVGKNHYF-AVANTKESRKDE-KYRCFLKNRDDDLY-VGVSITAECNTLKTPE  265

Query  304  EGSKTLNMTQ-KSESSK--CTYPSWLVKPYSWV-ALDLKASTRLLASSVNVTILDQ----  355
               + L +T  K+E  +  CT P        WV   ++ A   +  + +N T        
Sbjct  266  TSPERLKLTPVKAEFVEPGCTLPQNFSG--EWVNTANIDADVSISETHINETYYPDKARY  323

Query  356  HETLYACHSVARNTKGQLDLDRFQIVARATRGCTNGFVCMVFHKRDDHVIEMQQSQKWTQ  415
             +T+Y C    R  +G    +R  +      GC   +VC  F  R  ++I  ++     +
Sbjct  324  RKTIYVC----RERRG----NRVMMARLTVDGCQKDYVCFDFMPRHHNIIRYRKGLAVIK  375

Query  416  QDVD-ACEHGTF-DPLSVPYTTFITMEPMTRQCPHLGRYN  453
             D    C    F +  +  Y  F+   P+  +CP  G++N
Sbjct  376  DDFSTVCSWVQFPNSEAWKYDLFLARNPVPVRCPVAGKFN  415


 Score = 40.4 bits (93),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 55/258 (21%), Positives = 101/258 (39%), Gaps = 54/258 (21%)

Query  87   GCEFPAQWRGNWFQSGE-NTLIAINGTRL--SHKGECVKKNNDMFIIYDKNGR-------  136
            GC  P  + G W  +   +  ++I+ T +  ++  +  +    +++  ++ G        
Sbjct  284  GCTLPQNFSGEWVNTANIDADVSISETHINETYYPDKARYRKTIYVCRERRGNRVMMARL  343

Query  137  ----CNRCVVMYE---RHPNVIQYKETICR-SDDSADLCNQL---DGDAALLSLF-RYNA  184
                C +  V ++   RH N+I+Y++ +    DD + +C+ +   + +A    LF   N 
Sbjct  344  TVDGCQKDYVCFDFMPRHHNIIRYRKGLAVIKDDFSTVCSWVQFPNSEAWKYDLFLARNP  403

Query  185  SPTPCPFPGPLEF-----------------LYMRSDDHKACTAPLSQADACTQDSKLFL-  226
             P  CP  G   F                 L  R D H  C   +S    C  D K    
Sbjct  404  VPVRCPVAGKFNFTQRGEHPFRTRILGGVTLSPRPDIH--CKQNISDLSVCDTDQKELAV  461

Query  227  --RYMACADVPG--TESY---NVEMECLATWKEGSTQYLVARLNGTGIVNDEGRYRCFAY  279
               Y    D  G   + Y   +  M+C+  WKE    YL+   +    ++   +YRC+ Y
Sbjct  462  DENYCLSVDHLGRPVDIYSDPDYRMKCIGFWKENLKSYLITYDD----LDPLSKYRCWVY  517

Query  280  AKSG-NTWNLAQSGDASC  296
             ++  N   ++Q+  A C
Sbjct  518  QRADLNRVLMSQAVGAFC  535


>Q8MQQ3_DROME unnamed protein product
Length=1149

 Score = 31.2 bits (69),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 29/73 (40%), Gaps = 1/73 (1%)

Query  410  SQKWTQQDVDACEHGTFDPLSVPYTTFITMEPMTRQCPHLGRYNVVFVTNKPPAGGEPSV  469
            +Q    +D D    G   P +VPY   +   P  RQ     +Y+ ++ TN PP   +P V
Sbjct  848  NQDNLDRDRDIIGEGLPPPYTVPYDHAVPANPNRRQTMDSSKYS-IYGTNVPPQQQQPGV  906

Query  470  WSTRVHERIHGTY  482
                   R    Y
Sbjct  907  GGDTAAVRPQSLY  919


>Q9VHK1_DROME unnamed protein product
Length=1735

 Score = 31.2 bits (69),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 29/73 (40%), Gaps = 1/73 (1%)

Query  410   SQKWTQQDVDACEHGTFDPLSVPYTTFITMEPMTRQCPHLGRYNVVFVTNKPPAGGEPSV  469
             +Q    +D D    G   P +VPY   +   P  RQ     +Y+ ++ TN PP   +P V
Sbjct  1212  NQDNLDRDRDIIGEGLPPPYTVPYDHAVPANPNRRQTMDSSKYS-IYGTNVPPQQQQPGV  1270

Query  470   WSTRVHERIHGTY  482
                    R    Y
Sbjct  1271  GGDTAAVRPQSLY  1283



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000062-PA

Length=380
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IR83_DROME  unnamed protein product                                 33.5    0.27 
Q582A1_TRYB2  unnamed protein product                                 32.0    0.88 
Q7K3V3_DROME  unnamed protein product                                 31.2    1.9  


>Q8IR83_DROME unnamed protein product
Length=330

 Score = 33.5 bits (75),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 12/102 (12%)

Query  1    LGLSKAGRYDKSGTMAMFTSFGRNAPYLRQQLAALLGNTSISVKFICLVVLFSYCLS-FS  59
            L  ++    D+    A+ TS G N   L Q+ + L     I    + L  LF++  S F+
Sbjct  182  LSNTREDMLDEFDESALATSVGSNLQTLEQRRSNLEEREDIDEVLVSLSALFTFVDSQFT  241

Query  60   EQAIL----------ILSVTPGYLLAPAFWVWTAFTSCFLEI  91
            +QAIL             V P     P+F++ +A  S F +I
Sbjct  242  DQAILPSTPDTDDSKTDEVIPNTDQDPSFYLPSA-DSLFKDI  282


>Q582A1_TRYB2 unnamed protein product
Length=312

 Score = 32.0 bits (71),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  297  IPGFNPHDSERRRQIALKELSERLSKDHAK  326
            +PG    +++RRR IAL  LS R+ +  A 
Sbjct  272  LPGSTEEEAQRRRNIALAALSSRVQQTTAD  301


>Q7K3V3_DROME unnamed protein product
Length=1893

 Score = 31.2 bits (69),  Expect = 1.9, Method: Composition-based stats.
 Identities = 12/26 (46%), Positives = 18/26 (69%), Gaps = 0/26 (0%)

Query  335   KKHSPVPSAVAVQIPEPAVSKPLPSP  360
             +KH  V SA++V +P   VS+P+P P
Sbjct  1500  RKHGNVESAMSVYVPTEDVSEPIPVP  1525


 Score = 30.4 bits (67),  Expect = 3.7, Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 7/58 (12%)

Query  310   QIALKELSERLSKD------HAKQPLLPDRGKKH-SPVPSAVAVQIPEPAVSKPLPSP  360
             Q+  KE ++++++        A +PL P   K++ SP    VA  + EPA++ P  +P
Sbjct  1285  QLGTKEAAQKMAETILEQAIKAGKPLSPPPTKENASPANPTVATTMQEPAITAPSTNP  1342



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000063-PA

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HAKAI_DROME  unnamed protein product                                  262     3e-82


>HAKAI_DROME unnamed protein product
Length=473

 Score = 262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 130/141 (92%), Gaps = 1/141 (1%)

Query  104  SVEQQFDLEADISQLEAPTFTTINRGPPEPMLRLRWDHRVNLIGEKVLNPMIHCCDKCLK  163
            S+ +  D+EADISQLEAPTFTT++RGPPEPMLRL+W+H+V+LIGEKVLNPMIHCCD+C K
Sbjct  126  SLARAVDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCDK  185

Query  164  PILIYGRMIPCKHVFCLLCAKRE-DKVCPRCMEKVSRVEQTGLGTVFMCTHGGTRYGNAG  222
            PIL+YGRMIPCKHVFCL CA+ E  K CPRC +KV RVEQ+GLGTVFMCTHGG+RYG++G
Sbjct  186  PILVYGRMIPCKHVFCLKCARAEPIKSCPRCTDKVLRVEQSGLGTVFMCTHGGSRYGSSG  245

Query  223  CRRTYLSQRDLQAHINHRHVA  243
            CRRTYLSQRDLQAHINHRHVA
Sbjct  246  CRRTYLSQRDLQAHINHRHVA  266



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000064-PA

Length=671
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38CI7_TRYB2  unnamed protein product                                 148     3e-37
Q38AT4_TRYB2  unnamed protein product                                 51.2    2e-06
Q38AT1_TRYB2  unnamed protein product                                 50.1    4e-06


>Q38CI7_TRYB2 unnamed protein product
Length=688

 Score = 148 bits (373),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 169/690 (24%), Positives = 286/690 (41%), Gaps = 94/690 (14%)

Query  10   DEQQQERSGA----PRV----RGCTDVFWLCLFILFWALMILLAVFSFVYGSPIRLIHGY  61
            +E  + R G     P+V    R CTD+ +LCLF +       L + +FV G     ++G 
Sbjct  3    NEPDEARVGGVPEMPKVYEKKRTCTDIVFLCLFFVMLLAFAALGIIAFVDGEAKDSLNGR  62

Query  62   DSFGNVCGVKN-NQKFGNMELSGQDTSDK-----PYLFFLDVARLKQ-----------SL  104
            D  G  CG  +  + F      G     K      YL++     LKQ           SL
Sbjct  63   DRTGRYCGSGSPPEGFAESIPQGAPFQSKVWGENKYLWY--PFPLKQTAMSLNPLLYLSL  120

Query  105  KICVKKCP-------NRRLENLNDVCQFYEDTGSQLCHDKPGSGFSACKDIGNTKTTTGS  157
             +CV++CP        R L+N + V +  ++T     +             G++   +G 
Sbjct  121  GLCVQQCPMANERLLERLLKNPSSVTEEEKNTMKVYSYG------------GSSVVESGM  168

Query  158  CPV---FPVYDSKPILNRCIPKAIG--EVAKNIATNLYGLLNSWDAIQQILGDLYKTWRE  212
             PV   FPVY + PIL RC+P       V   + T+ Y        ++ +L ++  +W+ 
Sbjct  169  QPVNHAFPVYHTGPILRRCLPTITQPPSVRDLLMTSEYSQRVYAFVLKGVL-EVKASWKV  227

Query  213  ILALSLLSFVLSLFMIAIIHMLASFVTWIVTILVVIASLAGTGLLWYTYVDIKH----QL  268
             L  +    +L    + ++  L SFV W   I   +  L+G  +    Y++  H     L
Sbjct  228  FLCAAAACTLLCFIFLFLVRFLISFVVWASIIACFLLLLSGGCICIQLYLNDGHFMNLHL  287

Query  269  DSTPPEELLEESVRNEKAFLILAIIASVITVILFFLICFIRKRISFMAALFRESAKCLAE  328
            D T    LL          L +AI   +  ++  F+I     RI  + AL + +++ +  
Sbjct  288  DVTKYSVLL----------LCVAIGLWIGALVYVFVIIGACPRIRLVCALAKIASRVVDN  337

Query  329  LPGLFFQPLVTFLALLVFFAFWITVGLCLATANYPGTKS--INSIDTLDVNASFTTKPID  386
             P     P++  +A+L    + I V L L  A     K   +   D + +N   + K I 
Sbjct  338  APSTVLLPILMNVAILCLLVWSILVALGLYNARRKTGKISFVPVTDAIGINDG-SFKGIG  396

Query  387  EKQKLLDIPLGQYKTFTLVEYVNPTWVSYMWWVYIIGFIWVTEFIVACQAMVISGAVAHW  446
            E +    +  G    + LV         Y+ +  +  F+W   F+ A     IS     W
Sbjct  397  ETKFYQGVVEGVEHRYALV---------YLLFGELFAFLWCVSFLNAVSFTSISFVSTFW  447

Query  447  YFRGKDSSASPVCSSWGTL------ISYHLGTVACGSLLITIFKIPRLILTYLRAKFEKT  500
            YF   +     V   +G L      + YH GT+A GSLLI I +I R++L Y   K E+ 
Sbjct  448  YFSNLNGGKKRV-PFFGVLRAFVWTVFYHAGTLALGSLLIAILQIVRILLVYAAEKAEEA  506

Query  501  KETS---PCANCGLNCCICCFYCLEKFIRYMNQNAYTVVAIEGTHFCNAARIAFNTIVSN  557
             +      C +C L   + CF   E F+  +N+N Y VV +    FC +A    + +  +
Sbjct  507  VDRHDLIQCLHCYLQYALLCF---ENFVSSINKNIYVVVCLTSGSFCTSACTGLSVLKGH  563

Query  558  AVQIAVINGIGDFILFLGKVFVTAATGSIGLLFLRQD---PRLHFYAAPILVICIFSFFI  614
            +  + +I+ +   +  LGK+FVT  T     L  +     P +     P+++I I ++F+
Sbjct  564  SSDLFLISWMVLCVKILGKLFVTVGTVVTSYLLFKHTTLAPGVDSMVMPLILIGIGAYFL  623

Query  615  AHCVISLYETVIDTLFLCVCEDKNLNGDNG  644
            +     ++++    L +C C D ++N   G
Sbjct  624  SGPFFDVFDSSTLALLICYCYDHHINQSVG  653


>Q38AT4_TRYB2 unnamed protein product
Length=489

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 12/129 (9%)

Query  426  WVTEFIVACQAMVISGAVAHWYFRGKDS-SASPVCSSWGTLISYHLGTVACGSLLITIFK  484
            W ++       +  +G  A WYF GK++   +P  +S+    +   G++  GSLL+ I +
Sbjct  262  WTSQVTTNLMHVTTAGLTATWYFAGKENMPKNPTLASFKRGTTTSFGSICFGSLLVAIIR  321

Query  485  IPRLILTYLRAKFEKTKETSPCANCGLNCC-ICCFYCLEKFIRYMNQNAYTVVAIEGTHF  543
            + R +++        T E S   +  L C  +C   CLE+ + Y N  A+  VAI G  +
Sbjct  322  LIRWLVS--------TAEDSE--HEILRCVFLCIIGCLERLMEYFNTYAFVHVAIYGCGY  371

Query  544  CNAARIAFN  552
              AA++ + 
Sbjct  372  IEAAKMTWE  380


>Q38AT1_TRYB2 unnamed protein product
Length=505

 Score = 50.1 bits (118),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 60/129 (47%), Gaps = 12/129 (9%)

Query  426  WVTEFIVACQAMVISGAVAHWYFRGKDS-SASPVCSSWGTLISYHLGTVACGSLLITIFK  484
            W T+       +  +G  A WYF GK++   +P  +S+    +   G++  GSLL+ I +
Sbjct  278  WATQVTTNLMHVTTAGLTATWYFAGKENMPKNPTLASFKRGTTTSFGSICFGSLLVAIIR  337

Query  485  IPRLILTYLRAKFEKTKETSPCANCGLNCC-ICCFYCLEKFIRYMNQNAYTVVAIEGTHF  543
            + R    +L +  E ++         L C  +C   CLE  + Y N  A+  VAI G  +
Sbjct  338  LIR----WLVSTAEDSEHEI------LRCIFLCIIGCLESLMEYFNTYAFVHVAIYGCGY  387

Query  544  CNAARIAFN  552
              AA++ + 
Sbjct  388  TEAAKMTWE  396



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000065-PA

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q388D6_TRYB2  unnamed protein product                                 228     4e-73
Q583Q6_TRYB2  unnamed protein product                                 57.0    4e-09
Q9VBY2_DROME  unnamed protein product                                 49.7    1e-06


>Q388D6_TRYB2 unnamed protein product
Length=307

 Score = 228 bits (580),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/260 (43%), Positives = 155/260 (60%), Gaps = 3/260 (1%)

Query  36   VTKKEKWVNRQRVLVFASRGINHRDRHLMEDIKTLMPHHRPESKMERTKNLL-VVNEICE  94
             T  ++  NRQ+ LV  SR I+ RDRHL+ DI+ LMPH R   K+ RT  L   V E+CE
Sbjct  47   ATTDKRMTNRQKCLVLGSRNISSRDRHLLLDIRNLMPHAREHPKLGRTGGLGDSVIELCE  106

Query  95   MKNCNKTILFEGRRKKDLYMWMSNIPKGPSVKFLVENIYTMGELKLTGNCLRGSRPLLSF  154
            +  CN ++  E  R+   Y+W++  P+GPSVK  + N++T  EL++ GNCL+ SRPLL F
Sbjct  107  LHQCNSSLFIEAHRQDISYLWIAQAPRGPSVKMQLTNVHTADELRMAGNCLKYSRPLLHF  166

Query  155  DENFNSKPHLSILKELLSQIFGVPNHHPKSQPFFDHVYTFSVLDNRIWFRNYQII-KEDG  213
            D +F ++PHL ++K LL   F  P +HP+S+PF DH+  F  LD  IWFR+YQII  E  
Sbjct  167  DRDFETQPHLRVVKSLLQMTFNTPRYHPRSKPFVDHILCFFYLDGHIWFRHYQIIDTEPK  226

Query  214  ELAEIGPRFVLNPIKIFAGSFVGEVLWDNPHYVSPAKFRQAISKKAGYKYEDRIQQKMIS  273
             L EIGPRF L P  IF G F G V+W N    +P + R+    +   K       K  S
Sbjct  227  SLMEIGPRFTLEPTSIFNGCFKGNVIWKNALARTPTEQRRDRKTRRLEKVHMNEAVKAKS  286

Query  274  KANKP-EKSYDMNPLDDIFK  292
            K +K    + + NPLD +F+
Sbjct  287  KIHKALNPAPEPNPLDSVFR  306


>Q583Q6_TRYB2 unnamed protein product
Length=287

 Score = 57.0 bits (136),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 76/148 (51%), Gaps = 15/148 (10%)

Query  114  MWMSNIPKGPSVKFLVENIYTMGELKLTGNCLRGSRPLLSFDENFNSKPHLSILKELLSQ  173
            + +S++P GP+V F + N+ T  +++  G  +    P L F ENF +K    I +++L  
Sbjct  149  LTISHLPLGPTVVFTIHNLVTRHDIEDVGT-MSEQYPHLIF-ENFTTKLGCRI-RDVLKY  205

Query  174  IFGVPNHHPKSQPFFDHVYTFSVLDNRIWFRNYQ---IIKEDGELAEIGPRFVLNPIKIF  230
            +F VP      +P    V TF   ++ I FR++    + K + +L E+GPR  L+P +I 
Sbjct  206  LFPVP------KPEATRVLTFDNQNDFISFRHHTFKMVKKSNVQLTEVGPRMELSPCRIM  259

Query  231  AGSFV---GEVLWDNPHYVSPAKFRQAI  255
             G+      E  W    Y++ AK R+ +
Sbjct  260  LGTLEMDDAETEWVLQPYMNTAKKRRLM  287


>Q9VBY2_DROME unnamed protein product
Length=298

 Score = 49.7 bits (117),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 48/221 (22%), Positives = 101/221 (46%), Gaps = 19/221 (9%)

Query  47   RVLVFASRGINHRDRHLMEDIKTLMPHHRPESKMERTK-NLLVVNEICEMKNCNKTILFE  105
            ++++  S   + R +  M++++ ++P+     +M R    L  +   C   N    ++  
Sbjct  82   KIMLTTSHNPSSRLKMFMKELRLIIPN---AQQMNRGNYQLTTLMHACRANNVTDFLIVH  138

Query  106  GRRKKDLYMWMSNIPKGPSVKFLVENIYTMGELKLTGNCLRGSRPLLSFDENFNSKPHLS  165
              R     + + ++P GP+  F + ++    ++   G+ +   +P L F+ NF +   L 
Sbjct  139  EHRGIPDSLVVCHLPYGPTAFFNISDVVMRHDIPDIGH-MSEQKPHLIFN-NFKTPIGLR  196

Query  166  ILKELLSQIFGVPNHHPKSQPFFDHVYTFSVLDNRIWFRN--YQIIKEDGELAEIGPRFV  223
             +K +L  +F VP  + +       V +F   ++ I FR+  Y+ + ++ EL E+GPRF 
Sbjct  197  TVK-ILKHLFPVPKENSQR------VMSFLNHNDSIIFRHHQYKYVNKELELTEVGPRFS  249

Query  224  LNPIKIFAGSF----VGEVLWDNPHYVSPAKFRQAISKKAG  260
            L   +I  G+       +  W N  Y++ ++ R   S   G
Sbjct  250  LKLYQIKLGTLENIKAADTEWINRPYMNTSQKRLIFSNDPG  290



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000066-PA

Length=152
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RL28_DICDI  unnamed protein product                                   46.6    5e-07
Q385E9_TRYB2  unnamed protein product                                 42.4    2e-05
Q9VBP0_DROME  unnamed protein product                                 29.3    1.6  


>RL28_DICDI unnamed protein product
Length=132

 Score = 46.6 bits (109),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 30/53 (57%), Gaps = 2/53 (4%)

Query  15  MSSHLNWMIIRNNNAFLLKKRNINKPFSTEPNNLTNLSSYRYSGLVHRKSVGV  67
           MS  L W II+ NNAFL     +    S EP NL N +S +YSGL  R ++ V
Sbjct  1   MSQDLVWSIIKKNNAFLKSSHGLT--LSAEPGNLRNKNSLKYSGLARRTTIDV  51


>Q385E9_TRYB2 unnamed protein product
Length=146

 Score = 42.4 bits (98),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 63/138 (46%), Gaps = 12/138 (9%)

Query  16   SSHLNWMIIRNNNAFLLKKRNINKPFSTEPNNLTNLSSYRYSGLVHRKSVGVVDTPDKKG  75
            S+ L W+++R N+ FL K+  I    S++P N     + R SG ++ K+  +    D+  
Sbjct  4    STDLQWLLVRQNSKFLQKRNGIR--LSSDPFNNNANWTKRQSGFLNTKAAVIKTKGDR--  59

Query  76   FTVVYKKAKCVNKPAKATVKRTMKAGARRSLYKLKTLLKKNKYRVDLTKVALRR----AS  131
              +  K     NKP     K  M+ G + S+ K          R DL K+A RR    A 
Sbjct  60   ILLTTKSGDTNNKPKLMYKKTVMEPGVKSSVVKRAVA----DIRPDLAKMAYRRARKMAC  115

Query  132  AVLRSQKPLPAKKTRAVK  149
             + R +K   A+K R+ K
Sbjct  116  TITRMKKVCAARKERSSK  133


>Q9VBP0_DROME unnamed protein product
Length=765

 Score = 29.3 bits (64),  Expect = 1.6, Method: Composition-based stats.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 10/68 (15%)

Query  1    LCCHRGSRLKQAVKMSSHL-NWMIIRNNNAFLLKKRNINKPFST------EPNNLTNLSS  53
            L C R ++L++  ++SS + N +IIRNN   L  + NI   F+       + NN++ +  
Sbjct  140  LYCGRYAKLRRFPRLSSEVTNLIIIRNN---LTLRDNIFANFTRLQKLTLKYNNISRVPL  196

Query  54   YRYSGLVH  61
              +SGL H
Sbjct  197  GSFSGLFH  204



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000067-PA

Length=171
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W569_DROME  unnamed protein product                                 40.4    1e-04
O46063_DROME  unnamed protein product                                 39.7    2e-04
Q9VHT9_DROME  unnamed protein product                                 31.2    0.24 


>Q9W569_DROME unnamed protein product
Length=140

 Score = 40.4 bits (93),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 50/89 (56%), Gaps = 0/89 (0%)

Query  33   MSLATPELLNAIADLSSIREMKVAVNLSAQCGLIVGAITAVGGILGGPPGIALGGLLGTG  92
            M + T EL+ AIA ++  R ++VAV  S +   I  A +  GG+L GP G+A+GG  G  
Sbjct  1    MPIDTRELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGGAAGGI  60

Query  93   LASYHAGGKFKSVPEILAQEATPEQKEKL  121
             A     G F+ + E++  + T  Q+E+L
Sbjct  61   AAYKMTSGTFRPLGEVILNDLTDAQREQL  89


>O46063_DROME unnamed protein product
Length=122

 Score = 39.7 bits (91),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)

Query  33  MSLATPELLNAIADLSSIREMKVAVNLSAQCGLIVGAITAVGGILGGPPGIALGG  87
           M + T EL+ AIA ++  R ++VAV  S +   I  A +  GG+L GP G+A+GG
Sbjct  1   MPIDTRELMEAIAIVADERNVRVAVKQSGKGAAICAACSFAGGMLLGPVGLAVGG  55


>Q9VHT9_DROME unnamed protein product
Length=140

 Score = 31.2 bits (69),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 39/140 (28%), Positives = 73/140 (52%), Gaps = 2/140 (1%)

Query  33   MSLATPELLNAIADLSSIREMKVAVNLSAQCGLIVGAITAVGGILGGPPGIALGGLLGTG  92
            M  A  E++NA+A L+  + +++ +  + +   I      +GG+L GP G+ALGG +G  
Sbjct  1    MDSAISEIINALAILADDKNIQLTIKEAGKGAAICAGAALIGGLLLGPRGLALGGAIGGL  60

Query  93   LASYHAGGKFKSVPEILAQEATPEQKEKLAT-ALRNLLNAQNIFTVLELAATMQNNRLLM  151
             A     G FKS+ E++  + T  Q+ +L    +R +   +N+  V ++A  + NNR + 
Sbjct  61   TAYGLTEGNFKSLSEVILNDLTESQRRELEQHVIRAISEVRNV-RVRDVARLILNNRHVQ  119

Query  152  EAVSKVIREFFMSDMGYCIL  171
            E   + ++ +    MG  I+
Sbjct  120  EVALEAVKSYITDRMGMTIV  139



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000068-PA

Length=415
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RDX_DROME  unnamed protein product                                    82.0    2e-16
Q9VEN5_DROME  unnamed protein product                                 76.3    1e-14
Q7KSF5_DROME  unnamed protein product                                 76.3    1e-14


>RDX_DROME unnamed protein product
Length=829

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 77/142 (54%), Gaps = 0/142 (0%)

Query  199  DRYTDVTLKVGDEEIRAHRNILAAHSSVFDAMFNSKMIEEQTGVIPVEQFTPHVIKELLY  258
            ++++DVTL VG  E +AH+ ILAA S VF AMF  +M E +   + +      V+KE+L 
Sbjct  652  EKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEERKLNRVAITDVDHEVLKEMLR  711

Query  259  YMYTNNVQDLSTMFNHLYEAAHFYNLIDLENLCKNYMYENITVNNATLILQIAEKYDVKS  318
            ++YT    +L  M + L  AA  Y L  L+ +C+  +  N++V  A   L +A+ +    
Sbjct  712  FIYTGKAPNLEKMADDLLAAADKYALEKLKVMCEEALCVNLSVETAAETLILADLHSADQ  771

Query  319  LLRKVKKFISENESQLINNSEY  340
            L  +   FI+ + + ++  S +
Sbjct  772  LKAQTIDFINTHATDVMETSGW  793


>Q9VEN5_DROME unnamed protein product
Length=744

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 73/158 (46%), Gaps = 0/158 (0%)

Query  184  YSDEKLFKLYCFALEDRYTDVTLKVGDEEIRAHRNILAAHSSVFDAMFNSKMIEEQTGVI  243
            Y+ E L  +Y        TDV L+V  E   AH+ +L+A S  F AMF   + E +   +
Sbjct  40   YAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSRV  99

Query  244  PVEQFTPHVIKELLYYMYTNNVQDLSTMFNHLYEAAHFYNLIDLENLCKNYMYENITVNN  303
             ++   P  +  +LY+MYT  ++        L  AA  + + ++ + C  ++   +   N
Sbjct  100  QLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTN  159

Query  304  ATLILQIAEKYDVKSLLRKVKKFISENESQLINNSEYL  341
            A  I   AE++    L +K   FI  N +Q+    E+L
Sbjct  160  AIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFL  197


>Q7KSF5_DROME unnamed protein product
Length=776

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 73/158 (46%), Gaps = 0/158 (0%)

Query  184  YSDEKLFKLYCFALEDRYTDVTLKVGDEEIRAHRNILAAHSSVFDAMFNSKMIEEQTGVI  243
            Y+ E L  +Y        TDV L+V  E   AH+ +L+A S  F AMF   + E +   +
Sbjct  72   YAKEALKMMYMMRSHGMLTDVVLEVKKELFPAHKVVLSAASPYFKAMFTGGLKESEMSRV  131

Query  244  PVEQFTPHVIKELLYYMYTNNVQDLSTMFNHLYEAAHFYNLIDLENLCKNYMYENITVNN  303
             ++   P  +  +LY+MYT  ++        L  AA  + + ++ + C  ++   +   N
Sbjct  132  QLQGVCPTAMSRILYFMYTGQIRVTEVTVCQLLPAATMFQVPNVIDACCAFLERQLDPTN  191

Query  304  ATLILQIAEKYDVKSLLRKVKKFISENESQLINNSEYL  341
            A  I   AE++    L +K   FI  N +Q+    E+L
Sbjct  192  AIGIAHFAEQHGCVELQKKANVFIERNFTQVCQEEEFL  229



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000069-PA

Length=1330
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W151_DROME  unnamed protein product                                 34.3    0.16 
E1JGW3_DROME  unnamed protein product                                 33.9    0.18 
Q0E8W5_DROME  unnamed protein product                                 34.3    0.19 


>Q9W151_DROME unnamed protein product
Length=119

 Score = 34.3 bits (77),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query  233  LIVSIGCAFAQRSDAKNNSNIFNYFVECDKYFVK--FFASDSQCSDCYKLFRVYFIH  287
            +++ I  A     +    SN F+  +EC   F K  FF  D  C DCY+LFR   IH
Sbjct  15   VLIPIFAALPHNHNLSKRSNFFD--LECKGIFNKTMFFRLDRICEDCYQLFRETSIH  69


>E1JGW3_DROME unnamed protein product
Length=108

 Score = 33.9 bits (76),  Expect = 0.18, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query  233  LIVSIGCAFAQRSDAKNNSNIFNYFVECDKYFVK--FFASDSQCSDCYKLFRVYFIH  287
            +++ I  A     +    SN F+  +EC   F K  FF  D  C DCY+LFR   IH
Sbjct  15   VLIPIFAALPHNHNLSKRSNFFD--LECKGIFNKTMFFRLDRICEDCYQLFRETSIH  69


>Q0E8W5_DROME unnamed protein product
Length=119

 Score = 34.3 bits (77),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 21/57 (37%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query  233  LIVSIGCAFAQRSDAKNNSNIFNYFVECDKYFVK--FFASDSQCSDCYKLFRVYFIH  287
            +++ I  A     +    SN F+  +EC   F K  FF  D  C DCY+LFR   IH
Sbjct  15   VLIPIFAALPHNHNLSKRSNFFD--LECKGIFNKTMFFRLDRICEDCYQLFRETSIH  69



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000070-PA

Length=275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KEX6_DROME  unnamed protein product                             30.4    2.1  
Q9W205_DROME  unnamed protein product                                 30.0    2.4  
A0A0B4KFF9_DROME  unnamed protein product                             30.0    2.4  


>A0A0B4KEX6_DROME unnamed protein product
Length=2839

 Score = 30.4 bits (67),  Expect = 2.1, Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 68/171 (40%), Gaps = 22/171 (13%)

Query  74   TSTFGVREALDAVVNKYAQDDPKLAKRAEQVKSDIESM-------KPPIYNLRSRCRRVI  126
            T+T  +   L + V+K   +  +  +++   KS    +        P +Y    R RR  
Sbjct  780  TATHRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERLRRTG  839

Query  127  EPKKLRTHVIVLHVHGLLPET-RTDLEYTLIRIEGLISLVVDVEHQRVTMRTLATVTAKQ  185
             P+    H   + V  + P + R D    + + + ++S      H   ++ +LA +T KQ
Sbjct  840  SPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLS------HN--SLESLANMTEKQ  891

Query  186  IAEAIEDNNPTMEARLVTRNKYNQEFLVKLLNTDLGDY-----DDMPEYLP  231
            +   ++ N P ++       +YN+ F +        DY     DD   Y P
Sbjct  892  LNTELQYNRPDLDHETHRNTQYNK-FALHKQQQQQSDYRRDSPDDGERYKP  941


>Q9W205_DROME unnamed protein product
Length=2955

 Score = 30.0 bits (66),  Expect = 2.4, Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 68/171 (40%), Gaps = 22/171 (13%)

Query  74    TSTFGVREALDAVVNKYAQDDPKLAKRAEQVKSDIESM-------KPPIYNLRSRCRRVI  126
             T+T  +   L + V+K   +  +  +++   KS    +        P +Y    R RR  
Sbjct  896   TATHRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERLRRTG  955

Query  127   EPKKLRTHVIVLHVHGLLPET-RTDLEYTLIRIEGLISLVVDVEHQRVTMRTLATVTAKQ  185
              P+    H   + V  + P + R D    + + + ++S      H   ++ +LA +T KQ
Sbjct  956   SPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLS------HN--SLESLANMTEKQ  1007

Query  186   IAEAIEDNNPTMEARLVTRNKYNQEFLVKLLNTDLGDY-----DDMPEYLP  231
             +   ++ N P ++       +YN+ F +        DY     DD   Y P
Sbjct  1008  LNTELQYNRPDLDHETHRNTQYNK-FALHKQQQQQSDYRRDSPDDGERYKP  1057


>A0A0B4KFF9_DROME unnamed protein product
Length=2990

 Score = 30.0 bits (66),  Expect = 2.4, Method: Composition-based stats.
 Identities = 36/171 (21%), Positives = 68/171 (40%), Gaps = 22/171 (13%)

Query  74    TSTFGVREALDAVVNKYAQDDPKLAKRAEQVKSDIESM-------KPPIYNLRSRCRRVI  126
             T+T  +   L + V+K   +  +  +++   KS    +        P +Y    R RR  
Sbjct  896   TATHRMGSPLTSPVSKNGYESSRTVEKSSTYKSTSNYVTDSNIRASPSLYGTAERLRRTG  955

Query  127   EPKKLRTHVIVLHVHGLLPET-RTDLEYTLIRIEGLISLVVDVEHQRVTMRTLATVTAKQ  185
              P+    H   + V  + P + R D    + + + ++S      H   ++ +LA +T KQ
Sbjct  956   SPEPRIDHSSNVRVSSMKPASARRDSWDVINKTKHMLS------HN--SLESLANMTEKQ  1007

Query  186   IAEAIEDNNPTMEARLVTRNKYNQEFLVKLLNTDLGDY-----DDMPEYLP  231
             +   ++ N P ++       +YN+ F +        DY     DD   Y P
Sbjct  1008  LNTELQYNRPDLDHETHRNTQYNK-FALHKQQQQQSDYRRDSPDDGERYKP  1057



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000071-PA

Length=919
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VW24_DROME  unnamed protein product                                 673     0.0   
D3DMF6_DROME  unnamed protein product                                 671     0.0   
DLK1_CAEEL  unnamed protein product                                   354     2e-107


>Q9VW24_DROME unnamed protein product
Length=977

 Score = 673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/895 (46%), Positives = 556/895 (62%), Gaps = 101/895 (11%)

Query  26   NVALDKCIVTNRAIRDCIMCIQEEFSQLNGIQSDPVLNVVQMPSCNGVDCESN----TDS  81
            N++LD+       +R  + C+Q+EF  L    +D       + S   +   +N    TDS
Sbjct  38   NLSLDQ----TDNLRRSMACLQDEFGHLGIAATDLPFKSSDLDSPPRLQHHNNYAEITDS  93

Query  82   S-ENTTKATVAPDTVYAQRPFG------SW---IAGCMQPVTVALSNLVQKVIYSDKKGG  131
            S ENT +    P    A   FG       W   + GCM+PV     + + K    + K  
Sbjct  94   SAENTCQQRWPPHVGGAGAAFGHPDKPIGWMYGLLGCMKPVL----SFIGKTGVIEVKSQ  149

Query  132  QTDDWEIPFEYISELKWLGSGAQGAVFSGKLKKEIVAVKKVREPSETNIKHLRKLNHPNI  191
            +++DW+IPFE I+EL+WLGSGAQGAVFSG+LK E VAVKKV+E  ET+IKHLRKL+H NI
Sbjct  150  RSEDWQIPFESITELEWLGSGAQGAVFSGRLKNETVAVKKVKELKETDIKHLRKLDHENI  209

Query  192  VQFKGVCTQAPCYCIIMEFCPSGPLYDWLRVNKSVPPSRLSSWSRQIAAGMKYLHDHKII  251
            ++FKGVCTQ+P +CIIMEFCP GPL + L+  + + PSRL SWS+QIA GM+YLH HKII
Sbjct  210  IKFKGVCTQSPVFCIIMEFCPYGPLQNILKEEQVMLPSRLVSWSKQIALGMQYLHSHKII  269

Query  252  HRDLKSPNVLIGREEIVKISDFGTSREWNEKSARMTFAGTVAWMAPEIIRNEPCSEKVDI  311
            HRDLKSPN+LI   E+VKISDFGTSREWNE S +M+FAGTVAWMAPE+IRNEPCSEKVDI
Sbjct  270  HRDLKSPNILISTNEVVKISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDI  329

Query  312  WSYGVVLWELLSGEIPYKDVDSSAIMYGVGNNSLRLPIPKTCPDGYKLLVEQCWASKPRN  371
            WSYGVVLWE+L+ EIPYKDVDSSAI++GVGNNSL+L +P TCP+G+KLLV+ CW SKPRN
Sbjct  330  WSYGVVLWEMLTCEIPYKDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRN  389

Query  372  RPSFKQIESHLQIAAVELESVPQDKYLKAQETWKDEIATYIMQIKSDSTSSRDFEADLIR  431
            RPSF+QI SHL IA  EL    + +Y + Q++WK+E+ +++ +I  + T+   +E DLI+
Sbjct  390  RPSFRQILSHLDIAGPELLRKTEKQYFETQKSWKEEVRSHLKEITQNGTNIHKYEQDLIK  449

Query  432  RREDELRHAQDIREHYERKLQRTNKLYMELSAVLSQLEQRERDVIKREQH---SGHKQGK  488
            RR  E RHAQDIR  YE KLQ+TN+L+ ELS  +SQL+++E+++ +RE+    SG+K  +
Sbjct  450  RRTAEWRHAQDIRMVYEDKLQKTNQLFFELSECMSQLQEKEKEIAERERKLPGSGYKPNR  509

Query  489  ------KRMVHPILKCRRNPTTIQFSSSSPTSPSPPVVSPKSPVKVTMYAQLNDSNKPE-  541
                  ++M H   +    P  IQ  S++P     P  +P+SPVK  +YAQL+ + +P+ 
Sbjct  510  RFGNTIRKMQHYRRRLNPAPAAIQQQSTTPD----PETTPESPVKCMLYAQLDSNCQPKS  565

Query  542  ---NVV------VPGTFKQRK-FRHRRVGSGCGISSSPRSSPQRERKAAEISASR---LV  588
               N++       P   K +K FRHRR  SG    + P+ SP R+R+      +R   LV
Sbjct  566  YLANIIPSSGLGAPMPNKNKKVFRHRRNASG-SFGAPPKYSPTRDRRYQSEPENRKVQLV  624

Query  589  DNQTQTEMAIDSTETDSTYRDEQPLPQ---------QQSQLQ-QRRPSVQEKYIFEVSSN  638
            + QTQT+ A+D +ETD +   E P  Q         +Q  LQ QR   + +      S +
Sbjct  625  ERQTQTD-AMDVSETDISPSAEAPRSQPIDVPVPNHRQLPLQLQRVQKIAQAQARARSGS  683

Query  639  RLYPKAALD--CPNNGNNPEPIQLYHRRLQPTKSPCSSP-ELLNDNGNS-ERL---KDCS  691
                  A++  CP+NGN+    +L +      +  CSSP +L++D  NS ERL   + CS
Sbjct  684  TSSAAGAVNPACPSNGNSLSTSELTY------QDACSSPDQLIDDVMNSNERLDMTECCS  737

Query  692  DDDNLDTLDRKVNEMLNANGL--------VSPIDNGNSCGIVSHGRIMDELQSQAVEKNI  743
            D++NL+ L RKV E +N N L        VS  DNGN  G  S   + +   S  + +  
Sbjct  738  DNENLERLGRKVIEFINENRLSIQSNTNSVSNADNGN--GGASPLELRESGNSPCLSRCS  795

Query  744  ETNL---------NSNTDVIDAHEDVDAGEEDSWSDEEGEDPKYTYNYSLRRRSIARRPI  794
             T+          N N   I  + + ++ E+DSWSDEEGE     Y Y+LRRRSI R+PI
Sbjct  796  STHSKRRKHPLGDNPNGSSI-GNANGESHEQDSWSDEEGE--TTDYKYALRRRSIGRQPI  852

Query  795  GPGCRHRRP-KATLPVVLS----NKRILASDEENTSEYSHPPSSQSSTLESNPEV  844
              G R RR  KA L   ++    N  I++ +EENTSEYSH PSSQ STLESN ++
Sbjct  853  ARGMRPRRSYKAPLSQKIAIHKRNVVIVSDEEENTSEYSHSPSSQHSTLESNTDI  907


>D3DMF6_DROME unnamed protein product
Length=950

 Score = 671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/878 (46%), Positives = 548/878 (62%), Gaps = 97/878 (11%)

Query  43   IMCIQEEFSQLNGIQSDPVLNVVQMPSCNGVDCESN----TDSS-ENTTKATVAPDTVYA  97
            + C+Q+EF  L    +D       + S   +   +N    TDSS ENT +    P    A
Sbjct  24   MACLQDEFGHLGIAATDLPFKSSDLDSPPRLQHHNNYAEITDSSAENTCQQRWPPHVGGA  83

Query  98   QRPFG------SW---IAGCMQPVTVALSNLVQKVIYSDKKGGQTDDWEIPFEYISELKW  148
               FG       W   + GCM+PV     + + K    + K  +++DW+IPFE I+EL+W
Sbjct  84   GAAFGHPDKPIGWMYGLLGCMKPVL----SFIGKTGVIEVKSQRSEDWQIPFESITELEW  139

Query  149  LGSGAQGAVFSGKLKKEIVAVKKVREPSETNIKHLRKLNHPNIVQFKGVCTQAPCYCIIM  208
            LGSGAQGAVFSG+LK E VAVKKV+E  ET+IKHLRKL+H NI++FKGVCTQ+P +CIIM
Sbjct  140  LGSGAQGAVFSGRLKNETVAVKKVKELKETDIKHLRKLDHENIIKFKGVCTQSPVFCIIM  199

Query  209  EFCPSGPLYDWLRVNKSVPPSRLSSWSRQIAAGMKYLHDHKIIHRDLKSPNVLIGREEIV  268
            EFCP GPL + L+  + + PSRL SWS+QIA GM+YLH HKIIHRDLKSPN+LI   E+V
Sbjct  200  EFCPYGPLQNILKEEQVMLPSRLVSWSKQIALGMQYLHSHKIIHRDLKSPNILISTNEVV  259

Query  269  KISDFGTSREWNEKSARMTFAGTVAWMAPEIIRNEPCSEKVDIWSYGVVLWELLSGEIPY  328
            KISDFGTSREWNE S +M+FAGTVAWMAPE+IRNEPCSEKVDIWSYGVVLWE+L+ EIPY
Sbjct  260  KISDFGTSREWNEISTKMSFAGTVAWMAPEVIRNEPCSEKVDIWSYGVVLWEMLTCEIPY  319

Query  329  KDVDSSAIMYGVGNNSLRLPIPKTCPDGYKLLVEQCWASKPRNRPSFKQIESHLQIAAVE  388
            KDVDSSAI++GVGNNSL+L +P TCP+G+KLLV+ CW SKPRNRPSF+QI SHL IA  E
Sbjct  320  KDVDSSAIIWGVGNNSLKLLVPSTCPEGFKLLVKLCWKSKPRNRPSFRQILSHLDIAGPE  379

Query  389  LESVPQDKYLKAQETWKDEIATYIMQIKSDSTSSRDFEADLIRRREDELRHAQDIREHYE  448
            L    + +Y + Q++WK+E+ +++ +I  + T+   +E DLI+RR  E RHAQDIR  YE
Sbjct  380  LLRKTEKQYFETQKSWKEEVRSHLKEITQNGTNIHKYEQDLIKRRTAEWRHAQDIRMVYE  439

Query  449  RKLQRTNKLYMELSAVLSQLEQRERDVIKREQH---SGHKQGK------KRMVHPILKCR  499
             KLQ+TN+L+ ELS  +SQL+++E+++ +RE+    SG+K  +      ++M H   +  
Sbjct  440  DKLQKTNQLFFELSECMSQLQEKEKEIAERERKLPGSGYKPNRRFGNTIRKMQHYRRRLN  499

Query  500  RNPTTIQFSSSSPTSPSPPVVSPKSPVKVTMYAQLNDSNKPE----NVV------VPGTF  549
              P  IQ  S++P     P  +P+SPVK  +YAQL+ + +P+    N++       P   
Sbjct  500  PAPAAIQQQSTTPD----PETTPESPVKCMLYAQLDSNCQPKSYLANIIPSSGLGAPMPN  555

Query  550  KQRK-FRHRRVGSGCGISSSPRSSPQRERKAAEISASR---LVDNQTQTEMAIDSTETDS  605
            K +K FRHRR  SG    + P+ SP R+R+      +R   LV+ QTQT+ A+D +ETD 
Sbjct  556  KNKKVFRHRRNASG-SFGAPPKYSPTRDRRYQSEPENRKVQLVERQTQTD-AMDVSETDI  613

Query  606  TYRDEQPLPQ---------QQSQLQ-QRRPSVQEKYIFEVSSNRLYPKAALD--CPNNGN  653
            +   E P  Q         +Q  LQ QR   + +      S +      A++  CP+NGN
Sbjct  614  SPSAEAPRSQPIDVPVPNHRQLPLQLQRVQKIAQAQARARSGSTSSAAGAVNPACPSNGN  673

Query  654  NPEPIQLYHRRLQPTKSPCSSP-ELLNDNGNS-ERL---KDCSDDDNLDTLDRKVNEMLN  708
            +    +L +      +  CSSP +L++D  NS ERL   + CSD++NL+ L RKV E +N
Sbjct  674  SLSTSELTY------QDACSSPDQLIDDVMNSNERLDMTECCSDNENLERLGRKVIEFIN  727

Query  709  ANGL--------VSPIDNGNSCGIVSHGRIMDELQSQAVEKNIETNL---------NSNT  751
             N L        VS  DNGN  G  S   + +   S  + +   T+          N N 
Sbjct  728  ENRLSIQSNTNSVSNADNGN--GGASPLELRESGNSPCLSRCSSTHSKRRKHPLGDNPNG  785

Query  752  DVIDAHEDVDAGEEDSWSDEEGEDPKYTYNYSLRRRSIARRPIGPGCRHRRP-KATLPVV  810
              I  + + ++ E+DSWSDEEGE     Y Y+LRRRSI R+PI  G R RR  KA L   
Sbjct  786  SSI-GNANGESHEQDSWSDEEGE--TTDYKYALRRRSIGRQPIARGMRPRRSYKAPLSQK  842

Query  811  LS----NKRILASDEENTSEYSHPPSSQSSTLESNPEV  844
            ++    N  I++ +EENTSEYSH PSSQ STLESN ++
Sbjct  843  IAIHKRNVVIVSDEEENTSEYSHSPSSQHSTLESNTDI  880


>DLK1_CAEEL unnamed protein product
Length=928

 Score = 354 bits (908),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/405 (44%), Positives = 257/405 (63%), Gaps = 27/405 (7%)

Query  105  IAGCMQPVTVALSNLVQKVIYSDKKGGQTDDWEIPFEYISELKWLGSGAQGAVFSGKLKK  164
            +  C QPV         K     +K  + + WEIPF+ ISEL+WLGSG+QGAVF G+L+ 
Sbjct  101  LFSCFQPV---FGYFGTKTTVEIEKS-EDELWEIPFDAISELEWLGSGSQGAVFRGQLEN  156

Query  165  EIVAVKKVREPSETNIKHLRKLNHPNIVQFKGVCTQAPCYCIIMEFCPSGPLYDWLRVNK  224
              VAVKKV +  ET IKHLR L H NI++F GVC+++PCYCI+ME+C  G L   L+   
Sbjct  157  RTVAVKKVNQLKETEIKHLRHLRHQNIIEFLGVCSKSPCYCIVMEYCSKGQLCTVLKSRN  216

Query  225  SVPPSRLSSWSRQIAAGMKYLHDHKIIHRDLKSPNVLIGREEIVKISDFGTSR-EWNEKS  283
            ++     + W ++IA GM YLH +K+IHRDLKSPN+LI  E+ +KI DFGTS  +    S
Sbjct  217  TITRELFAQWVKEIADGMHYLHQNKVIHRDLKSPNILISAEDSIKICDFGTSHMQKKMDS  276

Query  284  ARMTFAGTVAWMAPEIIRNEPCSEKVDIWSYGVVLWELLSGEIPYKDVDSSAIMYGVGNN  343
              M+F GTV+WMAPE+I+ +PC+EKVD++S+GVVLWE+L+ E PY ++   AI++GVG N
Sbjct  277  TMMSFCGTVSWMAPEMIKKQPCNEKVDVYSFGVVLWEMLTRETPYANIAQMAIIFGVGTN  336

Query  344  SLRLPIPKTCPDGYKLLVEQCWASKPRNRPSFKQIESHLQIAAVELESVPQDKYLKAQET  403
             L LP+P+  P G  LL++QC + K RNRPSF  I  H +I   EL  + ++++  A ++
Sbjct  337  ILSLPMPEEAPKGLVLLIKQCLSQKGRNRPSFSHIRQHWEIFKPELFEMTEEEWQLAWDS  396

Query  404  WKDEIATYIMQIKSDSTSSRD---------FEADLIRRREDELRHAQDIREHYERKLQRT  454
            +++    +   I+  ST +RD          E ++ R+R ++L H +DIR  YE KL+RT
Sbjct  397  YRE----FAKCIQYPSTVTRDHGGPKSAFAMEEEIQRKRHEQLNHIKDIRNMYEMKLKRT  452

Query  455  NKLYMELSAVLSQLEQR-------ERDVIKREQHSGHKQGKKRMV  492
            NK+Y +L    ++L+ +       E+D+ +REQ   H Q   + V
Sbjct  453  NKMYDKLQGCFTELKLKESELAEWEKDLTEREQW--HNQNSPKAV  495



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000072-PA

Length=456
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D6XD01_TRYB2  unnamed protein product                                 134     2e-34
Q94771_9TRYP  unnamed protein product                                 134     2e-34
TBG2_DROME  unnamed protein product                                   119     2e-29


>D6XD01_TRYB2 unnamed protein product
Length=447

 Score = 134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 120/454 (26%), Positives = 210/454 (46%), Gaps = 41/454 (9%)

Query  22   KGMLTIQFGQCGNQLGQSLFSQLSDDLNAKDTAISKQDNSTYTEQSFQKWFTGLNKDGKR  81
            + ++T+Q GQCGNQ+G   + QL  +   +   + +   S   ++  +  F     D   
Sbjct  3    REIITLQVGQCGNQVGSEFWRQLCAEHGIRHDGVVESFASGGDDR--KDVFFYQADDDHY  60

Query  82   LARAILLDTEHKVINSIRRDTKDHWAYNSQN-FIYQSAGGSANNWAFGSLVKGPQLKDNI  140
            + RA+L+D E +VIN+I+R +     +N +N +I+   GG+ NNWA G  + G  +++ +
Sbjct  61   IPRALLVDLEPRVINAIQRGSMQRL-FNPENVYIHSEGGGAGNNWAHGYEM-GDTVQETL  118

Query  141  LEYSRREIEKNDSFDGILLLLSSAGGTGSGVGSYTVDLLRNEFPNKTIVGSIVLPFTS--  198
             +   RE E +DS +G +L  S AGGTGSG+GSY ++ L + FP K I    V P  S  
Sbjct  119  FDMIEREAENSDSLEGFVLTHSIAGGTGSGMGSYLLENLNDRFPKKLIQTYSVFPNQSRG  178

Query  199  --GEVGVQNYNTMLTIARFNETADLTLLFQNEHVHSICTKDLKNTDTKLMDMNDVISRKL  256
               +V VQ YN++L I R    AD  ++  N  ++ I T +L  +   +  MN ++S  +
Sbjct  179  GDSDVIVQPYNSLLAIKRLTLHADCVVVLDNTALNRIATDNLHISSPTVEQMNGLVSTVM  238

Query  257  CSVFQPV-------NDVWCNANYLTSTVACHPSYKIATIESTPYVPPRVSEFESAYSWGL  309
             +    +       ND+      L  T  CH          T Y P  +    S     +
Sbjct  239  AASTATLRYPGYMNNDLMSMLASLIPTPRCH-------FVCTGYTPTTLD--TSNIQSSV  289

Query  310  YVKHLKQSLRCPAIGKTDVKPVTLKSGQSYYKSVTNVLVSRGKFTKNDPL----TCDEFK  365
                +   +R   + K  +   ++KSG   Y S+ N++  +G     DP     + +  +
Sbjct  290  QKTSVHDVMRRLLMPKNMMVSTSMKSG--CYISLLNLI--QGDV---DPAQVHRSLERIR  342

Query  366  NKAM-YVDWLGSSDQLTCLNQQRRLVNHEKFLALV-TNNAKVSQTLDGIVTKAWNTYVHG  423
             ++  ++ W  +S Q+    +   L    +   LV  N+  +S      + +    +  G
Sbjct  343  ERSPNFIPWGPASIQVILSKKSPYLDTRHRVSGLVMANHTSISSLFQRTLKQFDLLFNRG  402

Query  424  AFLHQYKKFGLEE---DDFLEAFGKVENVIKNYK  454
             FL QYK++G  +   D+F  +   VE+++  YK
Sbjct  403  VFLEQYKRYGPIKDNLDEFKHSRDVVESLVSEYK  436


>Q94771_9TRYP unnamed protein product
Length=447

 Score = 134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 120/454 (26%), Positives = 210/454 (46%), Gaps = 41/454 (9%)

Query  22   KGMLTIQFGQCGNQLGQSLFSQLSDDLNAKDTAISKQDNSTYTEQSFQKWFTGLNKDGKR  81
            + ++T+Q GQCGNQ+G   + QL  +   +   + +   S   ++  +  F     D   
Sbjct  3    REIITLQVGQCGNQVGSEFWRQLCAEHGIRHDGVVESFASGGDDR--KDVFFYQADDDHY  60

Query  82   LARAILLDTEHKVINSIRRDTKDHWAYNSQN-FIYQSAGGSANNWAFGSLVKGPQLKDNI  140
            + RA+L+D E +VIN+I+R +     +N +N +I+   GG+ NNWA G  + G  +++ +
Sbjct  61   IPRALLVDLEPRVINAIQRGSMQRL-FNPENVYIHSEGGGAGNNWAHGYEM-GDTVQETL  118

Query  141  LEYSRREIEKNDSFDGILLLLSSAGGTGSGVGSYTVDLLRNEFPNKTIVGSIVLPFTS--  198
             +   RE E +DS +G +L  S AGGTGSG+GSY ++ L + FP K I    V P  S  
Sbjct  119  FDMIEREAENSDSLEGFVLTHSIAGGTGSGMGSYLLENLNDRFPKKLIQTYSVFPNQSRG  178

Query  199  --GEVGVQNYNTMLTIARFNETADLTLLFQNEHVHSICTKDLKNTDTKLMDMNDVISRKL  256
               +V VQ YN++L I R    AD  ++  N  ++ I T +L  +   +  MN ++S  +
Sbjct  179  GDSDVIVQPYNSLLAIKRLTLHADCVVVLDNTALNRIATDNLHISSPTVEQMNGLVSTVM  238

Query  257  CSVFQPV-------NDVWCNANYLTSTVACHPSYKIATIESTPYVPPRVSEFESAYSWGL  309
             +    +       ND+      L  T  CH          T Y P  +    S     +
Sbjct  239  AASTATLRYPGYMNNDLMSMLASLIPTPRCH-------FVCTGYTPTTLD--TSNIQSSV  289

Query  310  YVKHLKQSLRCPAIGKTDVKPVTLKSGQSYYKSVTNVLVSRGKFTKNDPL----TCDEFK  365
                +   +R   + K  +   ++KSG   Y S+ N++  +G     DP     + +  +
Sbjct  290  QKTSVHDVMRRLLMPKNMMVSTSMKSG--CYISLLNLI--QGDV---DPAQVHRSLERIR  342

Query  366  NKAM-YVDWLGSSDQLTCLNQQRRLVNHEKFLALV-TNNAKVSQTLDGIVTKAWNTYVHG  423
             ++  ++ W  +S Q+    +   L    +   LV  N+  +S      + +    +  G
Sbjct  343  ERSPNFIPWGPASIQVILSKKSPYLDTRHRVSGLVMANHTSISSLFQRTLKQFDLLFNRG  402

Query  424  AFLHQYKKFGLEE---DDFLEAFGKVENVIKNYK  454
             FL QYK++G  +   D+F  +   VE+++  YK
Sbjct  403  VFLEQYKRYGPIKDNLDEFKHSRDVVESLVSEYK  436


>TBG2_DROME unnamed protein product
Length=457

 Score = 119 bits (299),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 124/239 (52%), Gaps = 19/239 (8%)

Query  24   MLTIQFGQCGNQLGQSLFSQL------SDDLNAKDTAISKQDNSTYTEQSFQKWFTGLNK  77
            ++T+Q GQCGNQ+G   + +L      S D   +D A   QD         +  F     
Sbjct  5    IITLQLGQCGNQIGFEFWKRLCLEHGISPDGVLEDFATDGQDR--------KDVFFYQAD  56

Query  78   DGKRLARAILLDTEHKVINSIRRDTKDHWAYNSQN-FIYQSAGGSANNWAFGSLVKGPQL  136
            D   + RA+L+D E +VIN+I         YN +N F+ +  GG+ NNWA G   +G ++
Sbjct  57   DNHYIPRAVLIDLEPRVINNIMTSPYSKL-YNQENVFLSKHGGGAGNNWASG-FSQGEKV  114

Query  137  KDNILEYSRREIEKNDSFDGILLLLSSAGGTGSGVGSYTVDLLRNEFPNKTIVGSIVLPF  196
            ++ + +   RE + +DS +G +L  S AGGTGSG+GSY ++ L   FP K I    V P 
Sbjct  115  QEEVFDILDREADGSDSLEGFVLCHSIAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPN  174

Query  197  TS--GEVGVQNYNTMLTIARFNETADLTLLFQNEHVHSICTKDLKNTDTKLMDMNDVIS  253
                 +V VQ YN++LT+ R  + AD  ++  N  ++ I T+ L         +N+++S
Sbjct  175  QDEISDVVVQPYNSILTLKRLTKCADSVVVLDNTALNRIATERLHIQTPTFTQINNLVS  233



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000073-PA

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PGSC2_DROME  unnamed protein product                                  158     2e-44
PGPLF_DROME  unnamed protein product                                  160     5e-43
PGPLE_DROME  unnamed protein product                                  156     6e-42


>PGSC2_DROME unnamed protein product
Length=184

 Score = 158 bits (399),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 72/166 (43%), Positives = 103/166 (62%), Gaps = 2/166 (1%)

Query  622  VRIIKRVAWGAQPATDSPRHLKVQPAPYAIISHTATQSCYNKAKCILNVRVIQTFHIEAK  681
            V II +  WG + AT            YA+I HTA   C  KA CI  ++ IQ +H+++ 
Sbjct  21   VTIISKSEWGGRSATSKTS--LANYLSYAVIHHTAGNYCSTKAACITQLQNIQAYHMDSL  78

Query  682  GWLDVGYNFLVGGDGNVYEGRGWDMAGAHTHNYNNRSIGIAFVGDFSYKSPTKEQIAVAE  741
            GW D+GYNFL+GGDGNVYEGRGW++ GAH  N+N++SIGI+F+G+++  + T  QI  A+
Sbjct  79   GWADIGYNFLIGGDGNVYEGRGWNVMGAHATNWNSKSIGISFLGNYNTNTLTSAQITAAK  138

Query  742  KLLESGVKSNKLVKDYKLIGQRQVVHTQSPGDKLFAIIRAWEHFTS  787
             LL   V   ++V  Y L G RQV  T+ PG  ++  IR W ++ +
Sbjct  139  GLLSDAVSRGQIVSGYILYGHRQVGSTECPGTNIWNEIRTWSNWKA  184


 Score = 94.4 bits (233),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 66/111 (59%), Gaps = 1/111 (1%)

Query  464  YVIICHTYYWYCKTIDSCTTVLKKLQKSAIKS-GYGDIEYNFVIPFDGNVYQGRGWNTEG  522
            Y +I HT   YC T  +C T L+ +Q   + S G+ DI YNF+I  DGNVY+GRGWN  G
Sbjct  46   YAVIHHTAGNYCSTKAACITQLQNIQAYHMDSLGWADIGYNFLIGGDGNVYEGRGWNVMG  105

Query  523  NHTLDFNNKSLAIGFVGNYDIFKPTKEQLDSLKKLLRLGVKEFRMAKEYVL  573
             H  ++N+KS+ I F+GNY+    T  Q+ + K LL   V   ++   Y+L
Sbjct  106  AHATNWNSKSIGISFLGNYNTNTLTSAQITAAKGLLSDAVSRGQIVSGYIL  156


>PGPLF_DROME unnamed protein product
Length=369

 Score = 160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 117/205 (57%), Gaps = 8/205 (4%)

Query  592  FKAVILFIGIIMTTANDLDPG-----NDFEKKS--EDVRIIKRVAWGAQPATDSPRHLKV  644
            F+  +L+  +I+     L  G       F   S  + + I+ R  W  +P +    HLK+
Sbjct  20   FRFELLYFCVILLMVVGLAAGYFMWMMSFSTHSPNKGLHILDRSEWLGEPPSGKYPHLKL  79

Query  645  QPAPYAIISHTATQSCYNKAKCILNVRVIQTFHIEAKGWLDVGYNFLVGGDGNVYEGRGW  704
             P    II HTAT+ C  +  CI  ++ IQ FH+++ GW+D+GYNFLVGGDG +Y GRGW
Sbjct  80   -PVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMKSFGWVDIGYNFLVGGDGQIYVGRGW  138

Query  705  DMAGAHTHNYNNRSIGIAFVGDFSYKSPTKEQIAVAEKLLESGVKSNKLVKDYKLIGQRQ  764
             + G H + Y   S+ IAF+G F    P   QI  A++L++ GV+ ++L  DY +   RQ
Sbjct  139  HIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEAAKRLMDEGVRLHRLQPDYHIYAHRQ  198

Query  765  VVHTQSPGDKLFAIIRAWEHFTSNP  789
            +  T+SPG KLF +++ W  FT +P
Sbjct  199  LSPTESPGQKLFELMQNWPRFTQDP  223


 Score = 154 bits (390),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 101/327 (31%), Positives = 164/327 (50%), Gaps = 23/327 (7%)

Query  437  FEIVSRQRWGALKP--RIPPIQLEVRPPRYVIICHTYYWYCKTIDSCTTVLKKLQKSAIK  494
              I+ R  W    P  + P ++L   P   +II HT    C+  D C   +K +Q   +K
Sbjct  57   LHILDRSEWLGEPPSGKYPHLKL---PVSNIIIHHTATEGCEQEDVCIYRMKTIQAFHMK  113

Query  495  S-GYGDIEYNFVIPFDGNVYQGRGWNTEGNHTLDFNNKSLAIGFVGNYDIFKPTKEQLDS  553
            S G+ DI YNF++  DG +Y GRGW+ +G H   +   S++I F+G +   +P   Q+++
Sbjct  114  SFGWVDIGYNFLVGGDGQIYVGRGWHIQGQHVNGYGAISVSIAFIGTFVNMEPPARQIEA  173

Query  554  LKKLLRLGVKEFRMAKEYVLLVYTYIRFGVKMESPSLMFKAVILFIGIIMTTANDLDPGN  613
             K+L+  GV+  R+  +Y +  +  +      ESP        LF  +        DP +
Sbjct  174  AKRLMDEGVRLHRLQPDYHIYAHRQLS---PTESPGQK-----LFELMQNWPRFTQDPTS  225

Query  614  DFEKKSEDVRIIKRVAWGAQPATDSPRHLKVQPAPYAIISHTATQSCYNKAKCILNVRVI  673
                 +E V+I+ R  W AQP       LK+ P        T T SC+ +A+C   VR++
Sbjct  226  LRLLSNETVKIVTRPYWLAQPPIVPLTPLKL-PIESVRFVATNTPSCFTQAECTFRVRLL  284

Query  674  QTFHIEAKGWLDVGYNFLVGGDGNVYEGRGWDMAGAHTHNYNNRSIGIAFVGDFSYKSPT  733
            Q +HIE+ G+ D+ YNF+  GD N+YE RGWD +     + +   + +AF+G      P+
Sbjct  285  QNWHIESNGYKDINYNFVAAGDENIYEARGWDHSCEPPKDAD--ELVVAFIG------PS  336

Query  734  KEQIAVAEKLLESGVKSNKLVKDYKLI  760
                 +A +L++ G+K   + K+Y LI
Sbjct  337  SSNKKIALELIKQGIKLGHISKNYSLI  363


>PGPLE_DROME unnamed protein product
Length=345

 Score = 156 bits (395),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 101/162 (62%), Gaps = 1/162 (1%)

Query  624  IIKRVAWGAQPATDSPRHLKVQPAPYAIISHTATQSCYNKAKCILNVRVIQTFHIEAKGW  683
            II R +W AQ   D P  L++ P  Y +I HTAT+S   +A  +  +R +Q FHIE++GW
Sbjct  177  IIPRSSWLAQKPMDEPLPLQL-PVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGW  235

Query  684  LDVGYNFLVGGDGNVYEGRGWDMAGAHTHNYNNRSIGIAFVGDFSYKSPTKEQIAVAEKL  743
             D+ YNFLVG DGN+YEGRGW   GAHT  YN  S+GI+F+G F  + PT + + +   L
Sbjct  236  NDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNL  295

Query  744  LESGVKSNKLVKDYKLIGQRQVVHTQSPGDKLFAIIRAWEHF  785
            L  GV+   +  DY+LI   Q   T+SPG +L+  I+ W HF
Sbjct  296  LARGVEDGHISTDYRLICHCQCNSTESPGRRLYEEIQTWPHF  337


 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 81/139 (58%), Gaps = 2/139 (1%)

Query  439  IVSRQRWGALKPRIPPIQLEVRPPRYVIICHTYYWYCKTIDSCTTVLKKLQKSAIKS-GY  497
            I+ R  W A KP   P+ L++ P +YV+I HT     +       +++ +Q   I+S G+
Sbjct  177  IIPRSSWLAQKPMDEPLPLQL-PVKYVVILHTATESSEKRAINVRLIRDMQCFHIESRGW  235

Query  498  GDIEYNFVIPFDGNVYQGRGWNTEGNHTLDFNNKSLAIGFVGNYDIFKPTKEQLDSLKKL  557
             DI YNF++  DGN+Y+GRGW T G HTL +N  SL I F+G +    PT + L+  + L
Sbjct  236  NDIAYNFLVGCDGNIYEGRGWKTVGAHTLGYNRISLGISFIGCFMKELPTADALNMCRNL  295

Query  558  LRLGVKEFRMAKEYVLLVY  576
            L  GV++  ++ +Y L+ +
Sbjct  296  LARGVEDGHISTDYRLICH  314


 Score = 32.0 bits (71),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 12/28 (43%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  1    LLELGVKDNKLAKDYKLLAHCQTSIEET  28
            LL  GV+D  ++ DY+L+ HCQ +  E+
Sbjct  295  LLARGVEDGHISTDYRLICHCQCNSTES  322


 Score = 29.6 bits (65),  Expect = 9.3, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 11/87 (13%)

Query  106  INISSSNNVHIGSKHVYNGPVTI-------NQYIHGNLDPLAERDPPGNKSNEHSEHEGT  158
            +NIS+S NVHIG+    NG + I       N+    ++ P  +  P   K+  H E +  
Sbjct  94   VNISNSTNVHIGNVTNINGNIQIIADGLTQNRRDRRHVSPPRDNAP---KTPTHFEDDYQ  150

Query  159  SCSEDE-RAHRFLCRLKFYLTDEITII  184
              SE+  R+  F+ R KF +  E++ I
Sbjct  151  DESEERVRSDVFIRRQKFKIPKELSAI  177



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000074-PA

Length=1071
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TAF4_DROME  unnamed protein product                                   269     8e-76


>TAF4_DROME unnamed protein product
Length=921

 Score = 269 bits (688),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 163/208 (78%), Gaps = 2/208 (1%)

Query  864   PMVQQRLKNFLTSYGLEEPNQEVASLISHAAQERLKNLVEKLAIIAEHRIDLNKIDPRYE  923
             P +Q R++   +  GL+EP+Q+VA LISHA QERLKN+VEKLA+IAEHRID+ K+DPRYE
Sbjct  716   PSLQARIRAITSEAGLDEPSQDVAVLISHACQERLKNIVEKLAVIAEHRIDVIKLDPRYE  775

Query  924   VTQDVRSQLKFLEELDKVERKRHEEQEREALMKVAKSRSKIEDPEQAKLKAKAKEMQRVE  983
               +DVR Q+KFLEELDK E+KRHEE ERE L++ AKSRS++EDPEQAK+KA+AKEMQR E
Sbjct  776   PAKDVRGQIKFLEELDKAEQKRHEELEREMLLRAAKSRSRVEDPEQAKMKARAKEMQRAE  835

Query  984   MEEARQREANQTALQAIGPRKKPKLDLGAASGNSTSGIGNLGAGGLGFNRQLPLRPRLKR  1043
             MEE RQR+AN TALQAIGPRKK KLD    + +S +G    G      +    LRPR+KR
Sbjct  836   MEELRQRDANLTALQAIGPRKKLKLD--GETVSSGAGSSGGGVLSSSGSAPTTLRPRIKR  893

Query  1044  VNFRDLLFLLEQEKEMCRSTTLYRSYLK  1071
             VN RD+LF +EQE+E CRS+ L+++YLK
Sbjct  894   VNLRDMLFYMEQEREFCRSSMLFKTYLK  921



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000075-PA

Length=418
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D5SHR0_DROME  unnamed protein product                                 349     3e-118
Q9W2F9_DROME  unnamed protein product                                 343     2e-116
Q9VDH3_DROME  unnamed protein product                                 58.2    2e-09 


>D5SHR0_DROME unnamed protein product
Length=367

 Score = 349 bits (895),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 204/435 (47%), Positives = 246/435 (57%), Gaps = 134/435 (31%)

Query  18   RRKCEAD---GKDAKA----ELTAQRNMFPSAQIKMRLMSPSSSPATSPTMSNSSSPTPP  70
            R+KC+ D    +D KA    +L++   ++  + IK+     SSSP  SPT+SNSSSPTP 
Sbjct  25   RKKCDMDRERERDVKALEPRDLSSTGRIYARSDIKI-----SSSPTVSPTISNSSSPTPT  79

Query  71   TPAASAYS-------------------------------QKMTGIPCVAAASRYTAPVHI  99
             PA+S+ +                               + +TGIPCVAAASRYTAPVHI
Sbjct  80   PPASSSVTPLGLPGAVAAAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHI  139

Query  100  DVGGTIYTSSLETLTNGLYRGESRELLSLFGVIIFFAEKVIDPTKLEGFLLLRAALLFGW  159
            DVGGTIYTSSLETLT                                             
Sbjct  140  DVGGTIYTSSLETLTK--------------------------------------------  155

Query  160  IRLYPESRLAKLFNGSIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIPENFADLDL  219
               YPES+LAKLFNG IPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLI E+F DL+L
Sbjct  156  ---YPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLEL  212

Query  220  LLEEARYFDIAPMTRQLEQLKKERIKNGGAPTSSTPSPPPDQ-STSPGGPQHRGASSNSS  278
            LLEEARY+++ PM +QLE ++K+R++NG     + P+PP     TSP             
Sbjct  213  LLEEARYYEVEPMIKQLESMRKDRVRNGNY-LVAPPTPPARHIKTSP-------------  258

Query  279  NNVGGSSRPTTPLFREQHAEAKLQQRATEGYGCGYECVALHVSPDLGERVMLSGGRALLD  338
                                     R +    C YE VALH+SPDLGER+MLS  RALLD
Sbjct  259  -------------------------RTSASPECNYEVVALHISPDLGERIMLSAERALLD  293

Query  339  EVFPETTQAVLEARSGVAWHAQDARHVIRFPLNGYCKLNSVQAITRLLNAGFRVVASNGG  398
            E+FPE +QA   +RSGV+W+  D   +IRFPLNGYCKLNSVQ +TRLLNAGF + AS G 
Sbjct  294  ELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLNAGFTIEASVG-  352

Query  399  GVEGQQFSEYLFVRQ  413
               GQQFSEYL  R+
Sbjct  353  ---GQQFSEYLLARR  364


>Q9W2F9_DROME unnamed protein product
Length=338

 Score = 343 bits (880),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 240/424 (57%), Gaps = 131/424 (31%)

Query  26   KDAKA----ELTAQRNMFPSAQIKMRLMSPSSSPATSPTMSNSSSPTPPTPAASAYS---  78
            +D KA    +L++   ++  + IK+     SSSP  SPT+SNSSSPTP  PA+S+ +   
Sbjct  7    RDVKALEPRDLSSTGRIYARSDIKI-----SSSPTVSPTISNSSSPTPTPPASSSVTPLG  61

Query  79   ----------------------------QKMTGIPCVAAASRYTAPVHIDVGGTIYTSSL  110
                                        + +TGIPCVAAASRYTAPVHIDVGGTIYTSSL
Sbjct  62   LPGAVAAAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSL  121

Query  111  ETLTNGLYRGESRELLSLFGVIIFFAEKVIDPTKLEGFLLLRAALLFGWIRLYPESRLAK  170
            ETLT                                                YPES+LAK
Sbjct  122  ETLTK-----------------------------------------------YPESKLAK  134

Query  171  LFNGSIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIPENFADLDLLLEEARYFDIA  230
            LFNG IPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLI E+F DL+LLLEEARY+++ 
Sbjct  135  LFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVE  194

Query  231  PMTRQLEQLKKERIKNGGAPTSSTPSPPPDQ-STSPGGPQHRGASSNSSNNVGGSSRPTT  289
            PM +QLE ++K+R++NG     + P+PP     TSP                        
Sbjct  195  PMIKQLESMRKDRVRNGNY-LVAPPTPPARHIKTSP------------------------  229

Query  290  PLFREQHAEAKLQQRATEGYGCGYECVALHVSPDLGERVMLSGGRALLDEVFPETTQAVL  349
                          R +    C YE VALH+SPDLGER+MLS  RALLDE+FPE +QA  
Sbjct  230  --------------RTSASPECNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQ  275

Query  350  EARSGVAWHAQDARHVIRFPLNGYCKLNSVQAITRLLNAGFRVVASNGGGVEGQQFSEYL  409
             +RSGV+W+  D   +IRFPLNGYCKLNSVQ +TRLLNAGF + AS G    GQQFSEYL
Sbjct  276  SSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLNAGFTIEASVG----GQQFSEYL  331

Query  410  FVRQ  413
              R+
Sbjct  332  LARR  335


>Q9VDH3_DROME unnamed protein product
Length=228

 Score = 58.2 bits (139),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 5/77 (6%)

Query  168  LAKLF-NGSIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIPENFADLDLLLEEARY  226
            LA+LF  G   +  DS K  YF+DRDG +FR+IL+F+R+  L +PE F +   LL EA +
Sbjct  29   LAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKALHLPEGFRERQRLLREAEH  87

Query  227  FDIAPMTRQLEQLKKER  243
            F +  M   LE ++ ER
Sbjct  88   FKLTAM---LECIRSER  101



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000076-PA

Length=186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95V68_ORNMO  unnamed protein product                                 85.5    2e-21
LYSD_DROME  unnamed protein product                                   71.6    4e-16
LYSE_DROME  unnamed protein product                                   70.5    1e-15


>Q95V68_ORNMO unnamed protein product
Length=146

 Score = 85.5 bits (210),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 60/116 (52%), Gaps = 0/116 (0%)

Query  29   ARILKKCDAASELRRSKVINKSFIAHLVCVMQHESKFNTSLIRGPGSKSSYSYGVFQISS  88
             ++  +C  ASELR    + K  IA  VC+ +HES FNT+ +  P S  S  +G+FQI+ 
Sbjct  22   GKVYDRCSLASELRWKYNLPKDQIADWVCIAEHESSFNTAALGRPNSDGSQDHGLFQIND  81

Query  89   DKWCSRYRVGGECQKKCDDFANDDIQDDIVCADKIFKMEGLKHWPGWERNCKNGPL  144
              WCS      +C   C    +D+I DD+ C  KI+   G   W  W+ NC+   L
Sbjct  82   RYWCSPPGPHNDCGVSCAALRDDNIDDDVKCIRKIYARHGFSAWVAWKNNCRGKNL  137


>LYSD_DROME unnamed protein product
Length=140

 Score = 71.6 bits (174),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (47%), Gaps = 8/137 (6%)

Query  18   LLVVVSRQPSSARILKKCDAASELRRSKVINKSFIAHLVCVMQHESKFNTSLIRGPGSKS  77
            L+ +    P+  R + +C  A E+    V  +  +A   C+ +HES + T ++       
Sbjct  7    LVALACAAPAFGRTMDRCSLAREMSNLGV-PRDQLARWACIAEHESSYRTGVVGPENYNG  65

Query  78   SYSYGVFQISSDKWCS----RYRVGGECQKKCDDFANDDIQDDIVCADKIFKMEGLKHWP  133
            S  YG+FQI+   WC+    R+    EC   C+    DDI   + CA K+   +G   W 
Sbjct  66   SNDYGIFQINDYYWCAPPSGRFSY-NECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWS  124

Query  134  GWERNCKNGPLPNLNDC  150
             W     +G LP+++DC
Sbjct  125  TWHY--CSGWLPSIDDC  139


>LYSE_DROME unnamed protein product
Length=140

 Score = 70.5 bits (171),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 64/137 (47%), Gaps = 8/137 (6%)

Query  18   LLVVVSRQPSSARILKKCDAASELRRSKVINKSFIAHLVCVMQHESKFNTSLIRGPGSKS  77
            L+ +    P+  R L +C  A E+    V  +  +A   C+ +HES + T ++       
Sbjct  7    LVALAMAAPALGRTLDRCSLAREMSNLGV-PRDQLARWACIAEHESSYRTGVVGPENYNG  65

Query  78   SYSYGVFQISSDKWCS----RYRVGGECQKKCDDFANDDIQDDIVCADKIFKMEGLKHWP  133
            S  YG+FQI++  WC+    R+    EC   C+    DDI   + CA K+   +G   W 
Sbjct  66   SNDYGIFQINNYYWCAPPSGRFSY-NECGLSCNALLTDDITHSVRCAQKVLSQQGWSAWS  124

Query  134  GWERNCKNGPLPNLNDC  150
             W     +G LP+++ C
Sbjct  125  TWHY--CSGWLPSIDGC  139



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000077-PA

Length=466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KEU4_DROME  unnamed protein product                             50.4    2e-06
A8DYA5_DROME  unnamed protein product                                 50.1    2e-06
Q5BI22_DROME  unnamed protein product                                 50.1    3e-06


>A0A0B4KEU4_DROME unnamed protein product
Length=497

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 83/381 (22%), Positives = 144/381 (38%), Gaps = 44/381 (12%)

Query  5    IEDLNDDCVIDILSYLPVLDRLRSYRVCKRWKTLG--ELSWQKTKALSLRRDFWGLSSES  62
            I+ L  + ++ + SYL V+   R  +VCK W  L     SWQK      +RD  G     
Sbjct  26   IKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEG-----  80

Query  63   RFIVNRHVLKKLLEICGRYLVHVSLSNVVQKSGLPDTNVRVKSCKFVFTLIRELCPNVRS  122
                   V++ + + C  +L  +SL    Q  G  D +VR          +   C N+  
Sbjct  81   ------PVIENISQRCRGFLKSLSLRG-CQSVG--DQSVRT---------LANHCHNIEH  122

Query  123  IDAGE--PVQDCTLEYVASHYSDLTHFAVREAKNF-EPILALLFSNNRNLRHVRLEGCRI  179
            +D  +   + D + + ++ + S LT   +    N  +  L  L     NL  + +  C +
Sbjct  123  LDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHL  182

Query  180  ---NGTCLLALNPQALREFYFVDNQVGEPQHLIDALEGFRNIRILNLTRVAVEDDQACMD  236
               NG   LA     LR+F     +      ++   +   ++ +LNL       D +   
Sbjct  183  ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSS---  239

Query  237  HVLEAVRQNAASVEHLYLKFYDNHREYIDPSFVAEFTNLEKLHIDGDIIVNDKFLAIVAA  296
              +  +  N   ++ L +    +  +    S       L  L + G     D     +  
Sbjct  240  --IRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGR  297

Query  297  NCTKLKSLQLSNSTCLTDAGIASIG-GLPELRWLSLNALEGTTDGALGGLVN-------L  348
            NC  L+ + L   + +TD  +A +  G P L  L+L+  E  TD  +  L         L
Sbjct  298  NCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEIL  357

Query  349  RLLEVRRCPKVGVGGLSKLLG  369
             +LE+  CP +    L  L+ 
Sbjct  358  SVLELDNCPLITDRTLEHLVS  378


>A8DYA5_DROME unnamed protein product
Length=426

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 81/381 (21%), Positives = 143/381 (38%), Gaps = 44/381 (12%)

Query  5    IEDLNDDCVIDILSYLPVLDRLRSYRVCKRWKTLG--ELSWQKTKALSLRRDFWGLSSES  62
            I+ L  + ++ + SYL V+   R  +VCK W  L     SWQK      +RD  G     
Sbjct  15   IKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEG-----  69

Query  63   RFIVNRHVLKKLLEICGRYLVHVSLSNVVQKSGLPDTNVRVKSCKFVFTLIRELCPNVRS  122
                   V++ + + C  +L  +SL        + D +VR          +   C N+  
Sbjct  70   ------PVIENISQRCRGFLKSLSLRGC---QSVGDQSVRT---------LANHCHNIEH  111

Query  123  IDAGE--PVQDCTLEYVASHYSDLTHFAVREAKNF-EPILALLFSNNRNLRHVRLEGCRI  179
            +D  +   + D + + ++ + S LT   +    N  +  L  L     NL  + +  C +
Sbjct  112  LDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHL  171

Query  180  ---NGTCLLALNPQALREFYFVDNQVGEPQHLIDALEGFRNIRILNLTRVAVEDDQACMD  236
               NG   LA     LR+F     +      ++   +   ++ +LNL       D +   
Sbjct  172  ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSS---  228

Query  237  HVLEAVRQNAASVEHLYLKFYDNHREYIDPSFVAEFTNLEKLHIDGDIIVNDKFLAIVAA  296
              +  +  N   ++ L +    +  +    S       L  L + G     D     +  
Sbjct  229  --IRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGR  286

Query  297  NCTKLKSLQLSNSTCLTDAGIASIG-GLPELRWLSLNALEGTTDGALGGLVN-------L  348
            NC  L+ + L   + +TD  +A +  G P L  L+L+  E  TD  +  L         L
Sbjct  287  NCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEIL  346

Query  349  RLLEVRRCPKVGVGGLSKLLG  369
             +LE+  CP +    L  L+ 
Sbjct  347  SVLELDNCPLITDRTLEHLVS  367


>Q5BI22_DROME unnamed protein product
Length=437

 Score = 50.1 bits (118),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 81/381 (21%), Positives = 143/381 (38%), Gaps = 44/381 (12%)

Query  5    IEDLNDDCVIDILSYLPVLDRLRSYRVCKRWKTLG--ELSWQKTKALSLRRDFWGLSSES  62
            I+ L  + ++ + SYL V+   R  +VCK W  L     SWQK      +RD  G     
Sbjct  26   IKQLPKEVLLRVFSYLDVVSLCRCAQVCKYWNVLALDGSSWQKINLFDFQRDIEG-----  80

Query  63   RFIVNRHVLKKLLEICGRYLVHVSLSNVVQKSGLPDTNVRVKSCKFVFTLIRELCPNVRS  122
                   V++ + + C  +L  +SL        + D +VR          +   C N+  
Sbjct  81   ------PVIENISQRCRGFLKSLSLRGC---QSVGDQSVRT---------LANHCHNIEH  122

Query  123  IDAGE--PVQDCTLEYVASHYSDLTHFAVREAKNF-EPILALLFSNNRNLRHVRLEGCRI  179
            +D  +   + D + + ++ + S LT   +    N  +  L  L     NL  + +  C +
Sbjct  123  LDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHL  182

Query  180  ---NGTCLLALNPQALREFYFVDNQVGEPQHLIDALEGFRNIRILNLTRVAVEDDQACMD  236
               NG   LA     LR+F     +      ++   +   ++ +LNL       D +   
Sbjct  183  ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSS---  239

Query  237  HVLEAVRQNAASVEHLYLKFYDNHREYIDPSFVAEFTNLEKLHIDGDIIVNDKFLAIVAA  296
              +  +  N   ++ L +    +  +    S       L  L + G     D     +  
Sbjct  240  --IRQLAANCHKLQKLCVSKCADLTDLTLLSLSQHNHLLNTLEVSGCRNFTDIGFQALGR  297

Query  297  NCTKLKSLQLSNSTCLTDAGIASIG-GLPELRWLSLNALEGTTDGALGGLVN-------L  348
            NC  L+ + L   + +TD  +A +  G P L  L+L+  E  TD  +  L         L
Sbjct  298  NCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEIL  357

Query  349  RLLEVRRCPKVGVGGLSKLLG  369
             +LE+  CP +    L  L+ 
Sbjct  358  SVLELDNCPLITDRTLEHLVS  378



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000078-PA

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   56.2    8e-08
PATR1_CAEEL  unnamed protein product                                  35.0    0.27 


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/195 (27%), Positives = 77/195 (39%), Gaps = 50/195 (26%)

Query  3    DTSYDGTRGFGV-LSGGLGRLVDGETGADNYKQEIGPGRGTGWVAWMRDKITDDYVDMDF  61
            D SYDG       L+GG+G+L DGE G +N            WV W R +  +  V + F
Sbjct  205  DFSYDGNLANSPHLTGGIGKLYDGEVGKNNVFVN-----HHKWVGWRRKR--NGNVKLAF  257

Query  62   NFDNLRIFNAVHVFTNNYFKRDVQVFERAEIWFNESDNNGSSNNDEAQADSVEPRYFDVG  121
             F  LR  + + + T+N FK+  + F  A + F+ +                       G
Sbjct  258  EFSELRNISGILIHTSNEFKKSAKAFSSATVLFSIN-----------------------G  294

Query  122  KDDDDKKEGEDEEEKKRKRLQQEPVTYTYIPDTNLENARNVSIGLHGRRGKSLRFRLYFA  181
            KD  D                   V +    DT  E  R + I ++ R  K  + RL F 
Sbjct  295  KDFSDT-----------------IVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFG  337

Query  182  --ARWIMISEITFDS  194
              + W+ ISE+ F+S
Sbjct  338  TDSDWLFISEVNFES  352


 Score = 34.3 bits (77),  Expect = 0.43, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 27/48 (56%), Gaps = 6/48 (13%)

Query  639  RELRMLSSLADPNLARILGVLWPDSGEPTRP-WTIIEYTELGDLAHYL  685
            RE+R+L SL  PN+  ++GV         +P   I+EY E GDL  Y+
Sbjct  569  REIRVLGSLKHPNVVEVVGVC-----TIQKPILCIMEYMENGDLKSYI  611


>PATR1_CAEEL unnamed protein product
Length=833

 Score = 35.0 bits (79),  Expect = 0.27, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 9/92 (10%)

Query  546  CKEIEPANIPGQ-----CLHTMEKLGSGHIGEAVVCAI--LGLSDLPLGPKSVSSTSEPL  598
             KE++ + IP        L   E++  G+  +++V A   L L   P+ P+S   +  PL
Sbjct  169  TKEVKSSQIPSMPSSALTLEDCERMQMGNKPDSLVDAFKDLQLGSTPVQPQSAQFSKHPL  228

Query  599  --RLAVARIPSTASETAPPSLSSSSSSSEPSE  628
              R+A    P+TAS  A P+L +++ S E  E
Sbjct  229  EARIAAPGTPATASSQALPTLPTAALSLEELE  260



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000079-PA

Length=223
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   93.2    1e-21
DDRA_CAEEL  unnamed protein product                                   84.3    1e-18
NRX4_DROME  unnamed protein product                                   35.0    0.045


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 49/72 (68%), Gaps = 0/72 (0%)

Query  20   RLRKETAGGAWCPKNQIESGVREWLQIDLSGVHVVTSIETQGRFGNGHGVEYTEEYTIEY  79
            R  +E+  GAWCPKNQI S  +EWLQI  S   V+TS+ETQGRF +G G+EY   + I+Y
Sbjct  58   RAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQY  117

Query  80   WRPGLAEWRQYR  91
            WRP L  W  Y+
Sbjct  118  WRPSLNAWASYK  129


 Score = 33.9 bits (76),  Expect = 0.092, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 29/48 (60%), Gaps = 0/48 (0%)

Query  173  LQVMSGNVDTSTIVSRELIPPIFASQLRILPYSVHRRTVCLRVELKGC  220
            L+ +  N DT   + R L   I A ++RI+P S   RTVC+RVE+ GC
Sbjct  134  LETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGC  181


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 84.3 bits (207),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 1/77 (1%)

Query  20   RLRKETAGGAWCPKNQIESGVREWLQIDLSGVHVVTSIETQGRFGNGHGVEYTEEYTIEY  79
            RL  E A GAWCPK QI S   E+LQ+ L+   ++TS+ETQGR+GNG G E+   Y I+Y
Sbjct  58   RLHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHYMIDY  117

Query  80   WRPGLAEWRQYRLWNGQ  96
             RPG ++W +Y+   G 
Sbjct  118  LRPG-SQWIRYKNRTGH  133


 Score = 57.0 bits (136),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)

Query  176  MSGNVDTSTIVSRELIPPIFASQLRILPYSVHRRTVCLRVELKGCQ  221
            M GN DT+T V R L PPI AS++R +P S + RTVC+R E+ GC+
Sbjct  136  MDGNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCK  181


>NRX4_DROME unnamed protein product
Length=1284

 Score = 35.0 bits (79),  Expect = 0.045, Method: Compositional matrix adjust.
 Identities = 22/72 (31%), Positives = 31/72 (43%), Gaps = 7/72 (10%)

Query  19   PRLRKETAGGAWCPKNQIESGVREWLQIDLSGVHVVTSIETQGRFGNGHGVEYTEEYTIE  78
            P   +     AW P   +E+    +L +DL    +V  I T GR    H  E+  EY ++
Sbjct  68   PDKARLNGNAAWTP---VENTYNHFLTLDLGDPRMVRKIATMGRM---HTDEFVTEYIVQ  121

Query  79   YWRPGLAEWRQY  90
            Y   G   WR Y
Sbjct  122  YSDDG-EFWRSY  132


 Score = 32.3 bits (72),  Expect = 0.35, Method: Compositional matrix adjust.
 Identities = 19/48 (40%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query  174  QVMSGNVDTSTIVSRELIPPIFASQLRILPYSVHRRTVCLRVELKGCQ  221
            Q+  GN D ++I       PI A  +RI P   H R + +RVEL GC 
Sbjct  140  QMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDR-ISMRVELYGCD  186



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


Query= CFLO000080-PA

Length=580
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   198     2e-54
CAM1_CAEEL  unnamed protein product                                   191     1e-51
ROR2_DROME  unnamed protein product                                   183     9e-50


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 158/290 (54%), Gaps = 26/290 (9%)

Query  272  DFPREKLSIAESLGCGNFGDVHICEVDQFPGYEEVFRNTTTDLVVVKSLKPGSPELLRLE  331
            +  R+KL     +G G FG+V +C+++                V VK L  G  +     
Sbjct  521  EIARDKLICVSRIGQGEFGEVDLCQLENRK-------------VAVKKLH-GISQADEFS  566

Query  332  FRKEAKKLARLNDRNVARLLGASLDDDPMCVVLENGECGDLNQYLQSHVAETTTVQTTKT  391
            F +E + L  L   NV  ++G      P+  ++E  E GDL    +S++ +  T+QT++ 
Sbjct  567  FHREIRVLGSLKHPNVVEVVGVCTIQKPILCIMEYMENGDL----KSYILKNPTIQTSQC  622

Query  392  LSFGTLVYMATQIASGMKYLEEMDFVHRDLATRNCLVSKGYTVKILDLGSGRSAYLADYF  451
            +S      + TQ+A+G+ YLE  +FVHRD+A RNCLV     VKI D G  RS Y  +Y+
Sbjct  623  IS------ICTQLAAGLAYLESCNFVHRDIAARNCLVDGEGNVKIADFGMARSLYSQEYY  676

Query  452  KTDGR-SLPIRWMAWESMLLGNYTSKSDVWAFAVTFWEILTFAREQPFEELPDYRIVENA  510
            K +G+  LPIRWMAWE++LLG +++ SDVW F VT WEI +   E+P+ ++ D  +VEN 
Sbjct  677  KVEGKFVLPIRWMAWEALLLGKFSTASDVWGFGVTMWEIFSLCSEKPYSDMTDDDVVENL  736

Query  511  TYFYQQDERRMILPLPKNCPKEMYD-LMRECWQRDERDRPNFREIHLFLQ  559
                     + +L  P+ CP ++Y+  +  CW  +   RP+F  +HL LQ
Sbjct  737  QSMSSTGSLKQVLSRPRMCPSKLYNEQILPCWNYESSRRPSFENVHLHLQ  786


>CAM1_CAEEL unnamed protein product
Length=928

 Score = 191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 155/300 (52%), Gaps = 15/300 (5%)

Query  270  IFDFPREKLSIAESLGCGNFGDVHICEVDQFPGYEEVFRNTTTDLVVVKSLKPGSPELLR  329
            +F+    +LS+ E +G G FG VH         Y           V VK  +  +    R
Sbjct  582  VFEITPSQLSVREKIGEGQFGVVH------SGIYTSGLFAPEPMAVAVKKCRHDATNAER  635

Query  330  LEFRKEAKKLARLNDRNVARLLGASLDDDPMCVVLENGECGDLNQYLQSHVAETTTVQTT  389
             +  +E + +A  +  NV +L+G    D+ +  V E    GDL++ L+  V         
Sbjct  636  AQLEQEIRAVATFDHPNVIKLIGVCYMDNSLLAVFEYMVHGDLHELLKVRVPPADHDMGG  695

Query  390  KTLSFGTLVYMATQIASGMKYLEEMDFVHRDLATRNCLVSKGYTVKILDLGSGRSAYLAD  449
             T +    +Y+ATQIA GM+YL  M FVHRDLATRNCLV    T+KI D G  R++Y +D
Sbjct  696  ITEANAEFLYIATQIALGMEYLASMSFVHRDLATRNCLVGDTRTIKIADFGLMRTSYGSD  755

Query  450  YFKTDGRS-LPIRWMAWESMLLGNYTSKSDVWAFAVTFWEILTFAREQPFEELPDYRIVE  508
            Y+K   RS +P+RWM+ E++  G ++  SDVW+F VT WEI +F R QP+E   + +++E
Sbjct  756  YYKMLHRSWMPVRWMSKEAIEQGRFSEASDVWSFGVTLWEIWSFGR-QPYEGASNQQVIE  814

Query  509  NATYFYQQDERRMILPLPKNCPKEMYDLMRECWQRDERDRPNFREIHLFLQRKNLGYKPH  568
                       R +L  P NCP  +Y LM ECW  +   RP F EI   LQ  +L    H
Sbjct  815  LVA-------NRHLLECPHNCPTNIYSLMVECWHENIERRPTFSEIRSRLQSWSLASPAH  867


>ROR2_DROME unnamed protein product
Length=724

 Score = 183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 157/294 (53%), Gaps = 20/294 (7%)

Query  271  FDFPREKLSIAESLGCGNFGDVHICEV-DQFPGYEEVFRNTTTDLVVVKSLKPGSPELLR  329
             ++PR  +    SLG G FG V         P  E++       LV VK LK  + + ++
Sbjct  434  LEYPRGDIVYVRSLGQGAFGRVFQARAPGLVPDQEDL-------LVAVKMLKDDASDQMQ  486

Query  330  LEFRKEAKKLARLNDRNVARLLGASLDDDPMCVVLENGECGDLNQYLQS---HVAETTTV  386
            ++F +EA  LA  +  N+ RLLG      PMC++ E    GDL+++L++   +       
Sbjct  487  MDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYATHQAPT  546

Query  387  QTTKTLSFGTLVYMATQIASGMKYLEEMDFVHRDLATRNCLVSKGYTVKILDLGSGRSAY  446
            Q    L+   L+ MA  IA+GM YL E  FVHRDLATRNCL+++   VKI D G     Y
Sbjct  547  QDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFGLSHKIY  606

Query  447  LADYFKTDGRS-LPIRWMAWESMLLGNYTSKSDVWAFAVTFWEILTFAREQPFEELPDYR  505
            L DY+K D    +PIRWM  ES+L   ++ +SDVWA+ +  WE+ +FA  QP+  L    
Sbjct  607  LQDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFAL-QPYFGLTHEE  665

Query  506  IVENATYFYQQDERRMILPLPKNCPKEMYDLMRECWQRDERDRPNFREIHLFLQ  559
            +++   Y  + +    +L  P N P  +Y LMR CW R   +RP F EI+  +Q
Sbjct  666  VIK---YIKEGN----VLGCPDNTPLSVYALMRRCWNRKPSERPGFAEINHCIQ  712



Lambda      K        H
   0.320    0.133    0.422 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6306415110


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 4, 2020  4:51 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= CFLO000081-PA

Length=370
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   101     4e-23
DDRA_CAEEL  unnamed protein product                                   89.0    5e-19
NRX4_DROME  unnamed protein product                                   45.1    8e-05


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 101 bits (251),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 73/227 (32%), Positives = 115/227 (51%), Gaps = 26/227 (11%)

Query  19   FWLQLLVGNDNPQTEKEQIFDPPIVATKVRFNPYTVHMRTVCMRVELYGCPWTEGLYSYS  78
            F L+ +  N++ +    +  D  I+A ++R  P +   RTVCMRVE++GCP+ + L  Y+
Sbjct  132  FELETIPANNDTEHAIRRHLDRAIIARRIRIVPVSNSTRTVCMRVEVFGCPFDDSLVFYN  191

Query  79   MPQG-VQRGFELNLTDCTYDG-AEESGFLTGGLG----------------YEWVGWRNDT  120
            + QG +Q G  ++  D +YDG    S  LTGG+G                ++WVGWR   
Sbjct  192  VDQGDLQSG--ISYHDFSYDGNLANSPHLTGGIGKLYDGEVGKNNVFVNHHKWVGWRRKR  249

Query  121  PNILGQAIEITFEFDYTRNFTAMHLHTNNYFTKDVEVFSRAKVYVSNDNSQFIGEPVQFT  180
                   +++ FEF   RN + + +HT+N F K  + FS A V  S +   F    V F 
Sbjct  250  ----NGNVKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSINGKDFSDTIVHFN  305

Query  181  YMPDHALEQARDVTIKLHSRSGRFIKLQLYFA--SHWIMISEIVFDS  225
               D   E  R + I +++R  +  K++L F   S W+ ISE+ F+S
Sbjct  306  NPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDWLFISEVNFES  352


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 106/226 (47%), Gaps = 39/226 (17%)

Query  26   GNDNPQTEKEQIFDPPIVATKVRFNPYTVHMRTVCMRVELYGCPWTEGLYSYSMPQGVQR  85
            GN +  T   ++ DPPIVA+++RF P + + RTVCMR E++GC      Y  ++P G  R
Sbjct  138  GNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCKHEGVTYYSTVPDG-SR  196

Query  86   GFELNLTDCTYDGAE---ES------GFLTGG------------LGYEWVGWRNDTPNIL  124
               L+  D  ++ ++   ES      G LT G            +   W+GW  DT +  
Sbjct  197  LDTLDFKDSMFEDSQIYTESGIKRGLGLLTDGFVAQASPFEKNQMNNSWIGWNRDTTD--  254

Query  125  GQAIEITFEFDYTRNFTAMHLHTNNYFTKDVEVFSRAKVYVSNDNSQFIGEPV--QFTYM  182
               I I FEF+   NFT + L T       ++V        S D   F   P+  Q +  
Sbjct  255  -GRITILFEFEEVHNFTDVVLATFGNRIDGIDVI------FSQDGKTF---PLFSQISSS  304

Query  183  PDHALEQAR---DVTIKLHSRSGRFIKLQLYFASHWIMISEIVFDS  225
               +L       D  + LH+R+GR +++ + F+S W+ ++E+ F S
Sbjct  305  ERQSLNNTSRRYDFRVPLHNRAGRKVRISIKFSSDWMFLTEVHFTS  350


>NRX4_DROME unnamed protein product
Length=1284

 Score = 45.1 bits (105),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 2/55 (4%)

Query  22   QLLVGNDNPQTEKEQIFDPPIVATKVRFNPYTVHMRTVCMRVELYGCPW-TEGLY  75
            Q+  GN +  +    +F+ PI+A  VR NP   H R + MRVELYGC + +E LY
Sbjct  140  QMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDR-ISMRVELYGCDYISENLY  193



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000082-PA

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   89.0    4e-21
DDRA_CAEEL  unnamed protein product                                   76.6    9e-17
SEM1A_CAEEL  unnamed protein product                                  30.4    0.66 


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 89.0 bits (219),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 41/106 (39%), Positives = 60/106 (57%), Gaps = 2/106 (2%)

Query  20   QHSLIAHLDLHRTCPYLARPLLRKDTGGGAWCPKNIVKEGVREYLEINLRTPRVLTSTRT  79
            Q S  +  DL  T P  AR    +++G GAWCPKN +    +E+L+I+     V+TS  T
Sbjct  40   QISASSSFDLQSTGPQHARA--HQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVET  97

Query  80   QGRFGNGKGLEYTEQYYIEYWRPGFTEWRRWKDRRGVDIISEYSQT  125
            QGRF +G+G+EY   + I+YWRP    W  +KD   ++ I   + T
Sbjct  98   QGRFDDGRGMEYATAFKIQYWRPSLNAWASYKDDFELETIPANNDT  143


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 76.6 bits (187),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 68/126 (54%), Gaps = 6/126 (5%)

Query  19   TQHSLIAHLDLHRTCPYLARPLLRKDTGGGAWCPKNIVKEGVREYLEINLRTPRVLTSTR  78
            +Q +  +  D     P  AR  L  +   GAWCPK  +     E+L++ L    ++TS  
Sbjct  39   SQITASSSFDKQSVGPQNAR--LHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVE  96

Query  79   TQGRFGNGKGLEYTEQYYIEYWRPGFTEWRRWKDRRG-VDIISEYSQTYPFSLYSILETA  137
            TQGR+GNG G E+   Y I+Y RPG ++W R+K+R G V +   +  T P  +  +L+  
Sbjct  97   TQGRYGNGTGREFASHYMIDYLRPG-SQWIRYKNRTGHVYMDGNFDTTTP--VIRVLDPP  153

Query  138  IFSSQI  143
            I +S+I
Sbjct  154  IVASRI  159


>SEM1A_CAEEL unnamed protein product
Length=712

 Score = 30.4 bits (67),  Expect = 0.66, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 5/37 (14%)

Query  5    PDYTAIPEKERTGITQHSLIAHLDLHRTCPYLARPLL  41
            PD T +PE   + I  H L     LHR  P +A PLL
Sbjct  377  PDSTKLPENTVSFILHHPL-----LHRPIPSVAAPLL  408



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000083-PA

Length=99
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   47.4    2e-07
DDRA_CAEEL  unnamed protein product                                   38.1    4e-04
Q38B64_TRYB2  unnamed protein product                                 28.9    0.62 


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 47.4 bits (111),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/58 (43%), Positives = 34/58 (59%), Gaps = 1/58 (2%)

Query  16  LRELLVFFALLSMPPASHGLDLRQCKEALGMESGKIPDEDISASSMYD-PTLGPKHAR  72
           ++ LL  F +         L+LR+C   LGM + KI DE ISASS +D  + GP+HAR
Sbjct  1   MKLLLYLFGVTFHSNTVVALELRECSHQLGMSNRKIRDEQISASSSFDLQSTGPQHAR  58


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 38.1 bits (87),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 2/43 (5%)

Query  32  SHGLDLRQCKE-ALGMESGKIPDEDISASSMYDP-TLGPKHAR  72
           ++ L + QC E ALGM++G I D  I+ASS +D  ++GP++AR
Sbjct  16  TNTLRIDQCGENALGMQNGDIADSQITASSSFDKQSVGPQNAR  58


>Q38B64_TRYB2 unnamed protein product
Length=1366

 Score = 28.9 bits (63),  Expect = 0.62, Method: Compositional matrix adjust.
 Identities = 15/46 (33%), Positives = 26/46 (57%), Gaps = 1/46 (2%)

Query  43   ALGMESGKIPDEDISASSMYDPTL-GPKHARYVKPTHTPTQEEKIS  87
            AL ++ GKI  EDI   S+++  L  P  +  ++PT   T++  +S
Sbjct  879  ALLLQKGKITVEDIRQGSVFNKALYAPSTSHVLRPTAADTRDSYVS  924



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000084-PA

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   87.8    5e-19
DDRA_CAEEL  unnamed protein product                                   84.3    6e-18
Q584R1_TRYB2  unnamed protein product                                 32.7    0.41 


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 87.8 bits (216),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 0/73 (0%)

Query  234  RLNQESFGGAWCPRPQIKTDSSEWIQIDLHKVHVITATGIQGRFGNGQGAEYAEAYWLEY  293
            R +QES  GAWCP+ QI + S EW+QI      VIT+   QGRF +G+G EYA A+ ++Y
Sbjct  58   RAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAFKIQY  117

Query  294  WRPSLGKWVRYKN  306
            WRPSL  W  YK+
Sbjct  118  WRPSLNAWASYKD  130


 Score = 45.4 bits (106),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 31/56 (55%), Gaps = 0/56 (0%)

Query  91   LLSLLCSLLLHRVAASVIDMSQCTAALGMASGAIPDSDITASSSFDSGNVGPHHGR  146
            LL  L  +  H      +++ +C+  LGM++  I D  I+ASSSFD  + GP H R
Sbjct  3    LLLYLFGVTFHSNTVVALELRECSHQLGMSNRKIRDEQISASSSFDLQSTGPQHAR  58


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 51/76 (67%), Gaps = 1/76 (1%)

Query  234  RLNQESFGGAWCPRPQIKTDSSEWIQIDLHKVHVITATGIQGRFGNGQGAEYAEAYWLEY  293
            RL+ E   GAWCP+PQI + S E++Q+ L+   +IT+   QGR+GNG G E+A  Y ++Y
Sbjct  58   RLHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHYMIDY  117

Query  294  WRPSLGKWVRYKNPGG  309
             RP   +W+RYKN  G
Sbjct  118  LRPG-SQWIRYKNRTG  132


 Score = 43.9 bits (102),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 35/59 (59%), Gaps = 6/59 (10%)

Query  89   LVLLSLLCSLLLHRVAASVIDMSQC-TAALGMASGAIPDSDITASSSFDSGNVGPHHGR  146
            LVLL++  +        + + + QC   ALGM +G I DS ITASSSFD  +VGP + R
Sbjct  5    LVLLAIYGT-----TTTNTLRIDQCGENALGMQNGDIADSQITASSSFDKQSVGPQNAR  58


>Q584R1_TRYB2 unnamed protein product
Length=513

 Score = 32.7 bits (73),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 21/68 (31%), Positives = 31/68 (46%), Gaps = 4/68 (6%)

Query  211  WFYAVHLVHGKDLTAHVRVPFC---FRLNQESFGGAWCPRPQIKTDSSEWIQIDLHKVHV  267
            +F   HL HG DL  H+R  +     R + E        R  ++T SS    +D H + +
Sbjct  102  YFVMEHLPHG-DLLEHIRTRYSRHSCRRHSEDVANTPSDRNGLQTSSSSTPCLDFHDIQL  160

Query  268  ITATGIQG  275
            ITA  + G
Sbjct  161  ITAQLVVG  168



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000085-PA

Length=502
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   146     3e-37
DDRA_CAEEL  unnamed protein product                                   119     2e-28
NRX4_DROME  unnamed protein product                                   32.3    1.1  


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 146 bits (368),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/201 (39%), Positives = 121/201 (60%), Gaps = 11/201 (5%)

Query  28   LPYSYHTRTVCMRVELYGCPWNDGIVSYSMPQGEKRGGSDFFDAAYDGYWSDG--LRRGL  85
            +P S  TRTVCMRVE++GCP++D +V Y++ QG+ + G  + D +YDG  ++   L  G+
Sbjct  163  VPVSNSTRTVCMRVEVFGCPFDDSLVFYNVDQGDLQSGISYHDFSYDGNLANSPHLTGGI  222

Query  86   GQLTDGVTGPDNIKKN---WVGWRNDTRHGQPLEITFEFDHVREFSAVNIYCANQFTNHV  142
            G+L DG  G +N+  N   WVGWR   R+G  +++ FEF  +R  S + I+ +N+F    
Sbjct  223  GKLYDGEVGKNNVFVNHHKWVGWRR-KRNGN-VKLAFEFSELRNISGILIHTSNEFKKSA  280

Query  143  QVFSEVNILFSIGGKYYTGDPIVYETPEDKIFEYSRAISINLHHRIGKFVKLRFSFA--A  200
            + FS   +LFSI GK ++   + +  PED   E  R I I +++RI K  K+R +F   +
Sbjct  281  KAFSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDS  340

Query  201  RWLMISEIVFDSDVAHGNFSL  221
             WL ISE+ F+S+  H N  L
Sbjct  341  DWLFISEVNFESN--HTNIEL  359


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 145/297 (49%), Gaps = 45/297 (15%)

Query  4    GNTNTYLESKHTLEPAIWASRVRFLPYSYHTRTVCMRVELYGCPWNDGIVSYS-MPQGEK  62
            GN +T       L+P I ASR+RF+P S +TRTVCMR E++GC  ++G+  YS +P G +
Sbjct  138  GNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCK-HEGVTYYSTVPDGSR  196

Query  63   RGGSDFFDAAYDG---YWSDGLRRGLGQLTDGVTG------PDNIKKNWVGWRNDTRHGQ  113
                DF D+ ++    Y   G++RGLG LTDG          + +  +W+GW  DT  G+
Sbjct  197  LDTLDFKDSMFEDSQIYTESGIKRGLGLLTDGFVAQASPFEKNQMNNSWIGWNRDTTDGR  256

Query  114  PLEITFEFDHVREFSAVNIYCANQFTNHVQVFSEVNILFSIGGKYYTGDPIVYETPEDKI  173
             + I FEF+ V  F+ V +     F N +     ++++FS  GK +     +  +    +
Sbjct  257  -ITILFEFEEVHNFTDVVL---ATFGNRID---GIDVIFSQDGKTFPLFSQISSSERQSL  309

Query  174  FEYSRA--ISINLHHRIGKFVKLRFSFAARWLMISEIVFDSDVAHGNFSLESAPSTEAPL  231
               SR     + LH+R G+ V++   F++ W+ ++E+ F S     N +L S        
Sbjct  310  NNTSRRYDFRVPLHNRAGRKVRISIKFSSDWMFLTEVHFTS---AANLTLLS--------  358

Query  232  SRERGSPREIHHQIPVSTAKQDDATYMAVIIGVLTAVILLLAVAMFLIVSHHRQRKN  288
              E+  P       P S A Q     + V+ G++   I    VA  + V   R++KN
Sbjct  359  --EKIPP-------PSSAATQQ----LLVVCGIIFLTI-FACVAYCVSVCLKRRQKN  401


>NRX4_DROME unnamed protein product
Length=1284

 Score = 32.3 bits (72),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query  1    LITGNTNTYLESKHTLEPAIWASRVRFLPYSYHTRTVCMRVELYGCPW  48
            +  GN++      +  E  I A  VR  P  +H R + MRVELYGC +
Sbjct  141  MFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDR-ISMRVELYGCDY  187



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000086-PA

Length=532
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q24201_DROME  unnamed protein product                                 288     1e-90
Q9VIB5_DROME  unnamed protein product                                 286     1e-89
Q24195_DROME  unnamed protein product                                 267     2e-82


>Q24201_DROME unnamed protein product
Length=556

 Score = 288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 277/534 (52%), Gaps = 47/534 (9%)

Query  5    VVETTRGSIRGLLQKSIEGFEYCAFKGIPYAEPPIGELRFKDPVPVKKWIGIRDARKYGQ  64
            V +T  G +RG+ + S+    Y +F+GIPYA+PP+GELRFK P     W G+RD  +   
Sbjct  18   VADTEYGQVRGIKRLSLYDVPYFSFEGIPYAQPPVGELRFKAPQRPIPWEGVRDCSQPKD  77

Query  65   MCVQYDCFMTLRGGSEDCLYLNVYAKTLDKENKKATMVFIHGGAFYFGNSDDMFYGPDYL  124
              VQ         GSEDCLYLNVY   +  +  +  MV+IHGG F  G ++  +YGPDY 
Sbjct  78   KAVQVQFVFDKVEGSEDCLYLNVYTNNVKPDKARPVMVWIHGGGFIIGEANREWYGPDYF  137

Query  125  IRKDVVLVTINYRLGVFGFLDLENEI--APGNQGLKDQVMALQWIRDNIGNFGGDPENVT  182
            +++DVVLVTI YRLG  GF+ L++     PGN GLKDQV+AL+WI++N  +FGGDP  +T
Sbjct  138  MKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCIT  197

Query  183  IFGESTGGAAVHYLTLSPLSKGLFHKAISQSAVAFSPICFVKNGRKNATELCTLLG-KSL  241
            +FGES GGA+ HY+ L+  ++GLFH+ I QS  A  P  +  +   N   +  L+G K  
Sbjct  198  VFGESAGGASTHYMMLTDQTQGLFHRGILQSGSAICPWAYNGDITHNPYRIAKLVGYKGE  257

Query  242  SDPKKILEYLKTVDSNKLRDAQEQL-----RLSKITFPFGPGVDDKSLSPF------MPF  290
             + K +LE+L+ V +  L   +E +     R++KI F FGP     SL PF      +  
Sbjct  258  DNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFRFGP-----SLEPFSTPECVISK  312

Query  291  SAEEMSEKGV--HIPYLLGYTSGEGILMLSDAFTVKGLKRSELFKILDENFDSCIDENYL  348
              +EM +      IP  +G TS EG+L + +   +      ++ + LD        E   
Sbjct  313  PPKEMMKTAWSNSIPMFIGNTSYEGLLWVPEVKLM-----PQVLQQLDAGTPFIPKELLA  367

Query  349  SVLNRHNI--IPMQLKRLYYKGKQISEKN----CSIYAKFVGELTFIEGIHKLIKIQVNK  402
            +  ++  +     Q++ ++  G + +  N    CSIY      L  +   H         
Sbjct  368  TEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAY------A  421

Query  403  SSAPTYLYKFSYDQGFSLIKSKLKSL--QLRGASHFDDLNYIFKMNLYDLLGVPHLQKGS  460
            + AP Y Y++ +D    +   ++  +   ++G SH DDL+Y F   L        L K S
Sbjct  422  AGAPVYFYRYDFDSEELIFPYRIMRMGRGVKGVSHADDLSYQFSSLL-----ARRLPKES  476

Query  461  HDYKVMEQITEMWTNFAKYGKPTIITSELLPTHWLPVV--NDTVLRYLNIGEDL  512
             +Y+ +E+   +WT FA  G P       + T  +  V  +D V++ LNI +DL
Sbjct  477  REYRNIERTVGIWTQFAATGNPYSEKINGMDTLTIDPVRKSDEVIKCLNISDDL  530


>Q9VIB5_DROME unnamed protein product
Length=572

 Score = 286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 276/534 (52%), Gaps = 47/534 (9%)

Query  5    VVETTRGSIRGLLQKSIEGFEYCAFKGIPYAEPPIGELRFKDPVPVKKWIGIRDARKYGQ  64
            V +T  G +RG+ + S+    Y +F+GIPYA+PP+GELRFK P     W  +RD  +   
Sbjct  34   VADTEYGQVRGIKRLSLYDVPYFSFEGIPYAQPPVGELRFKAPQRPIPWERVRDCSQPKD  93

Query  65   MCVQYDCFMTLRGGSEDCLYLNVYAKTLDKENKKATMVFIHGGAFYFGNSDDMFYGPDYL  124
              VQ         GSEDCLYLNVY   +  +  +  MV+IHGG F  G ++  +YGPDY 
Sbjct  94   KAVQVQFVFDKVEGSEDCLYLNVYTNNVKPDKARPVMVWIHGGGFIIGEANREWYGPDYF  153

Query  125  IRKDVVLVTINYRLGVFGFLDLENEI--APGNQGLKDQVMALQWIRDNIGNFGGDPENVT  182
            +++DVVLVTI YRLG  GF+ L++     PGN GLKDQV+AL+WI++N  +FGGDP  +T
Sbjct  154  MKEDVVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCIT  213

Query  183  IFGESTGGAAVHYLTLSPLSKGLFHKAISQSAVAFSPICFVKNGRKNATELCTLLG-KSL  241
            +FGES GGA+ HY+ L+  ++GLFH+ I QS  A  P  +  +   N   +  L+G K  
Sbjct  214  VFGESAGGASTHYMMLTDQTQGLFHRGILQSGSAICPWAYNGDITHNPYRIAKLVGYKGE  273

Query  242  SDPKKILEYLKTVDSNKLRDAQEQL-----RLSKITFPFGPGVDDKSLSPF------MPF  290
             + K +LE+L+ V +  L   +E +     R++KI F FGP     SL PF      +  
Sbjct  274  DNDKDVLEFLQNVKAKDLIRVEENVLTLEERMNKIMFAFGP-----SLEPFSTPECVISK  328

Query  291  SAEEMSEKGV--HIPYLLGYTSGEGILMLSDAFTVKGLKRSELFKILDENFDSCIDENYL  348
              +EM +      IP  +G TS EG+L + +   +      ++ + LD        E   
Sbjct  329  PPKEMMKTAWSNSIPMFIGNTSYEGLLWVPEVKLM-----PQVLQQLDAGTPFIPKELLA  383

Query  349  SVLNRHNI--IPMQLKRLYYKGKQISEKN----CSIYAKFVGELTFIEGIHKLIKIQVNK  402
            +  ++  +     Q++ ++  G + +  N    CSIY      L  +   H         
Sbjct  384  TEPSKEKLDSWSAQIRDVHRTGSESTPDNYMDLCSIYYFVFPALRVVHSRHAY------A  437

Query  403  SSAPTYLYKFSYDQGFSLIKSKLKSL--QLRGASHFDDLNYIFKMNLYDLLGVPHLQKGS  460
            + AP Y Y++ +D    +   ++  L   ++G SH DDL+Y F       L    L K S
Sbjct  438  AGAPVYFYRYDFDSEELIFPYRIMRLGRGVKGVSHADDLSYQFSS-----LLARRLPKES  492

Query  461  HDYKVMEQITEMWTNFAKYGKPTIITSELLPTHWLPVV--NDTVLRYLNIGEDL  512
             +Y+ +E+   +WT FA  G P       + T  +  V  +D V++ LNI +DL
Sbjct  493  REYRNIERTVGIWTQFAATGNPYSEKINGMDTLTIDPVRKSDEVIKCLNISDDL  546


>Q24195_DROME unnamed protein product
Length=554

 Score = 267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 184/539 (34%), Positives = 277/539 (51%), Gaps = 51/539 (9%)

Query  5    VVETTRGSIRGLLQKSIEGFE-YCAFKGIPYAEPPIGELRFKDPVPVKKWIGIRDARKYG  63
            +++T  G +RGL +K++   E Y AF+GIPYA+PP+G+LRF+ P P + W G+ +     
Sbjct  22   ILDTKYGQVRGLQRKTVYDKEPYFAFEGIPYAKPPVGDLRFRAPQPPEPWQGVLNCTTNR  81

Query  64   QMCVQYDCFMTLRGGSEDCLYLNVYAKTLDKENKKATMVFIHGGAFYFGNSDDMFYGPDY  123
               +Q +  + +  GSEDCL+LNVY K L  E     +V+I+GG F  G +    Y PDY
Sbjct  82   SKPMQRNMLLGIVEGSEDCLHLNVYVKALKSEKPLPVIVWIYGGGFQKGEASRDIYSPDY  141

Query  124  LIRKDVVLVTINYRLGVFGFLDLENEI--APGNQGLKDQVMALQWIRDNIGNFGGDPENV  181
             ++K VV V INYRL   GFL L++     PGN GLKDQVMAL+WI  NI  F GDP N+
Sbjct  142  FMKKPVVFVAINYRLAALGFLSLKDPKLDVPGNAGLKDQVMALRWISQNIAQFNGDPNNI  201

Query  182  TIFGESTGGAAVHYLTLSPLSKGLFHKAISQSAVAFSPICFVKNGRKN-ATELCTLLGKS  240
            T+ GES G A+VH +  +  ++GLFHKAI QS  A S   +V++   N A  L   LG  
Sbjct  202  TLMGESAGSASVHVMMTTEQTRGLFHKAIMQSGCALSE--WVESPDNNWAFRLAQNLG-Y  258

Query  241  LSDPK--KILEYLKTVDSNKLRDA-QEQLRLSKIT----FPFGPGVD----DKSLSPFMP  289
            + D K   +L +L  V + ++    Q+ + L ++     F FGP ++    D  + P  P
Sbjct  259  MGDEKDADVLSFLSKVSARQIAAIDQDVINLDEVRSFLLFAFGPVIEPYETDHCVWPKRP  318

Query  290  FSAEEMSEK-GVHIPYLLGYTSGEGI----LMLSDAFTVKGLKRSELFKILDENFDSCID  344
               + +SE  G  IP ++G  S EG+    L+  D + +K             NF + + 
Sbjct  319  --KDLLSEAWGNDIPVIVGGNSFEGLFSYQLVRKDPWALK-------------NFHNILP  363

Query  345  ENY--LSVLNRHNIIPMQLKRLYYKGKQISEKNCSIYAKFVGELTFIEGIHKLI-KIQVN  401
                  S L   +++  +LK+LY+  +                       H+ I   Q  
Sbjct  364  REVRETSSLEGQDLLVRRLKQLYFNNEMQESMEMFEALNIFSHRQIWHDTHRFILARQSY  423

Query  402  KSSAPTYLYKFSYDQ-GFSLIKSKLKSLQLRGASHFDDLNYIFKMNLYDLLGVPHLQKGS  460
                PTYLY+F +D   F+  +  +   ++RG +H D+L+Y+F    Y+++    L K S
Sbjct  424  APKTPTYLYRFDFDSPHFNQXRRLVCGDRIRGVAHADELSYLF----YNIIA-SKLDKSS  478

Query  461  HDYKVMEQITEMWTNFAKYGKPTIITSELLPTHWLPVV--NDTVLRYLNIGEDLTMQSV  517
             +YK +E++  MWT+FA  G P     EL    W  V    + V +  NI  DL M+ +
Sbjct  479  MEYKTIERMVGMWTSFASSGNPN--CPELGSAKWEAVQLKENAVEKCFNISHDLEMRDL  535



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000087-PA

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGT6_CAEEL  unnamed protein product                                 279     1e-87
Q9N574_CAEEL  unnamed protein product                                 278     3e-87
O17851_CAEEL  unnamed protein product                                 254     5e-78


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 279 bits (713),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 168/501 (34%), Positives = 277/501 (55%), Gaps = 42/501 (8%)

Query  23   RRGRIAKKIHGPFSFPIIGNMLSFDISSPKKLWYIVQKVSDTY-YPITR---IWTTTQAV  78
            R  ++ K ++ P S+PI+G+ L   I+ P    ++ Q +   Y YP  R   +W      
Sbjct  25   RMRQVLKHLNQPRSYPIVGHGL---ITKPDPEGFMNQVIGMGYLYPDPRMCLLWIGPFPC  81

Query  79   ISIRHPNDLEILFPSHKVIEKGWIYKYLHPWLKTGLLTSGGKTTKCNEREKWRQRRKILT  138
            + +   + +E +F S K + KG+ Y  L PWL   +LTS        ++E+WR +RK+LT
Sbjct  82   LMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTS--------QKEQWRPKRKLLT  133

Query  139  PAFHFNILKKYMDITEEQGESLIRYLQTDGKESVQSLVPFCSRFTLNIICEAALGVALDK  198
            P FH++ILK ++ I  EQ + L++ L   G +    ++   +  TL+IICE ++G A+  
Sbjct  134  PTFHYDILKDFLPIFNEQSKILVQKLCCLGADEEVDVLSVITLCTLDIICETSMGKAIGA  193

Query  199  LDPKIMED--YKKAIYKLGSIAVYRIPRPYIHDWMLKLFPFLRISREQRQALGVLHNFTD  256
               ++ E+  Y  A++ +  +   R   P +  W   ++      R   + L +LH+FT 
Sbjct  194  ---QLAENNEYVWAVHTINKLISKRTNNPLM--WNSFIYNLTEDGRTHEKCLRILHDFTK  248

Query  257  KIVQERREYHNRTGGKYLEELNDEDDETVSDIYMRGKKRLAMLDLLLLSERNGLIDDAGI  316
            K++ ER+E         L+E         +D  M G  RLA LDLLL   ++G +D+  +
Sbjct  249  KVIVERKEA--------LQE---------NDYKMEG--RLAFLDLLLEMVKSGQMDETDV  289

Query  317  KEEVDTFTFEGHDTTAMAMMFILMLMAENQECQDKARMEVSEVADRNGGRLGFNQIQELH  376
            + EVDTF FEGHDTT+  +M+ + L+  + E Q K + E+ EV   +   +    +  + 
Sbjct  290  QAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDED-VTIEHLSRMK  348

Query  377  YLERCIKESLRLYPPVAIIFRYFSEDLQLKHALVPEDSHAMILIYGAHMDSNFWKDPNKF  436
            YLE  +KE+LRL+P V II R  S+D  +    +P+    ++ +Y  H D   WKDP+ F
Sbjct  349  YLECALKEALRLFPSVPIITRELSDDQVIGGVNIPKGVTFLLNLYLVHRDPAQWKDPDVF  408

Query  437  DPDRFLVENMQNRHAFSYVPFSAGPRNCIGQRFAMNELKSLIGRILYNFRLEPVTKLADM  496
            DPDRFL EN   R +F+++PFSAG RNCIGQRFA+ E K ++  +L NF ++ V  + ++
Sbjct  409  DPDRFLPENSIGRKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEV  468

Query  497  QLTADLILRPAEPVYLKYSRQ  517
            +   ++I+RP  P+++K +R+
Sbjct  469  RPKMEIIVRPVTPIHMKLTRR  489


>Q9N574_CAEEL unnamed protein product
Length=495

 Score = 278 bits (710),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/501 (33%), Positives = 278/501 (55%), Gaps = 42/501 (8%)

Query  23   RRGRIAKKIHGPFSFPIIGNMLSFDISSPKKLWYIVQKVSDTY-YPITR---IWTTTQAV  78
            R  +  K ++ P S+PI+G+ L   ++ P    ++ Q +   Y YP  R   +W      
Sbjct  25   RMRQALKHLNQPRSYPIVGHGL---VTKPDPEGFMNQVIGMGYLYPDPRMCLLWIGPFPC  81

Query  79   ISIRHPNDLEILFPSHKVIEKGWIYKYLHPWLKTGLLTSGGKTTKCNEREKWRQRRKILT  138
            + +   + +E +F S K + KG+ Y  L PWL   +LTS        ++E+WR +RK+LT
Sbjct  82   LMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTS--------QKEQWRPKRKLLT  133

Query  139  PAFHFNILKKYMDITEEQGESLIRYLQTDGKESVQSLVPFCSRFTLNIICEAALGVALDK  198
            P FH++ILK ++ I  EQ + L++ + + G E    ++   +  TL+IICE ++G A+  
Sbjct  134  PTFHYDILKDFLPIFNEQSKILVQKMCSLGAEEEVDVLSVITLCTLDIICETSMGKAIGA  193

Query  199  LDPKIMED--YKKAIYKLGSIAVYRIPRPYIHDWMLKLFPFLRISREQRQALGVLHNFTD  256
               ++ E+  Y  A++ +  +   R   P +  W   ++      R   + L +LH+FT 
Sbjct  194  ---QLAENNEYVWAVHTINKLISKRTNNPLM--WNSFIYNLTEDGRTHEKCLRILHDFTK  248

Query  257  KIVQERREYHNRTGGKYLEELNDEDDETVSDIYMRGKKRLAMLDLLLLSERNGLIDDAGI  316
            K++ ER+E         L+E         +D  M G  RLA LDLLL   ++G +D+  +
Sbjct  249  KVIVERKEA--------LQE---------NDYKMEG--RLAFLDLLLEMVKSGQMDETDV  289

Query  317  KEEVDTFTFEGHDTTAMAMMFILMLMAENQECQDKARMEVSEVADRNGGRLGFNQIQELH  376
            + EVDTF FEGHDTT+  +M+ + L+  + E Q K + E+ EV   +   +    +  + 
Sbjct  290  QAEVDTFMFEGHDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDED-VTIEHLSRMK  348

Query  377  YLERCIKESLRLYPPVAIIFRYFSEDLQLKHALVPEDSHAMILIYGAHMDSNFWKDPNKF  436
            YLE  +KE+LRL+P V II R  S+D  +    +P+    ++ +Y  H D + WKDP+ F
Sbjct  349  YLECALKEALRLFPSVPIITRELSDDQVIGGVNIPKGVTFLLNLYLVHRDPSQWKDPDVF  408

Query  437  DPDRFLVENMQNRHAFSYVPFSAGPRNCIGQRFAMNELKSLIGRILYNFRLEPVTKLADM  496
            DPDRFL EN   R +F+++PFSAG RNCIGQRFA+ E K ++  +L NF ++ V  + ++
Sbjct  409  DPDRFLPENSIARKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNVKAVELMHEV  468

Query  497  QLTADLILRPAEPVYLKYSRQ  517
            +   ++I+RP  P+++K +R+
Sbjct  469  RPKMEIIVRPVTPIHMKLTRR  489


>O17851_CAEEL unnamed protein product
Length=509

 Score = 254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 167/521 (32%), Positives = 270/521 (52%), Gaps = 53/521 (10%)

Query  4    ILLLILFGVLLFHCFVRFGRRGRIAK---KIHGPFSFPIIGNMLS---FDIS-----SPK  52
            ++ + LF   L + F+R   R RI K   K  GP+SFPIIG +     FDIS     S +
Sbjct  11   LITIFLFYYKLIYNFIR--DRLRIYKYMRKFDGPYSFPIIGTLYMVNIFDISKFTTQSME  68

Query  53   KLWYIVQKVSDTYYPITRIWTTTQAVISIRHPNDLEILFPSHKVIEKGWIYKYLHPWLKT  112
               Y  QK   T      +W     +I++ +P   + +  S++VI K   Y  L PWL T
Sbjct  69   LAQYYCQKGCGT----IGLWLGPVPLIAVINPQHAKEILESNEVITKAEEYDILFPWLGT  124

Query  113  GLLTSGGKTTKCNEREKWRQRRKILTPAFHFNILKKYMDITEEQGESLIRYLQ---TDGK  169
            GLLTS G         KWRQRRK+LTPAFHF +L  ++ + + Q +  +  ++     GK
Sbjct  125  GLLTSTG--------SKWRQRRKMLTPAFHFKVLNDFLSVHDYQAKVFLEQIKPYADSGK  176

Query  170  ESVQSLVPFCSRFTLNIICEAALGVALDKLDPKIMEDYKKAIYKLGSIAVYRIPRPYIHD  229
            E    L P+  R  L++IC+ ++GV +D  +    + Y +++  L   A   I RP+   
Sbjct  177  EV--DLFPYIKRLALDVICDTSMGVTIDAQNNHDHQ-YVESVRLLSEYAFEWILRPW---  230

Query  230  WMLKLFPFLRIS---REQRQALGVLHNFTDKIVQERREYHNRTGGKYLEELNDEDDETVS  286
              L+L P   ++    E  + L ++ +FT  +++E+ E   +                V 
Sbjct  231  --LRLKPLWYLTGPGHEYDRHLKIVTDFTKTVIKEKWEEFQKFH--------------VD  274

Query  287  DIYMRGKKRLAMLDLLLLSERNGLIDDAGIKEEVDTFTFEGHDTTAMAMMFILMLMAENQ  346
             +    K+ +A LDLLL     GL+++  I+EEVDTF FEGHDTT+ +M + L  +A N 
Sbjct  275  PVVKTDKRSMAFLDLLLELRNEGLMNEDDIREEVDTFMFEGHDTTSASMGWTLWCLAHNP  334

Query  347  ECQDKARMEVSEVADRNGGRLGFNQIQELHYLERCIKESLRLYPPVAIIFRYFSEDLQLK  406
            E Q+K   EV  +   +      + ++++ YLE+C+KESLR+YP V    R   +D+ + 
Sbjct  335  EFQEKVIQEVDGIFGTSDRDCTNDDLKQMKYLEKCLKESLRMYPSVPFFGRTVEQDVVIN  394

Query  407  HALVPEDSHAMILIYGAHMDSNFWKDPNKFDPDRFLVENMQNRHAFSYVPFSAGPRNCIG  466
                P+    +++      +   + +PN+++P+ F  + + +RHA+S +PFSAGPRNCIG
Sbjct  395  GDFFPKGVRIIVMPLLLQRNPLIFDNPNQYNPENFSEDKIGSRHAYSDIPFSAGPRNCIG  454

Query  467  QRFAMNELKSLIGRILYNFRLEPVTKLADMQLTADLILRPA  507
            Q+FAM E K++I      +R+         ++  +LIL+ +
Sbjct  455  QKFAMMEEKAVISWFFRKYRVTASQPFGMNKILPELILKSS  495



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000088-PA

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGT6_CAEEL  unnamed protein product                                 153     4e-42
Q9N574_CAEEL  unnamed protein product                                 153     4e-42
CP4G1_DROME  unnamed protein product                                  121     4e-30


>G5EGT6_CAEEL unnamed protein product
Length=495

 Score = 153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/308 (30%), Positives = 160/308 (52%), Gaps = 36/308 (12%)

Query  87   ILQSARGVSLDKLETEKVQEYTRAIHDFGGAVM-----PYVLDFMMCSLIKVGRLQVNAL  141
            I +++ G ++     E   EY  A+H     +      P + +  + +L + GR     L
Sbjct  182  ICETSMGKAIGAQLAEN-NEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCL  240

Query  142  KILHKLTDKVLKERRE------YHMITKNKYLQ---------EVDHDDDNSAKDT---GN  183
            +ILH  T KV+ ER+E      Y M  +  +L          ++D  D  +  DT     
Sbjct  241  RILHDFTKKVIVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEG  300

Query  184  TSIASMGLLSTLMLLAENKDAQARAEV-LKSVNKNSGNFNVFDNQELSYVQCCIKESLRL  242
                S GL+  + LL  + + Q + +  L  V  +  +  +     + Y++C +KE+LRL
Sbjct  301  HDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDEDVTIEHLSRMKYLECALKEALRL  360

Query  243  YPSVPSVIRHLTEDIHLKTLS-----------EILSRDPKLWPEPEKFDPDRFLPERSVK  291
            +PSVP + R L++D  +  ++            ++ RDP  W +P+ FDPDRFLPE S+ 
Sbjct  361  FPSVPIITRELSDDQVIGGVNIPKGVTFLLNLYLVHRDPAQWKDPDVFDPDRFLPENSIG  420

Query  292  RHPFAYLPFTAGPRNCIGQKFAMLLLKSIVARILYNYYLEPIDRLSDVRFTADLILRPAH  351
            R  FA++PF+AG RNCIGQ+FA++  K I+A +L N+ ++ ++ + +VR   ++I+RP  
Sbjct  421  RKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNIKAVELMHEVRPKMEIIVRPVT  480

Query  352  PVNLKFVK  359
            P+++K  +
Sbjct  481  PIHMKLTR  488


>Q9N574_CAEEL unnamed protein product
Length=495

 Score = 153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/308 (30%), Positives = 160/308 (52%), Gaps = 36/308 (12%)

Query  87   ILQSARGVSLDKLETEKVQEYTRAIHDFGGAVM-----PYVLDFMMCSLIKVGRLQVNAL  141
            I +++ G ++     E   EY  A+H     +      P + +  + +L + GR     L
Sbjct  182  ICETSMGKAIGAQLAEN-NEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCL  240

Query  142  KILHKLTDKVLKERRE------YHMITKNKYLQ---------EVDHDDDNSAKDT---GN  183
            +ILH  T KV+ ER+E      Y M  +  +L          ++D  D  +  DT     
Sbjct  241  RILHDFTKKVIVERKEALQENDYKMEGRLAFLDLLLEMVKSGQMDETDVQAEVDTFMFEG  300

Query  184  TSIASMGLLSTLMLLAENKDAQARAEV-LKSVNKNSGNFNVFDNQELSYVQCCIKESLRL  242
                S GL+  + LL  + + Q + +  L  V  +  +  +     + Y++C +KE+LRL
Sbjct  301  HDTTSTGLMWAIHLLGNHPEVQRKVQAELDEVMGDDEDVTIEHLSRMKYLECALKEALRL  360

Query  243  YPSVPSVIRHLTEDIHLKTLS-----------EILSRDPKLWPEPEKFDPDRFLPERSVK  291
            +PSVP + R L++D  +  ++            ++ RDP  W +P+ FDPDRFLPE S+ 
Sbjct  361  FPSVPIITRELSDDQVIGGVNIPKGVTFLLNLYLVHRDPSQWKDPDVFDPDRFLPENSIA  420

Query  292  RHPFAYLPFTAGPRNCIGQKFAMLLLKSIVARILYNYYLEPIDRLSDVRFTADLILRPAH  351
            R  FA++PF+AG RNCIGQ+FA++  K I+A +L N+ ++ ++ + +VR   ++I+RP  
Sbjct  421  RKSFAFIPFSAGSRNCIGQRFALMEEKVIMAHLLRNFNVKAVELMHEVRPKMEIIVRPVT  480

Query  352  PVNLKFVK  359
            P+++K  +
Sbjct  481  PIHMKLTR  488


>CP4G1_DROME unnamed protein product
Length=556

 Score = 121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 103/188 (55%), Gaps = 16/188 (9%)

Query  188  SMGLLSTLMLLAENKDAQAR--AEVLKSVNKNSGNFNVF-DNQELSYVQCCIKESLRLYP  244
            S G    L ++  +KD QA+  AE       N      F D  E+ Y++  I E+LRLYP
Sbjct  362  SAGSSFALCMMGIHKDIQAKVFAEQKAIFGDNMLRDCTFADTMEMKYLERVILETLRLYP  421

Query  245  SVPSVIRHLTEDIHLKT-------------LSEILSRDPKLWPEPEKFDPDRFLPERSVK  291
             VP + R L  D+ L +             L   + R P ++P P KFDPD FLPER   
Sbjct  422  PVPLIARRLDYDLKLASGPYTVPKGTTVIVLQYCVHRRPDIYPNPTKFDPDNFLPERMAN  481

Query  292  RHPFAYLPFTAGPRNCIGQKFAMLLLKSIVARILYNYYLEPIDRLSDVRFTADLILRPAH  351
            RH ++++PF+AGPR+C+G+K+AML LK +++ I+ NY +   D  +D +  AD+IL+  +
Sbjct  482  RHYYSFIPFSAGPRSCVGRKYAMLKLKVLLSTIVRNYIVHSTDTEADFKLQADIILKLEN  541

Query  352  PVNLKFVK  359
              N+   K
Sbjct  542  GFNVSLEK  549


 Score = 34.3 bits (77),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (53%), Gaps = 5/91 (5%)

Query  4    IILTVLFLGLFTFHVKMRYSRAGRLIDKIPGPTPLPVLGNL-LDMNVSPGDLFYT-LRDL  61
            ++ T++ + L+ +    R SR  R++  IP P  LP+LG   +   +S  ++    L  L
Sbjct  31   LVGTLVAMALYEYW--RRNSREYRMVANIPSPPELPILGQAHVAAGLSNAEILAVGLGYL  88

Query  62   AKL-PIVKAWMFSYAMVGIRDPDDLEILQSA  91
             K    +KAW+ +  +V + +P D+E++ S 
Sbjct  89   NKYGETMKAWLGNVLLVFLTNPSDIELILSG  119



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000089-PA

Length=126
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9N384_CAEEL  unnamed protein product                                 27.7    1.9  
Q384V1_TRYB2  unnamed protein product                                 28.1    2.5  
Q54TS2_DICDI  unnamed protein product                                 26.9    6.8  


>Q9N384_CAEEL unnamed protein product
Length=146

 Score = 27.7 bits (60),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 25/44 (57%), Gaps = 0/44 (0%)

Query  36   VESNSIKSAYVSDFGLSDRLKRSPKHGELVIQIEKEVGQQSSIV  79
            V +  I S +V+    +D ++R+P HG  +I+IE  V   S+ V
Sbjct  101  VSNGGIISIFVNGAHFADFVERTPSHGVHLIEIEGGVHVHSAHV  144


>Q384V1_TRYB2 unnamed protein product
Length=1236

 Score = 28.1 bits (61),  Expect = 2.5, Method: Composition-based stats.
 Identities = 12/27 (44%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  35   TVESNSIKSAYVSDFGLSDRLKRSPKH  61
            +V S+ + +  V+DFGL+  L RS KH
Sbjct  513  SVSSDDVGTIRVADFGLARTLHRSMKH  539


>Q54TS2_DICDI unnamed protein product
Length=1706

 Score = 26.9 bits (58),  Expect = 6.8, Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 35/64 (55%), Gaps = 8/64 (13%)

Query  31    SVPRTVESNSIKSAYVSDFGL------SDRLKRSPKHGELVIQIEKEVGQQSSIVIEGKQ  84
             ++ +++ES ++    +SDF        ++ LK++ +  +L+ Q  KE    +SI I   Q
Sbjct  1059  NIIKSIESGNLNE--ISDFHFENYLKKTNFLKKTNEKQKLLFQSIKERSNLTSIFIRNSQ  1116

Query  85    ILLE  88
             +LLE
Sbjct  1117  LLLE  1120



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000090-PA

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C6A13_DROME  unnamed protein product                                  363     2e-120
CP6A2_DROME  unnamed protein product                                  356     1e-117
C6A20_DROME  unnamed protein product                                  337     4e-110


>C6A13_DROME unnamed protein product
Length=493

 Score = 363 bits (931),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/492 (40%), Positives = 294/492 (60%), Gaps = 12/492 (2%)

Query  29   TLLGILTVILSLYYYFLRLTTFDFWQSRGIPGPRPVAIYGNLKEIIFGK-MSVGDLVVLQ  87
            TLL ++  +  L Y  LR   + +W  RG+ G RPV   GN+  +  G+ +   D+ +  
Sbjct  3    TLLVLVFTVGLLLYVKLRWH-YSYWSRRGVAGERPVYFRGNMSGL--GRDLHWTDINLRI  59

Query  88   YEKHKHQPMF-GIYAMRSPILVINDPDLIKDVLIKDFASFANRGVRIFEKVEPLSANLVN  146
            Y K +    + G +   +  L I D +LI+D++I+DF+SFA+RG+    + +PL+ NL+ 
Sbjct  60   YRKFRGVERYCGYFTFMTKSLFIMDLELIRDIMIRDFSSFADRGLFHNVRDDPLTGNLLF  119

Query  147  LEAARWKPLRAKQTMMFTSAKLKEMFYLLLECADHLERALTEDNDVVDACEVTARYTTDC  206
            L+   W+ LR   T +FTS K+K MF  ++E  + L +A       ++A ++ AR+TTD 
Sbjct  120  LDGPEWRWLRQNLTQVFTSGKMKFMFPNMVEVGEKLTQACRLQVGEIEAKDLCARFTTDV  179

Query  207  IGACVFGIDMKALEDDESDFRRIGKKFVQLDKWRAFKVRFKQIFPGLFNQLGFIMYDHEI  266
            IG+C FG++  +L+D ES FRR+G+   Q          F    P L  +L F ++  E+
Sbjct  180  IGSCAFGLECNSLQDPESQFRRMGRSVTQEPLHSVLVQAFMFAQPELARKLRFRLFRPEV  239

Query  267  NDFFIGTMIKTMEHRRKNNIKRGDFVDLLNDLKQNPGKLEGIE--LTDELLTAQAFAFFF  324
            ++FF+ T+ +T+++RR+ NI R D + LL +L +     EG++  L+ E + AQA  FF 
Sbjct  240  SEFFLDTVRQTLDYRRRENIHRNDLIQLLMELGE-----EGVKDALSFEQIAAQALVFFL  294

Query  325  AGFDTSSLTISHALYELAINRSIQDRVRKEIEKVLAEYDGKLVYEGIESMKYLHKVLSET  384
            AGFDTSS T+S  LYELA+N  +Q+R+R E+  VL   + KL Y+ ++ M YL +V++ET
Sbjct  295  AGFDTSSTTMSFCLYELALNPDVQERLRVEVLAVLKRNNQKLTYDSVQEMPYLDQVVAET  354

Query  385  LRKYPVTPILTRQSMDSYSFSTGQLTIPKDTRIWIPIYGIHRDCSIYPDPETFDPERFSE  444
            LRKYP+ P L R+S   Y      L +   ++I IP++ IH D  +YPDPE FDP RF  
Sbjct  355  LRKYPILPHLLRRSTKEYQIPNSNLILEPGSKIIIPVHSIHHDPELYPDPEKFDPSRFEP  414

Query  445  ENIRERHSSHYLPFGAGPRNCIGARFGNYQSKVGLITILKNFKVDVCEKTPIPYVSNRRR  504
            E I+ RH   YLPFG GPRNCIG RFG  Q KVGL+ +L++FK    EKT IP   + R 
Sbjct  415  EEIKARHPFAYLPFGEGPRNCIGERFGKLQVKVGLVYLLRDFKFSRSEKTQIPLKFSSRN  474

Query  505  FLIGPAAGIPLR  516
            FLI    G+ LR
Sbjct  475  FLISTQEGVHLR  486


>CP6A2_DROME unnamed protein product
Length=506

 Score = 356 bits (914),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 203/509 (40%), Positives = 297/509 (58%), Gaps = 22/509 (4%)

Query  29   TLLGILTVILSLYYYFLRLTTFDFWQSRGIPGPRPVAIYGNLKEIIFGKMSV-GDLVVLQ  87
             L+ +L  I SL  Y L    F++W  RG+P   P  +YGN+  + F K  V  D     
Sbjct  3    VLIYLLIAISSLLAY-LYHRNFNYWNRRGVPHDAPHPLYGNM--VGFRKNRVMHDFFYDY  59

Query  88   YEKHKHQ--PMFGIYAMRSPILVINDPDLIKDVLIKDFASFANRGVRIFEKVEPLSANLV  145
            Y K++    P  G Y +  P   I D  L K++LIKDF++FA+RG     + +PL+ +L 
Sbjct  60   YNKYRKSGFPFVGFYFLHKPAAFIVDTQLAKNILIKDFSNFADRGQFHNGRDDPLTQHLF  119

Query  146  NLEAARWKPLRAKQTMMFTSAKLKEMFYLLLECADHLERALTE------DNDVVDACEVT  199
            NL+  +WK +R + T  FTS K+K MF  +++ ++   + +TE      +  V++  E+ 
Sbjct  120  NLDGKKWKDMRQRLTPTFTSGKMKFMFPTVIKVSEEFVKVITEQVPAAQNGAVLEIKELM  179

Query  200  ARYTTDCIGACVFGIDMKALEDDESDFRRIGKKFVQLDKWRAFKVRFKQIFPGLFNQLGF  259
            AR+TTD IG C FGI+   L    SDFR +G+K     +       F   FP L ++L  
Sbjct  180  ARFTTDVIGTCAFGIECNTLRTPVSDFRTMGQKVFTDMRHGKLLTMFVFSFPKLASRLRM  239

Query  260  IMYDHEINDFFIGTMIKTMEHRRKNNIKRGDFVDLLNDLKQ-------NPGKLEGIELTD  312
             M   +++ FF+  +  T+  R + N KR DF++LL +LKQ       N   +EG+++ +
Sbjct  240  RMMPEDVHQFFMRLVNDTIALRERENFKRNDFMNLLIELKQKGRVTLDNGEVIEGMDIGE  299

Query  313  ELLTAQAFAFFFAGFDTSSLTISHALYELAINRSIQDRVRKEIEKVLAEYDGKLVYEGIE  372
              L AQ F F+ AGF+TSS T+S+ LYELA N+ IQDR+R EI+ VL E +G+L YE I+
Sbjct  300  --LAAQVFVFYVAGFETSSSTMSYCLYELAQNQDIQDRLRNEIQTVLEEQEGQLTYESIK  357

Query  373  SMKYLHKVLSETLRKYPVTPILTRQSMDSYSFSTGQ-LTIPKDTRIWIPIYGIHRDCSIY  431
            +M YL++V+SETLR Y + P L R++++ Y     + L I K T++ IP    HRD  +Y
Sbjct  358  AMTYLNQVISETLRLYTLVPHLERKALNDYVVPGHEKLVIEKGTQVIIPACAYHRDEDLY  417

Query  432  PDPETFDPERFSEENIRERHSSHYLPFGAGPRNCIGARFGNYQSKVGLITILKNFKVDVC  491
            P+PETFDPERFS E +  R S  +LPFG GPRNCIG RFG  Q+++GL  I+  F+V VC
Sbjct  418  PNPETFDPERFSPEKVAARESVEWLPFGDGPRNCIGMRFGQMQARIGLAQIISRFRVSVC  477

Query  492  EKTPIPYVSNRRRFLIGPAAGIPLRFTKI  520
            + T IP   +    ++G   GI LR  +I
Sbjct  478  DTTEIPLKYSPMSIVLGTVGGIYLRVERI  506


>C6A20_DROME unnamed protein product
Length=501

 Score = 337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 194/504 (38%), Positives = 286/504 (57%), Gaps = 23/504 (5%)

Query  30   LLGILTVILSLYYYFLRLTTFDFWQSRGIPGPRPVAIYGNLKEIIFGKMSVGDLVVLQYE  89
            L+G++T + + Y +      F++W+ RGIP   P   YGN  E++   +   D+    Y 
Sbjct  8    LIGVITFV-AWYVH----QHFNYWKRRGIPHDEPKIPYGNTSELM-KTVHFADIFKRTYN  61

Query  90   KHKHQ---PMFGIYAMRSPILVINDPDLIKDVLIKDFASFANRGVRIFEKVEPLSANLVN  146
            K +++   P  G Y     ++V+ D D  K VLI++F  F +RGV   E+ +PLSANLVN
Sbjct  62   KLRNKTDGPFVGFYMYFKRMVVVTDIDFAKTVLIREFDKFHDRGVFHNERDDPLSANLVN  121

Query  147  LEAARWKPLRAKQTMMFTSAKLKEMFYLLLECADHLERALTE----DNDVVDACEVTARY  202
            ++  +WK LR K T  FTS K+K MF  +L   D L R   E    D+D ++   V AR+
Sbjct  122  IDGQKWKTLRQKLTPTFTSGKMKTMFPTILTVGDELIRVFGETASADSDSMEITNVVARF  181

Query  203  TTDCIGACVFGIDMKALEDDESDFRRIGKKFVQLDKWRAFKVRFKQIF--PGLFNQLGFI  260
            T D IG+C FG+D  +L D ++ F ++G     + + R  K     +F  P L  +L   
Sbjct  182  TADVIGSCAFGLDCHSLSDPKAKFVQMGT--TAITERRHGKSMDLLLFGAPELAAKLRMK  239

Query  261  MYDHEINDFFIGTMIKTMEHRRKNNIKRGDFVDLLNDLK---QNPGKLEGIELTDELLTA  317
                E+ DF++  +  T+++R KNN+KR DFVD+L ++K    N  K  G+   +  + A
Sbjct  240  ATVQEVEDFYMNIIRDTVDYRVKNNVKRHDFVDMLIEMKLKFDNGDKENGLTFNE--IAA  297

Query  318  QAFAFFFAGFDTSSLTISHALYELAINRSIQDRVRKEIEKVLAEYDGKLVYEGIESMKYL  377
            QAF FF AGF+TSS T+  ALYELA ++ IQD++R EI  VL +++GKL Y+ +  M YL
Sbjct  298  QAFIFFLAGFETSSTTMGFALYELACHQDIQDKLRTEINTVLKQHNGKLDYDSMREMTYL  357

Query  378  HKVLSETLRKYPVTPILTRQSMDSYSFSTGQLTIPKDTRIWIPIYGIHRDCSIYPDPETF  437
             KV+ ET+RK PV   L R +   Y  +  +  I K T + +P   IH D   YP+PE F
Sbjct  358  EKVIDETMRKRPVVGHLIRVATQHYQHTNPKYNIEKGTGVIVPTLAIHHDPEFYPEPEKF  417

Query  438  DPERFSEENIRERHSSHYLPFGAGPRNCIGARFGNYQSKVGLITILKNFKVDVC-EKTPI  496
             PERF E+ +++R +  +LPFG GPRNCIG RFG  Q  VG+  ++ NFK +    KT +
Sbjct  418  IPERFDEDQVQQRPACTFLPFGDGPRNCIGLRFGRMQVIVGMALLIHNFKFEFHPTKTVV  477

Query  497  PYVSNRRRFLIGPAAGIPLRFTKI  520
            P       FL+    GI L+ T++
Sbjct  478  PLEYRTDDFLLSSKGGIHLKVTRV  501



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000091-PA

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CP6G1_DROME  unnamed protein product                                  202     1e-57
CP6G2_DROME  unnamed protein product                                  200     7e-57
CP6W1_DROME  unnamed protein product                                  194     9e-55


>CP6G1_DROME unnamed protein product
Length=524

 Score = 202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 142/499 (28%), Positives = 233/499 (47%), Gaps = 32/499 (6%)

Query  124  YLYLVRNYDHWRTQKVPTAPGVLPGFGHALPLLTLRENFGTLISRLYA--RMGLRSMYGC  181
            Y +  RN+ +W+ +K        P  G+   +  +  +FG  +S +Y   R+   ++ G 
Sbjct  18   YTWFQRNHSYWQ-RKGIPYIPPTPIIGNTKVVFKMENSFGMHLSEIYNDPRLKDEAVVGI  76

Query  182  YLLQTPALLIREPHLLKAVLRSDFPSFRNNLLSVHGDLDPVMANNPFFARDDLWRESRVR  241
            Y +  P L+IR+  L+K++L  DF  F N         DP+  NN FF RD  W+  R +
Sbjct  77   YSMNKPGLIIRDIELIKSILIKDFNRFHNRYARCDPHGDPLGYNNLFFVRDAHWKGIRTK  136

Query  242  LSANFSGKRMRFVFANSALACQKLQDFVDRR-IGTAAEF--ESRDLFARVSGEVVASTVF  298
            L+  F+  +++ ++       + L+  + RR    +  F  E +++ A+ S + +A+  F
Sbjct  137  LTPVFTSGKVKQMYTLMQEIGKDLELALQRRGEKNSGSFITEIKEICAQFSTDSIATIAF  196

Query  299  GIDSRGFEDAPERDSFARVAARFFEPTVGNAARLAVRFFLPRVADRLGVGFLTREMDRFV  358
            GI +   E+      F     + F  TV  A    V FFLP++   + + F T +   F+
Sbjct  197  GIRANSLENP--NAEFRNYGRKMFTFTVARAKDFFVAFFLPKLVSLMRIQFFTADFSHFM  254

Query  359  RRRLGAFVKSTLHSGRPLEQCYQFPLDLD------------GLDEDAVTAQATSLLFDGY  406
            R  +G  ++    SG          + L               ++D + AQA      G+
Sbjct  255  RSTIGHVMEERERSGLLRNDLIDVLVSLRKEAAAEPSKPHYAKNQDFLVAQAGVFFTAGF  314

Query  407  EACTNVLSFMMYRLAGNAEVQTRAREEVARVL---AGELSYEGVKGLEYLEWVVMETLRM  463
            E  ++ +SF +Y +A + E+Q R R+E+   L    G LSYE ++ LEYL  VV E LRM
Sbjct  315  ETSSSTMSFALYEMAKHPEMQKRLRDEINEALVEGGGSLSYEKIQSLEYLAMVVDEVLRM  374

Query  464  NPVFGDLSRVCTRETVLEGSDGLSCR------LRPGDVVLMSPESLHMDEEYWPRPGVFD  517
             PV   L R    E+V EG   LS +      L  G  V +   +LH D +YW  P  FD
Sbjct  375  YPVLPFLDR--EYESV-EGQPDLSLKPFYDYTLENGTPVFIPIYALHHDPKYWTNPSQFD  431

Query  518  PERFASENRVKLSRYAFLGFSEGARMCPGKRMGLMIVKTVAAAVLQRYSIEVAERSRGPL  577
            PERF+  NR  +   A+  F  G   C G R+GL+  K    ++L+ +S+   E +   +
Sbjct  432  PERFSPANRKNIVAMAYQPFGSGPHNCIGSRIGLLQSKLGLVSLLKNHSVRNCEATMKDM  491

Query  578  KLNPNSFASVVEGGLWIRL  596
            K +P  F    +GG+ + +
Sbjct  492  KFDPKGFVLQADGGIHLEI  510


>CP6G2_DROME unnamed protein product
Length=519

 Score = 200 bits (508),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 142/526 (27%), Positives = 252/526 (48%), Gaps = 51/526 (10%)

Query  108  MDFTLLFFAFAALLSI-YLYLVRNYDHWRTQKVPTAPGVLPGF--GHALPLLTLRENFGT  164
            M+  LL    A+L+ I +L L ++Y +WR   V     + P +  G+ + LL +R +   
Sbjct  1    MELVLLILV-ASLIGIAFLALQQHYSYWRRMGVRE---IRPKWIVGNLMGLLNMRMSPAE  56

Query  165  LISRLYARMGLRS--MYGCYLLQTPALLIREPHLLKAVLRSDFPSFRNNLLSVHGDLDPV  222
             IS+LY      +    G ++   PALL+R+P +++ +L  DF  F N   S     DP+
Sbjct  57   FISQLYNHPDAENEPFVGIHVFHKPALLLRDPEMVRNILVKDFAGFSNRYSSSDPKGDPL  116

Query  223  MANNPFFARDDLWRESRVRLSANFSGKRMRFVF-----ANSALACQKLQDFVDRRIGTAA  277
             + N FF ++  W+E R++LS  F+G R++ +F       ++L     Q  +        
Sbjct  117  GSQNIFFLKNPAWKEVRLKLSPFFTGNRLKQMFPLIEEVGASLDAHLRQQPLHNERMRCF  176

Query  278  EFESRDLFARVSGEVVASTVFGIDSRGFEDAPERDSFARVAARFFEPTVGNAARLAVRFF  337
            + E+++L A  + +V+A+  +G+ +  F D   +  F R     FE  +  AA   + FF
Sbjct  177  DLEAKELCALYTTDVIATVAYGVSANSFTDP--KCEFRRHGRSVFEFNLLRAAEFTLVFF  234

Query  338  LPRVADRLGVGFLTREMDRFVRRRLGAFVKSTLHSGRPLEQCYQFPLDL---------DG  388
            LP +   +    +  E  RF+R+ +   +     SG+         ++           G
Sbjct  235  LPHLVPFVRFKVVPAEATRFLRKTINYVMSEREKSGQKRNDLIDILIEFRRSTQLAKASG  294

Query  389  LDE------DAVTAQATSLLFDGYEACTNVLSFMMYRLAGNAEVQTRAREEVARVL---A  439
            + +      D + AQA      G+E+ ++ ++F MY LA + +VQ R REE+   L    
Sbjct  295  IKDQFVFEGDILVAQAVLFFTAGFESSSSTMAFAMYELAKDTDVQQRLREEIKDALVESG  354

Query  440  GELSYEGVKGLEYLEWVVMETLRMNPVFGDLSRVCTRETVLEGSDGLSCRLRPGDVVLMS  499
            G+++ + ++ LE+++ +++E LRM P    L R CT         G    L P     + 
Sbjct  355  GQVTLKMIESLEFMQMILLEVLRMYPPLPFLDRECT--------SGRDYSLAPFHKKFVV  406

Query  500  PE---------SLHMDEEYWPRPGVFDPERFASENRVKLSRYAFLGFSEGARMCPGKRMG  550
            P+         +LHMD +Y+P+P  F PERF+ ENR   + Y ++ F  G   C G+R G
Sbjct  407  PKGMPVYIPCYALHMDPQYFPQPRKFLPERFSPENRKLHTPYTYMPFGLGPHGCIGERFG  466

Query  551  LMIVKTVAAAVLQRYSIEVAERSRGPLKLNPNSFASVVEGGLWIRL  596
             +  K     +L+ + I  +ER+   ++L+P +  +  +GG+ +RL
Sbjct  467  YLQAKVGLVNLLRNHMITTSERTPHRMQLDPKAIITQAKGGIHLRL  512


>CP6W1_DROME unnamed protein product
Length=514

 Score = 194 bits (492),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 132/487 (27%), Positives = 219/487 (45%), Gaps = 33/487 (7%)

Query  121  LSIYLYLVRNYDHWRTQKVPTAPGVLPGFGHALPLLTLRENFGTLISRLYARMGLRS--M  178
            +  Y++  R    W    V       P  G     LT +  F   I + +   G  +   
Sbjct  12   IVFYIWQRRTLSFWERHGVKYIRP-FPVVGCTREFLTAKVPFFEQIQKFHEAPGFENEPF  70

Query  179  YGCYLLQTPALLIREPHLLKAVLRSDFPSFRNNLLSVHGDLDPVMANNPFFARDDLWRES  238
             G Y+   PAL+IR+  L+K V+   F  F N +L      D +   N FFAR   WRE 
Sbjct  71   VGVYMTHRPALVIRDLELIKTVMIKKFQYFNNRVLQTDPHNDALGYKNLFFARSPGWREL  130

Query  239  RVRLSANFSGKRMRFVFANSALACQKLQDFVDRRIGTAAEFESRDLFARVSGEVVASTVF  298
            R ++S  F+  +++ ++       + LQD  +R +G+  E + +DL +R + +++A+  F
Sbjct  131  RTKISPVFTSGKIKQMYPLMVKIGKNLQDSAER-LGSGTEVQVKDLCSRFTTDLIATIAF  189

Query  299  GIDSRGFEDAPERDSFARVAARFFEPTVGNAARLAVRFFLPRVADRLGVGFLTREMDRFV  358
            G+++   +DA  +  F       F  T+      A+ F +P +A    V   +RE  +F+
Sbjct  190  GVEANALQDA--KSEFFYHNRAIFSLTLSRGIDFAIIFMIPALASLARVKLFSRETTKFI  247

Query  359  RRRLGAFVKSTLHSGRPLEQCYQFPLDLD------------GLDEDAVTAQATSLLFDGY  406
            R  +   +K    +G          L L              +D D + AQA      G+
Sbjct  248  RSSVNYVLKERERTGEKRNDLIDILLALKREAAANPGKMSKEVDLDYLVAQAAVFQTAGF  307

Query  407  EACTNVLSFMMYRLAGNAEVQTRAREEVARVLAGE--LSYEGVKGLEYLEWVVMETLRMN  464
            E   + ++  +Y LA N  +Q R R+E+      E  +SYE ++ + YL  VV ETLR  
Sbjct  308  ETSASTMTMTLYELAKNEALQDRLRQEIVDFFGDEDHISYERIQEMPYLSQVVNETLRKY  367

Query  465  PVFGDLSRVCTRETVLEGSDGLSCRLRP--------GDVVLMSPESLHMDEEYWPRPGVF  516
            P+ G + R C+     + ++G    L P        G  + MS  ++H D +YWP P  +
Sbjct  368  PIVGYIERECS-----QPAEGERFTLEPFHNMELPHGMSIYMSTVAVHRDPQYWPDPEKY  422

Query  517  DPERFASENRVKLSRYAFLGFSEGARMCPGKRMGLMIVKTVAAAVLQRYSIEVAERSRGP  576
            DPERF S NR  L+  A++ F  G R C G R+GL+  K     +L+ +     +++   
Sbjct  423  DPERFNSSNRDNLNMDAYMPFGVGPRNCIGMRLGLLQSKLGLVHILRNHRFHTCDKTIKK  482

Query  577  LKLNPNS  583
            ++  P S
Sbjct  483  IEWAPTS  489



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000092-PA

Length=829
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGK1_CAEEL  unnamed protein product                                 32.3    2.4  
Q95XN3_CAEEL  unnamed protein product                                 31.6    4.0  
M9PD17_DROME  unnamed protein product                                 30.8    7.1  


>G5EGK1_CAEEL unnamed protein product
Length=2553

 Score = 32.3 bits (72),  Expect = 2.4, Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 6/62 (10%)

Query  78   KMDLSPST-----DPRTIIYWLKKNCNIDDKKSKIRLLYI-ITDGMVNSDSVDECFELNQ  131
            ++D +PS      + RT  ++L +N +  + K KIRLL + + DG V + SVDE   ++Q
Sbjct  52   RLDENPSKSLWMDNGRTFEHYLVRNKDEIEYKRKIRLLKVRMLDGAVKTISVDESQPVSQ  111

Query  132  YM  133
             M
Sbjct  112  LM  113


>Q95XN3_CAEEL unnamed protein product
Length=996

 Score = 31.6 bits (70),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 36/62 (58%), Gaps = 6/62 (10%)

Query  78   KMDLSPST-----DPRTIIYWLKKNCNIDDKKSKIRLLYI-ITDGMVNSDSVDECFELNQ  131
            ++D +PS      + RT  ++L +N +  + K KIRLL + + DG V + SVDE   ++Q
Sbjct  52   RLDENPSKSLWMDNGRTFEHYLVRNKDEIEYKRKIRLLKVRMLDGAVKTISVDESQPVSQ  111

Query  132  YM  133
             M
Sbjct  112  LM  113


>M9PD17_DROME unnamed protein product
Length=1844

 Score = 30.8 bits (68),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (58%), Gaps = 2/45 (4%)

Query  197   NLTSYIKLKFLKKFQNNANALEEIEKLKKLRSRLFDELSLKTEQK  241
             NL S +     KK    +N LE + KLK+LRS+L +   L ++QK
Sbjct  1772  NLASLVYQSVQKKHPYASNWLERLRKLKRLRSKLIE--GLNSQQK  1814



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000093-PA

Length=114
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBM3_DROME  unnamed protein product                                 33.5    0.026
EGAL1_CAEEL  unnamed protein product                                  29.6    0.53 
PEN3A_PENVA  unnamed protein product                                  27.3    1.4  


>A1ZBM3_DROME unnamed protein product
Length=1366

 Score = 33.5 bits (75),  Expect = 0.026, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  7    LLLLATLAIISIEAYRPPVVKPHPNRPPF---PSFPGQGPFN  45
            ++LL++LA +SI  Y P   K  P R P    P+F   GP+N
Sbjct  359  IVLLSSLAEVSIYVYAPDKTKSLPFRLPLEGEPTFMAVGPYN  400


>EGAL1_CAEEL unnamed protein product
Length=574

 Score = 29.6 bits (65),  Expect = 0.53, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 18/41 (44%), Gaps = 1/41 (2%)

Query  18   IEAYRPPVVKPHPNRPPFPSFPGQGPFNPRPRRSPDNNGQI  58
            IE   P V+   PNRPP   F    P+    RR   N G I
Sbjct  497  IEVNHPEVLLASPNRPPPQPFI-SSPYRASTRRDVRNGGSI  536


>PEN3A_PENVA unnamed protein product
Length=82

 Score = 27.3 bits (59),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 28/52 (54%), Gaps = 4/52 (8%)

Query  1   MKFLVSLLLLATLAIISI-EAYRPPVVKPHPNRPPFPS-FPGQ--GPFNPRP  48
           M+ +V L+ LA+ A++   + Y+    +P P  PPF    PG   GP+N  P
Sbjct  1   MRLVVCLVFLASFALVCQGQVYKGGYTRPIPRPPPFVRPLPGGPIGPYNGCP  52



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000094-PA

Length=114
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZBM3_DROME  unnamed protein product                                 33.9    0.020
EGAL1_CAEEL  unnamed protein product                                  29.6    0.53 
Q384N5_TRYB2  unnamed protein product                                 28.1    1.5  


>A1ZBM3_DROME unnamed protein product
Length=1366

 Score = 33.9 bits (76),  Expect = 0.020, Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query  7    LLLLATLAVISIEAYRPPVVKPHPNRPPF---PSFPGQGPFN  45
            ++LL++LA +SI  Y P   K  P R P    P+F   GP+N
Sbjct  359  IVLLSSLAEVSIYVYAPDKTKSLPFRLPLEGEPTFMAVGPYN  400


>EGAL1_CAEEL unnamed protein product
Length=574

 Score = 29.6 bits (65),  Expect = 0.53, Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 18/41 (44%), Gaps = 1/41 (2%)

Query  18   IEAYRPPVVKPHPNRPPFPSFPGQGPFNPRPRRSPDNNGQI  58
            IE   P V+   PNRPP   F    P+    RR   N G I
Sbjct  497  IEVNHPEVLLASPNRPPPQPFI-SSPYRASTRRDVRNGGSI  536


>Q384N5_TRYB2 unnamed protein product
Length=270

 Score = 28.1 bits (61),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 13/45 (29%), Positives = 27/45 (60%), Gaps = 0/45 (0%)

Query  51   SPDNNGQISINAKKEGGKTSWNVEAQQKIWENKHGSIHVSGGSNK  95
            S    G+  +NA+K+  +    +E+++K ++N  G+IH S G ++
Sbjct  226  SSTKEGRAKLNAEKKLRELRQLLESREKEYDNLKGTIHASYGRSR  270



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000095-PA

Length=94
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRA_CAEEL  unnamed protein product                                   45.1    1e-06
DDRB_CAEEL  unnamed protein product                                   40.8    4e-05
Q9VM55_DROME  unnamed protein product                                 31.2    0.090


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 45.1 bits (105),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 1/55 (2%)

Query  16  AVVLAVGLLATAVRCIDLAQC-VGPLGMESGAIPDNDITASSSFDSGNVGPHQAR  69
           A+VL      T    + + QC    LGM++G I D+ ITASSSFD  +VGP  AR
Sbjct  4   ALVLLAIYGTTTTNTLRIDQCGENALGMQNGDIADSQITASSSFDKQSVGPQNAR  58


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 40.8 bits (94),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 28/52 (54%), Gaps = 0/52 (0%)

Query  18  VLAVGLLATAVRCIDLAQCVGPLGMESGAIPDNDITASSSFDSGNVGPHQAR  69
           +  V   +  V  ++L +C   LGM +  I D  I+ASSSFD  + GP  AR
Sbjct  7   LFGVTFHSNTVVALELRECSHQLGMSNRKIRDEQISASSSFDLQSTGPQHAR  58


>Q9VM55_DROME unnamed protein product
Length=3557

 Score = 31.2 bits (69),  Expect = 0.090, Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 6/50 (12%)

Query  28    VRCIDLAQC--VGPLGMESGAIPDNDITASS---SFDSGNVGPHQARYGW  72
             + CI   +C  + PLG+ SG IPD+ I A+S   ++++ N+  + A  GW
Sbjct  1290  ITCIREPECKVIKPLGLSSGRIPDSAINATSERPNYEAKNIRLNSAT-GW  1338


 Score = 27.3 bits (59),  Expect = 2.1, Method: Composition-based stats.
 Identities = 12/21 (57%), Positives = 15/21 (71%), Gaps = 0/21 (0%)

Query  37   VGPLGMESGAIPDNDITASSS  57
            VG LG+ +G IPD+ IT S S
Sbjct  832  VGDLGLGNGGIPDDSITTSVS  852



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000096-PA

Length=129
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   87.0    7e-21
DDRA_CAEEL  unnamed protein product                                   86.3    1e-20
Q54P86_DICDI  unnamed protein product                                 29.6    0.74 


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 87.0 bits (214),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 0/77 (0%)

Query  6    PRGSRVRTENQGGAWCPKDQVTDDPRQWLEIDLHTVHLITATGTQGRFGNGVGVEYAESY  65
            P+ +R   E+  GAWCPK+Q+    ++WL+I      +IT+  TQGRF +G G+EYA ++
Sbjct  54   PQHARAHQESGSGAWCPKNQINSLSKEWLQISFSVDTVITSVETQGRFDDGRGMEYATAF  113

Query  66   VLEYWRPRLGKWIRYKD  82
             ++YWRP L  W  YKD
Sbjct  114  KIQYWRPSLNAWASYKD  130


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 86.3 bits (212),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 54/81 (67%), Gaps = 1/81 (1%)

Query  6    PRGSRVRTENQGGAWCPKDQVTDDPRQWLEIDLHTVHLITATGTQGRFGNGVGVEYAESY  65
            P+ +R+ +E   GAWCPK Q+     ++L++ L+   LIT+  TQGR+GNG G E+A  Y
Sbjct  54   PQNARLHSELASGAWCPKPQINSKSYEFLQVTLNDTFLITSVETQGRYGNGTGREFASHY  113

Query  66   VLEYWRPRLGKWIRYKDVKGH  86
            +++Y RP   +WIRYK+  GH
Sbjct  114  MIDYLRPG-SQWIRYKNRTGH  133


>Q54P86_DICDI unnamed protein product
Length=361

 Score = 29.6 bits (65),  Expect = 0.74, Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (46%), Gaps = 5/48 (10%)

Query  55   NGVGVEYAESYVLEYWRPRLGKWIRYKDVKGHNVSAILSTYFLPLVRY  102
            N +   Y ES  LE WRP        +D+  HN    L+ YF P V +
Sbjct  22   NYIDYVYKESIELEVWRPN-----NKRDLMAHNNVVSLAKYFWPHVDF  64



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000097-PA

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRA_CAEEL  unnamed protein product                                   86.7    4e-20
DDRB_CAEEL  unnamed protein product                                   79.3    2e-17
NRX4_DROME  unnamed protein product                                   31.6    0.39 


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 86.7 bits (213),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 75/142 (53%), Gaps = 8/142 (6%)

Query  10   IKGNDNTYLESKHILDPPIWASKIRFLPYDSHMRYVCMRVELYGCLWTDGIVSYSMPQGN  69
            + GN +T      +LDPPI AS+IRF+P   + R VCMR E++GC   +G+  YS     
Sbjct  136  MDGNFDTTTPVIRVLDPPIVASRIRFVPSSKNTRTVCMRAEIHGCKH-EGVTYYSTVPDG  194

Query  70   KRSTDWEFFDAIYDGPW---DGELRRGLGLLTDGRTGPDNFKVGIHAHDRGKGWVGWRND  126
             R    +F D++++      +  ++RGLGLLTDG     +       +     W+GW  D
Sbjct  195  SRLDTLDFKDSMFEDSQIYTESGIKRGLGLLTDGFVAQAS---PFEKNQMNNSWIGWNRD  251

Query  127  TRAGQPVEIKFEFDRVREFSAV  148
            T  G+ + I FEF+ V  F+ V
Sbjct  252  TTDGR-ITILFEFEEVHNFTDV  272


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 79.3 bits (194),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 86/169 (51%), Gaps = 12/169 (7%)

Query  6    IEKVIKGNDNTYLESKHILDPPIWASKIRFLPYDSHMRYVCMRVELYGCLWTDGIVSYSM  65
            +E +   ND  +   +H LD  I A +IR +P  +  R VCMRVE++GC + D +V Y++
Sbjct  134  LETIPANNDTEHAIRRH-LDRAIIARRIRIVPVSNSTRTVCMRVEVFGCPFDDSLVFYNV  192

Query  66   PQGNKRSTDWEFFDAIYDGPWDGE--LRRGLGLLTDGRTGPDNFKVGIHAHDRGKGWVGW  123
             QG+ +S    + D  YDG       L  G+G L DG  G +N  V  H       WVGW
Sbjct  193  DQGDLQS-GISYHDFSYDGNLANSPHLTGGIGKLYDGEVGKNNVFVNHHK------WVGW  245

Query  124  RNDTRAGQPVEIKFEFDRVREFSAVHVVCNNQFNKDIKVRAFPVFHFSI  172
            R   R G  V++ FEF  +R  S + +  +N+F K  K  +     FSI
Sbjct  246  RRK-RNGN-VKLAFEFSELRNISGILIHTSNEFKKSAKAFSSATVLFSI  292


>NRX4_DROME unnamed protein product
Length=1284

 Score = 31.6 bits (70),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query  8    KVIKGNDNTYLESKHILDPPIWASKIRFLPYDSHMRYVCMRVELYGC  54
            ++ KGN +      ++ + PI A  +R  P   H R + MRVELYGC
Sbjct  140  QMFKGNSDGNSIHYNVFEVPIIAQWVRINPTRWHDR-ISMRVELYGC  185



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000098-PA

Length=478
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   52.0    9e-07
DDRA_CAEEL  unnamed protein product                                   43.9    3e-04
GCY5_CAEEL  unnamed protein product                                   32.3    0.99 


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 52.0 bits (123),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 19/151 (13%)

Query  156  FSQMEVLFSIGGKFYSGEPITYNSMEDNVFEHAHNVTVKLHNRVGKFVKLKLHF--SAKW  213
            FS   VLFSI GK +S   + +N+ ED   E    + + ++NR+ K  K++L+F   + W
Sbjct  283  FSSATVLFSINGKDFSDTIVHFNNPEDTESEVPRWIRIPVNNRIAKVAKIRLNFGTDSDW  342

Query  214  IMISEVSFISVVAHGNFSAEELASTESPAQRDVFVEKKGGVPGEPPVSQAKHDDPTYMAV  273
            + ISEV+F S     N +  EL +       DV +            S  +HDD T M  
Sbjct  343  LFISEVNFES-----NHTNIELLND------DVVIPDSVSY-----FSVTEHDDGTSMFA  386

Query  274  VIGILMAVILLLAVAIFLIVSRHRQRKCFAS  304
               I   + L++AV I  ++ R R+ +  AS
Sbjct  387  F-IIFFFMFLIVAVIILTVLYRKREYRVKAS  416


>DDRA_CAEEL unnamed protein product
Length=766

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 80/198 (40%), Gaps = 36/198 (18%)

Query  155  VFSQMEVLFSIGGKFYSGEPITYNSMEDNVFEHAHNVTVKLHNRVGKFVKLKLHFSAKWI  214
            +FSQ    F +  +  S E  + N+         ++  V LHNR G+ V++ + FS+ W+
Sbjct  287  IFSQDGKTFPLFSQISSSERQSLNNTS-----RRYDFRVPLHNRAGRKVRISIKFSSDWM  341

Query  215  MISEVSFISVVAHGNFSAEELASTESPAQRDVFVEKKGGVPGEPPVSQAKHDDPTYMAVV  274
             ++EV F S                  A   +  EK   +P  PP S A       + VV
Sbjct  342  FLTEVHFTSA-----------------ANLTLLSEK---IP--PPSSAATQQ----LLVV  375

Query  275  IGILMAVIL-LLAVAIFLIVSRHRQRKCFASPVNGK-APSHLGSS-TCATVEKGAALMA-  330
             GI+   I   +A  + + + R ++ K   S V      +H+G+  TC        L   
Sbjct  376  CGIIFLTIFACVAYCVSVCLKRRQKNKSVDSNVKKDLIITHMGNKPTCHVFPSNGKLSNG  435

Query  331  -YTLEDDERYAGGSLPTL  347
             Y + +D  YA     TL
Sbjct  436  HYEVANDILYARSQKSTL  453


>GCY5_CAEEL unnamed protein product
Length=1122

 Score = 32.3 bits (72),  Expect = 0.99, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (52%), Gaps = 5/62 (8%)

Query  177  YNSMEDNVFEHAHNVTVKL--HNRVGKFVKLKL---HFSAKWIMISEVSFISVVAHGNFS  231
            ++SM+ N  E    V ++   H+ + KF+ L +    F A W M S  S   ++A GNFS
Sbjct  586  HHSMQMNKEEKEKFVKLRKLEHDNLNKFIGLSIDGPQFVAVWKMCSRGSLQDIIARGNFS  645

Query  232  AE  233
             +
Sbjct  646  MD  647



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000099-PA

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6NR10_DROME  unnamed protein product                                 468     1e-156
Q9VY08_DROME  unnamed protein product                                 468     1e-156
Q9VY02_DROME  unnamed protein product                                 412     3e-136


>Q6NR10_DROME unnamed protein product
Length=703

 Score = 468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 250/578 (43%), Positives = 364/578 (63%), Gaps = 15/578 (3%)

Query  67   EYDFIVVGAGSAGAVVASRLSEVKNITVLLIEAGTKEYPLMDIPALARLLQRSDQINWRY  126
            EYDFIVVG+GSAGAVVA+RLSEV+   VLLIEAG  E  + D+P+LA  LQ S +++W Y
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLS-KLDWAY  114

Query  127  ESESSDKYCKGSTDSKCYFPRGRVMGGSSILNFMVATRGNKNNYDEWAASSGDESWSYEN  186
            ++E S K C G  +++C +PRGRV+GGSS+LN+M+  RGN+++YD WA S G+  W Y+N
Sbjct  115  KTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWA-SLGNPGWDYDN  173

Query  187  MLKYFKKLEDYQVRGVDFDRKVHNKGGPVHITSAPYTTLLADTFVKAGEESGYSEVDYNG  246
            +L+YFKK ED +   +  + K H +GG + +  +P+ + L   FV+AG + GY   D NG
Sbjct  174  VLRYFKKSEDNRNPYLA-NNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDING  232

Query  247  DSQIGYSYFQNTVVNGERWSSNRAYLHPAKNRTNLFLTRDSFVSKVIIDGKSKKATGVSF  306
              Q G+   Q T+  G R S+ +A+L P + R N  L+ +S V++VII+  + +A  V F
Sbjct  233  AKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEF  292

Query  307  SKKGRRILVKARKEIILSAGAINSPQILMLSGIGPKKHLQSLGIKVLKNSPVGSNLMDHV  366
             K G+   + AR+E+I+SAGAIN+PQ++MLSG+GP+KHL+  GI+VL++ PVG N+ DHV
Sbjct  293  VKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHV  352

Query  367  IYGGLVFKTNISFDSMESDVLSRKN-SAIN-DYITKRNGSLAVGMGFEALAFLNVDRPNS  424
              GGL F      D   + V  R N +A+   Y+ +  G +    G E LAF++    N 
Sbjct  353  GMGGLTFLV----DKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNR  408

Query  425  LHENPNVEFLFGPNTGLKD--PSFGYDLGLSEFYIDQISLNNTSHAHWNVILSLLQPKSR  482
              + P+++F   P +   D        LGL E    ++     +   W ++  LL+P+SR
Sbjct  409  SLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSR  468

Query  483  GKLLLKSKNPRDKPKVYPNYFDDPEDVRVMIKGIKEAIKLSKTKEFEKYDSQMYHMPI--  540
            G + L+S NP   P +  NYFDDP D + +++G K A+++++ + F+++ S+++  P+  
Sbjct  469  GSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPN  528

Query  541  CKDKTYDSDDYWECALRIFSATCHHQSGTCKMGDGGDDTAVVNSRLKVIGVEGLRVADAS  600
            CK   + SD Y EC +R  S T +H  GT KMG   D  AVV+ RL+V GV GLRV DAS
Sbjct  529  CKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDAS  588

Query  601  IMPNIVSGHTNIPTIAIAEKLSDMVKEDWGYLTPPSEK  638
            IMP I SG+TN P I IAEK +D++KEDW  LT P  K
Sbjct  589  IMPTISSGNTNAPVIMIAEKGADLIKEDW--LTNPEYK  624


>Q9VY08_DROME unnamed protein product
Length=703

 Score = 468 bits (1203),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 250/578 (43%), Positives = 364/578 (63%), Gaps = 15/578 (3%)

Query  67   EYDFIVVGAGSAGAVVASRLSEVKNITVLLIEAGTKEYPLMDIPALARLLQRSDQINWRY  126
            EYDFIVVG+GSAGAVVA+RLSEV+   VLLIEAG  E  + D+P+LA  LQ S +++W Y
Sbjct  56   EYDFIVVGSGSAGAVVANRLSEVRKWKVLLIEAGPDENEISDVPSLAAYLQLS-KLDWAY  114

Query  127  ESESSDKYCKGSTDSKCYFPRGRVMGGSSILNFMVATRGNKNNYDEWAASSGDESWSYEN  186
            ++E S K C G  +++C +PRGRV+GGSS+LN+M+  RGN+++YD WA S G+  W Y+N
Sbjct  115  KTEPSTKACLGMQNNRCNWPRGRVLGGSSVLNYMLYVRGNRHDYDHWA-SLGNPGWDYDN  173

Query  187  MLKYFKKLEDYQVRGVDFDRKVHNKGGPVHITSAPYTTLLADTFVKAGEESGYSEVDYNG  246
            +L+YFKK ED +   +  + K H +GG + +  +P+ + L   FV+AG + GY   D NG
Sbjct  174  VLRYFKKSEDNRNPYLA-NNKYHGRGGLLTVQESPWHSPLVAAFVEAGTQLGYDNRDING  232

Query  247  DSQIGYSYFQNTVVNGERWSSNRAYLHPAKNRTNLFLTRDSFVSKVIIDGKSKKATGVSF  306
              Q G+   Q T+  G R S+ +A+L P + R N  L+ +S V++VII+  + +A  V F
Sbjct  233  AKQAGFMIAQGTIRRGSRCSTAKAFLRPIRMRKNFHLSMNSHVTRVIIEPGTMRAQAVEF  292

Query  307  SKKGRRILVKARKEIILSAGAINSPQILMLSGIGPKKHLQSLGIKVLKNSPVGSNLMDHV  366
             K G+   + AR+E+I+SAGAIN+PQ++MLSG+GP+KHL+  GI+VL++ PVG N+ DHV
Sbjct  293  VKHGKVYRIAARREVIISAGAINTPQLMMLSGLGPRKHLEKHGIRVLQDLPVGENMQDHV  352

Query  367  IYGGLVFKTNISFDSMESDVLSRKN-SAIN-DYITKRNGSLAVGMGFEALAFLNVDRPNS  424
              GGL F      D   + V  R N +A+   Y+ +  G +    G E LAF++    N 
Sbjct  353  GMGGLTFLV----DKPVAIVQDRFNPTAVTFQYVLRERGPMTTLGGVEGLAFVHTPYSNR  408

Query  425  LHENPNVEFLFGPNTGLKD--PSFGYDLGLSEFYIDQISLNNTSHAHWNVILSLLQPKSR  482
              + P+++F   P +   D        LGL E    ++     +   W ++  LL+P+SR
Sbjct  409  SLDWPDIQFHMAPASINSDNGARVKKVLGLKESVYQEVYHPIANKDSWTIMPLLLRPRSR  468

Query  483  GKLLLKSKNPRDKPKVYPNYFDDPEDVRVMIKGIKEAIKLSKTKEFEKYDSQMYHMPI--  540
            G + L+S NP   P +  NYFDDP D + +++G K A+++++ + F+++ S+++  P+  
Sbjct  469  GSVKLRSANPFHYPLINANYFDDPLDAKTLVEGAKIALRVAEAQVFKQFGSRLWRKPLPN  528

Query  541  CKDKTYDSDDYWECALRIFSATCHHQSGTCKMGDGGDDTAVVNSRLKVIGVEGLRVADAS  600
            CK   + SD Y EC +R  S T +H  GT KMG   D  AVV+ RL+V GV GLRV DAS
Sbjct  529  CKQHKFLSDAYLECHVRTISMTIYHPCGTAKMGPAWDPEAVVDPRLRVYGVRGLRVIDAS  588

Query  601  IMPNIVSGHTNIPTIAIAEKLSDMVKEDWGYLTPPSEK  638
            IMP I SG+TN P I IAEK +D++KEDW  LT P  K
Sbjct  589  IMPTISSGNTNAPVIMIAEKGADLIKEDW--LTNPEYK  624


>Q9VY02_DROME unnamed protein product
Length=633

 Score = 412 bits (1060),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 222/583 (38%), Positives = 349/583 (60%), Gaps = 36/583 (6%)

Query  68   YDFIVVGAGSAGAVVASRLSEVKNITVLLIEAGTKEYPLMDIPALARLLQRSDQINWRYE  127
            YDFIV+G GSAG V+A+RLSE    +VLL+EAG  E  L+D+P L  + QRS   +W+Y 
Sbjct  57   YDFIVIGGGSAGCVLAARLSENPEWSVLLLEAGGDEPLLIDLPQLYPVFQRSPW-DWKYL  115

Query  128  SESSDKYCKGSTDSKCYFPRGRVMGGSSILNFMVATRGNKNNYDEWAASSGDESWSYENM  187
            +E SD+YC    D +C++PR +V+GG S +N M+  RGN+ +YD+WAA  G+  W+Y+N+
Sbjct  116  TEPSDRYCLAMEDQRCFWPRAKVLGGCSSINAMMYIRGNRRDYDQWAAL-GNPGWNYDNI  174

Query  188  LKYFKKLEDYQVRGVDFDRKVHNKGGPVHITSAPYTTLLADTFVKAGEESG--YSEVDYN  245
            L YF+KLED +V G +     H  GGP+ +    + + L D F++A ++ G  + + D+N
Sbjct  175  LHYFRKLEDMRVPGFEHS-PYHGHGGPISVERYRFPSPLLDIFMRAAQQLGMVHPDGDFN  233

Query  246  GDSQIGYSYFQNTVVNGERWSSNRAYLHPAKNRTNLFLTRDSFVSKVIIDGKSKKATGVS  305
            G SQ G++    ++ +G R S+N+ Y+  +  R NL +   +FV +++ID +S +A GV 
Sbjct  234  GRSQTGFAPPHGSLRDGLRCSANKGYIRRSWQRPNLDIVLKAFVERIVIDPQSHRAIGVI  293

Query  306  FSKKGRRILVKARKEIILSAGAINSPQILMLSGIGPKKHLQSLGIKVLKNSP-VGSNLMD  364
            F     +  V+A++E+ILSAG++ SPQ+LM+SG+GP+  L+  GI V+++ P VG NL D
Sbjct  294  FEYGLLKHTVRAKREVILSAGSLASPQLLMVSGVGPRDQLEPQGIPVVQHLPGVGGNLQD  353

Query  365  HVIYGGLVFKTNISFDSMESDVLS------RKNSAINDYITKRNGSLAVGMGFEALAFLN  418
            H+   G ++    +FDS ++  LS          A+ D++   +         E + F +
Sbjct  354  HISTSGAIY----TFDSGQNRHLSFIVPEMMNEQAVEDFVQGSDSFFYAMPVSEVMGFFS  409

Query  419  VDRPNSLHENPNVEFLFGPNTGLKDPSFGY--DLGLSEFYIDQISLNNTSHAHWNVILS-  475
                +   + P+V+   G        S+GY  D G+       I+L+N + A   V+   
Sbjct  410  TRYQDPRLDWPDVQIFMG--------SYGYGADGGMIGRRGAAITLDNYAEAFEPVLYQD  461

Query  476  -------LLQPKSRGKLLLKSKNPRDKPKVYPNYFDDPEDVRVMIKGIKEAIKLSKTKEF  528
                   L++P+SRG L L+S +P+  P ++ NY+DDP D+ VM++G+K A +L++T   
Sbjct  462  SFVIAPLLMRPRSRGYLQLRSADPKVHPLIHANYYDDPHDMAVMVEGLKLAHRLTQTPVM  521

Query  529  EKYDSQM--YHMPICKDKTYDSDDYWECALRIFSATCHHQSGTCKMGDGGDDTAVVNSRL  586
            +  ++ M  Y    C +  Y SD +WEC  R +S T +H  GTCKM    D   VV+ RL
Sbjct  522  QSLNATMNIYEWRNCPEVEYLSDAFWECLARFYSQTIYHPVGTCKMAPASDPAGVVDPRL  581

Query  587  KVIGVEGLRVADASIMPNIVSGHTNIPTIAIAEKLSDMVKEDW  629
            +V G+ GLRV DASIMP I +G+TN PT+ +AE+ +D++KEDW
Sbjct  582  RVRGMRGLRVIDASIMPTIPTGNTNAPTLMLAERGADIIKEDW  624



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000100-PA

Length=123
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABL_DROME  unnamed protein product                                    83.2    1e-19
ROR2_DROME  unnamed protein product                                   78.2    7e-18
ROR1_DROME  unnamed protein product                                   74.7    1e-16


>ABL_DROME unnamed protein product
Length=1620

 Score = 83.2 bits (204),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 11/100 (11%)

Query  11   DFQRDVRILAALEDRNIARVLGACCREEPYCVVMEYLEHGDLCQFLKSHVTAEDAHSMPI  70
            DF  +  I+  ++  N+ +++G C RE P+ ++ E++ HG+L  FL+S            
Sbjct  411  DFLEEAAIMKEMKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRS-----------A  459

Query  71   GVKTLSFNCLIYMAAQIASGMRYLENLNFVHRDLATSTIL  110
            G +TL    L+YMA QIASGM YLE+ N++HRDLA    L
Sbjct  460  GRETLDAVALLYMATQIASGMSYLESRNYIHRDLAARNCL  499


>ROR2_DROME unnamed protein product
Length=724

 Score = 78.2 bits (191),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 65/110 (59%), Gaps = 4/110 (4%)

Query  3    EANEKEKLDFQRDVRILAALEDRNIARVLGACCREEPYCVVMEYLEHGDLCQFLKSHVTA  62
            +A+++ ++DF+R+  +LA  +  NI R+LG C    P C++ EY+  GDL +FL++  + 
Sbjct  480  DASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRA-CSP  538

Query  63   EDAHSMPIGVKTLSFN--CLIYMAAQIASGMRYLENLNFVHRDLATSTIL  110
               H  P   + L  N   L+ MAA IA+GM YL    FVHRDLAT   L
Sbjct  539  YATHQAPTQDR-LQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCL  587


>ROR1_DROME unnamed protein product
Length=685

 Score = 74.7 bits (182),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 65/107 (61%), Gaps = 8/107 (7%)

Query  4    ANEKEKLDFQRDVRILAALEDRNIARVLGACCREEPYCVVMEYLEHGDLCQFLKSHVTAE  63
            A+ K + DF+R++ +++ L+ +NI  +LG    +EPYC++ EY+ +GDL +FL S+   E
Sbjct  448  ASVKTQQDFKREIELISDLKHQNIVCILGVVLNKEPYCMLFEYMANGDLHEFLISNSPTE  507

Query  64   DAHSMPIGVKTLSFNCLIYMAAQIASGMRYLENLNFVHRDLATSTIL  110
                     K+LS    + +A QI+ GM+YL   ++VHRDLA    L
Sbjct  508  G--------KSLSQLEFLQIALQISEGMQYLSAHHYVHRDLAARNCL  546



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000101-PA

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDRB_CAEEL  unnamed protein product                                   111     1e-28
ROR1_DROME  unnamed protein product                                   103     5e-26
7LESS_DROME  unnamed protein product                                  93.2    3e-22


>DDRB_CAEEL unnamed protein product
Length=797

 Score = 111 bits (277),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 86/165 (52%), Gaps = 30/165 (18%)

Query  1    LVGMAYHVKISDFGTDNELYACDYYKVDGGMTLPVRWMAWESLVLGKYTTKSDVWSFAVT  60
            LV    +VKI+DFG    LY+ +YYKV+G   LP+RWMAWE+L+LGK++T SDVW F VT
Sbjct  652  LVDGEGNVKIADFGMARSLYSQEYYKVEGKFVLPIRWMAWEALLLGKFSTASDVWGFGVT  711

Query  61   LWEILNLGRRVPHEHLSDQEVVDRLRKLCRDCSACSDDASQIKSSEEEDNDDDDEEEEED  120
            +WEI +L    P+  ++D +VV+ L+ +    S                           
Sbjct  712  MWEIFSLCSEKPYSDMTDDDVVENLQSMSSTGSL-------------------------K  746

Query  121  KVTSRFEHLPKPLASSKDIYDLMLECWRRDESERPTFREISLFLQ  165
            +V SR    P  L + +     +L CW  + S RP+F  + L LQ
Sbjct  747  QVLSRPRMCPSKLYNEQ-----ILPCWNYESSRRPSFENVHLHLQ  786


>ROR1_DROME unnamed protein product
Length=685

 Score = 103 bits (258),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 83/161 (52%), Gaps = 39/161 (24%)

Query  1    LVGMAYHVKISDFGTDNELYACDYYKVDGGMTLPVRWMAWESLVLGKYTTKSDVWSFAVT  60
            LV     VKISDFG   ++Y+ DYY+V     LPVRWM  ES++ GK+TT+SDVWSF V 
Sbjct  546  LVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFGVV  605

Query  61   LWEILNLGRRVPHEHLSDQEVVDRLRKLCRDCSACSDDASQIKSSEEEDNDDDDEEEEED  120
            LWEI + G + P+   S+QEV++ +R            + Q+ S+ E             
Sbjct  606  LWEIYSYGMQ-PYYGFSNQEVINLIR------------SRQLLSAPENC-----------  641

Query  121  KVTSRFEHLPKPLASSKDIYDLMLECWRRDESERPTFREIS  161
                       P A    +Y LM+ECW     +RPTF +IS
Sbjct  642  -----------PTA----VYSLMIECWHEQSVKRPTFTDIS  667


>7LESS_DROME unnamed protein product
Length=2554

 Score = 93.2 bits (230),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/151 (36%), Positives = 77/151 (51%), Gaps = 39/151 (26%)

Query  8     VKISDFGTDNELYACDYYKVDGGMTLPVRWMAWESLVLGKYTTKSDVWSFAVTLWEILNL  67
             VKI DFG   ++Y  DYY+ +G   LPVRWM+ ESLV G +TT+SDVW+F V  WEIL L
Sbjct  2364  VKIGDFGLARDIYKSDYYRKEGEGLLPVRWMSPESLVDGLFTTQSDVWAFGVLCWEILTL  2423

Query  68    GRRVPHEHLSDQEVVDRLRKLCRDCSACSDDASQIKSSEEEDNDDDDEEEEEDKVTSRFE  127
             G++ P+   ++ EV+  +++  R                                     
Sbjct  2424  GQQ-PYAARNNFEVLAHVKEGGR-------------------------------------  2445

Query  128   HLPKPLASSKDIYDLMLECWRRDESERPTFR  158
              L +P   ++ +Y L+L CWR D  ERP+FR
Sbjct  2446  -LQQPPMCTEKLYSLLLLCWRTDPWERPSFR  2475



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000102-PA

Length=494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TTN1_CAEEL  unnamed protein product                                   30.8    3.6  


>TTN1_CAEEL unnamed protein product
Length=18562

 Score = 30.8 bits (68),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 49/171 (29%), Positives = 84/171 (49%), Gaps = 10/171 (6%)

Query  161   PQPFQNKP--QPFQNKPQPFQNKPQLYQSQPAPVRSTTEGIPSLFSPQPLPLFDPET-IE  217
             P P  N P  +P   K  P ++K      Q A V      +P   +P   P  +    +E
Sbjct  6913  PVPEANAPTFEPTVEKLAPVESKETSEVQQAAIVEQKDVPVPEANAPTVEPTVEKLAPVE  6972

Query  218   KRRASLQSVNNKANKPSKESKDDKNQCVQNDEQKQDQNSAK-KQELDSKSDLAVKQEDKD  276
              +  S++S   +A+   K+ KDDK++  + D + Q +N  K KQE D+K    +K+E+ D
Sbjct  6973  SKETSVESKETQADAKLKKEKDDKHKQ-EADAKLQKENDDKLKQEADAK----LKKENDD  7027

Query  277   QPDQNA-ANEELDVDEYLQKERETKKQIDDIIKVAQALREKLDREKGMKLQ  326
             +  Q A A  + + D+ L++E + K + ++  K+ Q    KL +E   KL+
Sbjct  7028  KLKQEADAKLKKENDDKLKQEADAKLKKENDDKLKQEAAAKLKKENDDKLK  7078



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000103-PA

Length=422
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RUMI_DROME  unnamed protein product                                   419     3e-145
Q95RJ1_DROME  unnamed protein product                                 29.6    5.2   
A1Z7L5_DROME  unnamed protein product                                 29.3    6.2   


>RUMI_DROME unnamed protein product
Length=411

 Score = 419 bits (1078),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 197/357 (55%), Positives = 250/357 (70%), Gaps = 7/357 (2%)

Query  71   KLLATIEAAEANYVEC----EGKKCNCFAEVITRDLKIF-AGGIERKLIEAARPRGTFYQ  125
            K+   IE A A+Y  C    +   C+C A V+ RDL  + + G+ R++IE++   GT Y+
Sbjct  49   KIRRQIEKANADYKPCSSDPQDSDCSCHANVLKRDLAPYKSTGVTRQMIESSARYGTKYK  108

Query  126  IINGELYREKNCMFPSRCAGVEHFLSKLSANTSDVSLVINVRDYPQSSKHFGEPL--PVF  183
            I    LYR+ NCMFP+RC G+EHFL  L A   D+ L+IN RDYPQ +  +G     PVF
Sbjct  109  IYGHRLYRDANCMFPARCEGIEHFLLPLVATLPDMDLIINTRDYPQLNAAWGNAAGGPVF  168

Query  184  SFSKTPQYYDIMYPAWAFWEGGPAISLYPRGLGRWDLHRKSLKEAGERVPWEDKETRAFF  243
            SFSKT +Y DIMYPAW FW GGPA  L+PRG+GRWD  R+ L++    +PW  K +  FF
Sbjct  169  SFSKTKEYRDIMYPAWTFWAGGPATKLHPRGIGRWDQMREKLEKRAAAIPWSQKRSLGFF  228

Query  244  RGSRTSSERDNLVLLSRDKPHLVDAQYTKNQAWKSEKDTLHMPPAVEASLESHCSYKYLF  303
            RGSRTS ERD+L+LLSR  P LV+AQYTKNQ WKS KDTL  P A E S E HC YKYLF
Sbjct  229  RGSRTSDERDSLILLSRRNPELVEAQYTKNQGWKSPKDTLDAPAADEVSFEDHCKYKYLF  288

Query  304  NYRGVAASFRHKHLFLCGSLVFHVGDEWTEFYYDAMKPWIHYVPVPRDASQQQIEELIQF  363
            N+RGVAASFR KHLFLC SLVFHVGDEW EF+YD +KPW+HYVP+    SQQ+ E ++ F
Sbjct  289  NFRGVAASFRLKHLFLCKSLVFHVGDEWQEFFYDQLKPWVHYVPLKSYPSQQEYEHILSF  348

Query  364  AKDNDAIAKRIAERGRDFVWRRLKLSDVTCFWKKLVRRYSKLFKYKPALEENLIKIS  420
             K NDA+A+ IA+RG DF+W  L++ D+ C+W+KL++RY KL +Y+   E+ LI I 
Sbjct  349  FKKNDALAQEIAQRGYDFIWEHLRMKDIKCYWRKLLKRYVKLLQYEVKPEDQLIYIG  405


>Q95RJ1_DROME unnamed protein product
Length=317

 Score = 29.6 bits (65),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (48%), Gaps = 15/90 (17%)

Query  259  SRDKPHLVDAQYTKNQAWKSEKDTLHMPPAVEASLESHCSYK---YLFNYRGVAASFRHK  315
            ++ K H+   +   +Q+W+ + +   +P  V+AS+    S K     F+     A+ + +
Sbjct  212  TKAKEHVAHLKGATSQSWQGKAEIPLLPACVKASVRMSPSIKSKGSPFSSPPKKATTQPQ  271

Query  316  HLFLCGSLVFHVGDEWTEFYYDAMKPWIHY  345
                 G+ V H G       +DA++PW+H+
Sbjct  272  -----GADVVHTG-------HDALQPWLHH  289


>A1Z7L5_DROME unnamed protein product
Length=293

 Score = 29.3 bits (64),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 43/90 (48%), Gaps = 15/90 (17%)

Query  259  SRDKPHLVDAQYTKNQAWKSEKDTLHMPPAVEASLESHCSYK---YLFNYRGVAASFRHK  315
            ++ K H+   +   +Q+W+ + +   +P  V+AS+    S K     F+     A+ + +
Sbjct  188  TKAKEHVAHLKGATSQSWQGKAEIPLLPACVKASVRMSPSIKSKGSPFSSPPKKATTQPQ  247

Query  316  HLFLCGSLVFHVGDEWTEFYYDAMKPWIHY  345
                 G+ V H G       +DA++PW+H+
Sbjct  248  -----GADVVHTG-------HDALQPWLHH  265



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000104-PA

Length=361
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38E96_TRYB2  unnamed protein product                                 30.4    3.1  
SYVC_DICDI  unnamed protein product                                   29.6    5.1  
MYOC_DICDI  unnamed protein product                                   28.9    9.1  


>Q38E96_TRYB2 unnamed protein product
Length=1053

 Score = 30.4 bits (67),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 28/98 (29%), Positives = 45/98 (46%), Gaps = 13/98 (13%)

Query  49   KKDRDLGKDELWMGKESAACSDANVDRVRQMIREDQRLSVKELGDE-----------VGI  97
            +KD +  K +L + +  +  S A V +VRQ +RE   L   +LGD              I
Sbjct  454  QKDLNRSKLKLTISRLGSGISPAPVTQVRQSLREI--LEAPDLGDTDHEYMRYFNAYENI  511

Query  98   ASEACQSILTVNLGMRRVAARLVPRFLSDDQRSRRYEV  135
                 +S  T N+ + R+A   + RFL+D    R++ V
Sbjct  512  IGVILESRRTNNMSVLRLAHEALLRFLADKNEGRKHIV  549


>SYVC_DICDI unnamed protein product
Length=1072

 Score = 29.6 bits (65),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 0/37 (0%)

Query  74    DRVRQMIREDQRLSVKELGDEVGIASEACQSILTVNL  110
             D+V Q IR+D    +K L +E+ I ++  +S   +N+
Sbjct  1036  DKVPQNIRDDNTQKIKALDEEINITNKTIESFTKLNI  1072


>MYOC_DICDI unnamed protein product
Length=1182

 Score = 28.9 bits (63),  Expect = 9.1, Method: Compositional matrix adjust.
 Identities = 15/47 (32%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query  288  PDLLPCDFFLFPKIKAF-LKGKAFEEPAAMKRSTTAYLQSIAPQDFQ  333
            PD++  D    P    F +K +A E  A + +ST  Y+++I P D +
Sbjct  549  PDVIDTDSKKLPSTAGFKIKSQAAELVATLMKSTPHYIRTIKPNDLK  595



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000105-PA

Length=82
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDFR_DROME  unnamed protein product                                   63.2    3e-13
A1Z9Q8_DROME  unnamed protein product                                 34.3    0.006
Q4V3E9_DROME  unnamed protein product                                 33.9    0.006


>PDFR_DROME unnamed protein product
Length=669

 Score = 63.2 bits (152),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 3/62 (5%)

Query  22   ANFSGTNSSNMECEALHRDFVIPDDEIWCNWTFDSILCWPPTKASTMSRLRCP-QLNGVD  80
            A+ + TN  N  C AL  ++ +P   ++CNWT+D++LCWPPT A  ++R+ CP   +GVD
Sbjct  121  ASAAATNFEN--CSALFVNYTLPQTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVD  178

Query  81   TR  82
            TR
Sbjct  179  TR  180


>A1Z9Q8_DROME unnamed protein product
Length=504

 Score = 34.3 bits (77),  Expect = 0.006, Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 1/36 (3%)

Query  45  DDEIWCNWTFDSILCWPPTKASTMSRLRC-PQLNGV  79
           +D   C   FDSILCWP T   T++ L+C  +L G+
Sbjct  48  NDSGHCLTQFDSILCWPRTARGTLAVLQCMDELQGI  83


>Q4V3E9_DROME unnamed protein product
Length=475

 Score = 33.9 bits (76),  Expect = 0.006, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 17/24 (71%), Gaps = 0/24 (0%)

Query  50   CNWTFDSILCWPPTKASTMSRLRC  73
            C  +FDS+LCWP T A +++ L C
Sbjct  84   CPSSFDSVLCWPRTNAGSLAVLPC  107



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000106-PA

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PDFR_DROME  unnamed protein product                                   328     5e-105
E2QCM9_DROME  unnamed protein product                                 127     1e-31 
Q4V3E9_DROME  unnamed protein product                                 123     4e-30 


>PDFR_DROME unnamed protein product
Length=669

 Score = 328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 185/369 (50%), Positives = 230/369 (62%), Gaps = 53/369 (14%)

Query  12   FVEKRCGENGSWEGK--VGELSPPSGWTNYTPCFTPEMMLLLQKLYTGSEDLANVHPRVA  69
            F  ++C  +G W  +    E++PP GWT+Y PC+ PE++ L+Q++  GS+D         
Sbjct  182  FAIRKCELDGRWGSRPNATEVNPP-GWTDYGPCYKPEIIRLMQQM--GSKDF--------  230

Query  70   DSRNVNLRNNTCRGTRFEYPSYNIPTYMRTKYAGARIDIAAKTRYLEFVGLTLSLTALLV  129
                                              A IDIA +TR LE VGL LSL AL+V
Sbjct  231  ---------------------------------DAYIDIARRTRTLEIVGLCLSLFALIV  257

Query  130  SLSIFCRFRTLRNTRTRIHKNLFVAMMVQVVIKLTLYIDQALSNMNAYDQQYS---IQNT  186
            SL IFC FR+LRN RT+IHKNLFVAM++QV+I+LTLY+DQ            S   I+NT
Sbjct  258  SLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENT  317

Query  187  PILCEGFYVLLEYARTAMFTWMFIEGFFLHNKVTVAVFTETSGYQMYRVIGWGYPIFMTA  246
            P LCE  YVLLEYARTAMF WMFIEG +LHN VTVAVF  +   + +  +GW  PI MT 
Sbjct  318  PYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTT  377

Query  247  GWTVVTAIYYHPS--KCWWGYNLTFYFWILEGTRLAMILFNCGFLLNILRVLIIKLRRSH  304
             W   T +Y   S  +C W YNLT Y+WILEG RLA+IL N  FL+NI+RVL++KLR+S 
Sbjct  378  VWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQ  437

Query  305  MTETEQIIKAVKAVLVLLPLLGITNLAAMSEAPLDKSILQFALWSYITHFLTSFQGLFIA  364
             ++ EQ  KAV+A +VLLPLLGITNL     APL K+   FA+WSY THFLTSFQG FIA
Sbjct  438  ASDIEQTRKAVRAAIVLLPLLGITNL-LHQLAPL-KTATNFAVWSYGTHFLTSFQGFFIA  495

Query  365  FLYCFSNNE  373
             +YCF N E
Sbjct  496  LIYCFLNGE  504


>E2QCM9_DROME unnamed protein product
Length=476

 Score = 127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 102/327 (31%), Positives = 150/327 (46%), Gaps = 42/327 (13%)

Query  119  GLTLSLTALLVSLSIFCRFRTLRNTRTRIHKNLFVAMMVQVVI-KLTLYIDQALSNMNAY  177
            G  LS   L+V+L IF  F+ LR  R  IH NLF+  +   ++  LTL++          
Sbjct  168  GYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFL----------  217

Query  178  DQQYSIQNTPILCEGFYVLLEYARTAMFTWMFIEGFFLHNKVTVAVFTETSGYQMYRVIG  237
             Q  + +++   C    ++ +Y     F WMF+EG +L+  V     ++   + +Y +IG
Sbjct  218  -QVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIG  276

Query  238  WGYPIFMTAGWTVVTAIYYHPS---------KCWWGYNLTFYFWILEGTRLAMILFNCGF  288
            WG P      W++  A   H            C W    +   WI +      +L N  F
Sbjct  277  WGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRE-SHIDWIFKVPASLALLVNLVF  335

Query  289  LLNILRVLIIKLRRSHMTETEQIIKAVKAVLVLLPLLGITNLAAMS--EAPLDKSILQFA  346
            L+ I+ VLI KLR +H  ET Q  KA KA+LVL+PL GIT L  ++  E  + ++     
Sbjct  336  LIRIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLLVLTGPEQGISRN-----  390

Query  347  LWSYITHFLTSFQGLFIAFLYCFSNNEEFASKIH-------KKKIHTQTL---HSAQRCT  396
            L+  I  FL S QG F+A  YCF N+E   +  H        + IH  +     S + C 
Sbjct  391  LFEAIRAFLISTQGFFVALFYCFLNSEVRQTLRHGFTRWRESRNIHRNSSIKNRSTEECV  450

Query  397  QLLWRPIPTTRY--LCDYRCVGVIDLV  421
              L RP P TR   L  Y  + + D V
Sbjct  451  ICL-RPSPHTRLGSLQRYHSIDITDFV  476


>Q4V3E9_DROME unnamed protein product
Length=475

 Score = 123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 87/267 (33%), Positives = 129/267 (48%), Gaps = 29/267 (11%)

Query  119  GLTLSLTALLVSLSIFCRFRTLRNTRTRIHKNLFVAMMVQVVI-KLTLYIDQALSNMNAY  177
            G  LS   L+V+L IF  F+ LR  R  IH NLF+  +   ++  LTL++          
Sbjct  168  GYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFL----------  217

Query  178  DQQYSIQNTPILCEGFYVLLEYARTAMFTWMFIEGFFLHNKVTVAVFTETSGYQMYRVIG  237
             Q  + +++   C    ++ +Y     F WMF+EG +L+  V     ++   + +Y +IG
Sbjct  218  -QVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIG  276

Query  238  WGYPIFMTAGWTVVTAIYYHPS---------KCWWGYNLTFYFWILEGTRLAMILFNCGF  288
            WG P      W++  A   H            C W    +   WI +      +L N  F
Sbjct  277  WGCPAVCILVWSIAKAFAPHLENEHFNGLEIDCAWMRE-SHIDWIFKVPASLALLVNLVF  335

Query  289  LLNILRVLIIKLRRSHMTETEQIIKAVKAVLVLLPLLGITNLAAMS--EAPLDKSILQFA  346
            L+ I+ VLI KLR +H  ET Q  KA KA+LVL+PL GIT L  ++  E  + ++     
Sbjct  336  LIRIMWVLITKLRSAHTLETRQYYKASKALLVLIPLFGITYLLVLTGPEQGISRN-----  390

Query  347  LWSYITHFLTSFQGLFIAFLYCFSNNE  373
            L+  I  FL S QG F+A  YCF N+E
Sbjct  391  LFEAIRAFLISTQGFFVALFYCFLNSE  417



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000107-PA

Length=353
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W0H8_DROME  unnamed protein product                                 94.0    1e-21
Q8IRH7_DROME  unnamed protein product                                 80.1    1e-17
O96051_DROME  unnamed protein product                                 79.7    2e-17


>Q9W0H8_DROME unnamed protein product
Length=329

 Score = 94.0 bits (232),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 124/265 (47%), Gaps = 13/265 (5%)

Query  91   EDSRKLLETIFWKADTDKDDFLDIRELAKWIHAKIIDHIDRSMRDNIGLFTSIDSNPRNG  150
            E+SR+ L  I  + D +KD  + + EL  WI         R + +++G       NP N 
Sbjct  75   EESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQR----RYIEEDVGRVWK-QHNPDNN  129

Query  151  E-ISWDEYHAHFLRSNGLSEDYIDSYNERHLELSRSQKEAVVRDRARWSEAARNDPDKLT  209
            E ISWD Y        G  +D      E+  E   S K  + RDR RWS A ++  D LT
Sbjct  130  ETISWDSY---MQTVYGFMDDLSPDEKEQE-ENGVSYKSLLKRDRYRWSVADQDLDDNLT  185

Query  210  LDEFLAFTHPESSHRALLQMVEDLFDKFDRDGDEQLTEDEFSDLPSEGVNVEPSVSMPVR  269
             DEF AF HPE        ++ +     D+D D +++ DE+          E      V 
Sbjct  186  KDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVA  245

Query  270  QERRQEFRHLIDKNKNGKADRSELLAYIDPRNPRHAIQEANHLIELSDVNHDGKLQLSEV  329
             ER + F    D +K+G  +  E+  +I P +  H+  EA HL+  +D +HD KL   E+
Sbjct  246  NER-EAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEI  304

Query  330  LSKTDLFLGSKMVDTEGSF--HDEF  352
            L K D+F+GS+  D   +   HDEF
Sbjct  305  LDKYDVFVGSQATDFGEALARHDEF  329


>Q8IRH7_DROME unnamed protein product
Length=192

 Score = 80.1 bits (196),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 85/170 (50%), Gaps = 3/170 (2%)

Query  185  SQKEAVVRDRARWSEAARNDPDKLTLDEFLAFTHPESSHRALLQMVEDLFDKFDRDGDEQ  244
            S K  + RDR RWS A ++  D LT DEF AF HPE        ++ +     D+D D +
Sbjct  24   SYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGK  83

Query  245  LTEDEFSDLPSEGVNVEPSVSMPVRQERRQEFRHLIDKNKNGKADRSELLAYIDPRNPRH  304
            ++ DE+          E      V  ER + F    D +K+G  +  E+  +I P +  H
Sbjct  84   ISVDEYIGDMYRSTGAEDEEPEWVANER-EAFSTHRDLDKDGYLNEEEVKQWIAPHDFDH  142

Query  305  AIQEANHLIELSDVNHDGKLQLSEVLSKTDLFLGSKMVDTEGSF--HDEF  352
            +  EA HL+  +D +HD KL   E+L K D+F+GS+  D   +   HDEF
Sbjct  143  SEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF  192


>O96051_DROME unnamed protein product
Length=193

 Score = 79.7 bits (195),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/171 (35%), Positives = 87/171 (51%), Gaps = 4/171 (2%)

Query  185  SQKEAVVRDRARWSEAARNDPDKLTLDEFLAFTHPESSHRALLQMVEDLFDKFDRDGDEQ  244
            S K  + RDR RWS A ++  D LT DEF AF HPE        ++ +     D+D D +
Sbjct  24   SYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGK  83

Query  245  LTEDEF-SDLPSEGVNVEPSVSMPVRQERRQEFRHLIDKNKNGKADRSELLAYIDPRNPR  303
            ++ DE+  D+       E      V  ER + F    D +K+G  +  E+  +I P +  
Sbjct  84   ISVDEYIGDMYRSTGAAEDEEPEWVANER-EAFSTHRDLDKDGYLNEEEVKQWIAPHDFD  142

Query  304  HAIQEANHLIELSDVNHDGKLQLSEVLSKTDLFLGSKMVDTEGSF--HDEF  352
            H+  EA HL+  +D +HD KL   E+L K D+F+GS+  D   +   HDEF
Sbjct  143  HSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQTTDFGEALARHDEF  193



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000108-PA

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLR8_DROME  unnamed protein product                                 357     2e-114
A0A0B4LHY2_DROME  unnamed protein product                             281     3e-85 
Q95SK1_DROME  unnamed protein product                                 281     3e-85 


>Q9VLR8_DROME unnamed protein product
Length=600

 Score = 357 bits (917),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 203/610 (33%), Positives = 334/610 (55%), Gaps = 58/610 (10%)

Query  72   DCAAEKSILKNFFSWYDYSVLGTMLIVSSMIGTFYACFTKEQKTSED-------------  118
            +  A+K +    F   DY+V   M+++S+  G ++ C  K +   E+             
Sbjct  2    EAVAKKGMENYRFGSVDYAVFLGMIVLSTSTGIYFGCIKKSKVKLEEAEPTLPTTTPKRR  61

Query  119  -----------FLLGGSDMGTLPMAMSLAASFITAIELLGNPAEMYGHGTQFWMTCVSFV  167
                       +LLG  ++   P+AMSL AS+I+ + +LG  +E+Y +GTQ+W   ++ +
Sbjct  62   KHDFGSEKMSEYLLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGTQYWFIAIAIM  121

Query  168  LVVPITSQLYLPVYMKLRLTSSYEYLNLRFDRHCRLLASGLYMLQMILYTSVAVYAPALA  227
            L     S +Y+PV+  L++ SSYEYL +RF    R +AS +++L  IL+    VY PA+A
Sbjct  122  LQGIAVSYVYIPVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIA  181

Query  228  LSHVTGLNTYAAVSLVYAVCIFYASQGGMKAVIMTDTFQAVVLMGSLLLIVMWGGLMAGG  287
            L+ V+G+N +    ++  VC+FY   GG+KAV+ TD +Q +V+  S+L + +   + A G
Sbjct  182  LNQVSGINLHVIAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANG  241

Query  288  PLVIWNDSQETGRLEFFNLSPNPTVRHSFWSVVIGGTFYWTTMFCSNQASVQKYLSVQSI  347
              V+++D+ + GRL F N +P+P VRH+ WSV+IGG  YWT+    NQ  VQ+Y+S+ S+
Sbjct  242  LNVLFDDAAKGGRLIFNNTNPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYMSLPSL  301

Query  348  GQVRKALWVSAIGLILIYTINFMTGMVLYSTYKGCDPITAEHITGQDQLLPLYVMNFMGA  407
             + R ++ +  IG+    ++    G+++Y  YK CDP++A  IT  DQLLPL+V+  +G 
Sbjct  302  KKARASMAIFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQSVGH  361

Query  408  AKGVPGLFVSGIFAASLGTVASALNSLAAITCEDVLQGLFKIRMPASRGAA-YAKWISVF  466
              G+ GLF++GIF A+L +++  LNS + +  ED+++G FK++ P+ R +    K   + 
Sbjct  362  IYGMSGLFIAGIFGAALSSLSVVLNSTSLVILEDIVRGCFKMQ-PSERASTILVKSTVIV  420

Query  467  FGLLSFALVFVVERLGGVLQVPNTFSRQCQYANVKINNNFNEQAQVALSFNGMVGGVTLG  526
             G ++ +LVFV+E+L G+L +       C                   S   +  G T G
Sbjct  421  LGFVALSLVFVLEQLSGILSI-------CT------------------SMTAIAAGTTFG  455

Query  527  LFSLGMFVPWANARGAVTGATISLIVVLWIGLGAQISALRGDIIEKTLDTSIENCPCLNS  586
            LF+LGM VPWAN  G   G   S ++  WI  G Q +   G++  + L  S+E C     
Sbjct  456  LFTLGMLVPWANTVGTAVGGIASALLAGWISFGTQFTIAAGELNSQKLPVSVEGC-----  510

Query  587  TATAAVPSLDSVEAHGHEAWFVYRISYLWYSAIGCIGTMVIGVAVSYITGFQDPADLDHD  646
                 V   +++     + + +YR+SY W + IG    +V+G  VS +T   +   LD D
Sbjct  511  --VGNVTLRENIWVDEEQVFPLYRLSYHWINPIGVATVIVVGALVSLVTKPTNMKTLDPD  568

Query  647  LLSPPIRRLI  656
            L+SP I R +
Sbjct  569  LISPVIHRFL  578


>A0A0B4LHY2_DROME unnamed protein product
Length=621

 Score = 281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 183/627 (29%), Positives = 318/627 (51%), Gaps = 52/627 (8%)

Query  84   FSWYDYSVLGTMLIVSSMIGTFYACFTKEQKTSEDFLLGGSDMGTLPMAMSLAASFITAI  143
            FS  DY V   ML  S+ IG ++  F+K + T+E++L GG  M TLP+A+SL +S ++ +
Sbjct  25   FSLTDYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSSQLSGV  84

Query  144  ELLGNPAEMYGHGTQFWMTCVSFVLVVPITSQLYLPVYMKLRLTSSYEYLNLRFDRHCRL  203
             ++  PAE Y  G        + VL VP+   + +PV+    +++ YEYL LRF +  R 
Sbjct  85   AMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRTRQ  144

Query  204  LASGLYMLQMILYTSVAVYAPALALSHVTGLNTYAAVSLVYAVCIFYASQGGMKAVIMTD  263
            L +  ++L   L   V ++ P+LA S VTG N +   ++V ++C+FY   GG+KAV+ TD
Sbjct  145  LVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVWTD  204

Query  264  TFQAVVLMGSLLLIVMWGGLMAGGPLVIWNDSQETGRLEFFNLSPNPTVRHSFWSVVIGG  323
              Q  V++ S++L+ + G    GG   +  ++ E GR + F+   +P +R +F S +  G
Sbjct  205  VVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFD-FSFGIDPRLRLTFISGMASG  263

Query  324  TFYWTTMFCSNQASVQKYLSVQSIGQVRKALWVSAIGLILIYTINFMTGMVLYSTYKGCD  383
               WT     +Q+ VQ+ +S+ S G  ++ L ++ +G +LI +    TG+++++ Y GCD
Sbjct  264  LLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAYYYGCD  323

Query  384  PITAEHITGQDQLLPLYVMNFMGAAKGVPGLFVSGIFAASLGTVASALNSLAAITCEDVL  443
            PI A  ++  D+L+P ++ + MG   G+PG+F+S +F+ASL +++++LNS A +   D +
Sbjct  324  PIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFDYI  383

Query  444  QGLFKIRMPASRGAAYAKWISVFFGLLSFALVFVVERLGGVLQVPNTFSRQCQYANVKIN  503
            +   +I    ++  A  K + V  G       F+V+                        
Sbjct  384  KP--RINHSEAKANATMKLVIVVMGAYCIVGGFIVQ------------------------  417

Query  504  NNFNEQAQVALSFNGMVGGVTLGLFSLGMFVPWANARGAVTGATISLIVVLWIGLGAQIS  563
             NFN   Q   +  G+  G  +G+F LGMFVP  NA+ AV+G   S +V+LWI +  Q++
Sbjct  418  -NFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMN  476

Query  564  ALRGDIIEKTLDTSIENCPC-------------LNSTATAAVPSLDSVEA-----HGHEA  605
               G I    L   ++ C               + +  T A+PSL++ +        +  
Sbjct  477  FKAGLIKYDPLPNGLDQCEAKGFEVILNAINKNVTNVGTTAIPSLEAPKELTTAFDSNRD  536

Query  606  WFVYRISYLWYSAIGCIGTMVIGVAVSYITGFQDPADLDHDLLSPPIRRLIGTTKSKPQH  665
            + +Y  S+ WY  +G +      + +SY+         +  L SP +R ++   K  P  
Sbjct  537  FSIYDTSFYWYKVLGALLVFAWAIPMSYVWPLDKEEKQNPKLYSPFVRSML--NKPSPVL  594

Query  666  ASHGLHGITNLALGMNDEKPKIEVNGN  692
                L     L   +++E+ K + NG+
Sbjct  595  ELEELP----LKTPLSEEQIKEKENGS  617


>Q95SK1_DROME unnamed protein product
Length=622

 Score = 281 bits (718),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 183/628 (29%), Positives = 318/628 (51%), Gaps = 53/628 (8%)

Query  84   FSWYDYSVLGTMLIVSSMIGTFYACFTKEQKTSEDFLLGGSDMGTLPMAMSLAASFITAI  143
            FS  DY V   ML  S+ IG ++  F+K + T+E++L GG  M TLP+A+SL +S ++ +
Sbjct  25   FSLTDYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSSQLSGV  84

Query  144  ELLGNPAEMYGHGTQFWMTCVSFVLVVPITSQLYLPVYMKLRLTSSYEYLNLRFDRHCRL  203
             ++  PAE Y  G        + VL VP+   + +PV+    +++ YEYL LRF +  R 
Sbjct  85   AMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRTRQ  144

Query  204  LASGLYMLQMILYTSVAVYAPALALSHVTGLNTYAAVSLVYAVCIFYASQGGMKAVIMTD  263
            L +  ++L   L   V ++ P+LA S VTG N +   ++V ++C+FY   GG+KAV+ TD
Sbjct  145  LVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVWTD  204

Query  264  TFQAVVLMGSLLLIVMWGGLMAGGPLVIWNDSQETGRLEFFNLSPNPTVRHSFWSVVIGG  323
              Q  V++ S++L+ + G    GG   +  ++ E GR + F+   +P +R +F S +  G
Sbjct  205  VVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFD-FSFGIDPRLRLTFISGMASG  263

Query  324  TFYWTTMFCSNQASVQKYLSVQSIGQVRKALWVSAIGLILIYTINFMTGMVLYSTYKGCD  383
               WT     +Q+ VQ+ +S+ S G  ++ L ++ +G +LI +    TG+++++ Y GCD
Sbjct  264  LLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAYYYGCD  323

Query  384  PITAEHITGQDQLLPLYVMNFMGAAKGVPGLFVSGIFAASLGTVASALNSLAAITCEDVL  443
            PI A  ++  D+L+P ++ + MG   G+PG+F+S +F+ASL +++++LNS A +   D +
Sbjct  324  PIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFDYI  383

Query  444  QGLFKIRMPASRGAAYAKWISVFFGLLSFALVFVVERLGGVLQVPNTFSRQCQYANVKIN  503
            +   +I    ++  A  K + V  G       F+V+                        
Sbjct  384  KP--RINHSEAKANATMKLVIVVMGAYCIVGGFIVQ------------------------  417

Query  504  NNFNEQAQVALSFNGMVGGVTLGLFSLGMFVPWANARGAVTGATISLIVVLWIGLGAQIS  563
             NFN   Q   +  G+  G  +G+F LGMFVP  NA+ AV+G   S +V+LWI +  Q++
Sbjct  418  -NFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMN  476

Query  564  ALRGDIIEKTLDTSIENCPC--------------LNSTATAAVPSLDSVEA-----HGHE  604
               G I    L   ++ C                + +  T A+PSL++ +        + 
Sbjct  477  LKAGLIKYDPLPNGLDQCEAKGFEVILNAIRNKNVTNVGTTAIPSLEAPKELTTAFDSNR  536

Query  605  AWFVYRISYLWYSAIGCIGTMVIGVAVSYITGFQDPADLDHDLLSPPIRRLIGTTKSKPQ  664
             + +Y  S+ WY  +G +      + +SY+         +  L SP +R ++   K  P 
Sbjct  537  DFSIYDTSFYWYKVLGALLVFAWAIPMSYVWPLDKEEKQNPKLYSPFVRSML--NKPSPV  594

Query  665  HASHGLHGITNLALGMNDEKPKIEVNGN  692
                 L     L   +++E+ K + NG+
Sbjct  595  LELEELP----LKTPLSEEQIKEKENGS  618



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


Query= CFLO000109-PA

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLR8_DROME  unnamed protein product                                 302     5e-95
Q9V9U2_DROME  unnamed protein product                                 240     4e-71
Q95SK1_DROME  unnamed protein product                                 239     5e-71


>Q9VLR8_DROME unnamed protein product
Length=600

 Score = 302 bits (774),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 203/591 (34%), Positives = 299/591 (51%), Gaps = 55/591 (9%)

Query  1    MEGMTLTWPDYIVILGTMCVSTGIGIYY------------------KFTGNRQR------  36
            ME       DY V LG + +ST  GIY+                    T  R++      
Sbjct  9    MENYRFGSVDYAVFLGMIVLSTSTGIYFGCIKKSKVKLEEAEPTLPTTTPKRRKHDFGSE  68

Query  37   TTAEYFTANKSMGTLPVGIALMVTFISAVALLGISSDSYTHGTMYVVFYIPFLLVVPIVC  96
              +EY   ++++   PV ++L+ ++IS V +LG +S+ Y +GT Y    I  +L    V 
Sbjct  69   KMSEYLLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGTQYWFIAIAIMLQGIAVS  128

Query  97   YGYYPIFYKLQLTSVFEYLKLRFGNFARSTTSWANWVQLLLYSGICLYAPALALEVTAGL  156
            Y Y P+F  LQ+ S +EYL++RF +  RS  S+   +  +L+    +Y PA+AL   +G+
Sbjct  129  YVYIPVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIALNQVSGI  188

Query  157  PQLWSIIALGVVCAFYSSIGGMKAVLVTDVFQGFLMLAAVFMVIITAAWNVGGLGEIWRI  216
                  + + VVC FY+ +GG+KAV+ TD +Q  +M  +V  V I A     GL  ++  
Sbjct  189  NLHVIAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLNVLFDD  248

Query  217  AKEGGRLEINNFSLNPTERHSWWSLTFGGMTVLLSMNGVSQVQVQRLMTVKNLHSARKAM  276
            A +GGRL  NN + +P  RH+ WS+  GG +   S N V+Q  VQR M++ +L  AR +M
Sbjct  249  AAKGGRLIFNNTNPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYMSLPSLKKARASM  308

Query  277  VINMIIHNLFGIATCFAGLAIYSRYHDCDPKASGRITSNDQLMPFYIMDTLSQFPGLPGL  336
             I  I    F    C+ GL IY  Y DCDP ++G IT +DQL+P +++ ++    G+ GL
Sbjct  309  AIFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQSVGHIYGMSGL  368

Query  337  FISGIFSAALSTISASLNSLAAITLEDHVKPIYEKCWKRSISEPLMMKIGKSLAFAYGLV  396
            FI+GIF AALS++S  LNS + + LED V+     C+K   SE     + KS     G V
Sbjct  369  FIAGIFGAALSSLSVVLNSTSLVILEDIVR----GCFKMQPSERASTILVKSTVIVLGFV  424

Query  397  CIGIALCGQFLGSVLQASLSINGCIGGTVLGIFTLGMLVESANEPGAVFGLLSTLVFVMW  456
             + +    + L  +L    S+     GT  G+FTLGMLV  AN  G   G +++ +   W
Sbjct  425  ALSLVFVLEQLSGILSICTSMTAIAAGTTFGLFTLGMLVPWANTVGTAVGGIASALLAGW  484

Query  457  ISFGTPRPTPA------ELPASITGCEFNITSTPFNGISNFDGITREDDDNSTEDSAYFY  510
            ISFGT     A      +LP S+ GC  N+T              RE+     ++   F 
Sbjct  485  ISFGTQFTIAAGELNSQKLPVSVEGCVGNVT-------------LRENI--WVDEEQVFP  529

Query  511  LYRISYMWYSVIGFVGTFVVGFVASCIYRCFVAADDNEKKRLDPDLFFPVI  561
            LYR+SY W + IG     VVG + S + +          K LDPDL  PVI
Sbjct  530  LYRLSYHWINPIGVATVIVVGALVSLVTK------PTNMKTLDPDLISPVI  574


>Q9V9U2_DROME unnamed protein product
Length=622

 Score = 240 bits (612),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 175/584 (30%), Positives = 292/584 (50%), Gaps = 30/584 (5%)

Query  1    MEGMTLTWPDYIVILGTMCVSTGIGIYYKFTGNRQRTTAEYFTANKSMGTLPVGIALMVT  60
            +E +  +  DYIV    +  S GIG+Y+ F    + TT EY    K M TLPV I+L+ +
Sbjct  20   LEDLHFSLTDYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSS  79

Query  61   FISAVALLGISSDSYTHGTMYVVFYIPFLLVVPIVCYGYYPIFYKLQLTSVFEYLKLRFG  120
             +S VA++ + +++Y+ G   +      +L VP++ Y   P+FY   +++ +EYL+LRF 
Sbjct  80   QLSGVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFS  139

Query  121  NFARSTTSWANWVQLLLYSGICLYAPALALEVTAGLPQLWSIIALGVVCAFYSSIGGMKA  180
               R   +    +   L   + ++ P+LA     G         +  +C FY+ +GG+KA
Sbjct  140  KRTRQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKA  199

Query  181  VLVTDVFQGFLMLAAVFMVIITAAWNVGGLGEIWRIAKEGGRLEINNFSLNPTERHSWWS  240
            V+ TDV QG +ML +V +V I    N GG+  +   A EGGR + + F ++P  R ++ S
Sbjct  200  VVWTDVVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFDFS-FGIDPRLRLTFIS  258

Query  241  LTFGGMTVLLSMNGVSQVQVQRLMTVKNLHSARKAMVINMIIHNLFGIATCFAGLAIYSR  300
                G+ +     G+ Q  VQR++++ +   A++ +++  +   L    TCF G+ +++ 
Sbjct  259  GMASGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAY  318

Query  301  YHDCDPKASGRITSNDQLMPFYIMDTLSQFPGLPGLFISGIFSAALSTISASLNSLAAIT  360
            Y+ CDP  +G ++  D+LMPF+I D +    G+PG+FIS +FSA+LS++SASLNS A + 
Sbjct  319  YYGCDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVV  378

Query  361  LEDHVKPIYEKCWKRSISEPLMMKIGKSLAFAYGLVCIGIALCGQFLGSVLQASLSINGC  420
              D++KP      + + SE       K +    G  CI      Q   S++Q   +I G 
Sbjct  379  YFDYIKP------RINHSEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGI  432

Query  421  IGGTVLGIFTLGMLVESANEPGAVFGLLSTLVFVMWI------SFGTPRPTPAELPASIT  474
              G V+G+F LGM V   N   AV G+  + + ++WI      +F         LP  + 
Sbjct  433  NMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMNFKAGLIKYDPLPNGLD  492

Query  475  GCEFNITSTPFNGISNFD----GITR-------EDDDNSTEDSAYFYLYRISYMWYSVIG  523
             CE        N I N +    G T        ++   + + +  F +Y  S+ WY V+G
Sbjct  493  QCEAKGFEVILNAIRNKNVTNVGTTAIPSLEAPKELTTAFDSNRDFSIYDTSFYWYKVLG  552

Query  524  FVGTFVVGFVASCIYRCFVAADDNEKKRLDPDLFFPVIASRIRH  567
             +  F     A  I   +V   D E+K+ +P L+ P + S +  
Sbjct  553  ALLVF-----AWAIPMSYVWPLDKEEKQ-NPKLYSPFVRSMLNK  590


>Q95SK1_DROME unnamed protein product
Length=622

 Score = 239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 175/584 (30%), Positives = 291/584 (50%), Gaps = 30/584 (5%)

Query  1    MEGMTLTWPDYIVILGTMCVSTGIGIYYKFTGNRQRTTAEYFTANKSMGTLPVGIALMVT  60
            +E +  +  DYIV    +  S GIG+Y+ F    + TT EY    K M TLPV I+L+ +
Sbjct  20   LEDLHFSLTDYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSS  79

Query  61   FISAVALLGISSDSYTHGTMYVVFYIPFLLVVPIVCYGYYPIFYKLQLTSVFEYLKLRFG  120
             +S VA++ + +++Y+ G   +      +L VP++ Y   P+FY   +++ +EYL+LRF 
Sbjct  80   QLSGVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFS  139

Query  121  NFARSTTSWANWVQLLLYSGICLYAPALALEVTAGLPQLWSIIALGVVCAFYSSIGGMKA  180
               R   +    +   L   + ++ P+LA     G         +  +C FY+ +GG+KA
Sbjct  140  KRTRQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKA  199

Query  181  VLVTDVFQGFLMLAAVFMVIITAAWNVGGLGEIWRIAKEGGRLEINNFSLNPTERHSWWS  240
            V+ TDV QG +ML +V +V I    N GG+  +   A EGGR + + F ++P  R ++ S
Sbjct  200  VVWTDVVQGSVMLISVVLVAILGTSNTGGITNVLENAAEGGRFDFS-FGIDPRLRLTFIS  258

Query  241  LTFGGMTVLLSMNGVSQVQVQRLMTVKNLHSARKAMVINMIIHNLFGIATCFAGLAIYSR  300
                G+ +     G+ Q  VQR++++ +   A++ +++  +   L    TCF G+ +++ 
Sbjct  259  GMASGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAY  318

Query  301  YHDCDPKASGRITSNDQLMPFYIMDTLSQFPGLPGLFISGIFSAALSTISASLNSLAAIT  360
            Y+ CDP  +G ++  D+LMPF+I D +    G+PG+FIS +FSA+LS++SASLNS A + 
Sbjct  319  YYGCDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVV  378

Query  361  LEDHVKPIYEKCWKRSISEPLMMKIGKSLAFAYGLVCIGIALCGQFLGSVLQASLSINGC  420
              D++KP      + + SE       K +    G  CI      Q   S++Q   +I G 
Sbjct  379  YFDYIKP------RINHSEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGI  432

Query  421  IGGTVLGIFTLGMLVESANEPGAVFGLLSTLVFVMWISFGTPRPTPA------ELPASIT  474
              G V+G+F LGM V   N   AV G+  + + ++WI         A       LP  + 
Sbjct  433  NMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMNLKAGLIKYDPLPNGLD  492

Query  475  GCEFNITSTPFNGISNFD----GITR-------EDDDNSTEDSAYFYLYRISYMWYSVIG  523
             CE        N I N +    G T        ++   + + +  F +Y  S+ WY V+G
Sbjct  493  QCEAKGFEVILNAIRNKNVTNVGTTAIPSLEAPKELTTAFDSNRDFSIYDTSFYWYKVLG  552

Query  524  FVGTFVVGFVASCIYRCFVAADDNEKKRLDPDLFFPVIASRIRH  567
             +  F     A  I   +V   D E+K+ +P L+ P + S +  
Sbjct  553  ALLVF-----AWAIPMSYVWPLDKEEKQ-NPKLYSPFVRSMLNK  590



Lambda      K        H
   0.317    0.134    0.406 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3876471732


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Jun 4, 2020  4:51 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= CFLO000110-PA

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ORCO_ANOGA  unnamed protein product                                   56.2    1e-08
ORCO_AEDAE  unnamed protein product                                   53.5    1e-07
OR49A_DROME  unnamed protein product                                  53.1    1e-07


>ORCO_ANOGA unnamed protein product
Length=478

 Score = 56.2 bits (134),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 70/142 (49%), Gaps = 8/142 (6%)

Query  194  QAQIKDCIDRHNLLIHSKKRIENTFGIIAIWMAISSAVTLCALTFQVSEI-AKNKLSIQR  252
            ++ IK  ++RH  ++     I +T+G   +   ++S + L  L +Q ++I   N   +  
Sbjct  327  RSAIKYWVERHKHVVRLVSAIGDTYGPALLLHMLTSTIKLTLLAYQATKIDGVNVYGLTV  386

Query  253  IGRLCLSLFPKAAQIFAYGWHGNRIERESARSLDSMYGSHWPENCSKHFKNDITIVLVQK  312
            IG LC +L    AQ+F +   GNR+  ES+  +++ Y  HW +  S+  K  + IV  Q 
Sbjct  387  IGYLCYAL----AQVFLFCIFGNRLIEESSSVMEAAYSCHWYDG-SEEAKTFVQIVCQQC  441

Query  313  PLILVAKGCMF--IQLDMFTKI  332
               +   G  F  + LD+F  +
Sbjct  442  QKAMTISGAKFFTVSLDLFASV  463


>ORCO_AEDAE unnamed protein product
Length=478

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 69/142 (49%), Gaps = 8/142 (6%)

Query  194  QAQIKDCIDRHNLLIHSKKRIENTFGIIAIWMAISSAVTLCALTFQVSEI-AKNKLSIQR  252
            ++ IK  ++RH  ++     I  T+G   +   ++S + L  L +Q ++I A N   +  
Sbjct  327  RSAIKYWVERHKHVVRLVSAIGETYGAALLLHMLTSTIKLTLLAYQATKIDALNVYGLTV  386

Query  253  IGRLCLSLFPKAAQIFAYGWHGNRIERESARSLDSMYGSHWPENCSKHFKNDITIVLVQK  312
            IG L  +L    AQ+F +   GNR+  ES+  +++ Y  HW +  S+  K  + IV  Q 
Sbjct  387  IGYLVYAL----AQVFLFCIFGNRLIEESSSVMEAAYSCHWYDG-SEEAKTFVQIVCQQC  441

Query  313  PLILVAKGCMF--IQLDMFTKI  332
               +   G  F  + LD+F  +
Sbjct  442  QKAMTISGAKFFTVSLDLFASV  463


>OR49A_DROME unnamed protein product
Length=396

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/262 (26%), Positives = 106/262 (40%), Gaps = 36/262 (14%)

Query  86   RIGLYAYYMYSFSAFVAITMFLYAFGPLID-----YLKYGK----FTRAVPSIIPFDYKS  136
            R  LY YY      FV + M   A  PL+       + +GK    + R  P+ + FD   
Sbjct  133  RNVLYVYY------FVMVVM---ALEPLVQSCIMYLIGFGKADFTYKRIFPTRLTFD-SE  182

Query  137  GGLMHWLFYFTEFYGLSTIWFISSAVDLAYVLYTIQMCGELKLLAKKFKELNLEENYQAQ  196
              L + L Y  +F     I  +S   DL  +  + Q+   L  LA     +      + Q
Sbjct  183  KPLGYVLAYVIDFTYSQFIVNVSLGTDLWMMCVSSQISMHLGYLANMLASIRPSPETEQQ  242

Query  197  IKDC------IDRHNLLIHSKKRIENTFGIIAIWMAISSAVTLCALTFQVSEIAKNKLSI  250
              DC      I RH L+I  +K +   FG++      +++  LC + +       N   I
Sbjct  243  --DCDFLASIIKRHQLMIRLQKDVNYVFGLLLASNLFTTSCLLCCMAYYTVVEGFNWEGI  300

Query  251  QRIGRLCLSLFPK-AAQIFAYGWHGNRIERESARSLDSMYGSHWPENCSKHFKNDITIVL  309
                   + LF   AAQ +    HG  +   S     + + S W E  S  +K +I I++
Sbjct  301  SY-----MMLFASVAAQFYVVSSHGQMLIDLSTNLAKAAFESKWYEG-SLRYKKEILILM  354

Query  310  --VQKPLILVAKGCMFIQLDMF  329
               Q+PL + A+G + I LD F
Sbjct  355  AQAQRPLEISARGVIIISLDTF  376



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000111-PA

Length=1221
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VLR8_DROME  unnamed protein product                                 300     9e-89
A0A0B4LHY2_DROME  unnamed protein product                             238     1e-66
Q9V9U2_DROME  unnamed protein product                                 237     2e-66


>Q9VLR8_DROME unnamed protein product
Length=600

 Score = 300 bits (767),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 181/528 (34%), Positives = 289/528 (55%), Gaps = 24/528 (5%)

Query  673   HRGNEYFSADKSMSIIPVGIALMVSFMSAITLLGLSAENYSYGTQFVGINVAYWIATPII  732
              + +EY    +++ + PV ++L+ S++S +T+LG ++E Y+YGTQ+  I +A  +    +
Sbjct  68    EKMSEYLLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGTQYWFIAIAIMLQGIAV  127

Query  733   CYGYVPVFFNLGAISAYEYLDKRFGYGARITASFAYWVQLLLYSGVVLYAPALALEATTG  792
              Y Y+PVF  L   S+YEYL+ RF    R  ASF + +  +L+   ++Y PA+AL   +G
Sbjct  128   SYVYIPVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIALNQVSG  187

Query  793   MNIVTSIVAIGLVCAFYSTIGGIKAVLITDVFQGGLMFISLFIVIFTAAHRVGGVGEIWR  852
             +N+    V I +VC FY+ +GGIKAV+ TD +Q  +MF+S+  V   A     G+  ++ 
Sbjct  188   INLHVIAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLNVLFD  247

Query  853   IASEGKRIQFDNTSSDPTVRHTWWGLIIGGMCTYLSLFGVNQVQVQRMMTLKNIKSARVA  912
              A++G R+ F+NT+  P VRHT W ++IGG   + S   VNQ  VQR M+L ++K AR +
Sbjct  248   DAAKGGRLIFNNTNPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYMSLPSLKKARAS  307

Query  913   YWVNVFMLSCLSILTCFSGLALYSHYYECDPKVTKRIGSMDMLMPLYVMDTLSSIPGVPG  972
               +    ++    + C+ GL +Y  Y +CDP     I   D L+PL+V+ ++  I G+ G
Sbjct  308   MAIFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQSVGHIYGMSG  367

Query  973   LFVAGIFSAGLSTISAGLNSLAAVTLEDYIKPIYTWSSGHEFSEKQSIICSKILVLVFGI  1032
             LF+AGIF A LS++S  LNS + V LED ++  +        SE+ S I  K  V+V G 
Sbjct  368   LFIAGIFGAALSSLSVVLNSTSLVILEDIVRGCFKMQP----SERASTILVKSTVIVLGF  423

Query  1033  LCIALAFAAQLLGGVLQASLTIFGVVGGPLLGIFTLGMLTESTNQIGAVMGTLTSFAFCM  1092
             + ++L F  + L G+L    ++  +  G   G+FTLGML    N +G  +G + S     
Sbjct  424   VALSLVFVLEQLSGILSICTSMTAIAAGTTFGLFTLGMLVPWANTVGTAVGGIASALLAG  483

Query  1093  WIAFGQPRPVPPA------LSISADGCSNKTSDFVGKILQSEK----ADSYFYLFKISYM  1142
             WI+FG    +         L +S +GC       VG +   E      +  F L+++SY 
Sbjct  484   WISFGTQFTIAAGELNSQKLPVSVEGC-------VGNVTLRENIWVDEEQVFPLYRLSYH  536

Query  1143  WYSAIGFIITMVIGYAVSHLSRIFNKKDADELDPDLFFPFVSRRIKRR  1190
             W + IG    +V+G  VS +++  N K    LDPDL  P + R + + 
Sbjct  537   WINPIGVATVIVVGALVSLVTKPTNMKT---LDPDLISPVIHRFLPKE  581


 Score = 281 bits (720),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 179/548 (33%), Positives = 289/548 (53%), Gaps = 29/548 (5%)

Query  96   GKQKTIQEYFSADKSMNIIPIAIGLMVSFVSAITLLGISAENYTYGTQFFVINLSYLIGT  155
            G +K + EY    +++ + P+A+ L+ S++S +T+LG ++E Y YGTQ++ I ++ ++  
Sbjct  66   GSEK-MSEYLLGSRNLKVFPVAMSLIASYISGVTILGTTSEIYNYGTQYWFIAIAIMLQG  124

Query  156  PLVCYGYMPVFFNIGAISAFEYLEKRFGRASRVVAGIIYWIQLLLYSGVVLYAPALTLEA  215
              V Y Y+PVF  +   S++EYLE RF    R +A  ++ +  +L+   ++Y PA+ L  
Sbjct  125  IAVSYVYIPVFSALQVGSSYEYLEMRFHSVVRSIASFMFILDEILFLPFIVYVPAIALNQ  184

Query  216  TTGIDKIWSIVGIGVICAFYCTLGGIKAVLITDVFQGGLMFTSLFIIIFTAAHKVGGFSE  275
             +GI+     V I V+C FY  +GGIKAV+ TD +Q  +MF S+  +   A     G + 
Sbjct  185  VSGINLHVIAVVIVVVCVFYTFVGGIKAVVHTDAWQVLVMFLSVLAVAILATVYANGLNV  244

Query  276  IWRIASEGKRIQFDEISLDPTIRHTWWGLLIGGLGSYLSLYGVNQVQIQRMMTTKYQKTV  335
            ++  A++G R+ F+  +  P +RHT W +LIGG   + S   VNQ  +QR M      ++
Sbjct  245  LFDDAAKGGRLIFNNTNPSPYVRHTVWSVLIGGFSYWTSFNAVNQTMVQRYM------SL  298

Query  336  QFIKSARLALWLSWPILAFLSALTCYSGLAMYSYYYKCDPKTTNRIESMDMLMPLFVMDT  395
              +K AR ++ +    +A   ++ CY GL +Y  Y  CDP +   I   D L+PLFV+ +
Sbjct  299  PSLKKARASMAIFTIGVAAFVSVCCYVGLLIYEMYKDCDPLSAGLITHDDQLLPLFVVQS  358

Query  396  LSNVPGLPGLFVAGIFSAGLSTISAGLNSLAAVTLEDYIKPMYSFCSGHKLSENQSIVCS  455
            + ++ G+ GLF+AGIF A LS++S  LNS + V LED ++     C   + SE  S +  
Sbjct  359  VGHIYGMSGLFIAGIFGAALSSLSVVLNSTSLVILEDIVRG----CFKMQPSERASTILV  414

Query  456  KILVLVFGISCIALAFAAQLLGGILQASLTIFGVVGGPLLGIFTLGMLVESANEIGAITG  515
            K  V+V G   ++L F  + L GIL    ++  +  G   G+FTLGMLV  AN +G   G
Sbjct  415  KSTVIVLGFVALSLVFVLEQLSGILSICTSMTAIAAGTTFGLFTLGMLVPWANTVGTAVG  474

Query  516  TLISFAFCMWIAFGQPRPLPP------KLPVDTYGCSYNFNASISFEEAFEKSDSSYFYL  569
             + S     WI+FG    +        KLPV   GC  N    ++  E     +   F L
Sbjct  475  GIASALLAGWISFGTQFTIAAGELNSQKLPVSVEGCVGN----VTLRENIWVDEEQVFPL  530

Query  570  YKISYIWYSVIGFLITMALGYVISNLSRVALKIPHDEPDPQLFFPFIASRIKK-----RR  624
            Y++SY W + IG    + +G ++S +++          DP L  P I   + K     R 
Sbjct  531  YRLSYHWINPIGVATVIVVGALVSLVTK---PTNMKTLDPDLISPVIHRFLPKECFSGRN  587

Query  625  LQTEINQN  632
            L  + ++N
Sbjct  588  LHAQAHKN  595


>A0A0B4LHY2_DROME unnamed protein product
Length=621

 Score = 238 bits (606),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 171/586 (29%), Positives = 289/586 (49%), Gaps = 43/586 (7%)

Query  73   DLAVIAVAMGISVIIGLYYRFSGGKQKTIQEYFSADKSMNIIPIAIGLMVSFVSAITLLG  132
            D  V ++ +  S  IG+Y+ F    + T +EY    K M  +P+AI L+ S +S + ++ 
Sbjct  29   DYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSSQLSGVAMMS  88

Query  133  ISAENYTYGTQFFVINLSYLIGTPLVCYGYMPVFFNIGAISAFEYLEKRFGRASRVVAGI  192
            + AE Y++G     +  + ++  P++ Y  +PVF++    + +EYLE RF + +R +  I
Sbjct  89   VPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRTRQLVTI  148

Query  193  IYWIQLLLYSGVVLYAPALTLEATTGIDKIWSIVGIGVICAFYCTLGGIKAVLITDVFQG  252
             + +   L   V ++ P+L     TG +       +  IC FY  LGGIKAV+ TDV QG
Sbjct  149  TFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVWTDVVQG  208

Query  253  GLMFTSLFIIIFTAAHKVGGFSEIWRIASEGKRIQFDEISLDPTIRHTWWGLLIGGLGSY  312
             +M  S+ ++        GG + +   A+EG R  F    +DP +R T+   +  GL  +
Sbjct  209  SVMLISVVLVAILGTSNTGGITNVLENAAEGGRFDFS-FGIDPRLRLTFISGMASGLLMW  267

Query  313  LSLYGVNQVQIQRMMTTKYQKTVQFIKSARLALWLSWPILAFLSALTCYSGLAMYSYYYK  372
                G++Q  +QR+++      +     A+  L ++      + + TC++G+ M++YYY 
Sbjct  268  TGKLGLDQSCVQRIVS------LPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAYYYG  321

Query  373  CDPKTTNRIESMDMLMPLFVMDTLSNVPGLPGLFVAGIFSAGLSTISAGLNSLAAVTLED  432
            CDP     +   D LMP F+ D + ++ G+PG+F++ +FSA LS++SA LNS A V   D
Sbjct  322  CDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFD  381

Query  433  YIKPMYSFCSGHKLSENQSIVCSKILVLVFGISCIALAFAAQLLGGILQASLTIFGVVGG  492
            YIKP  +       SE ++    K++++V G  CI   F  Q    I+Q   TI G+  G
Sbjct  382  YIKPRINH------SEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGINMG  435

Query  493  PLLGIFTLGMLVESANEIGAITGTLISFAFCMWIAF-GQPR---------PLPPKLP-VD  541
             ++G+F LGM V   N   A++G   S    +WI   GQ           PLP  L   +
Sbjct  436  AVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMNFKAGLIKYDPLPNGLDQCE  495

Query  542  TYGCSYNFNA-----------SISFEEAFEKSDSSY-----FYLYKISYIWYSVIGFLIT  585
              G     NA           +I   EA ++  +++     F +Y  S+ WY V+G L+ 
Sbjct  496  AKGFEVILNAINKNVTNVGTTAIPSLEAPKELTTAFDSNRDFSIYDTSFYWYKVLGALLV  555

Query  586  MALGYVISNLSRVALKIPHDEPDPQLFFPFIASRIKKRRLQTEINQ  631
             A    +S +  +      ++ +P+L+ PF+ S + K     E+ +
Sbjct  556  FAWAIPMSYVWPLD---KEEKQNPKLYSPFVRSMLNKPSPVLELEE  598


 Score = 223 bits (567),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 170/572 (30%), Positives = 278/572 (49%), Gaps = 50/572 (9%)

Query  676   NEYFSADKSMSIIPVGIALMVSFMSAITLLGLSAENYSYGTQFVGINVAYWIATPIICYG  735
              EY    K M  +PV I+L+ S +S + ++ + AE YS+G   + +  A  ++ P++ Y 
Sbjct  58    EEYLQGGKRMPTLPVAISLVSSQLSGVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYI  117

Query  736   YVPVFFNLGAISAYEYLDKRFGYGARITASFAYWVQLLLYSGVVLYAPALALEATTGMNI  795
              VPVF++    + YEYL+ RF    R   +  + +   L   V ++ P+LA    TG NI
Sbjct  118   IVPVFYDNNVSNCYEYLELRFSKRTRQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNI  177

Query  796   VTSIVAIGLVCAFYSTIGGIKAVLITDVFQGGLMFISLFIVIFTAAHRVGGVGEIWRIAS  855
                   +  +C FY+ +GGIKAV+ TDV QG +M IS+ +V        GG+  +   A+
Sbjct  178   HLINTVVSSICVFYTMLGGIKAVVWTDVVQGSVMLISVVLVAILGTSNTGGITNVLENAA  237

Query  856   EGKRIQFDNTSSDPTVRHTWWGLIIGGMCTYLSLFGVNQVQVQRMMTLKNIKSA-RVAYW  914
             EG R  F +   DP +R T+   +  G+  +    G++Q  VQR+++L +   A R    
Sbjct  238   EGGRFDF-SFGIDPRLRLTFISGMASGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLM  296

Query  915   VNVFMLSCLSILTCFSGLALYSHYYECDPKVTKRIGSMDMLMPLYVMDTLSSIPGVPGLF  974
               V  L  +S  TCF+G+ ++++YY CDP     +   D LMP ++ D +  + G+PG+F
Sbjct  297   AGVGFLLIMS-FTCFTGIIMFAYYYGCDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVF  355

Query  975   VAGIFSAGLSTISAGLNSLAAVTLEDYIKPIYTWSSGHEFSEKQSIICSKILVLVFGILC  1034
             ++ +FSA LS++SA LNS A V   DYIKP       H  SE ++    K++++V G  C
Sbjct  356   ISCVFSASLSSLSASLNSFAGVVYFDYIKP----RINH--SEAKANATMKLVIVVMGAYC  409

Query  1035  IALAFAAQLLGGVLQASLTIFGVVGGPLLGIFTLGMLTESTNQIGAVMGTLTSFAFCMWI  1094
             I   F  Q    ++Q   TI G+  G ++G+F LGM     N   AV G   S    +WI
Sbjct  410   IVGGFIVQNFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWI  469

Query  1095  AF-GQPR---------PVPPALSISADGCS-----------NKTSDFVGKI----LQSEK  1129
                GQ           P+P  L    D C            NK    VG      L++ K
Sbjct  470   IINGQMNFKAGLIKYDPLPNGL----DQCEAKGFEVILNAINKNVTNVGTTAIPSLEAPK  525

Query  1130  -------ADSYFYLFKISYMWYSAIGFIITMVIGYAVSHLSRIFNKKDADELDPDLFFPF  1182
                    ++  F ++  S+ WY  +G +  +V  +A+  +S ++     ++ +P L+ PF
Sbjct  526   ELTTAFDSNRDFSIYDTSFYWYKVLGAL--LVFAWAIP-MSYVWPLDKEEKQNPKLYSPF  582

Query  1183  VSRRIKRRRQ--HLTEIDVNLSLQKSCLPDSK  1212
             V   + +      L E+ +   L +  + + +
Sbjct  583   VRSMLNKPSPVLELEELPLKTPLSEEQIKEKE  614


>Q9V9U2_DROME unnamed protein product
Length=622

 Score = 237 bits (604),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 171/587 (29%), Positives = 289/587 (49%), Gaps = 44/587 (7%)

Query  73   DLAVIAVAMGISVIIGLYYRFSGGKQKTIQEYFSADKSMNIIPIAIGLMVSFVSAITLLG  132
            D  V ++ +  S  IG+Y+ F    + T +EY    K M  +P+AI L+ S +S + ++ 
Sbjct  29   DYIVFSLMLSASAGIGVYFGFFSKAKNTTEEYLQGGKRMPTLPVAISLVSSQLSGVAMMS  88

Query  133  ISAENYTYGTQFFVINLSYLIGTPLVCYGYMPVFFNIGAISAFEYLEKRFGRASRVVAGI  192
            + AE Y++G     +  + ++  P++ Y  +PVF++    + +EYLE RF + +R +  I
Sbjct  89   VPAETYSFGFNMIFVVWAMVLSVPVLIYIIVPVFYDNNVSNCYEYLELRFSKRTRQLVTI  148

Query  193  IYWIQLLLYSGVVLYAPALTLEATTGIDKIWSIVGIGVICAFYCTLGGIKAVLITDVFQG  252
             + +   L   V ++ P+L     TG +       +  IC FY  LGGIKAV+ TDV QG
Sbjct  149  TFILNQFLMLPVYMFVPSLAFSQVTGYNIHLINTVVSSICVFYTMLGGIKAVVWTDVVQG  208

Query  253  GLMFTSLFIIIFTAAHKVGGFSEIWRIASEGKRIQFDEISLDPTIRHTWWGLLIGGLGSY  312
             +M  S+ ++        GG + +   A+EG R  F    +DP +R T+   +  GL  +
Sbjct  209  SVMLISVVLVAILGTSNTGGITNVLENAAEGGRFDFS-FGIDPRLRLTFISGMASGLLMW  267

Query  313  LSLYGVNQVQIQRMMTTKYQKTVQFIKSARLALWLSWPILAFLSALTCYSGLAMYSYYYK  372
                G++Q  +QR+++      +     A+  L ++      + + TC++G+ M++YYY 
Sbjct  268  TGKLGLDQSCVQRIVS------LPSYGHAKRCLLMAGVGFLLIMSFTCFTGIIMFAYYYG  321

Query  373  CDPKTTNRIESMDMLMPLFVMDTLSNVPGLPGLFVAGIFSAGLSTISAGLNSLAAVTLED  432
            CDP     +   D LMP F+ D + ++ G+PG+F++ +FSA LS++SA LNS A V   D
Sbjct  322  CDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVFISCVFSASLSSLSASLNSFAGVVYFD  381

Query  433  YIKPMYSFCSGHKLSENQSIVCSKILVLVFGISCIALAFAAQLLGGILQASLTIFGVVGG  492
            YIKP  +       SE ++    K++++V G  CI   F  Q    I+Q   TI G+  G
Sbjct  382  YIKPRINH------SEAKANATMKLVIVVMGAYCIVGGFIVQNFNSIIQTMWTITGINMG  435

Query  493  PLLGIFTLGMLVESANEIGAITGTLISFAFCMWIAF-GQPR---------PLPPKLP-VD  541
             ++G+F LGM V   N   A++G   S    +WI   GQ           PLP  L   +
Sbjct  436  AVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWIIINGQMNFKAGLIKYDPLPNGLDQCE  495

Query  542  TYGCSYNFNA------------SISFEEAFEKSDSSY-----FYLYKISYIWYSVIGFLI  584
              G     NA            +I   EA ++  +++     F +Y  S+ WY V+G L+
Sbjct  496  AKGFEVILNAIRNKNVTNVGTTAIPSLEAPKELTTAFDSNRDFSIYDTSFYWYKVLGALL  555

Query  585  TMALGYVISNLSRVALKIPHDEPDPQLFFPFIASRIKKRRLQTEINQ  631
              A    +S +  +      ++ +P+L+ PF+ S + K     E+ +
Sbjct  556  VFAWAIPMSYVWPLD---KEEKQNPKLYSPFVRSMLNKPSPVLELEE  599


 Score = 223 bits (569),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 168/569 (30%), Positives = 278/569 (49%), Gaps = 43/569 (8%)

Query  676   NEYFSADKSMSIIPVGIALMVSFMSAITLLGLSAENYSYGTQFVGINVAYWIATPIICYG  735
              EY    K M  +PV I+L+ S +S + ++ + AE YS+G   + +  A  ++ P++ Y 
Sbjct  58    EEYLQGGKRMPTLPVAISLVSSQLSGVAMMSVPAETYSFGFNMIFVVWAMVLSVPVLIYI  117

Query  736   YVPVFFNLGAISAYEYLDKRFGYGARITASFAYWVQLLLYSGVVLYAPALALEATTGMNI  795
              VPVF++    + YEYL+ RF    R   +  + +   L   V ++ P+LA    TG NI
Sbjct  118   IVPVFYDNNVSNCYEYLELRFSKRTRQLVTITFILNQFLMLPVYMFVPSLAFSQVTGYNI  177

Query  796   VTSIVAIGLVCAFYSTIGGIKAVLITDVFQGGLMFISLFIVIFTAAHRVGGVGEIWRIAS  855
                   +  +C FY+ +GGIKAV+ TDV QG +M IS+ +V        GG+  +   A+
Sbjct  178   HLINTVVSSICVFYTMLGGIKAVVWTDVVQGSVMLISVVLVAILGTSNTGGITNVLENAA  237

Query  856   EGKRIQFDNTSSDPTVRHTWWGLIIGGMCTYLSLFGVNQVQVQRMMTLKNIKSA-RVAYW  914
             EG R  F +   DP +R T+   +  G+  +    G++Q  VQR+++L +   A R    
Sbjct  238   EGGRFDF-SFGIDPRLRLTFISGMASGLLMWTGKLGLDQSCVQRIVSLPSYGHAKRCLLM  296

Query  915   VNVFMLSCLSILTCFSGLALYSHYYECDPKVTKRIGSMDMLMPLYVMDTLSSIPGVPGLF  974
               V  L  +S  TCF+G+ ++++YY CDP     +   D LMP ++ D +  + G+PG+F
Sbjct  297   AGVGFLLIMS-FTCFTGIIMFAYYYGCDPIQAGLVSKPDKLMPFFIQDIMGHMMGMPGVF  355

Query  975   VAGIFSAGLSTISAGLNSLAAVTLEDYIKPIYTWSSGHEFSEKQSIICSKILVLVFGILC  1034
             ++ +FSA LS++SA LNS A V   DYIKP       H  SE ++    K++++V G  C
Sbjct  356   ISCVFSASLSSLSASLNSFAGVVYFDYIKP----RINH--SEAKANATMKLVIVVMGAYC  409

Query  1035  IALAFAAQLLGGVLQASLTIFGVVGGPLLGIFTLGMLTESTNQIGAVMGTLTSFAFCMWI  1094
             I   F  Q    ++Q   TI G+  G ++G+F LGM     N   AV G   S    +WI
Sbjct  410   IVGGFIVQNFNSIIQTMWTITGINMGAVVGVFCLGMFVPRCNAKVAVSGIAFSCLVMLWI  469

Query  1095  AF-GQPR---------PVPPAL--------SISADGCSNKTSDFVGKI----LQSEK---  1129
                GQ           P+P  L         +  +   NK    VG      L++ K   
Sbjct  470   IINGQMNFKAGLIKYDPLPNGLDQCEAKGFEVILNAIRNKNVTNVGTTAIPSLEAPKELT  529

Query  1130  ----ADSYFYLFKISYMWYSAIGFIITMVIGYAVSHLSRIFNKKDADELDPDLFFPFVSR  1185
                 ++  F ++  S+ WY  +G +  +V  +A+  +S ++     ++ +P L+ PFV  
Sbjct  530   TAFDSNRDFSIYDTSFYWYKVLGAL--LVFAWAIP-MSYVWPLDKEEKQNPKLYSPFVRS  586

Query  1186  RIKRRRQ--HLTEIDVNLSLQKSCLPDSK  1212
              + +      L E+ +   L +  + + +
Sbjct  587   MLNKPSPVLELEELPLKTPLSEEQIKEKE  615



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000112-PA

Length=283
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJF1_DROME  unnamed protein product                                 283     1e-94
Q8SY13_DROME  unnamed protein product                                 279     2e-92
Q94534_DROME  unnamed protein product                                 186     3e-56


>Q9VJF1_DROME unnamed protein product
Length=361

 Score = 283 bits (724),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/284 (49%), Positives = 192/284 (68%), Gaps = 13/284 (5%)

Query  1    LRMMELVIPKHVVRSQAVRLECNYNLDNVGLYSVKWYKDGNEFYRYVPREKPPVLVFTLP  60
            LR+ E+ IP +V++  A +LEC Y+LD   LYSVKWYKDGNEFYRYVPR+ PP   F LP
Sbjct  25   LRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRYVPRDMPPAQTFLLP  84

Query  61   GITVDIHNSTESSVVLNSVNLMSSGRYRCEVSGEAPAFQTVSEHADMEVVALPEEG-PII  119
            G+ VD+HNS+++ V L +VNL S+GR+RCEVSGEAP+FQTV+EH DM V  LP+EG P I
Sbjct  85   GVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKI  144

Query  120  NGRGSRQRYQAHDVVRFNCTSAKSKPAATLSWFINGEPAQGQYVKVFGAHIKEVDREGLE  179
            +  G R RYQ  D VR NCT+ +SKPA  LSW +NGEP + Q ++ +   +    R+GLE
Sbjct  145  S--GGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVS--GRDGLE  200

Query  180  TVTRGLQVRIQDYHFKRGIMKIKCLAQIATVYWKSNELSIENGFRSNIESNKIPVMESRE  239
            T   GLQ R++  HF++G MK+KC+A+++TVYW+ NE S+E          K PV+ESRE
Sbjct  201  TSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGD-----RPQKAPVLESRE  255

Query  240  TRPQGHTHAEHILANSGCESRICKSHATKLLLLTIISLASLLMV  283
            T    ++ A+ + A+S   +    S     L+L  ++LA ++M 
Sbjct  256  TVYASNSRADPVQASSTASA---PSTPITPLVLLPVALAVMVMA  296


>Q8SY13_DROME unnamed protein product
Length=383

 Score = 279 bits (713),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 181/264 (69%), Gaps = 10/264 (4%)

Query  1    LRMMELVIPKHVVRSQAVRLECNYNLDNVGLYSVKWYKDGNEFYRYVPREKPPVLVFTLP  60
            LR+ E+ IP +V++  A +LEC Y+LD   LYSVKWYKDGNEFYRYVPR+ PP   F LP
Sbjct  25   LRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNEFYRYVPRDMPPAQTFLLP  84

Query  61   GITVDIHNSTESSVVLNSVNLMSSGRYRCEVSGEAPAFQTVSEHADMEVVALPEEG-PII  119
            G+ VD+HNS+++ V L +VNL S+GR+RCEVSGEAP+FQTV+EH DM V  LP+EG P I
Sbjct  85   GVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKI  144

Query  120  NGRGSRQRYQAHDVVRFNCTSAKSKPAATLSWFINGEPAQGQYVKVFGAHIKEVDREGLE  179
            +  G R RYQ  D VR NCT+ +SKPA  LSW +NGEP + Q ++ +   +    R+GLE
Sbjct  145  S--GGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKLRKYDTIVS--GRDGLE  200

Query  180  TVTRGLQVRIQDYHFKRGIMKIKCLAQIATVYWKSNELSIENGFRSNIESNKIPVMESRE  239
            T   GLQ R++  HF++G MK+KC+A+++TVYW+ NE S+E          K PV+ESRE
Sbjct  201  TSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGD-----RPQKAPVLESRE  255

Query  240  TRPQGHTHAEHILANSGCESRICK  263
            T    ++ A+ +   S  E  + K
Sbjct  256  TVYASNSRADPVQGTSYRELFVTK  279


>Q94534_DROME unnamed protein product
Length=427

 Score = 186 bits (473),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 134/219 (61%), Gaps = 10/219 (5%)

Query  1    LRMMELVIPKHVVRSQAVRLECNYNLDNVGLYSVKWYKDGNEFYRYVPREKPPVLVFTLP  60
            LR + + +P  V RS+   L+C Y++++  LYSVKWYK   EFYRY P+E PP+ VF  P
Sbjct  27   LRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPKETPPMKVFHFP  86

Query  61   GITVDIHNSTESSVVLNSVNLMSSGRYRCEVSGEAPAFQTVSEHADMEVVALPEEGPIIN  120
            G+ V   +S ES VVL++V + +SG+Y CEVS +AP+F T+   A++EV+  P   P I 
Sbjct  87   GVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPHNAPFIT  146

Query  121  GRGSRQRYQAHDVVRFNCTSAKSKPAATLSWFINGE---PAQGQYVKVFGAHIKEVDREG  177
              G R RY+  D++R NCTS  S+PAA L+W +N E   PA  ++ K+         R  
Sbjct  147  --GIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKIL-----RDARND  199

Query  178  LETVTRGLQVRIQDYHFKRGIMKIKCLAQIATVYWKSNE  216
            +ET   G+   + D HF  G +K++C AQ+  VYWK+ E
Sbjct  200  METAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTE  238



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000113-PA

Length=79


***** No hits found *****



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000114-PA

Length=318
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SY13_DROME  unnamed protein product                                 249     2e-80
Q9VJF1_DROME  unnamed protein product                                 248     4e-80
Q94534_DROME  unnamed protein product                                 167     3e-48


>Q8SY13_DROME unnamed protein product
Length=383

 Score = 249 bits (635),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/273 (47%), Positives = 170/273 (62%), Gaps = 7/273 (3%)

Query  21   LLSLLVLCATWLLDAVEALMMTNLKIPTHVVQNQTVRMECEFDLDGEPLYSVKWYKDGNE  80
            LL+ L    T     V  L +T ++IP +V++    ++EC +DLDGE LYSVKWYKDGNE
Sbjct  7    LLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNE  66

Query  81   FYRYVPNERPDVHVFSLPGVNVDKHSSSERSVAIHRVNLDSSGRYRCEVSGEAPAFDTIS  140
            FYRYVP + P    F LPGVNVD H+SS+  V +  VNL S+GR+RCEVSGEAP+F T++
Sbjct  67   FYRYVPRDMPPAQTFLLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVT  126

Query  141  DHSDLVVVVLPKDG-PIISGGKSKYQLGDLVRMNCTSAPSKPHATLTWYINNIEVTDNKT  199
            +H D++V  LP +G P ISGG+ +YQ+GD VR+NCT+  SKP   L+W +N   V   K 
Sbjct  127  EHGDMIVAYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKL  186

Query  200  IGPRSHRMDKNGLEIEKLGLKFEVKPSHFLHGDIHFKCIATIPLVYKRVEEHRVIGDSSF  259
                +    ++GLE   LGL+F V+  HF  G++  KCIA +  VY R  E  V GD   
Sbjct  187  RKYDTIVSGRDGLETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQ  246

Query  260  FKQPLESRETRAQSHNPKRASQLQ----RPLFV  288
                LESRET   S++  RA  +Q    R LFV
Sbjct  247  KAPVLESRETVYASNS--RADPVQGTSYRELFV  277


>Q9VJF1_DROME unnamed protein product
Length=361

 Score = 248 bits (632),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 166/264 (63%), Gaps = 3/264 (1%)

Query  21   LLSLLVLCATWLLDAVEALMMTNLKIPTHVVQNQTVRMECEFDLDGEPLYSVKWYKDGNE  80
            LL+ L    T     V  L +T ++IP +V++    ++EC +DLDGE LYSVKWYKDGNE
Sbjct  7    LLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNE  66

Query  81   FYRYVPNERPDVHVFSLPGVNVDKHSSSERSVAIHRVNLDSSGRYRCEVSGEAPAFDTIS  140
            FYRYVP + P    F LPGVNVD H+SS+  V +  VNL S+GR+RCEVSGEAP+F T++
Sbjct  67   FYRYVPRDMPPAQTFLLPGVNVDLHNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVT  126

Query  141  DHSDLVVVVLPKDG-PIISGGKSKYQLGDLVRMNCTSAPSKPHATLTWYINNIEVTDNKT  199
            +H D++V  LP +G P ISGG+ +YQ+GD VR+NCT+  SKP   L+W +N   V   K 
Sbjct  127  EHGDMIVAYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQQKL  186

Query  200  IGPRSHRMDKNGLEIEKLGLKFEVKPSHFLHGDIHFKCIATIPLVYKRVEEHRVIGDSSF  259
                +    ++GLE   LGL+F V+  HF  G++  KCIA +  VY R  E  V GD   
Sbjct  187  RKYDTIVSGRDGLETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQ  246

Query  260  FKQPLESRETRAQSHNPKRASQLQ  283
                LESRET   S++  RA  +Q
Sbjct  247  KAPVLESRETVYASNS--RADPVQ  268


>Q94534_DROME unnamed protein product
Length=427

 Score = 167 bits (423),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 134/227 (59%), Gaps = 1/227 (0%)

Query  34   DAVEALMMTNLKIPTHVVQNQTVRMECEFDLDGEPLYSVKWYKDGNEFYRYVPNERPDVH  93
            +   AL    +++P  V +++   ++C +D++ + LYSVKWYK   EFYRY P E P + 
Sbjct  22   EMTAALRDVRVRVPHAVRRSEKAILKCFYDIEDDSLYSVKWYKGRREFYRYTPKETPPMK  81

Query  94   VFSLPGVNVDKHSSSERSVAIHRVNLDSSGRYRCEVSGEAPAFDTISDHSDLVVVVLPKD  153
            VF  PGV V + SS+E  V +  V + +SG+Y CEVS +AP+F T+   ++L V+  P +
Sbjct  82   VFHFPGVKVRRVSSNESQVVLDAVTMATSGKYSCEVSADAPSFHTLIAAAELEVIETPHN  141

Query  154  GPIISGGKSKYQLGDLVRMNCTSAPSKPHATLTWYINNIEVTDNKTIGPRSHRMDKNGLE  213
             P I+G + +Y++GD++R NCTS  S+P A LTW +NN EV        +  R  +N +E
Sbjct  142  APFITGIRPRYRVGDILRGNCTSRHSRPAANLTWTVNNEEVNPALVRHHKILRDARNDME  201

Query  214  IEKLGLKFEVKPSHFLHGDIHFKCIATIPLVYKRVEEHRVIGDSSFF  260
               +G+ F V   HF +G +  +C A +  VY +  E ++I ++  F
Sbjct  202  TAVVGIHFVVTDQHFDNGKLKLRCSAQLHDVYWKTTE-KIILETDLF  247



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000115-PA

Length=216
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJF1_DROME  unnamed protein product                                 110     2e-28
Q8SY13_DROME  unnamed protein product                                 110     2e-28
Q95UI2_DROME  unnamed protein product                                 93.6    9e-25


>Q9VJF1_DROME unnamed protein product
Length=361

 Score = 110 bits (274),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%)

Query  58   YSSSERSVVIHRVNLDSSGRYRCEVSGEAPAFDTISDHSDLVVVVLPKDG-PKISGGKSK  116
            ++SS+  V +  VNL S+GR+RCEVSGEAP+F T+++H D++V  LP +G PKISGG+ +
Sbjct  91   HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPR  150

Query  117  YQLGDLVHMNCTSAPSKPHATLTWYINNIEVSR  149
            YQ+GD V +NCT+  SKP   L+W +N   V +
Sbjct  151  YQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQ  183


>Q8SY13_DROME unnamed protein product
Length=383

 Score = 110 bits (274),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 68/93 (73%), Gaps = 1/93 (1%)

Query  58   YSSSERSVVIHRVNLDSSGRYRCEVSGEAPAFDTISDHSDLVVVVLPKDG-PKISGGKSK  116
            ++SS+  V +  VNL S+GR+RCEVSGEAP+F T+++H D++V  LP +G PKISGG+ +
Sbjct  91   HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPR  150

Query  117  YQLGDLVHMNCTSAPSKPHATLTWYINNIEVSR  149
            YQ+GD V +NCT+  SKP   L+W +N   V +
Sbjct  151  YQIGDYVRVNCTAGRSKPAVKLSWQVNGEPVEQ  183


>Q95UI2_DROME unnamed protein product
Length=97

 Score = 93.6 bits (231),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 57/72 (79%), Gaps = 1/72 (1%)

Query  58   YSSSERSVVIHRVNLDSSGRYRCEVSGEAPAFDTISDHSDLVVVVLPKDG-PKISGGKSK  116
            ++SS+  V +  VNL S+GR+RCEVSGEAP+F T+++H D++V  LP +G PKISGG+ +
Sbjct  26   HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIVAYLPDEGSPKISGGRPR  85

Query  117  YQLGDLVHMNCT  128
            YQ+GD V +NCT
Sbjct  86   YQIGDYVRVNCT  97



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000116-PA

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5DX48_CAEEL  unnamed protein product                                 32.7    0.52 
MNK_CAEEL  unnamed protein product                                    30.0    3.1  
ABCGO_DICDI  unnamed protein product                                  29.6    4.3  


>Q5DX48_CAEEL unnamed protein product
Length=2886

 Score = 32.7 bits (73),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 26/91 (29%), Positives = 40/91 (44%), Gaps = 3/91 (3%)

Query  228   TPSITPNSVHYCRPIEFRFAKETSELSKRLFFHYQSLLNKVDFFKVFIGDFKTGFEMYCT  287
             +P I   +V  CR     FA+ T++  +++ F   SL ++ D     +  F    EM   
Sbjct  1684  SPIIGEIAVGVCRGESPSFARATADEYRKMIFASPSLFSQNDLLSAVV--FCMSEEMDTP  1741

Query  288   MMDNNNL-SRVNRPKSFESMLATFHAWIRCL  317
                N +  SR  R  SFE +  T H  +R L
Sbjct  1742  FWANEDANSRNWRVPSFEQLSCTVHHIVRLL  1772


>MNK_CAEEL unnamed protein product
Length=707

 Score = 30.0 bits (66),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 23/97 (24%), Positives = 45/97 (46%), Gaps = 3/97 (3%)

Query  132  RTLHEDDLLCIKDNNVVFVGKCEMDGASGQQIHRQKWITTNKRSKLD-ASVLHESETLSN  190
            R +  +++LC   N+V  V  C++D AS +    ++   +   S+ D AS +  +E ++ 
Sbjct  324  RDVKPENVLCTDPNHVSPVKLCDLDLASQRPPQHERHPLSQVASEPDLASPVGSAEFMAP  383

Query  191  --LDSYYTDDLDSDAENHIENFTTDRYVFIIFMVPLQ  225
              +D+Y  D L  D +    +     Y+ +    P Q
Sbjct  384  EVVDAYVGDSLKYDKKCDTWSLGVILYIMLAGYAPFQ  420


>ABCGO_DICDI unnamed protein product
Length=1159

 Score = 29.6 bits (65),  Expect = 4.3, Method: Composition-based stats.
 Identities = 29/100 (29%), Positives = 44/100 (44%), Gaps = 7/100 (7%)

Query  123  LEHTAQRILRTLHEDDLLCIKDNNVVFVGKCEMDGASGQQIHRQKWITTNKRSKLDASVL  182
            LE   QR+   L E  L  + DN +   G  E  G SG +  R   ++      +D S+L
Sbjct  571  LEIKQQRVASVLEELGLTRVADNPI---GTSEKRGISGGERRR---LSIATELIVDPSIL  624

Query  183  HESETLSNLDSYYTDDLDSDAENHIENFTTDRYVFIIFMV  222
               E  S LDS+   +L +  +  + N +T     IIF +
Sbjct  625  FIDEPTSGLDSHSASELITKLK-QLANNSTKGQRTIIFSI  663



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000117-PA

Length=153
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJF1_DROME  unnamed protein product                                 102     2e-26
Q8SY13_DROME  unnamed protein product                                 102     2e-26
Q9BMG9_DROME  unnamed protein product                                 70.5    1e-14


>Q9VJF1_DROME unnamed protein product
Length=361

 Score = 102 bits (253),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)

Query  21   VLCATWLLGA-----VEGLMMTNLKIPTHVVQNQTVRMECEFDLDGEPLYSVKWYKDGNE  75
            +L A + +G      V GL +T ++IP +V++    ++EC +DLDGE LYSVKWYKDGNE
Sbjct  7    LLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNE  66

Query  76   FYRYVPNERPDIHVFSLPGVNVDPHSPS  103
            FYRYVP + P    F LPGVNVD H+ S
Sbjct  67   FYRYVPRDMPPAQTFLLPGVNVDLHNSS  94


>Q8SY13_DROME unnamed protein product
Length=383

 Score = 102 bits (254),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 60/88 (68%), Gaps = 5/88 (6%)

Query  21   VLCATWLLGA-----VEGLMMTNLKIPTHVVQNQTVRMECEFDLDGEPLYSVKWYKDGNE  75
            +L A + +G      V GL +T ++IP +V++    ++EC +DLDGE LYSVKWYKDGNE
Sbjct  7    LLAALFFIGTLKDFRVAGLRLTEVRIPMYVIKGTAAQLECLYDLDGEALYSVKWYKDGNE  66

Query  76   FYRYVPNERPDIHVFSLPGVNVDPHSPS  103
            FYRYVP + P    F LPGVNVD H+ S
Sbjct  67   FYRYVPRDMPPAQTFLLPGVNVDLHNSS  94


>Q9BMG9_DROME unnamed protein product
Length=431

 Score = 70.5 bits (171),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 48/83 (58%), Gaps = 10/83 (12%)

Query  17   SLQLVLCATWLLGAVEGLMMTNLKI-PTHVVQNQTVRMECEFDLDGEPLYSVKWYKDGNE  75
            S++LV CA         L   NL I P  V + Q V + C +DLDG PLYS K+Y+   E
Sbjct  60   SMELVECA---------LRNVNLIIEPPAVRRGQHVVLRCMYDLDGAPLYSAKFYRGQLE  110

Query  76   FYRYVPNERPDIHVFSLPGVNVD  98
            FYRY P E P+  VF  PG++VD
Sbjct  111  FYRYTPGEFPNTKVFPFPGIHVD  133



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000118-PA

Length=276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJF1_DROME  unnamed protein product                                 97.8    2e-23
Q8SY13_DROME  unnamed protein product                                 97.8    3e-23
Q95UI2_DROME  unnamed protein product                                 82.0    1e-19


>Q9VJF1_DROME unnamed protein product
Length=361

 Score = 97.8 bits (242),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 67/115 (58%), Gaps = 28/115 (24%)

Query  112  HSSSERSVVIHRVNLDSSGRYRCEVSGEAPAFNTISDHSDLVVVDLDQECPKNALFCWLC  171
            H+SS+  V +  VNL S+GR+RCEVSGEAP+F T+++H D++V                 
Sbjct  91   HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIV-----------------  133

Query  172  FPIHLAAGDAAVLPKDG-PIISGGKSKYQLGDLVRMNCTSAPSKPHATLTWYINN  225
                      A LP +G P ISGG+ +YQ+GD VR+NCT+  SKP   L+W +N 
Sbjct  134  ----------AYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNG  178


>Q8SY13_DROME unnamed protein product
Length=383

 Score = 97.8 bits (242),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 67/115 (58%), Gaps = 28/115 (24%)

Query  112  HSSSERSVVIHRVNLDSSGRYRCEVSGEAPAFNTISDHSDLVVVDLDQECPKNALFCWLC  171
            H+SS+  V +  VNL S+GR+RCEVSGEAP+F T+++H D++V                 
Sbjct  91   HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIV-----------------  133

Query  172  FPIHLAAGDAAVLPKDG-PIISGGKSKYQLGDLVRMNCTSAPSKPHATLTWYINN  225
                      A LP +G P ISGG+ +YQ+GD VR+NCT+  SKP   L+W +N 
Sbjct  134  ----------AYLPDEGSPKISGGRPRYQIGDYVRVNCTAGRSKPAVKLSWQVNG  178


>Q95UI2_DROME unnamed protein product
Length=97

 Score = 82.0 bits (201),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 58/99 (59%), Gaps = 28/99 (28%)

Query  112  HSSSERSVVIHRVNLDSSGRYRCEVSGEAPAFNTISDHSDLVVVDLDQECPKNALFCWLC  171
            H+SS+  V +  VNL S+GR+RCEVSGEAP+F T+++H D++V                 
Sbjct  26   HNSSDAIVTLRNVNLQSAGRFRCEVSGEAPSFQTVTEHGDMIV-----------------  68

Query  172  FPIHLAAGDAAVLPKDG-PIISGGKSKYQLGDLVRMNCT  209
                      A LP +G P ISGG+ +YQ+GD VR+NCT
Sbjct  69   ----------AYLPDEGSPKISGGRPRYQIGDYVRVNCT  97



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000119-PA

Length=359
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJF1_DROME  unnamed protein product                                 56.6    9e-09
Q8SY13_DROME  unnamed protein product                                 56.6    1e-08
Q9VCL1_DROME  unnamed protein product                                 39.7    0.003


>Q9VJF1_DROME unnamed protein product
Length=361

 Score = 56.6 bits (135),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 0/70 (0%)

Query  195  KNGLEIEKLGLKFEVKPSHFLHGDIHFKCIATIPLVYKRVEEHRVIGDSSFFKQPLESRE  254
            ++GLE   LGL+F V+  HF  G++  KCIA +  VY R  E  V GD       LESRE
Sbjct  196  RDGLETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRE  255

Query  255  TRAQSHVRND  264
            T   S+ R D
Sbjct  256  TVYASNSRAD  265


>Q8SY13_DROME unnamed protein product
Length=383

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 39/70 (56%), Gaps = 0/70 (0%)

Query  195  KNGLEIEKLGLKFEVKPSHFLHGDIHFKCIATIPLVYKRVEEHRVIGDSSFFKQPLESRE  254
            ++GLE   LGL+F V+  HF  G++  KCIA +  VY R  E  V GD       LESRE
Sbjct  196  RDGLETSVLGLQFRVEQKHFRKGNMKLKCIAELSTVYWRCNEESVEGDRPQKAPVLESRE  255

Query  255  TRAQSHVRND  264
            T   S+ R D
Sbjct  256  TVYASNSRAD  265


>Q9VCL1_DROME unnamed protein product
Length=413

 Score = 39.7 bits (91),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (51%), Gaps = 2/89 (2%)

Query  149  YLIMQNNFAPCNRFDSVPHKNVDHSARDQKFITDNKTIGPRSHRMDKNGLEIEKLGLKFE  208
            Y I +  +  C    S P  ++     +Q  I D   +   +  + K+GL    LGL+  
Sbjct  306  YQIGEYLYLNCTSGKSHPASHLQWFVNEQP-ILDEHYLHKYNDIVHKHGLITSTLGLQLP  364

Query  209  VKPSHFLHGDIHFKCIATI-PLVYKRVEE  236
            ++P HF  GD+  KC+A+I P+++K  +E
Sbjct  365  LEPRHFHEGDMRVKCLASISPVLWKGGKE  393



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000120-PA

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NUP35_CAEEL  unnamed protein product                                  56.6    1e-08
ORC1_DROME  unnamed protein product                                   30.8    2.0  
G5ECK4_CAEEL  unnamed protein product                                 30.0    3.6  


>NUP35_CAEEL unnamed protein product
Length=381

 Score = 56.6 bits (135),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 2/79 (3%)

Query  183  WVTVFGFPITSLNTVLSHISSRVRIVDKHSAPHSQSNWIHLKCSSEQEAQRALTCNGNIV  242
            WVTVFGF  + ++ +L+  S    +V  H  P S+ N+IH++ S    AQ+A++ NG ++
Sbjct  200  WVTVFGFQPSQVSILLNLFSRHGEVV-SHQTP-SKGNFIHMRYSCVTHAQQAISRNGTLL  257

Query  243  AGSIMIGVVPCTDEGVIIG  261
                 IGVV CT++ VI G
Sbjct  258  DQDTFIGVVQCTNKDVING  276


>ORC1_DROME unnamed protein product
Length=924

 Score = 30.8 bits (68),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 18/57 (32%), Positives = 31/57 (54%), Gaps = 6/57 (11%)

Query  13   TFLLNKKMEPMTL--GSPVGSPAQPQNSPGTNSGYLPGFLLGDTNAQSRTRVMTPES  67
            +F+   K+ P+ +  G  V   ++ +N+P  N+ YLP   L + NA    +V TP+S
Sbjct  255  SFICENKVSPIKIVGGRSVVRLSEKKNAPEINANYLPASPLTEKNA----KVETPKS  307


>G5ECK4_CAEEL unnamed protein product
Length=1523

 Score = 30.0 bits (66),  Expect = 3.6, Method: Compositional matrix adjust.
 Identities = 24/86 (28%), Positives = 38/86 (44%), Gaps = 6/86 (7%)

Query  41   TNSGYLPGFLLGDTNAQSRTRVMTPESTRYGNSGHNVQNSPVTSYTTPEFRINRQKAMFG  100
            +N GYL GFL+ D   Q   R + PE+  +  + H    SP+     P F  +  +A   
Sbjct  99   SNPGYLDGFLVNDNAVQIGRRGLLPEA--HLVNLHVSAESPM----KPSFTTDFSEADVR  152

Query  101  GGNNLNISQINTENHAGGPPTKSLYD  126
                    +  T N+A  P  +++YD
Sbjct  153  FRTPATAPKAATSNYAVSPYARAVYD  178



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000121-PA

Length=231
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9UAU3_CAEEL  unnamed protein product                                 69.7    1e-13
RBP9X_DROME  unnamed protein product                                  44.3    4e-05
GEFH_DICDI  unnamed protein product                                   30.8    1.1  


>Q9UAU3_CAEEL unnamed protein product
Length=397

 Score = 69.7 bits (169),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 98/181 (54%), Gaps = 6/181 (3%)

Query  28   RTQMNNLIMNYLVTEGFKEAAEKFQQESG-VKPAVELDSMDDRIRIRDAIQNGRIEEAKT  86
            R ++  L++++ +  G+ E  E F +E   V P  ++D+M+ R  +R  I  G +E A  
Sbjct  170  REELQQLVIDHFLHHGYSEVIETFSKEVNIVVPKKDIDNMNARNEVRRLICVGEMESAIE  229

Query  87   LVNQLHPELLDNDRYLHFHLQQLHLIELIRSGRIEEALQFAQEQLSEAGE--SDENILGE  144
             +  L P +L++D  ++F +++ HLIE++R    +E +++ +  L + G+   DE  +  
Sbjct  230  KMTTLCPTILEDDE-INFIVRKQHLIEMVRQKLTKEPVEYFRAHLMKNGQRPCDEK-MDI  287

Query  145  LERTLALLAFDEPQKSPFSDLLHPTHRQKIASELNAAILKMEYQESTSPRVNNLLKMILW  204
            +ER   +L F+      F+     + R++ A E+N+A+L M  +  +S R++ L K I +
Sbjct  288  IERIFTMLVFNLEDDVEFNVYFQQSEREQTAKEVNSALLAMNGKLKSS-RLDLLAKTIAF  346

Query  205  A  205
             
Sbjct  347  T  347


>RBP9X_DROME unnamed protein product
Length=962

 Score = 44.3 bits (103),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/91 (32%), Positives = 44/91 (48%), Gaps = 0/91 (0%)

Query  31   MNNLIMNYLVTEGFKEAAEKFQQESGVKPAVELDSMDDRIRIRDAIQNGRIEEAKTLVNQ  90
            MN L+  YLV   F + AE F   +      +L S+  R +I   I  G++ +A     +
Sbjct  621  MNRLVSTYLVHNAFSKTAEAFNGYTNQTFNEDLASIKTRQKIIKLILTGKMSQAIEHTLR  680

Query  91   LHPELLDNDRYLHFHLQQLHLIELIRSGRIE  121
              P LL+N++ L F L+    IE+I    IE
Sbjct  681  SFPGLLENNKNLWFALKCRQFIEMINGADIE  711


 Score = 43.9 bits (102),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 9/76 (12%)

Query  117  SGR-IEEALQFAQEQLSEAGES--DENILGELER-----TLALLAFDEPQKSPFSDLLHP  168
             GR IE+ L+F +E LS  G+    EN++ E ER       +L+A+  P  SP   LL P
Sbjct  844  CGRVIEKILEFGKE-LSSMGQQLEKENLMTEEERQMLEDAFSLIAYSNPWSSPLGWLLCP  902

Query  169  THRQKIASELNAAILK  184
            + R+ +++ LN+AIL+
Sbjct  903  SRRESVSTTLNSAILE  918


>GEFH_DICDI unnamed protein product
Length=604

 Score = 30.8 bits (68),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query  19   RLEEGHQVQRTQMNNLIMNYLVTEGFKEAAEKFQQESGVKPA---VELDSMDD--RIRIR  73
            + E  H +  T +  LIM Y   E    + +K Q+E+ V+     V+ DS+++  RI I+
Sbjct  107  KTEASHSINDTMLLKLIMQYFHEENLTTSLKKIQEETKVQFTPNEVDKDSLENLLRIGIK  166

Query  74   DAIQNGRIEE  83
            D    G +E+
Sbjct  167  DTNWFGPLED  176



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000122-PA

Length=529
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHI1_DROME  unnamed protein product                                 708     0.0  
Q383Q6_TRYB2  unnamed protein product                                 57.8    8e-09
Q9VTX2_DROME  unnamed protein product                                 31.6    2.2  


>Q9VHI1_DROME unnamed protein product
Length=538

 Score = 708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/541 (65%), Positives = 424/541 (78%), Gaps = 15/541 (3%)

Query  1    MADPLSLLRQYNVNKREIIERDKQIIFGEFSWPKSVKTNYLTYGSGKEGSPKEYYTLECL  60
            MADPLSLLRQYN+NK+EI+ERD QIIFGEFSWPKSVKTNYL YGSGK+G+P+EYYTLECL
Sbjct  1    MADPLSLLRQYNINKKEIVERDSQIIFGEFSWPKSVKTNYLKYGSGKKGAPREYYTLECL  60

Query  61   LFLLKNVQLTHPVYVRQAAAENIPVVRRPDRKDLLAYLNGETATSVAIDKSAPLEIPTQV  120
            L+LLKNV L H VYVRQ AAE+IP V RPDRK+LLAYLNGET T  +IDKSAPLEIPTQV
Sbjct  61   LYLLKNVMLQHSVYVRQCAAEDIPAVNRPDRKELLAYLNGETPTCASIDKSAPLEIPTQV  120

Query  121  KRPAE---DGLESGSKKPRYEETHVQKVKEQLAARLDA-PKEASVTVENIKSLSEAMSVE  176
            KR AE     +E  +KK R+EET VQKV+EQLAAR D   KE +V ++NIKSLSE MSVE
Sbjct  121  KRAAEGEPSSVEVAAKKARFEETQVQKVREQLAARWDVNQKETAVNMDNIKSLSETMSVE  180

Query  177  KIAAIKAKRLAKKRTTINEKD-DIGMGSDLRDILDMEVEDTKNIVSRERQWRTRTTILQS  235
            KIAAIKAKRLA KRTTI   D D  MG+DLR ILD +V+ TK+I+SRERQWRTRT+ILQS
Sbjct  181  KIAAIKAKRLANKRTTIKRTDNDEAMGTDLRAILDYDVDSTKDIISRERQWRTRTSILQS  240

Query  236  SGKVFAKNIFAILTSIKAREEGRQKGPIVPTPMVTPRSTPL-RPLPQPAVYNRYDQERFI  294
            +GK+FAKNIFA+L  IKAREEGR + P VP P+  P    + +P PQ + YNRYDQERF 
Sbjct  241  TGKIFAKNIFAMLQGIKAREEGRNR-PQVPNPIKMPEPARIAKPQPQLSQYNRYDQERFN  299

Query  295  RQKEETEGFKIDTMGTYHGMTLKSVTEGTNPAVRKPIASTPVNPSVAPTSG------LIP  348
            RQKEETEGFKIDT+GTYHGM+LKSVTEG+    +    + P  P V   +       L+P
Sbjct  300  RQKEETEGFKIDTLGTYHGMSLKSVTEGSLAQRKAQANNLPGAPGVIAGAAAGRPKELLP  359

Query  349  TSAAKLTPQQAAQNKRPSRTPIIIIPSANTSLITMYNAKDILQDLKFISNDEKRNLAAKR  408
             + A+  P     +KR SRTPIIIIPSANTSLITM NAKDILQ+L+F+S  +K+    +R
Sbjct  360  AAQARQLPANGP-SKRTSRTPIIIIPSANTSLITMLNAKDILQELRFMSTSDKKLQGCQR  418

Query  409  ENEILLQRRKEGGFTVPYRVVDNPQKLTNADWERVVAVFVMGPAWQFKGWPFDGNPVEIF  468
            E E+LLQR++    TV YRV+DNP KL+  +W+RVVAVFVMGP WQFKGWP++GNPV+IF
Sbjct  419  ECEVLLQRKRNNQ-TVSYRVIDNPTKLSQQEWQRVVAVFVMGPQWQFKGWPWEGNPVDIF  477

Query  469  SKICAFHIKYDEMRTDANVARWAVTVIELSKTKRHLDRAAIMRFWEVLDKHMIKNKAHLR  528
            SKICAFH+ + EM+ D+NV RW+VT++ LS+ KRH+DRA + +FWE LDK++ K K  LR
Sbjct  478  SKICAFHLCFSEMKLDSNVERWSVTLLRLSQNKRHMDRAVLSKFWETLDKYIAKYKPDLR  537

Query  529  F  529
            +
Sbjct  538  Y  538


>Q383Q6_TRYB2 unnamed protein product
Length=391

 Score = 57.8 bits (138),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 88/194 (45%), Gaps = 34/194 (18%)

Query  354  LTPQQAAQ-NKRPSRTPIIIIPSANTSLITMYNAKDILQDLKFIS---------------  397
            + P+  +Q N++ +  P+I+I  + +S++ + N KD L+D  ++                
Sbjct  191  MVPEYHSQRNRKLNFVPLILISPSVSSVLQVINIKDFLEDGVYVEPSSRFLNPVTGDMNV  250

Query  398  NDEKRNLAAKRENEILLQRRKEGGFTVPYRVVDNPQKLTNADWERVVAVFVMGPAWQFKG  457
             D  +++  K  +   L   K       +RVV+ P+++ N  W  V A  V G  WQF  
Sbjct  251  EDAPKHITVKPGS--FLDADKYRVAYREFRVVNGPKQVKN--WNHVCACIVDGNEWQFNR  306

Query  458  WPFDGNP----VEIFSKICAFHIKYDEMRTDANVARWAVTVIELS----KTKRHLDRAAI  509
            W  D  P      +F ++C F   ++E +    +  W VT ++L+    K+  H+ +A+ 
Sbjct  307  WFPDEVPSLCVSRLFQRVCGFLPYFEEDKPPKALQEWHVTPLKLTRRVVKSHTHIRQASA  366

Query  510  MRFWE----VLDKH  519
              FWE     LD H
Sbjct  367  --FWEHLYLFLDTH  378


>Q9VTX2_DROME unnamed protein product
Length=663

 Score = 31.6 bits (70),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (51%), Gaps = 2/67 (3%)

Query  124  AEDGLESGSKKPRYEETHVQKVKEQLAARLDAPKEASVTVENIKSLSEAMSVEKIAAIKA  183
            AE  L+   K P  + TH+   +++L++    PKEA  T E +  L+   S E + A K 
Sbjct  198  AEISLKIAEKMPGCDATHIALCRKELSSVKPKPKEA--TSEQVPQLAHGESAELVGASKV  255

Query  184  KRLAKKR  190
             RL + +
Sbjct  256  VRLVETK  262



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000123-PA

Length=377
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VYE0_DROME  unnamed protein product                                 97.4    3e-22
DSX_DROME  unnamed protein product                                    86.3    4e-18
Q9XWN9_CAEEL  unnamed protein product                                 76.3    1e-15


>Q9VYE0_DROME unnamed protein product
Length=377

 Score = 97.4 bits (241),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/70 (63%), Positives = 54/70 (77%), Gaps = 0/70 (0%)

Query  26   RRPKCARCRNHGLISWLRGHKRECRYRECFCPKCSLIAERQRVMAAQVALKRQQAAEDAI  85
            R PKCARCRNHG+IS ++GHKR CR+REC CP C L+ +RQRVMAAQVAL+RQQ  E   
Sbjct  118  RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALE  177

Query  86   ALSMAKVTTG  95
            A + +  +TG
Sbjct  178  ATASSTKSTG  187


>DSX_DROME unnamed protein product
Length=549

 Score = 86.3 bits (212),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 47/65 (72%), Gaps = 0/65 (0%)

Query  28   PKCARCRNHGLISWLRGHKRECRYRECFCPKCSLIAERQRVMAAQVALKRQQAAEDAIAL  87
            P CARCRNHGL   L+GHKR C++R C C KC L A+RQRVMA Q AL+R QA ++  AL
Sbjct  42   PNCARCRNHGLKITLKGHKRYCKFRYCTCEKCRLTADRQRVMALQTALRRAQAQDEQRAL  101

Query  88   SMAKV  92
             M +V
Sbjct  102  HMHEV  106


>Q9XWN9_CAEEL unnamed protein product
Length=250

 Score = 76.3 bits (186),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 45/62 (73%), Gaps = 0/62 (0%)

Query  21   GPVKQRRPKCARCRNHGLISWLRGHKRECRYRECFCPKCSLIAERQRVMAAQVALKRQQA  80
            G  K+RRP C RC  H +++ L+GHKR C +R+CFC KC ++ ERQ++MA Q+ L+R+Q 
Sbjct  108  GKPKERRPNCQRCAQHSVVNRLKGHKRACPFRDCFCAKCQVVVERQKLMADQIKLRRRQK  167

Query  81   AE  82
             E
Sbjct  168  RE  169


 Score = 38.5 bits (88),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 18/61 (30%), Positives = 31/61 (51%), Gaps = 0/61 (0%)

Query  30  CARCRNHGLISWLRGHKRECRYRECFCPKCSLIAERQRVMAAQVALKRQQAAEDAIALSM  89
           C RC NHGL    + HK  C +R C C  C ++  R+++ +  + +   +  +    L+M
Sbjct  19  CQRCLNHGLREKRKNHKLSCTFRFCQCSNCIMVERRRQLNSRLMQIDGSRDEKPMTTLTM  78

Query  90  A  90
           A
Sbjct  79  A  79



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000124-PA

Length=283
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NGY0_DROME  unnamed protein product                                 40.4    0.002
M9NDS9_DROME  unnamed protein product                                 40.4    0.002
Q9W2Z3_DROME  unnamed protein product                                 40.0    0.002


>M9NGY0_DROME unnamed protein product
Length=3703

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 7/52 (13%)

Query  234  YIPHECECSKYYRCED-GNSLLG------TCPADLHFNYSIQDCDFPEDAGC  278
            +  H  +C KYY C D G S LG      TCP+ L+FN +   CDF  +  C
Sbjct  511  FFQHPRDCKKYYWCLDSGPSGLGIVAHMFTCPSGLYFNPAADSCDFARNVPC  562


>M9NDS9_DROME unnamed protein product
Length=4611

 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 7/52 (13%)

Query  234  YIPHECECSKYYRCED-GNSLLG------TCPADLHFNYSIQDCDFPEDAGC  278
            +  H  +C KYY C D G S LG      TCP+ L+FN +   CDF  +  C
Sbjct  511  FFQHPRDCKKYYWCLDSGPSGLGIVAHMFTCPSGLYFNPAADSCDFARNVPC  562


>Q9W2Z3_DROME unnamed protein product
Length=4519

 Score = 40.0 bits (92),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 27/52 (52%), Gaps = 7/52 (13%)

Query  234  YIPHECECSKYYRCED-GNSLLG------TCPADLHFNYSIQDCDFPEDAGC  278
            +  H  +C KYY C D G S LG      TCP+ L+FN +   CDF  +  C
Sbjct  511  FFQHPRDCKKYYWCLDSGPSGLGIVAHMFTCPSGLYFNPAADSCDFARNVPC  562



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000125-PA

Length=186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O17599_CAEEL  unnamed protein product                                 50.8    5e-08
RALA_DROME  unnamed protein product                                   50.4    8e-08
RHEB_DROME  unnamed protein product                                   49.7    1e-07


>O17599_CAEEL unnamed protein product
Length=181

 Score = 50.8 bits (120),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 31/49 (63%), Gaps = 1/49 (2%)

Query  5    VGNKCDESQSRREVAMSEGQAEADRWGCGFLETSAKTNHNVNTLFRDLL  53
            VGNKCD S  +R+V   EG A A+ W C F E SAK N NVN  F +++
Sbjct  114  VGNKCDLSH-QRQVRSEEGLALAESWSCPFTECSAKNNQNVNVTFAEIV  161


>RALA_DROME unnamed protein product
Length=201

 Score = 50.4 bits (119),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 24/49 (49%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query  5    VGNKCDESQSRREVAMSEGQAEADRWGCGFLETSAKTNHNVNTLFRDLL  53
            VGNKCD +  +R+V +SE Q  A +W   ++ETSAKT  NV+ +F DL+
Sbjct  122  VGNKCDLN-DKRKVPLSECQLRAQQWAVPYVETSAKTRENVDKVFFDLM  169


>RHEB_DROME unnamed protein product
Length=182

 Score = 49.7 bits (117),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 33/56 (59%), Gaps = 1/56 (2%)

Query  5    VGNKCDESQSRREVAMSEGQAEADRWGCGFLETSAKTNHNVNTLFRDLLTLEKNRS  60
            VGNK D  Q R  V+  EG+  A+ W   FLETSAK N +V  +F  LL L +N +
Sbjct  116  VGNKIDLHQERT-VSTEEGKKLAESWRAAFLETSAKQNESVGDIFHQLLILIENEN  170



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000126-PA

Length=148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RAPA_DICDI  unnamed protein product                                   109     7e-31
RAP1_CAEEL  unnamed protein product                                   108     2e-30
RAP1_DROME  unnamed protein product                                   106     1e-29


>RAPA_DICDI unnamed protein product
Length=186

 Score = 109 bits (273),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 77/113 (68%), Gaps = 2/113 (2%)

Query  36   DYRVVVFGAGGVGKSSLVLRFVKGTFRESYVPTIEDTYRQVISCNKNICTLQITDTTGSH  95
            ++++VV G+GGVGKS+L ++FV+G F E Y PTIED+YR+ +  + N C L+I DT G+ 
Sbjct  5    EFKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDSNQCMLEILDTAGTE  64

Query  96   QFPAMQRLSISKGHAFILVYSVSSRQSFEELRPIWEVIRELKGQDITQIPVML  148
            QF AM+ L +  G  F+LVYS+ S  +F EL  + E I  L+ +D   +P++L
Sbjct  65   QFTAMRDLYMKNGQGFVLVYSIISNSTFNELPDLREQI--LRVKDCEDVPMVL  115


>RAP1_CAEEL unnamed protein product
Length=188

 Score = 108 bits (270),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 79/113 (70%), Gaps = 2/113 (2%)

Query  36   DYRVVVFGAGGVGKSSLVLRFVKGTFRESYVPTIEDTYRQVISCNKNICTLQITDTTGSH  95
            +Y++VV G+GGVGKS+L ++FV+G F E Y PTIED+YR+ +  +   C L+I DT G+ 
Sbjct  3    EYKIVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTE  62

Query  96   QFPAMQRLSISKGHAFILVYSVSSRQSFEELRPIWEVIRELKGQDITQIPVML  148
            QF AM+ L +  G  F+LVYS++++ +F +L  + + I  L+ +D  ++P++L
Sbjct  63   QFTAMRDLYMKNGQGFVLVYSITAQSTFNDLMDLRDQI--LRVKDTDEVPMIL  113


>RAP1_DROME unnamed protein product
Length=184

 Score = 106 bits (265),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 78/113 (69%), Gaps = 2/113 (2%)

Query  36   DYRVVVFGAGGVGKSSLVLRFVKGTFRESYVPTIEDTYRQVISCNKNICTLQITDTTGSH  95
            +Y++VV G+GGVGKS+L ++FV+  F E Y PTIED+YR+ +  +   C L+I DT G+ 
Sbjct  3    EYKIVVLGSGGVGKSALTVQFVQCIFVEKYDPTIEDSYRKQVEVDGQQCMLEILDTAGTE  62

Query  96   QFPAMQRLSISKGHAFILVYSVSSRQSFEELRPIWEVIRELKGQDITQIPVML  148
            QF AM+ L +  G  F+LVYS++++ +F +L+ + E I  L+ +D   +P++L
Sbjct  63   QFTAMRDLYMKNGQGFVLVYSITAQSTFNDLQDLREQI--LRVKDTDDVPMVL  113



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000127-PA

Length=125
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q00085_DROME  unnamed protein product                                 28.1    1.5  
Q57UU4_TRYB2  unnamed protein product                                 28.5    1.6  
LSDA_DROME  unnamed protein product                                   27.7    3.0  


>Q00085_DROME unnamed protein product
Length=129

 Score = 28.1 bits (61),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 20/48 (42%), Positives = 25/48 (52%), Gaps = 2/48 (4%)

Query  35  QSEREKRKLNRRLN-HGNKKSALYDEKGLYIPTRDD-LCDCLQKSCFG  80
           Q  +E  K+N  L+  GN  SAL D K  +IP R+  L   LQ S  G
Sbjct  49  QRLKEATKINLSLSVLGNVISALVDGKSTHIPYRNSKLTRLLQDSLGG  96


>Q57UU4_TRYB2 unnamed protein product
Length=6613

 Score = 28.5 bits (62),  Expect = 1.6, Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 32/67 (48%), Gaps = 12/67 (18%)

Query  56    LYDEKGLYIPT------RDDLCDCLQKSCFGCHFPCPKCYSTKCGHECRNNRKWM--YDT  107
             L+++ G++ P+      +   CDCL+ S     FP P  + +   H  R    W   YDT
Sbjct  4203  LHEQLGVFAPSQYCFFVKRRGCDCLRLSICEMTFPPPTPFMSSVSHPWR----WAGGYDT  4258

Query  108   IENEGSD  114
             +E + S+
Sbjct  4259  VELKPSE  4265


>LSDA_DROME unnamed protein product
Length=890

 Score = 27.7 bits (60),  Expect = 3.0, Method: Composition-based stats.
 Identities = 16/58 (28%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query  1   MNHPPSATVRKSRGARQKAVDQVTRKFLHNFDPEQSEREKRKLNRRLNHGNKKSALYD  58
           +NHPPSA    + G +QK  D+ +       D  ++ R  R    ++++ N+ S   D
Sbjct  37  VNHPPSALSAPNPGQKQKHPDEDSNDAPATSDERRTSRRNRP---KVDYSNRPSGSGD  91



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000128-PA

Length=1195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q587C6_TRYB2  unnamed protein product                                 487     7e-154
Q8SWT2_DROME  unnamed protein product                                 247     9e-68 
DHX8_DROME  unnamed protein product                                   223     4e-59 


>Q587C6_TRYB2 unnamed protein product
Length=1009

 Score = 487 bits (1254),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 330/957 (34%), Positives = 512/957 (54%), Gaps = 143/957 (15%)

Query  184   ESSEDDEDEVEPEKNGNEISVGLVEENKAKENDE-ASKSKDKAEVQESDEKRITEISKEK  242
             E+    +++ E  K  N++ V L E    +EN+E   K +  +  QE   K +  I++E+
Sbjct  111   EACAKQKEKAEKRKALNDMRVSLHER---RENEEKLQKQRVVSSQQEYISKLVANIAEEE  167

Query  243   KKSEDQKEIEPSENKDMPKKNPKVVEKKPAVFVAVDRKPEVQEARMKLPILADEQSVVEA  302
              ++   +E    +  D+ K  P+      +V + V R P ++  R +LP+L +EQ++VEA
Sbjct  168   GRTRQVREAIDRDTLDLAKFAPQ------SVCIHVKRHPHIELTRKELPVLREEQAIVEA  221

Query  303   INENP--VVIITGETGSGKTTQVPQFLYEAGYA--------KDKMIGITEPRRVAAISMS  352
             IN      V+I GETGSGKTTQ+PQFL+E GY         ++  I +TEPRRVAAISM+
Sbjct  222   INSTSRTCVLICGETGSGKTTQIPQFLWECGYGDPKGSPFGREGCILVTEPRRVAAISMA  281

Query  353   KRVAEEMNL-TDKEVSYLIRFEGNTTPETKIKFMTDGVLLKEVQNDFLLKKYSVIILDEA  411
             +RVAEE+N+   ++V Y +R++ N +   KIKF T+G++LKE+Q+DFLL+KYSVII+DEA
Sbjct  282   RRVAEELNVPFGEDVCYQVRYDNNLSDGFKIKFATEGIVLKEIQSDFLLRKYSVIIVDEA  341

Query  412   HERSVYTDILIGLLTRIVSLRT-------KRN---------EPLKLIIMSATLRIEDFVN  455
             HERSV  DILIG+L+RI+  R        ++N         +PLKL+IMSAT+R+ DF +
Sbjct  342   HERSVTGDILIGMLSRIMPTRNDLYLEELRKNGGLPQMTTLKPLKLVIMSATMRVADFRD  401

Query  456   NSRLFKVKPPIKTVESRQFPVTIHFNRKTNP-DYVKEAIRKAAKIHTQLPEGGILIFLTG  514
             N +LF V PP   VE+R+FPVT HF+++T   +YV EA RK  +IH +LP GGIL+FL+ 
Sbjct  402   NRKLFPVPPPFICVEARRFPVTNHFSKRTELFNYVDEAFRKVCQIHKKLPPGGILVFLST  461

Query  515   QKEVNTVVRRLRKAFP-YREQKCD--------VVSKEKTENNEKNKNEKDIADNDGNSED  565
             Q E+  +  RL   +   + + C+        + S+  T  +E +++E DI        D
Sbjct  462   QYEIGLLCDRLLLHYAKTKIEYCETSYSKHALLTSELPTTPSESDESESDI------ERD  515

Query  566   EFFTKNAKNRRKKIAQLKLPQVSLDAYSAVPDD--------GHDDLIDLENEEEDENDDE  617
             EF                   ++ + Y+   DD        G     +     E      
Sbjct  516   EF------------------GLATEDYALDKDDTELENCNIGRKRCRNAAGSPEKAEGFA  557

Query  618   DEDEEDIDMSGSSNSQPLWVLPLYSLLPSYKQAKVFEPPPEGYRLCVVSTNVAETSLTIP  677
             DE E    ++G  N+  L VLPLY+L+   KQ +VF+ PP G RLCVV+TNVAETS+TIP
Sbjct  558   DESE----VNGELNT--LHVLPLYALMNFSKQQEVFQQPPAGKRLCVVATNVAETSITIP  611

Query  678   NIKYVVDSGKCKTKMYDKVTGVTTFMITWASKAAANQRAGRAGRMGPGHCYRLYSSAVFN  737
             NI+YVVDSG+ KTK  D+ T  + F I W S+A+A QR+GRAGR+ PGHCYRLYS+AV++
Sbjct  612   NIRYVVDSGRVKTKTVDESTCASCFRIEWTSQASAEQRSGRAGRVAPGHCYRLYSTAVYS  671

Query  738   DQFEAFSEPEIRRKPVDDLLLQMKVMNIDKVVNFPFPTPPGEEQLKMAEKRLCVLGALQQ  797
             +     S PEI R  ++ ++L MK   I+ V  FPFP+PP E  LK A   L ++GAL  
Sbjct  672   NLMPKHSAPEILRTSLESVVLLMKHFGINHVGTFPFPSPPKEADLKRALTHLGLIGALNS  731

Query  798   NHLRKKDLYCAKITDLGRTIATFPVLPRYGKMLALSQQHNLLAYTVCMVAALSVQELLIE  857
             +     D +  +IT  GR +  +P+ PR+ +++       L  + + ++  ++       
Sbjct  732   D-----DEF--RITATGRRLVAYPIPPRFSRVIVEGIDRKLPRFLITLITLIASIFSTTT  784

Query  858   ASSSEEEVKNKW------------IQTRRFWSGTGNSLF--LGDPMVFIRAVGAAEFASI  903
             +  ++E  + KW             Q  +     G+ L   L   +V++    A      
Sbjct  785   SVFTDEGHRIKWKSKDISDDEKERKQRLQALLHPGSDLLTSLNALLVYMNNSSAVN----  840

Query  904   KGKFSQFCQEHGLREKAMTEIRKLRHQL--------TNEIVLGVPGLDLSIDPK------  949
                    C  + L +K+++E ++L  QL          E V G    D+ + P+      
Sbjct  841   -------CDRYCLVQKSLSEAKQLGDQLLVLASRDTAEEPVEGASDADV-VGPEQLFEER  892

Query  950   -MPPPTDMEAKLLRQIILAGMSDQVAHKLSPEEIKEYINNSEGGKTKWKYAYKTTEMEEP  1008
              +   +  +  ++R++ + G+ DQVA + + +E + +    +  KT  K  Y T      
Sbjct  893   ALAHLSKNQEIVIRKLFIIGLVDQVARRATVQECRSHGVEYKSDKTT-KTPYITVANHII  951

Query  1009  VFMHTSCVLRKSA--PEWVVYQELYETTK-------TYMRGVTAIEPEWLPKFAPTL  1056
             V++H S  + ++   PE+V +  L +  +       T M G+T +  EWL + A T+
Sbjct  952   VYVHPSSSIARTYPPPEYVTFVTLQKNVRSETKESLTLMLGLTIVTKEWLHECAVTV  1008


>Q8SWT2_DROME unnamed protein product
Length=942

 Score = 247 bits (631),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 217/726 (30%), Positives = 339/726 (47%), Gaps = 105/726 (14%)

Query  285  EARMKLPILADEQSVVEAINENPVVIITGETGSGKTTQVPQFLYE----AGYAKDKMIGI  340
            EAR KLP +     +++A+ EN V++I G TG GKTTQVPQ L +     G A    I  
Sbjct  148  EARKKLPTMKYADDIIQAVRENQVILIVGSTGCGKTTQVPQILLDDAISRGCASSCRIIC  207

Query  341  TEPRRVAAISMSKRVA-EEMNLTDKEVSYLIRFEGNTTPE-TKIKFMTDGVLLKEVQNDF  398
            T+PRR++AI++++ V+ E        V Y IR E     E   I + T GVLL+++Q+D 
Sbjct  208  TQPRRISAIAIAEWVSYERCESLGNSVGYQIRLESRKARERASITYCTTGVLLQQLQSDP  267

Query  399  LLKKYSVIILDEAHERSVYTDILIGLLTRIVSLRTKRNEPLKLIIMSATLRIEDFV---N  455
            L+   SV+ILDE HERSV TD+L+GLL  I+  R      LK+I+MSAT+R +DF    N
Sbjct  268  LMHNLSVLILDEIHERSVETDLLMGLLKVILPHRPD----LKVILMSATVREQDFCDYFN  323

Query  456  NSRLFKVKPPIKTVESRQFPVTIHFNR----KTNPDYVKEAIRKAAKIHTQLPEGGILIF  511
            N  +F++       E   FPV + +      KTN ++ K   R+  +     PE      
Sbjct  324  NCPMFRI-------EGVMFPVKMLYLEDVLSKTNYEFQKFRDRRPKR---DPPERR----  369

Query  512  LTGQKEVNTVVRRLRKAFPYREQKCDVVSKEKTENNEKNKNEKDIADNDGNSEDEFFTKN  571
            +  +  +   +RR+R ++  R     V+ K +   +E  ++   IAD             
Sbjct  370  MKHEAMIEPYLRRIRNSYDSR-----VLDKLRLPESEGCEDIDFIAD--------LVYYI  416

Query  572  AKNRRKKIAQLKLPQVSLDAYSAVPDDGHDDLIDLENEEEDENDDEDEDEEDIDMSGSSN  631
             +N  +    + LP             G+D +  L N               +D   +S 
Sbjct  417  CENEPEGAILVFLP-------------GYDKISQLYNI--------------LDKPKTSK  449

Query  632  SQ----PLWVLPLYSLLPSYKQAKVFEPPPEGYRLCVVSTNVAETSLTIPNIKYVVDSGK  687
             Q     + V PL+SL+ S +Q  VF  PP G R  ++ST +AETS+TI ++ YV++SG+
Sbjct  450  GQRWRDHMAVFPLHSLMQSGEQQAVFRRPPAGQRKVIISTIIAETSVTIDDVVYVINSGR  509

Query  688  CKTKMYDKVTGVTTFMITWASKAAANQRAGRAGRMGPGHCYRLYSSAVFNDQFEAFSEPE  747
             K   YD  T + +    W +KA   QR GRAGR+ PG CY L+S A   D+ +    PE
Sbjct  510  TKATNYDIETNIQSLDEVWVTKANTQQRRGRAGRVRPGICYNLFSRAR-EDRMDDIPTPE  568

Query  748  IRRKPVDDLLLQMKVMNIDKVVNF--PFPTPPGEEQLKMAEKRLCVLGALQQNHLRKKDL  805
            I R  ++ ++L +K+++ID    F       P  E +KM  + L  + AL Q        
Sbjct  569  ILRSKLESIILSLKLLHIDDPYRFLQTLINAPNPEAIKMGVELLKRIEALDQT-------  621

Query  806  YCAKITDLGRTIATFPVLPRYGKMLALSQQHNLLAYTVCMVAALSVQELLIEASSSEEEV  865
                +T LG  +A  P+ P+ GKM+ +S     L       AALS +         E  V
Sbjct  622  --GTLTPLGMHLAKLPIDPQMGKMILMSALFCCLDPITSAAAALSFKSPFYSPLGKESRV  679

Query  866  KNKWIQTRRFWSGTGNSLFLGDPMVFIRAVGAAEFASIKGKFSQ----FCQEHGLREKAM  921
                I+ R   +   + L + + ++  R            ++S     FC ++ L    +
Sbjct  680  DE--IKRRMARNMRSDHLMVHNTIIAYR----------DSRYSHAERDFCYKNFLSSMTL  727

Query  922  TEIRKLRHQLTNEIVLGVPGLDLSIDPKMPPPTDME-AKLLRQIILAGMSDQVAHKLSPE  980
             ++ ++++Q + E++     L  S         + E   LLR II AG+   +AH     
Sbjct  728  QQLERMKNQFS-ELLYNYKFLASSNCKDAASNKNSEKIPLLRAIIGAGLYPNMAHLRKSR  786

Query  981  EIKEYI  986
            +IK  +
Sbjct  787  QIKNRV  792


>DHX8_DROME unnamed protein product
Length=1242

 Score = 223 bits (568),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 150/430 (35%), Positives = 217/430 (50%), Gaps = 52/430 (12%)

Query  635   LWVLPLYSLLPSYKQAKVFEPPPEGYRLCVVSTNVAETSLTIPNIKYVVDSGKCKTKMYD  694
             L +LP+YS LPS  Q ++F+P P G R  V++TN+AETSLTI  I YVVD G  K K+Y+
Sbjct  828   LIILPVYSALPSEMQTRIFDPAPAGSRKVVIATNIAETSLTIDGIFYVVDPGFVKQKVYN  887

Query  695   KVTGVTTFMITWASKAAANQRAGRAGRMGPGHCYRLYSSAVFNDQFEAFSEPEIRRKPVD  754
               TG+ + ++T  S+AAA QRAGRAGR GPG  YRLY+   + D+      PEI+R  + 
Sbjct  888   SKTGMDSLVVTPISQAAAKQRAGRAGRTGPGKTYRLYTERAYRDEMLPTPVPEIQRTNLA  947

Query  755   DLLLQMKVMNIDKVVNFPFPTPPGEEQLKMAEKRLCVLGALQQNHLRKKDLYCAKITDLG  814
               +LQ+K M I+ +++F F   P  E L MA ++L  L AL    L         +T LG
Sbjct  948   TTVLQLKTMGINDLLHFDFMDAPPVESLVMALEQLHSLSALDDEGL---------LTRLG  998

Query  815   RTIATFPVLPRYGKMLALSQQHNLLAYTVCMVAALSVQELLIEASSSEEEVKNKWIQTRR  874
             R +A FP+ P   KML +S         + +V+ LSVQ +       +     K     +
Sbjct  999   RRMAEFPLEPNLSKMLIMSVALQCSDEILTIVSMLSVQNVFYRPKDKQALADQK---KAK  1055

Query  875   FWSGTGNSLFLGDPMVFIRAVGAAEFASIK-GKFSQ-FCQEHGLREKAMTEIRKLRHQLT  932
             F    G+ L L            A + S K  KFS  +C E+ ++ + +   + +R QL 
Sbjct  1056  FNQAEGDHLTL-----------LAVYNSWKNNKFSNAWCYENFVQIRTLKRSQDVRKQLL  1104

Query  933   NEIVLGVPGLDLSIDPKMPPPTDMEAKLLRQIILAGMSDQVAHKLSPEEIKEYINNSEGG  992
                ++    LD+    K        +  +++ I +G     A K  P+E           
Sbjct  1105  G--IMDRHKLDVVSAGK-------NSVRIQKAICSGFFRNAAKK-DPQE-----------  1143

Query  993   KTKWKYAYKTTEMEEPVFMHTSCVLRKSAPEWVVYQELYETTKTYMRGVTAIEPEWLPKF  1052
                    Y+T    + V++H S  L    PEWV+Y EL +TTK YMR VT I+P+WL +F
Sbjct  1144  ------GYRTLVDSQVVYIHPSSALFNRQPEWVIYHELVQTTKEYMREVTTIDPKWLVEF  1197

Query  1053  APTLCSLSDP  1062
             AP+    SDP
Sbjct  1198  APSFFRFSDP  1207


 Score = 213 bits (541),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 115/242 (48%), Positives = 158/242 (65%), Gaps = 9/242 (4%)

Query  285  EARMKLPILADEQSVVEAINENPVVIITGETGSGKTTQVPQFLYEAGYAKDKMIGITEPR  344
            E R  LPI      +++A+ +N ++I+ GETGSGKTTQ+ Q+L E G+     IG T+PR
Sbjct  581  EQRQSLPIYKLRDDLIKAVTDNQILIVIGETGSGKTTQITQYLGECGFTARGKIGCTQPR  640

Query  345  RVAAISMSKRVAEEMNL-TDKEVSYLIRFEGNTTPETKIKFMTDGVLLKEVQNDFLLKKY  403
            RVAA+S++KRVAEE      +EV Y IRFE  T+PET IK+MTDG+LL+E   +  LK Y
Sbjct  641  RVAAMSVAKRVAEEYGCRLGQEVGYTIRFEDCTSPETIIKYMTDGMLLRECLMEAELKSY  700

Query  404  SVIILDEAHERSVYTDILIGLLTRIVSLRTKRNEPLKLIIMSATLRIEDFVNNSRLFKVK  463
            SVI+LDEAHER+++TD+L GLL   V  R +    LKLI+ SATL   D V  S+ F  K
Sbjct  701  SVIMLDEAHERTIHTDVLFGLLKTAVQKRPE----LKLIVTSATL---DAVKFSQYF-FK  752

Query  464  PPIKTVESRQFPVTIHFNRKTNPDYVKEAIRKAAKIHTQLPEGGILIFLTGQKEVNTVVR  523
             PI T+  R FPV + + ++   DY+  ++    +IH + P G IL+FLTGQ+E++T   
Sbjct  753  APIFTIPGRTFPVEVLYTKEPETDYLDASLITVMQIHLREPPGDILLFLTGQEEIDTACE  812

Query  524  RL  525
             L
Sbjct  813  IL  814



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000129-PA

Length=276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

THIO2_DROME  unnamed protein product                                  45.4    3e-06
A0A0B4LHC9_DROME  unnamed protein product                             46.6    9e-06
Q9W1I7_DROME  unnamed protein product                                 46.6    1e-05


>THIO2_DROME unnamed protein product
Length=106

 Score = 45.4 bits (106),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/104 (26%), Positives = 51/104 (49%), Gaps = 9/104 (9%)

Query  133  VTYLRGASSLQEELQRDTRVVWLVAFYTAWNPACVNFAPTFSELSAKYALENFRFGKMDI  192
            V  ++  + L  +L + +  + ++ F+  W   C   +P   ELS ++A +N    K+D+
Sbjct  2    VYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA-DNVVVLKVDV  60

Query  193  GRYPDVAAKYNINDSSKSLQLPTLILFKDGKEYERRPYADGNGK  236
                D+A +YNI+       +PT +  K+G + E   +A  N K
Sbjct  61   DECEDIAMEYNIS------SMPTFVFLKNGVKVEE--FAGANAK  96


>A0A0B4LHC9_DROME unnamed protein product
Length=330

 Score = 46.6 bits (109),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (48%), Gaps = 6/84 (7%)

Query  154  WLVAFYTAWNPACVNFAPTFSELSAKYALENFRFGKMDIGRYPDVAAKYNINDSSKSLQL  213
            W++ F+  W PAC N APT+   +        +  K+D+   P ++ ++ +        L
Sbjct  54   WMIEFFAPWCPACKNLAPTWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVT------AL  107

Query  214  PTLILFKDGKEYERRPYADGNGKL  237
            PT+   KDG+  + R   DG+  L
Sbjct  108  PTIYHVKDGEFRQYRGARDGDALL  131


>Q9W1I7_DROME unnamed protein product
Length=323

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (48%), Gaps = 6/84 (7%)

Query  154  WLVAFYTAWNPACVNFAPTFSELSAKYALENFRFGKMDIGRYPDVAAKYNINDSSKSLQL  213
            W++ F+  W PAC N APT+   +        +  K+D+   P ++ ++ +        L
Sbjct  54   WMIEFFAPWCPACKNLAPTWERFARVAKDVQVQVAKIDVTTSPSLSGRFFVT------AL  107

Query  214  PTLILFKDGKEYERRPYADGNGKL  237
            PT+   KDG+  + R   DG+  L
Sbjct  108  PTIYHVKDGEFRQYRGARDGDALL  131



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000130-PA

Length=863
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHH8_DROME  unnamed protein product                                 443     2e-146
SMU2_CAEEL  unnamed protein product                                   109     1e-24 
Q9VUX9_DROME  unnamed protein product                                 73.2    2e-13 


>Q9VHH8_DROME unnamed protein product
Length=557

 Score = 443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 285/541 (53%), Positives = 337/541 (62%), Gaps = 78/541 (14%)

Query  360  KLLMTPRSSVPS-----------------ATPASVPGTVRDSGAKAAQTPVVGGSNRAEL  402
            KLL TPR+  P                  ATP++ PGT   SG K         S R +L
Sbjct  21   KLLATPRAPPPGSGTSSTSAGGSLATATFATPSTAPGTTGLSGEKKKGQ---SSSERNDL  77

Query  403  RRKKKSYYAKLKKQEDDKMAELAEKYRDRARERRDGTNQE--QVEDPMTNAS--AYRAVA  458
            RRKKK++YA LKKQED K+ EL+EKYRDRARERRDG N +   V  P   +S  AYRAVA
Sbjct  78   RRKKKNFYAALKKQEDVKLQELSEKYRDRARERRDGANPDYVNVSTPGHGSSTNAYRAVA  137

Query  459  PDLKSGYDAAERRRQMIQQSKFLGGDMEHTHLVKGLDYALLQKVRSEIEARETEQEIEME  518
            PD+KSG DA ERRR++IQ+SKFLGGD++HTHLVKGLDYALLQKVRSE+ ++E E+E    
Sbjct  138  PDMKSGIDAQERRRRIIQESKFLGGDIQHTHLVKGLDYALLQKVRSELHSKEAEEEEIAA  197

Query  519  KLAKPKEKVKEKVKEVE----KKDEEVN-FKSKTARNICKTIMIMKSKTVERNELFAPGR  573
             +A+ K        E      ++ E++N      ARNI   +   +SK V RNELFAPGR
Sbjct  198  AVAREKLAEAAAAAEQLEAERRESEDINAINGALARNIYNLVQARRSKEVPRNELFAPGR  257

Query  574  MAYVIELDDET-EVDIPTTLIRSKADVP-TIDNTPTLTTNDIVINKLAQILSYLRQGNRH  631
            MAYVI+LDDE  E DIPTTL RSK +VP + ++  TLTTNDIVINKL+QILSYLR G R+
Sbjct  258  MAYVIDLDDELGESDIPTTLKRSKFEVPVSQEDVATLTTNDIVINKLSQILSYLRAGGRN  317

Query  632  GKKNKKNKDGRPRLDDFNELEIAPQRSIQD-----------------------DSIYGDI  668
             K  K++KD +P    F E E+   R                           D+IY DI
Sbjct  318  KKNKKRDKD-KPL---FYEKEVENLRGSSSNGGSSRHATSSSSNMGGKSAPLGDNIYDDI  373

Query  669  GDYIPDLTKSESSHL-KNKKKESYFAKPEPEINEEDNAPRLPNAEIPNEVAAIAKAIASS  727
            GDY P  T+ E +   + K   SYF    PE                   A+    I+S 
Sbjct  374  GDYQPSATRPERNRQEQGKSAPSYFGDGPPE-------------------ASEEPIISSI  414

Query  728  DVALRRGVALDKPAVEPVGYAECYPGLDEMQDAIDDSDDEVDYTKMDLGNKKGPIGRWDF  787
                +   A+     EP GYAECYPGL+EM DAIDDSDDEVDYTKMDLGNKKGPIGRWDF
Sbjct  415  PPPPKISKAMAARFAEPEGYAECYPGLEEMNDAIDDSDDEVDYTKMDLGNKKGPIGRWDF  474

Query  788  DTQEEYSEYMNNKEALPKAAFQYGVKMADGRRTRKYNKEKNEKAELDREWQKIQNIMNKR  847
            DTQEEYS+YM+ KEALPKAAFQYGVKM DGR+TRK   EKNEKAELDREWQKIQ I+ KR
Sbjct  475  DTQEEYSDYMSTKEALPKAAFQYGVKMQDGRKTRKNKTEKNEKAELDREWQKIQTIIQKR  534

Query  848  K  848
            K
Sbjct  535  K  535


>SMU2_CAEEL unnamed protein product
Length=547

 Score = 109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 71/105 (68%), Gaps = 3/105 (3%)

Query  746  GYAECYPG-LDEMQDAIDDSDDEVDYTKMDLGNKKG-PIGRWDFDTQEEYSEYMNNKEAL  803
            GY ECYPG L EM  A D SD+E DY+KMD G KK   + RWDFDT+EEY+ YM  +EAL
Sbjct  427  GYDECYPGGLVEMGGAWD-SDEEADYSKMDAGPKKNQAVNRWDFDTEEEYASYMEGREAL  485

Query  804  PKAAFQYGVKMADGRRTRKYNKEKNEKAELDREWQKIQNIMNKRK  848
            PKAA+QYGVK  +G R  K     ++   LDRE  +I  IM+KRK
Sbjct  486  PKAAYQYGVKNGEGGRKNKKQSAVSDAKRLDRELNEINKIMDKRK  530


>Q9VUX9_DROME unnamed protein product
Length=365

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 70/242 (29%), Positives = 109/242 (45%), Gaps = 48/242 (20%)

Query  62   SALDAVERSCALCEQMQCRGT-VGYGGNPDENGETTLDALIMDGVTMDVGAVGGIRNVKD  120
            SA+DA E   A+     C  T  GYG N   +G    DA IMDG T++ GA   +  VK+
Sbjct  40   SAVDACEA--AIVRLENCGYTNAGYGSNLCMDGSVQCDAAIMDGSTLNFGACTNVSRVKN  97

Query  121  AISVARKV---------MENTRHSLLGGELAADFAVQMG---FKKESLQTDKSRGLWETW  168
             I +AR++         +E     +L G  A  +A ++G    +   L + K++  +  +
Sbjct  98   PIQLARRICDAQSSPQLLERIPPMILAGTGAEHYADEVGCSMVEPGVLISSKAKFQFNHY  157

Query  169  KAGHCQPNFWENVTPDPSKSCGPYHLANSN--GEPTSSGGPHSDEDNH--------DTIG  218
            K+                     Y L  ++  G+ TS       E  +        DT+G
Sbjct  158  KS--------------------KYDLVVNSRLGKATSEESVQVPEPGNEVELAAALDTVG  197

Query  219  VLCLDTLGRVAAGVSTNGQKYKVPGRIGDSAVTGAGAYASGD---SGAAAATGDGDVIMR  275
             +C+D  G  AAG S+ G   KVPGR+G +A  GAG +A+     + A   TG+G+ +M+
Sbjct  198  AVCVDGAGNTAAGCSSGGILLKVPGRVGQAATYGAGCWATDTDELAIATCTTGNGEYLMK  257

Query  276  FL  277
             L
Sbjct  258  TL  259



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000131-PA

Length=588
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W430_DROME  unnamed protein product                                 236     4e-70
SYMPP_STHOU  unnamed protein product                                  108     7e-25
NFT1_DROME  unnamed protein product                                   39.3    0.009


>Q9W430_DROME unnamed protein product
Length=553

 Score = 236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 161/522 (31%), Positives = 269/522 (52%), Gaps = 64/522 (12%)

Query  59   SLPSLPSYIGAVVEYTPVTKKSEDGRSPGDANADNYLKFIKKAKERLVDIIVFPESSLSL  118
            S P  P+Y  AVVE++     S   R+   + ++++ K I++  +  VDIIVFPE  L+ 
Sbjct  22   SKPEDPTYTAAVVEHSQPVGDSPRART--TSASESFQKIIREVGD--VDIIVFPEHILNS  77

Query  119  PSSDNKTIARSEAASYIPDPKDNVVPCHQKQDDPKKFASSLAKLSCGALDYQMYVVINHR  178
             ++          A+++P    N+ PC+Q   D + F   L +LSC A    +YVVIN  
Sbjct  78   QAT----------ATFVPHESQNITPCYQT--DYELF---LIELSCSARANHLYVVINVV  122

Query  179  EKVDCQ--ANTDG---CPADGFLIYNTHVTFDRKGRVISRYRKYNLFGELGTNRTAWAEP  233
            EK  C   A +D    CP+ G   +NT+V FDR+GR++SRYRK +L+     + +    P
Sbjct  123  EKELCAHGAGSDTYNPCPSSGVRYFNTNVVFDRRGRIVSRYRKTHLWRHEYVSTSVLRSP  182

Query  234  --TVFDTDFGVRFGQFICFDILFESPAVNLTRDLGVTDIVYSVHWYSELPYAFNNEVQAA  291
              ++F TDFGV FG FICFD+LF  PA+ L ++  +TDIVY  +W+SELP+    ++Q  
Sbjct  183  DISIFRTDFGVTFGHFICFDMLFYDPAMKLVKEHKITDIVYPTYWFSELPFLGAVQLQEG  242

Query  292  WAYATDTNFLVSGHNNPVTGSGGSGIFIGRQGHAHTVSRDLPANVLVVSEIPKKINGKRT  351
            WA+  D N L +  +NP   + GSGI+ GR G       + P   L+++E+PK+ +G+  
Sbjct  243  WAFGNDVNVLAADASNPDGRTSGSGIYAGRGGRLVAEIFEQPTTKLLIAEVPKREHGQ--  300

Query  352  LAIDRSKLYTYEFDRSEISTSPEATAQPSGHYFYRTTDLSNYTSELIVTPEKNDETHYSK  411
            LA   + ++  +            T + +G   YR  ++  + SEL+     +D   + +
Sbjct  301  LAPTFTPIFEPQ----------RKTQRLTGLATYRDNNVDIFESELL----DDDFLSFER  346

Query  412  RLCNHGLCCDFELRVGFSKS----IFEPGSAYYRYRL-VAFNDQMSFAGRGSGRTQICGV  466
            +LC+   CC F +    + +    +   G+  YRYR+ V + ++ +  G        C +
Sbjct  347  QLCHGSFCCTFSIERKVTSAAENELPSSGAKSYRYRIGVYWGNETTVIGVDRTEQATCAL  406

Query  467  IACLNETIDSCGRLLEPSEKMALP---IKLEVDIKVPINRDERTVFLPVTLQRSGPVSSP  523
             AC +  + SCG +   +E++       KL +    P     R + +P +L      +  
Sbjct  407  FACTDVRLASCGYIYPENEEVINTHHFTKLSISGNFPAAPRGRRLIMPSSLN-----ALF  461

Query  524  LPLNVSEFKFVEDNER---------VEMGLRKARDDLLTFVV  556
            LP++VS+++++E  E          V++ L KA++DLLTF +
Sbjct  462  LPVSVSDYEWIESPEAANNLDKTILVDLKLAKAQNDLLTFAI  503


>SYMPP_STHOU unnamed protein product
Length=501

 Score = 108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 90/292 (31%), Positives = 140/292 (48%), Gaps = 27/292 (9%)

Query  65   SYIGAVVEYTPVTKKS-----EDGRSPGDANADNYLKFIKKAKERLVDIIVFPESSLSLP  119
            S+  AV E+  +  K+     E+       N+D Y + + +++ + V +IVFPE  L   
Sbjct  7    SWKVAVFEHQVIPPKTDMETREEALDALKLNSDVYHEAVLESRSKGVKMIVFPEYGLY--  64

Query  120  SSDNKTIARSEA---ASYIPDPKD-NVVPCHQKQDDPKKFASS---LAKLSCGALDYQMY  172
              D  T+ R+     A  +P PK  +  PC    D+P+    S   L   SC A +  MY
Sbjct  65   --DINTLTRTRMDLMAEKVPHPKHGHRNPC----DEPEYQTQSSEMLRTFSCMAKENDMY  118

Query  173  VVINHREKVDCQANTD-GCPADGFLIYNTHVTFDRKGRVISRYRKYNLFGELGT-NRTAW  230
            +V+N   +  C+  T+  CP D  L+YNT+V F+ +G V++RY K +LF E G  N +  
Sbjct  119  MVVNMAGREPCRRATEPECPGDKQLLYNTNVAFNNEGDVVARYYKTHLFWEEGWFNSSKN  178

Query  231  AEPTVFDTDFGVRFGQFICFDILFESPAVNLTRDLGVTDIVYSVHWYSELPYAFNNEVQA  290
             E  ++DT  G +FG F+CFD      AV L     V  I Y   W +  P   + +  +
Sbjct  179  YEMALWDTPIG-KFGTFMCFDF----QAVQLIEQYNVRHIAYPASWVNLPPIYQSIQSHS  233

Query  291  AWAYATDTNFLVSGHNNPVTGSGGSGIFIGRQGHAHTVSRDLPANVLVVSEI  342
            A+A     N L +  +   T + GSGI+            D+P + L+V+EI
Sbjct  234  AFARFAKINLLAASVHRLETSTYGSGIYSPNGAEIFYFRPDIPKSKLLVAEI  285


>NFT1_DROME unnamed protein product
Length=460

 Score = 39.3 bits (90),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 62/148 (42%), Gaps = 30/148 (20%)

Query  197  IYNTHVTFDRKGRVISRYRKYNLFGELGTNRTAWAEPTVFDTDFGV---------RFGQF  247
            I+N HV  + KG + + YRK ++F ++ T      E       + +         + G  
Sbjct  123  IFNAHVLLNEKGELAAVYRKLHMF-DVTTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQ  181

Query  248  ICFDILFESPAVNLTRDLGVTDIVYSVHWYSELPYAFNNEV-QAAW-----AYATDTN-F  300
            IC+D+ F  PAV L R LG   + Y        P AF     +A W     A A +T  F
Sbjct  182  ICYDLRFAEPAV-LLRKLGANLLTY--------PSAFTYATGKAHWEILLRARAIETQCF  232

Query  301  LVS----GHNNPVTGSGGSGIFIGRQGH  324
            +V+    G +N    S G  + +   G+
Sbjct  233  VVAAAQIGWHNQKRQSWGHSMIVSPWGN  260



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000132-PA

Length=559
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPE9_DROME  unnamed protein product                                 150     3e-40
Q0KI77_DROME  unnamed protein product                                 145     3e-38
Q9VG47_DROME  unnamed protein product                                 138     2e-35


>Q9VPE9_DROME unnamed protein product
Length=399

 Score = 150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 108/373 (29%), Positives = 172/373 (46%), Gaps = 52/373 (14%)

Query  64   RVDEHGYPAEEHTVTTKDGYKLPVLWV---------SPHRPTVQL---IMKHADTIKVTL  111
            R+  HGYP E H VTT+DGY L +  +         +  RP + L   +  ++D    + 
Sbjct  35   RIRSHGYPTETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRPPILLQHGLFSNSDCWLSSG  94

Query  112  ITIILAFFII---FLIFF---------------------FFRTSYHEMALLDVTAVIDYI  147
                LA+ +    + ++                      F+   +HE+  +D+ A+IDYI
Sbjct  95   PDNSLAYLLADAGYDVWLGNARGNIYSRNNIIISLNSHKFWHFDWHEIGTIDIPAMIDYI  154

Query  148  LLKTQQPSLIYVGHSMGGAISTILLSTKPEYNKKIKLAIGLAPAVFWYASP---LPHAAK  204
            L  T    + Y GHS G  +  ++LS +PEYN  IK    LAP  F+             
Sbjct  155  LADTGFDQIHYAGHSQGTTVYLVMLSERPEYNALIKSGHLLAPCAFFEHGTSFIFNALGP  214

Query  205  VVKINGEAIKNFLVNARIYELLPLSAATSRLSKNACKTKSIFFDYCLTVMSFVNGNNPRQ  264
            +V   G      LV+    EL+P +   +RL  N+C   +   +    +  F NG     
Sbjct  215  LVGTPGGIWNQLLVDT---ELIPNNNLVNRLVDNSCHLSNTICNNAFIM--FANGGYVNA  269

Query  265  LNSSILPNVVTAFPAGASRQTAFHFIQNMHLDGDKQRTREFLMYDHGEKKNLKKYGKPEP  324
             N+S +  ++   PAG+S     H++Q         ++ +F  YD G KKN + YG+  P
Sbjct  270  -NASSMSVLIETHPAGSSSNQGIHYLQ-------LWKSLKFRQYDWGTKKNNELYGQDLP  321

Query  325  PSYNLSNIVAPVALFYGLGDSLVGSGDVIELSKKLKNVVALVEVPDPNFGHMDFIMAQDV  384
            P Y+LS IVAP  L+    D+L G  DV  L +   ++     VP  +F H+DFI+A+++
Sbjct  322  PDYDLSKIVAPTHLYSSTNDALCGPEDVNTLVENFPHLTEDYRVPVQSFNHLDFIIAKNM  381

Query  385  KSLLNDRLLELVE  397
            K L+ND ++E + 
Sbjct  382  KELVNDPIIERIN  394


 Score = 55.5 bits (132),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 6/89 (7%)

Query  450  VSENSD-ALDFVAMVDE----HDYPVEEHLVTTEDGYELHVHRIPGSPD-KPKAPGKSVV  503
            ++E SD  L  +   DE    H YP E H VTT+DGY L + RIP S   K +   +  +
Sbjct  18   LAEKSDYCLSEIVKSDERIRSHGYPTETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRPPI  77

Query  504  YFQHGLFFSSNQWIIMGPEHSFGKIVFSA  532
              QHGLF +S+ W+  GP++S   ++  A
Sbjct  78   LLQHGLFSNSDCWLSSGPDNSLAYLLADA  106


>Q0KI77_DROME unnamed protein product
Length=388

 Score = 145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 108/370 (29%), Positives = 169/370 (46%), Gaps = 58/370 (16%)

Query  65   VDEHGYPAEEHTVTTKDGYKLPVLWVSPHR------PTVQLIMKHADTIKVTLITI----  114
            +  H YP E HTV T+DGY L    +   +      P   ++ +H  +    +  +    
Sbjct  25   IASHNYPVEVHTVLTRDGYLLDAFRIPGSKFCQQSGPKPAVLFQHGMSASSDVFLLNGPQ  84

Query  115  -ILAFFIIFLIF------------------------FFFRTSYHEMALLDVTAVIDYILL  149
              LAF +    F                         F+R S+HE+   DV A IDYIL 
Sbjct  85   DSLAFMLADACFDVWLSNSRGTRYSRRHVSLDPSDEAFWRFSWHEIGTEDVAAFIDYILD  144

Query  150  KTQQPSLIYVGHSMGGAISTILLSTKPEYNKKIKLAIGLAPAVFWYASPLPHAAKVVKIN  209
             T+Q +L ++GHS G     +LLS +PEYNK +K A+ LAPAVF     + H +    ++
Sbjct  145  TTKQRALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAVF-----MRHTS---TLS  196

Query  210  GEAIKNFLVNARIYELLPLSAATSRLSKNACKTKSIFFD--YCLTVMSFVNGNNPRQLNS  267
                ++F++     E +  +   ++L  N C    +F    +C T     NG   + LN+
Sbjct  197  QTVFRSFIMAMPDKEFMYHNGVLNKLLSNVC---GLFVARVFCTTFFLISNGKISKHLNT  253

Query  268  SILPNVVTAFPAGASRQTAFHFIQNMHLDGDKQRTREFLMYDHGEKKNLKKYGKPEPPSY  327
            S++P +    PAG S +   HFIQ      D  + R F   D G  +NL  Y   EPP Y
Sbjct  254  SVIPLIAATLPAGVSSRQPKHFIQLT----DSGKFRPF---DFGILRNLINYKSLEPPDY  306

Query  328  NLSNI--VAPVALFYGLGDSLVGSGDVIELSKKLKNVVALVEVPDPNFGHMDFIMAQDVK  385
             LSN+  + PV +FY   DS     D+   + ++  VV +  +  P + H DF+ +  V 
Sbjct  307  TLSNVRPLTPVHIFYSDDDSSTAKEDIQNFAARVPEVV-MHRISTPGWHHTDFVHSMTVA  365

Query  386  SLLNDRLLEL  395
             ++N  ++E+
Sbjct  366  DVINKPVIEI  375


 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 39/65 (60%), Gaps = 0/65 (0%)

Query  462  MVDEHDYPVEEHLVTTEDGYELHVHRIPGSPDKPKAPGKSVVYFQHGLFFSSNQWIIMGP  521
            ++  H+YPVE H V T DGY L   RIPGS    ++  K  V FQHG+  SS+ +++ GP
Sbjct  24   IIASHNYPVEVHTVLTRDGYLLDAFRIPGSKFCQQSGPKPAVLFQHGMSASSDVFLLNGP  83

Query  522  EHSFG  526
            + S  
Sbjct  84   QDSLA  88


>Q9VG47_DROME unnamed protein product
Length=430

 Score = 138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/371 (30%), Positives = 174/371 (47%), Gaps = 56/371 (15%)

Query  65   VDEHGYPAEEHTVTTKDGYKLPVLWV------SPHRPTVQLIMKH-----ADTIKVTLIT  113
            +  H YP + HTV T+DGY L V  +      +   P   +++ H     AD+  +T   
Sbjct  52   ISSHNYPVQTHTVVTRDGYILSVFRIPSSQLCASSEPKPVVLINHGMTGSADSWLLTGPR  111

Query  114  IILAFFI------IFLI------------------FFFFRTSYHEMALLDVTAVIDYILL  149
              L F +      ++LI                    F+R S+HE+ + D+ A +D+IL 
Sbjct  112  NGLPFLLADACYDVWLINCRGTRYSRKHLKLKAWLLQFWRFSWHEIGMEDLPATVDHILA  171

Query  150  KTQQPSLIYVGHSMGGAISTILLSTKPEYNKKIKLAIGLAPAVFWYASPLPHAAKVVKIN  209
             T++ SL YVGHS G     ++LS +PEYNK+I+  I LAP VF   S L    K++K  
Sbjct  172  STKRNSLHYVGHSQGCTSMLVMLSMRPEYNKRIRTTILLAPPVFLKHS-LSMGHKIMK--  228

Query  210  GEAIKNFLVNARIYELLPLSAATSRLSKNACKTKSIFFDYCLTVMSFVNGNNPRQLNSSI  269
               + N L +    ELLP     +      CK   +  D C  +    NG   + +N ++
Sbjct  229  --PLFNLLPDI---ELLPHHKMLNSAVSAICKILGV-KDVCTALYLLTNGRVSQHMNRTL  282

Query  270  LPNVVTAFPAGASRQTAFHFIQNMHLDGDKQRTREFLMYDHGEKKNLKKYGKPEPPSYNL  329
            +P ++   PAG S +   HF Q      D  R R+   YD G   N   Y +  PP Y L
Sbjct  283  IPMLIATHPAGISSRQPRHFFQ----LKDSGRFRQ---YDFGFGMNYLIYRQNTPPEYPL  335

Query  330  SNIVAP---VALFYGLGDSLVGSGDVIELSKKLKNVVALVEVPDPNFGHMDFIMAQDVKS  386
              +V P   + +FY   D  +   DV+ L+ KL   V    + D  + HMDF++A ++  
Sbjct  336  E-MVRPHSAIHIFYSDDDGTISPRDVLTLASKLPYAVPH-HITDETWNHMDFLLANNINE  393

Query  387  LLNDRLLELVE  397
            L+N+ ++++++
Sbjct  394  LINNPVIKIIK  404


 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 40/76 (53%), Gaps = 0/76 (0%)

Query  450  VSENSDALDFVAMVDEHDYPVEEHLVTTEDGYELHVHRIPGSPDKPKAPGKSVVYFQHGL  509
            +   +  +  V ++  H+YPV+ H V T DGY L V RIP S     +  K VV   HG+
Sbjct  39   IHHRTKVITAVDIISSHNYPVQTHTVVTRDGYILSVFRIPSSQLCASSEPKPVVLINHGM  98

Query  510  FFSSNQWIIMGPEHSF  525
              S++ W++ GP +  
Sbjct  99   TGSADSWLLTGPRNGL  114



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000133-PA

Length=481
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPE9_DROME  unnamed protein product                                 234     2e-72
Q0KI77_DROME  unnamed protein product                                 231     2e-71
Q9VG47_DROME  unnamed protein product                                 233     3e-71


>Q9VPE9_DROME unnamed protein product
Length=399

 Score = 234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 143/375 (38%), Positives = 208/375 (55%), Gaps = 10/375 (3%)

Query  100  VSENSD-ALDFVAMVDE----HDYPVEEHLVTTEDGYELHVHRIPGSPD-KPKAPGKPVV  153
            ++E SD  L  +   DE    H YP E H VTT+DGY L + RIP S   K +   +P +
Sbjct  18   LAEKSDYCLSEIVKSDERIRSHGYPTETHEVTTQDGYVLTLFRIPYSHKLKNQNEKRPPI  77

Query  154  YFQHGLFSSSDQWILMGPESDFSYMLADAGYDVWLGNIRGNTYSRSHVKLSPDYDGEFWN  213
              QHGLFS+SD W+  GP++  +Y+LADAGYDVWLGN RGN YSR+++ +S +   +FW+
Sbjct  78   LLQHGLFSNSDCWLSSGPDNSLAYLLADAGYDVWLGNARGNIYSRNNIIISLN-SHKFWH  136

Query  214  FSFHEIALFDIPATIDYILKETQQPSLIYVGHSMGGTISNVLLSTKPEYNEKIKLVINLA  273
            F +HEI   DIPA IDYIL +T    + Y GHS G T+  V+LS +PEYN  IK    LA
Sbjct  137  FDWHEIGTIDIPAMIDYILADTGFDQIHYAGHSQGTTVYLVMLSERPEYNALIKSGHLLA  196

Query  274  TTVTWLSPHQPTVELILHHADSIKGALNNMKI-YELLSLSAATPRMITTLCGEKSMFRQL  332
                +          +     +  G  N + +  EL+  +    R++   C   +     
Sbjct  197  PCAFFEHGTSFIFNALGPLVGTPGGIWNQLLVDTELIPNNNLVNRLVDNSCHLSNTICNN  256

Query  333  CAIFQMES--IQSDVNMWHNWISSFPAGTSAQSVLHYLQNIESGNFVMYDFGEKENSLKY  390
              I       + ++ +     I + PAG+S+   +HYLQ  +S  F  YD+G K+N+  Y
Sbjct  257  AFIMFANGGYVNANASSMSVLIETHPAGSSSNQGIHYLQLWKSLKFRQYDWGTKKNNELY  316

Query  391  GQPEPPAYDLSNIVAPVALIYGEGDSIIAPDDVIELSKRLPNVVTIESVPDPKFGHLDFV  450
            GQ  PP YDLS IVAP  L     D++  P+DV  L +  P++     VP   F HLDF+
Sbjct  317  GQDLPPDYDLSKIVAPTHLYSSTNDALCGPEDVNTLVENFPHLTEDYRVPVQSFNHLDFI  376

Query  451  VAQDIKKLLNNRLLE  465
            +A+++K+L+N+ ++E
Sbjct  377  IAKNMKELVNDPIIE  391


 Score = 80.5 bits (197),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 1/58 (2%)

Query  1    MLADAGYDVWLGNARGNTYSRSHVKLSPDDDAEFWQFSFHEVGLFDIPATIDYILKET  58
            +LADAGYDVWLGNARGN YSR+++ +S +   +FW F +HE+G  DIPA IDYIL +T
Sbjct  102  LLADAGYDVWLGNARGNIYSRNNIIISLNSH-KFWHFDWHEIGTIDIPAMIDYILADT  158


>Q0KI77_DROME unnamed protein product
Length=388

 Score = 231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 201/365 (55%), Gaps = 17/365 (5%)

Query  112  MVDEHDYPVEEHLVTTEDGYELHVHRIPGSPDKPKAPGKPVVYFQHGLFSSSDQWILMGP  171
            ++  H+YPVE H V T DGY L   RIPGS    ++  KP V FQHG+ +SSD ++L GP
Sbjct  24   IIASHNYPVEVHTVLTRDGYLLDAFRIPGSKFCQQSGPKPAVLFQHGMSASSDVFLLNGP  83

Query  172  ESDFSYMLADAGYDVWLGNIRGNTYSRSHVKLSPDYDGEFWNFSFHEIALFDIPATIDYI  231
            +   ++MLADA +DVWL N RG  YSR HV L P  D  FW FS+HEI   D+ A IDYI
Sbjct  84   QDSLAFMLADACFDVWLSNSRGTRYSRRHVSLDPS-DEAFWRFSWHEIGTEDVAAFIDYI  142

Query  232  LKETQQPSLIYVGHSMGGTISNVLLSTKPEYNEKIKLVINLATTVTWLSPHQPTVELILH  291
            L  T+Q +L ++GHS G T   VLLS +PEYN+ +K  + LA  V     H  T+   + 
Sbjct  143  LDTTKQRALHFLGHSQGCTTLVVLLSMRPEYNKLVKTAVLLAPAV--FMRHTSTLSQTV-  199

Query  292  HADSIKGALNNMKIYELLSLSAATPRMITTLCGEKSMFRQLCAIFQMES---IQSDVN--  346
                 +  +  M   E +  +    ++++ +CG   + R  C  F + S   I   +N  
Sbjct  200  ----FRSFIMAMPDKEFMYHNGVLNKLLSNVCG-LFVARVFCTTFFLISNGKISKHLNTS  254

Query  347  MWHNWISSFPAGTSAQSVLHYLQNIESGNFVMYDFGEKENSLKYGQPEPPAYDLSNI--V  404
            +     ++ PAG S++   H++Q  +SG F  +DFG   N + Y   EPP Y LSN+  +
Sbjct  255  VIPLIAATLPAGVSSRQPKHFIQLTDSGKFRPFDFGILRNLINYKSLEPPDYTLSNVRPL  314

Query  405  APVALIYGEGDSIIAPDDVIELSKRLPNVVTIESVPDPKFGHLDFVVAQDIKKLLNNRLL  464
             PV + Y + DS  A +D+   + R+P VV +  +  P + H DFV +  +  ++N  ++
Sbjct  315  TPVHIFYSDDDSSTAKEDIQNFAARVPEVV-MHRISTPGWHHTDFVHSMTVADVINKPVI  373

Query  465  EIMEN  469
            EI  +
Sbjct  374  EIFRS  378


 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 49/66 (74%), Gaps = 1/66 (2%)

Query  1    MLADAGYDVWLGNARGNTYSRSHVKLSPDDDAEFWQFSFHEVGLFDIPATIDYILKETQQ  60
            MLADA +DVWL N+RG  YSR HV L P D+A FW+FS+HE+G  D+ A IDYIL  T+Q
Sbjct  90   MLADACFDVWLSNSRGTRYSRRHVSLDPSDEA-FWRFSWHEIGTEDVAAFIDYILDTTKQ  148

Query  61   PSLIYL  66
             +L +L
Sbjct  149  RALHFL  154


>Q9VG47_DROME unnamed protein product
Length=430

 Score = 233 bits (593),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 139/388 (36%), Positives = 210/388 (54%), Gaps = 27/388 (7%)

Query  100  VSENSDALDFVAMVDEHDYPVEEHLVTTEDGYELHVHRIPGSPDKPKAPGKPVVYFQHGL  159
            +   +  +  V ++  H+YPV+ H V T DGY L V RIP S     +  KPVV   HG+
Sbjct  39   IHHRTKVITAVDIISSHNYPVQTHTVVTRDGYILSVFRIPSSQLCASSEPKPVVLINHGM  98

Query  160  FSSSDQWILMGPESDFSYMLADAGYDVWLGNIRGNTYSRSHVKLSPDYDGEFWNFSFHEI  219
              S+D W+L GP +   ++LADA YDVWL N RG  YSR H+KL   +  +FW FS+HEI
Sbjct  99   TGSADSWLLTGPRNGLPFLLADACYDVWLINCRGTRYSRKHLKLKA-WLLQFWRFSWHEI  157

Query  220  ALFDIPATIDYILKETQQPSLIYVGHSMGGTISNVLLSTKPEYNEKIKLVINLATTVTWL  279
             + D+PAT+D+IL  T++ SL YVGHS G T   V+LS +PEYN++I+  I LA  V   
Sbjct  158  GMEDLPATVDHILASTKRNSLHYVGHSQGCTSMLVMLSMRPEYNKRIRTTILLAPPV---  214

Query  280  SPHQPTVELILHHADS-----IKGALNNMKIYELLSLSAATPRMITTLCGEKSMFRQLCA  334
                      L H+ S     +K   N +   ELL         ++ +C    +     A
Sbjct  215  ---------FLKHSLSMGHKIMKPLFNLLPDIELLPHHKMLNSAVSAICKILGVKDVCTA  265

Query  335  IFQMESIQSDVNMWHN----WISSFPAGTSAQSVLHYLQNIESGNFVMYDFGEKENSLKY  390
            ++ + + +   +M        I++ PAG S++   H+ Q  +SG F  YDFG   N L Y
Sbjct  266  LYLLTNGRVSQHMNRTLIPMLIATHPAGISSRQPRHFFQLKDSGRFRQYDFGFGMNYLIY  325

Query  391  GQPEPPAYDLSNIVAP---VALIYGEGDSIIAPDDVIELSKRLPNVVTIESVPDPKFGHL  447
             Q  PP Y L  +V P   + + Y + D  I+P DV+ L+ +LP  V    + D  + H+
Sbjct  326  RQNTPPEYPLE-MVRPHSAIHIFYSDDDGTISPRDVLTLASKLPYAVP-HHITDETWNHM  383

Query  448  DFVVAQDIKKLLNNRLLEIMENSLKQVK  475
            DF++A +I +L+NN +++I++   + +K
Sbjct  384  DFLLANNINELINNPVIKIIKTFEENIK  411


 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 49/66 (74%), Gaps = 1/66 (2%)

Query  1    MLADAGYDVWLGNARGNTYSRSHVKLSPDDDAEFWQFSFHEVGLFDIPATIDYILKETQQ  60
            +LADA YDVWL N RG  YSR H+KL      +FW+FS+HE+G+ D+PAT+D+IL  T++
Sbjct  117  LLADACYDVWLINCRGTRYSRKHLKLKAWL-LQFWRFSWHEIGMEDLPATVDHILASTKR  175

Query  61   PSLIYL  66
             SL Y+
Sbjct  176  NSLHYV  181



Lambda      K        H
   0.329    0.140    0.427 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3372238254


Query= CFLO000134-PA

Length=850
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4V6L4_DROME  unnamed protein product                                 247     6e-74
Q9VPE9_DROME  unnamed protein product                                 235     2e-69
LIP1_DROME  unnamed protein product                                   228     2e-66


>Q4V6L4_DROME unnamed protein product
Length=398

 Score = 247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/378 (36%), Positives = 202/378 (53%), Gaps = 20/378 (5%)

Query  462  MAMANEHGYPAEEHIVKTADGYKLRIHRIPGSPSKPKAPGKPVVFFQHGVFASSDTWILM  521
            + +   HGY  EEH V+T+DGY L +HRIP S +      +PVVF  HG+  SS  W+L 
Sbjct  32   VTIVRGHGYEIEEHEVQTSDGYILTMHRIPYSKNTGYDGPRPVVFLMHGLLCSSSDWVLA  91

Query  522  GPDHDLGVSRIDRNVLQIMVLAYMLADIGYDVWLGNARGNTYSRSHVKLSPNHNPKFWQF  581
            GP   L               AY+L++ GYDVW+GNARGNTYS+ H   SP   P FW F
Sbjct  92   GPHSGL---------------AYLLSEAGYDVWMGNARGNTYSKRHASKSPLLQP-FWNF  135

Query  582  SYHEIALFDMPASIDYILKETQQPSLIYVGHSMGTSISYVLLSTKPEYNKKVKLVISLAP  641
             +H+I ++D+PA +DY+L  T    L YVGHS GT+  +VL S  P +  +++    LAP
Sbjct  136  EWHDIGIYDLPAMMDYVLYWTNVTQLTYVGHSQGTTSFFVLNSMIPRFKSRIRSAHLLAP  195

Query  642  VAFWHSSPGPFIRLLQYNTAAIKNFVLNAKINEIFPLTAASTHFGKIACRDQSIFQEICV  701
            VA+      P   +          FV      E  P T     FG + C D++I Q +C 
Sbjct  196  VAWMEHMESPLATVGGPLLGQPNAFVELFGSAEFLPNTQLMNLFGALLCSDEAISQFMCT  255

Query  702  NFIYYTAGYNPHQLNASALPHLFSFFPAGGSVKTLIHYSQNLNTGDFKMYDYGAKENFLR  761
            N ++   G+N   +N + LP + +  PAG SV  + HY Q  N+G F+ +DYG+  N   
Sbjct  256  NTLFLLGGWNSPYINETLLPDIMATTPAGCSVNQIFHYLQEYNSGYFRQFDYGSTRNKKE  315

Query  762  YKQRDAPSYNLSNVVAPVALFYGKGDAISAPGNTIELSKKLSNVVAMES---ISDTRFSH  818
            Y  +  P Y++  +  P  L+Y   D  ++  +   L   + N  A++S   + + +++H
Sbjct  316  YSSKTPPEYDVEGIDVPTYLYYSDNDYFASLIDVDRLRYTM-NPSALKSAYRMPEEKWNH  374

Query  819  LDFLFSRNLKELLNNRLI  836
            +DFL+  N+KE+L +R+I
Sbjct  375  IDFLWGLNIKEILYDRVI  392


 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 59/125 (47%), Gaps = 6/125 (5%)

Query  255  SDSENSDVLDFVAMVDDHDYPAEEHLVTTEDGYELHVHRIPGSPNKPKAPGKPVVFFHHG  314
            +D+  +  +  V +V  H Y  EEH V T DGY L +HRIP S N      +PVVF  HG
Sbjct  21   ADTGRASSVTTVTIVRGHGYEIEEHEVQTSDGYILTMHRIPYSKNTGYDGPRPVVFLMHG  80

Query  315  LFSSSDQWIIMGPEHSLGDVLFQNMWHNWISSFPAGT------SAQSVLHYLQNIESGNF  368
            L  SS  W++ GP   L  +L +  +  W+ +    T      S   +L    N E  + 
Sbjct  81   LLCSSSDWVLAGPHSGLAYLLSEAGYDVWMGNARGNTYSKRHASKSPLLQPFWNFEWHDI  140

Query  369  VMYDF  373
             +YD 
Sbjct  141  GIYDL  145


 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 0/75 (0%)

Query  344  ISSFPAGTSAQSVLHYLQNIESGNFVMYDFGEKENSLKYGQPEPPAYDLSNIVAPVALIY  403
            +++ PAG S   + HYLQ   SG F  +D+G   N  +Y    PP YD+  I  P  L Y
Sbjct  278  MATTPAGCSVNQIFHYLQEYNSGYFRQFDYGSTRNKKEYSSKTPPEYDVEGIDVPTYLYY  337

Query  404  GEGDSMIAPDDVIEL  418
             + D   +  DV  L
Sbjct  338  SDNDYFASLIDVDRL  352


 Score = 31.2 bits (69),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 37/78 (47%), Gaps = 17/78 (22%)

Query  5    ELLPLSEASSKMISTLCGEKSMFHELCLS-----------FLTESLQLDVNTWHHWVSSF  53
            E LP ++  +   + LC ++++   +C +           ++ E+L  D+      +++ 
Sbjct  228  EFLPNTQLMNLFGALLCSDEAISQFMCTNTLFLLGGWNSPYINETLLPDI------MATT  281

Query  54   PAGASAQSVFHYIQNIES  71
            PAG S   +FHY+Q   S
Sbjct  282  PAGCSVNQIFHYLQEYNS  299


>Q9VPE9_DROME unnamed protein product
Length=399

 Score = 235 bits (599),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 145/385 (38%), Positives = 199/385 (52%), Gaps = 47/385 (12%)

Query  468  HGYPAEEHIVKTADGYK