BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110274.1 vacuolar protein sorting-associated protein 72
homolog [Drosophila elegans]

Length=352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VPS72_DROME  unnamed protein product                                  647     0.0  
Q385I5_TRYB2  unnamed protein product                                 30.8    1.5  


>VPS72_DROME unnamed protein product
Length=351

 Score = 647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/350 (93%), Positives = 333/350 (95%), Gaps = 0/350 (0%)

Query  1    MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQDEEEDNEYEQKDEEEDVVDSDFSI  60
            MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQ++EED EYEQKDEEEDVVDSDFSI
Sbjct  1    MAASRSRRNNAGNKIAHLLNEEEEDDFYKTSYGGFQEDEEDKEYEQKDEEEDVVDSDFSI  60

Query  61   DEQDELVSDQEEAPEKKRKRGGVNTKAYKETKPATKKETKAVPALHKKRGGGGVTKRRVR  120
            DE DE VSDQEEAPEKKRKRG VNTKAYKETKPA KKETKA PALHKKR GGGVTKRR R
Sbjct  61   DENDEPVSDQEEAPEKKRKRGVVNTKAYKETKPAVKKETKATPALHKKRPGGGVTKRRPR  120

Query  121  PRFTVLDSGRKSIRTSTAIKTQATKIRLKEMDDARKRKKKKVRVEDYMPTQEELLEEAKI  180
            PRFTVLDSGRKSIRTSTAIKTQATKIRLKE+DDARKRKKKKVRVEDYMPTQEELLEEAKI
Sbjct  121  PRFTVLDSGRKSIRTSTAIKTQATKIRLKELDDARKRKKKKVRVEDYMPTQEELLEEAKI  180

Query  181  TEEENIKSLEKFQKMELEKKKSRPTKRTFTGPTIRYHSLTMPAMRKPTRGANLLVDSKDT  240
            TEEEN KSLEKFQKMELEKKKSRPTKRTF+GPTIRYHSLTMPAMRKPTRGAN  VDSKD 
Sbjct  181  TEEENTKSLEKFQKMELEKKKSRPTKRTFSGPTIRYHSLTMPAMRKPTRGANPAVDSKDL  240

Query  241  AGKCERTFVTVENDFNDKVFQNIFRHKPAPKVSNGICPITRLPARYFDPVTQQPYYSIQA  300
            AGKCERTFVT+ENDFNDKVFQ++FRHK  PK SNGICPITRLPARYFDP+TQQPYYSIQA
Sbjct  241  AGKCERTFVTIENDFNDKVFQSLFRHKAPPKASNGICPITRLPARYFDPITQQPYYSIQA  300

Query  301  FKILREAYYMQLEQQGGSSDQPELAKWLEWRKLVKENRLKVSAAASKNGD  350
            FKILREAYYMQLEQQGG S+QPELAKWLEWRKLVKENRLK SAAASKNGD
Sbjct  301  FKILREAYYMQLEQQGGGSEQPELAKWLEWRKLVKENRLKASAAASKNGD  350


>Q385I5_TRYB2 unnamed protein product
Length=243

 Score = 30.8 bits (68),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 17/93 (18%)

Query  1   MAASRSRRNNAGNKIAHLLNE---EEEDDFYKTSYGGFQDEEEDNEYEQKDEEEDVVDSD  57
           +A  R RR N GN + +LL +    +E+ F         D   D+ +   +E  D +DSD
Sbjct  11  VADDRPRRANRGNMLQNLLEKGLNSDEEKFLNN----LSDATSDSTFTTSEEAVDEIDSD  66

Query  58  FS------IDEQDELVSD----QEEAPEKKRKR  80
           FS      + E   +V+D    +EE  E+K++R
Sbjct  67  FSDEEIEGVLEGTTIVTDAALEREERLERKKER  99



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110275.1 aurora kinase B [Drosophila elegans]

Length=329
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AURKB_DROME  unnamed protein product                                  660     0.0   
AIR2_CAEEL  unnamed protein product                                   302     3e-102
Q9VGF9_DROME  unnamed protein product                                 286     3e-94 


>AURKB_DROME unnamed protein product
Length=329

 Score = 660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/329 (95%), Positives = 320/329 (97%), Gaps = 0/329 (0%)

Query  1    MTLSRTKHANRTHLPHLLAKVPEEHQEPIKNMCLQMMSHSAYGQPYDWSARDFDMGAHLG  60
            MTLSR KHANR HLPHLLAKVPEEHQEPIKNMCL+MMSH AYGQPYDWS RDF+MGAHLG
Sbjct  1    MTLSRAKHANRNHLPHLLAKVPEEHQEPIKNMCLKMMSHDAYGQPYDWSPRDFEMGAHLG  60

Query  61   RGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWF  120
            RGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWF
Sbjct  61   RGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWF  120

Query  121  HDESRIYLALEIASEGELFKHLRGAPNHRFDEPRAAKYTYQVANALNYCHLNNVIHRDLK  180
            HDESRIYLALEIASEGELFKHLRGAPNHRFDEPR+AKYTYQVANALNYCHLNNVIHRDLK
Sbjct  121  HDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLK  180

Query  181  PENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGIL  240
            PENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGIL
Sbjct  181  PENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGIL  240

Query  241  CYEFVVGCPPFESNSTESTYSKIRRMEISYPSYLSKGCKELIGGLLRKQSNGRITLVDVM  300
            CYEFVVGCPPFESNSTESTYSKIRRMEISYPS+LSKGCKELIGGLLRK+S GRITLVDVM
Sbjct  241  CYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVM  300

Query  301  THSWVKEGMALREMQLKKVERGKENTAKN  329
            TH WVK GMA RE+QL+K ERGKENTA+N
Sbjct  301  THYWVKAGMAERELQLQKRERGKENTARN  329


>AIR2_CAEEL unnamed protein product
Length=305

 Score = 302 bits (774),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 140/276 (51%), Positives = 192/276 (70%), Gaps = 4/276 (1%)

Query  48   WSARDFDMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSR  107
            ++  DF++G  LG+GKFG VYLAR +  H+ VA+KV+FK +L  G V+ Q+ REIEIQS 
Sbjct  25   FTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSH  84

Query  108  LKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRAAKYTYQVANALN  167
            L HP+I++L T+F D  +IYL LE A  GE++K L    + RF EP AAKY Y++A+AL+
Sbjct  85   LNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQL--TVSKRFSEPTAAKYMYEIADALS  142

Query  168  YCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNS  227
            YCH  NVIHRD+KPEN+L+ S  +LK+ DFGWS H P+NKR+T+CGT+DYLPPEMV+G  
Sbjct  143  YCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQTMCGTMDYLPPEMVNGAD  202

Query  228  YDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSYLSKGCKELIGGLLR  287
            + D+VD W +G+LCYEF+VG PPFE      TY+ I+    +YP  + KG ++LIG LL 
Sbjct  203  HSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLV  262

Query  288  KQSNGRITLVDVMTHSWVKEGM--ALREMQLKKVER  321
                 R TL  V  H W++  M   +R  + +K+E+
Sbjct  263  VDPKARCTLEQVKEHYWIQGMMEAKIRAEKQQKIEK  298


>Q9VGF9_DROME unnamed protein product
Length=411

 Score = 286 bits (731),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 174/258 (67%), Gaps = 0/258 (0%)

Query  48   WSARDFDMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSR  107
            W   +FD+G  LGRGKFG VYLARE+ S ++VA+KV+FK ++ +  V+ QV REIEIQS 
Sbjct  149  WELNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSH  208

Query  108  LKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRAAKYTYQVANALN  167
            L+HPHILRL  +FHD+ RIYL LE A +G LF  L+  P  RFDE ++A Y   + +AL 
Sbjct  209  LRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALL  268

Query  168  YCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNS  227
            Y H  ++IHRD+KPEN+LL     LK+ADFGWS H PN+ R TLCGT+DYLPPEMV G  
Sbjct  269  YLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKP  328

Query  228  YDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSYLSKGCKELIGGLLR  287
            +  +VD W LG+LC+E +VG  PF S + + TY KI +++   P ++SK    LI  LL 
Sbjct  329  HTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLV  388

Query  288  KQSNGRITLVDVMTHSWV  305
                 R+ L  VM H W+
Sbjct  389  LNPQHRLPLDQVMVHPWI  406



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110276.1 deoxyuridine 5'-triphosphate nucleotidohydrolase
[Drosophila elegans]

Length=192
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V3I1_DROME  unnamed protein product                                 331     1e-117
Q8IPB1_DROME  unnamed protein product                                 311     1e-109
B4LTG5_DROVI  unnamed protein product                                 275     4e-91 


>Q9V3I1_DROME unnamed protein product
Length=188

 Score = 331 bits (849),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/174 (94%), Positives = 167/174 (96%), Gaps = 0/174 (0%)

Query  1    MPSIDCDDIPAAKKMKIDNCVLKFAKLTENALAPVRGSAKAAGVDLRSAYDLVVPARGKA  60
            MPS D  DIPAAKKMKID CVL+FAKLTENAL PVRGSAKAAGVDLRSAYD+VVPARGKA
Sbjct  1    MPSTDFADIPAAKKMKIDTCVLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKA  60

Query  61   IVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVK  120
            IVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVK
Sbjct  61   IVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVK  120

Query  121  RGDRIAQFICERIFYPELELVDKLEDTERGEAGFGSTGVKDLPAAKAQNGNGEK  174
             GDRIAQFICERIFYP+L +VDKLEDTERGEAGFGSTGVKDLPAAKAQNGNGEK
Sbjct  121  HGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGVKDLPAAKAQNGNGEK  174


>Q8IPB1_DROME unnamed protein product
Length=174

 Score = 311 bits (796),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/160 (95%), Positives = 156/160 (98%), Gaps = 0/160 (0%)

Query  15   MKIDNCVLKFAKLTENALAPVRGSAKAAGVDLRSAYDLVVPARGKAIVKTDLQVQVPEGS  74
            MKID CVL+FAKLTENAL PVRGSAKAAGVDLRSAYD+VVPARGKAIVKTDLQVQVPEGS
Sbjct  1    MKIDTCVLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKTDLQVQVPEGS  60

Query  75   YGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKRGDRIAQFICERIF  134
            YGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVK GDRIAQFICERIF
Sbjct  61   YGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKHGDRIAQFICERIF  120

Query  135  YPELELVDKLEDTERGEAGFGSTGVKDLPAAKAQNGNGEK  174
            YP+L +VDKLEDTERGEAGFGSTGVKDLPAAKAQNGNGEK
Sbjct  121  YPQLVMVDKLEDTERGEAGFGSTGVKDLPAAKAQNGNGEK  160


>B4LTG5_DROVI unnamed protein product
Length=510

 Score = 275 bits (704),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 148/169 (88%), Gaps = 1/169 (1%)

Query  1    MPSIDCDDIPAAKKMKIDN-CVLKFAKLTENALAPVRGSAKAAGVDLRSAYDLVVPARGK  59
            M S   DDI  AKKMK+D  CVL++AK+ E+AL P RGS +AAG DLRSAYDL+VPARGK
Sbjct  1    MASPVIDDIQTAKKMKLDKKCVLRYAKIIEHALEPQRGSERAAGFDLRSAYDLIVPARGK  60

Query  60   AIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEV  119
            AIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSD DFEV
Sbjct  61   AIVKTDLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDTDFEV  120

Query  120  KRGDRIAQFICERIFYPELELVDKLEDTERGEAGFGSTGVKDLPAAKAQ  168
            KRGDRIAQFICERI  PELE VDKL+DT RGE+GFGSTGVK+LP  K Q
Sbjct  121  KRGDRIAQFICERISIPELEQVDKLDDTVRGESGFGSTGVKELPGDKQQ  169


 Score = 274 bits (700),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 151/185 (82%), Gaps = 3/185 (2%)

Query  5    DCDDIPAAKKMKIDNCVLKFAKLTENALAPVRGSAKAAGVDLRSAYDLVVPARGKAIVKT  64
            D   I  AK      CVL+FAKLTE+AL P RGS KAAG+DLRSAYDL+VPA GKAIVKT
Sbjct  326  DKQQIVTAKTPTDKKCVLRFAKLTEHALEPQRGSEKAAGLDLRSAYDLIVPAHGKAIVKT  385

Query  65   DLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKRGDR  124
            DLQVQ+PEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSD DFEVKRGDR
Sbjct  386  DLQVQLPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDTDFEVKRGDR  445

Query  125  IAQFICERIFYPELELVDKLEDTERGEAGFGSTGVKDLPA---AKAQNGNGEKAAEPEAA  181
            IAQFICE IFYPE +  DKL+DTERGEAGFGSTGVK+LP    AK QNGNG+       A
Sbjct  446  IAQFICELIFYPEPKEEDKLDDTERGEAGFGSTGVKELPEAKLAKQQNGNGKTPLGENDA  505

Query  182  APATT  186
             P +T
Sbjct  506  TPIST  510


 Score = 273 bits (698),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/164 (83%), Positives = 143/164 (87%), Gaps = 0/164 (0%)

Query  5    DCDDIPAAKKMKIDNCVLKFAKLTENALAPVRGSAKAAGVDLRSAYDLVVPARGKAIVKT  64
            D   I  AK      CVL+FAKLTE+AL P RGS KAAG+DLRSAYDL VP+RGKAIVKT
Sbjct  166  DKQQIVTAKTPTDKKCVLRFAKLTEHALEPQRGSEKAAGLDLRSAYDLKVPSRGKAIVKT  225

Query  65   DLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDVDFEVKRGDR  124
            DLQVQ+PEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSD DFEVKRGDR
Sbjct  226  DLQVQLPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSDTDFEVKRGDR  285

Query  125  IAQFICERIFYPELELVDKLEDTERGEAGFGSTGVKDLPAAKAQ  168
            IAQFICERIFYPELE  DKL+DTERGEAGFGSTGVK+LP  K Q
Sbjct  286  IAQFICERIFYPELEQEDKLDDTERGEAGFGSTGVKELPGDKQQ  329



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110277.1 uncharacterized protein LOC108134471 isoform X1
[Drosophila elegans]

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIL_DROME  unnamed protein product                                    32.7    0.84 


>HIL_DROME unnamed protein product
Length=818

 Score = 32.7 bits (73),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (45%), Gaps = 9/132 (7%)

Query  159  YTYYISTALFLIFGLKML-----YDGYKMKPTD---AQEELEEVQSDLRKREDELMRKAS  210
            Y  + ++AL +   LK       Y+  + KP D   A+EE   ++   RK ED+L RK +
Sbjct  142  YGRFDASALHIAHALKQTEIQKAYNKAREKPIDFYLAREEQAHLEMKHRKEEDDLYRKFA  201

Query  211  RKYEDSEGKRKNSNSDKEDVSEQALIHGRSSVSAGAGATSIGDSDMQHRQRKQRNHLNNN  270
             K  + + K ++   D+ +   Q L H      A +  +    + +  R  +Q+  L   
Sbjct  202  SKRAEEDRKIQDEFQDEWERELQRLTHKFEKELATSRRSRDEANILTMRHEQQKEDL-EK  260

Query  271  NSTITHSNSKQN  282
            N T+  S  K++
Sbjct  261  NMTLRRSKKKES  272



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110278.1 lysosomal thioesterase PPT2 homolog [Drosophila
elegans]

Length=289
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPT2_DROME  unnamed protein product                                   546     0.0  
PPT1_CAEEL  unnamed protein product                                   76.6    5e-16
PPT1_DROME  unnamed protein product                                   62.8    4e-11


>PPT2_DROME unnamed protein product
Length=288

 Score = 546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/289 (90%), Positives = 278/289 (96%), Gaps = 1/289 (0%)

Query  1    MRLQLRILLAILASCSWISGSLAYKPVVILHGILSGAESMSFLVREIEEIHPGTIVYNCD  60
            MRL+L++L+A+L +CS IS SLAYKPVVILHGILSGAESM+ LVREIEE HPGTIVYNCD
Sbjct  1    MRLRLQVLVALL-TCSSISVSLAYKPVVILHGILSGAESMASLVREIEEFHPGTIVYNCD  59

Query  61   KFSGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPDHNVKTF  120
            KF+GWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLP+HNVKTF
Sbjct  60   KFNGWYSLENAWRQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPEHNVKTF  119

Query  121  ISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQELYLKYSE  180
            ISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQ+LYLKYSE
Sbjct  120  ISLSSPQAGQYGTSFLHLIFPDLAAKTAFELFYSRVGQHTSVGGYWNDPQRQDLYLKYSE  179

Query  181  FLPLINNEKVTSNSTSFKMGMVRLNRLVMIGGPNDDVITPWQSSHFSYYDENMDVIPFNK  240
            FLPLINNEK TSNSTSFKMGMVRLN+LVMIGGPNDDVITPWQSSHF Y+DENMDVIPF +
Sbjct  180  FLPLINNEKKTSNSTSFKMGMVRLNKLVMIGGPNDDVITPWQSSHFGYFDENMDVIPFIR  239

Query  241  RKIFTTDSIGIKTLQEAGKLTIVIKPHVHHLAWHTRRDVIHQVIMPYLD  289
            R IFT+DSIGI+TLQEAGKL IV+KPHVHHLAWHTRRDVIH+VI PYLD
Sbjct  240  RPIFTSDSIGIRTLQEAGKLIIVVKPHVHHLAWHTRRDVIHEVIFPYLD  288


>PPT1_CAEEL unnamed protein product
Length=298

 Score = 76.6 bits (187),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/274 (26%), Positives = 124/274 (45%), Gaps = 28/274 (10%)

Query  7    ILLAILA-SCSWISGSLAYKPVVILHGI---LSGAESMSFLVREIEEIHPGTIVYNC---  59
            +LL +LA + +    +    PVV+ HG+        SM  + +  EE  PG  V++    
Sbjct  6    LLLCLLAITTAEFRNATKQVPVVMWHGMGDCCCNPLSMGSVKKLFEEQIPGVYVHSLQLG  65

Query  60   -----DKFSGWYSLENAWRQVDQVRDYLNEVGKLHPE---GIIVLGYSQGGLLARAAIQS  111
                 D   G+Y+  N    +  ++       K  PE   G   +G+SQG    RA  Q 
Sbjct  66   SSITKDIEHGFYANTNELVYMACIKI------KNDPELKNGYNAIGFSQGAQFLRAVAQR  119

Query  112  LPDHNVKTFISLSSPQAGQYGTSFL---HLIFPDLAAKTAFELFYSRVGQHTSVGGYWND  168
             P+  +K  +S+     G +G  +    +++   +        +   V +      YW+D
Sbjct  120  CPNPPMKNLVSVGGQHQGVFGAPYCIGDNIMCNGVRRLIDLGAYLPFVQKRVVQAQYWHD  179

Query  169  PQRQELYLKYSEFLPLINNEKVTSNSTSFKMGMVRLNRLVMIGGPNDDVITPWQSSHFSY  228
            P + E Y K S FL  I      +N+ ++K  ++ L  LV++    D ++ P  SS F +
Sbjct  180  PNQVEEYKKRSIFLADI--NNENNNNPTYKRNLLSLKNLVLVKFNQDHMVVPKDSSWFGF  237

Query  229  Y-DENMD-VIPFNKRKIFTTDSIGIKTLQEAGKL  260
            Y D ++D ++P N+  ++  D IG+K L E+G++
Sbjct  238  YKDGDIDTILPMNETDLYKEDRIGLKKLHESGRI  271


>PPT1_DROME unnamed protein product
Length=314

 Score = 62.8 bits (151),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/201 (26%), Positives = 87/201 (43%), Gaps = 19/201 (9%)

Query  73   RQVDQVRDYLNEVGKLHPEGIIVLGYSQGGLLARAAIQSLPDHNVKTFISLSSPQAGQYG  132
             QVD V   L +   L  +G   +G+SQGG   RA  +  P+  ++  I+L     G +G
Sbjct  98   EQVDYVCKQLLQDEHL-AKGYHAIGFSQGGQFLRAVAERCPNPPMRNLITLGGQHQGIFG  156

Query  133  TSFLHLIFPDLAAKTAFEL--------FYSRVGQHTSVGGYWNDPQRQELYLKYSEFLPL  184
                  + P L  K    +        +   V +      YW+DP  +  Y   S FL  
Sbjct  157  LP----MCPTLTEKPCDYITRLLDNAAYAPEVQKALVQATYWHDPIMENKYRLGSTFLAD  212

Query  185  INNEKVTSNSTSFKMGMVRLNRLVMIGGPNDDVITPWQSSHFSYYD--ENMDVIPFNKRK  242
            INNE   +    +   + +L + VM+   ND ++ P +S  F YY   +N  + PF + K
Sbjct  213  INNELFINK--FYIENLQKLKKFVMVQFLNDTIVQPKESQWFQYYTTGQNKVIQPFTESK  270

Query  243  IFTTDSIGIKTLQEAGKLTIV  263
            ++    +G+  +   G+L  +
Sbjct  271  VY--QDLGLDKMHRQGQLVFL  289



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110279.1 exosome complex component CSL4 [Drosophila elegans]

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKJ4_DROME  unnamed protein product                                 400     2e-144
Q9XXD2_CAEEL  unnamed protein product                                 94.0    8e-24 
Q95XD0_CAEEL  unnamed protein product                                 37.0    0.007 


>Q9VKJ4_DROME unnamed protein product
Length=204

 Score = 400 bits (1028),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/204 (95%), Positives = 199/204 (98%), Gaps = 0/204 (0%)

Query  1    MSSQPDETIVCLPGERLCRTEDNIVLGIGTYEQNGYIYASKSGIVNIEESGENCQVVSVH  60
            MS Q DET+VCLPGERLCRTED+IVLGIGTYEQNGYIYASKSGIVNIE+SG+ CQVVSVH
Sbjct  1    MSEQQDETVVCLPGERLCRTEDSIVLGIGTYEQNGYIYASKSGIVNIEDSGDKCQVVSVH  60

Query  61   KPGFHLTIPATGDVVTARVLVTTPKFVKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRV  120
            KPGFHLTIPATGDVVTARVLVTTPKF KCAIFCVRNVLLESSYRGLLRKEDVRETEKDRV
Sbjct  61   KPGFHLTIPATGDVVTARVLVTTPKFAKCAIFCVRNVLLESSYRGLLRKEDVRETEKDRV  120

Query  121  DIYKSFKPGDVILARVINQLDQSFLLTTAENELGVVIAYASDARKTRVPMVPVGWSEMQC  180
            DIYKSF+PGDVILARVINQL+QSFLLTTAENELGVVIAYASD RKTRVPMVPVGWSEMQC
Sbjct  121  DIYKSFRPGDVILARVINQLEQSFLLTTAENELGVVIAYASDYRKTRVPMVPVGWSEMQC  180

Query  181  PQTTIKEPRKVAKVLPESSINAVK  204
            PQTTIKEPRKVAKVLPESSINAVK
Sbjct  181  PQTTIKEPRKVAKVLPESSINAVK  204


>Q9XXD2_CAEEL unnamed protein product
Length=208

 Score = 94.0 bits (232),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 68/209 (33%), Positives = 109/209 (52%), Gaps = 20/209 (10%)

Query  7    ETIVCLPGERLCRTEDNIVLGIGTYEQNGYIYASKSGIVNI----EESGENCQVVSVHKP  62
            ET+V  PG+++        +G G YE N  I+AS +G VN+    ++S    QV+ V + 
Sbjct  4    ETLVA-PGDKVLDAIGEYRMGKGLYEANRRIFASVAGFVNVYGFRDKSDNLVQVIEVRRS  62

Query  63   GFHLT---IPATGDVVTARVLVTTPKFVKCAIFCVRNVLLESSYRGLLRKEDVRETEKDR  119
               L    +P  G +VTA+V+    +F KC I  + + + +  +  LL K+ +R  E + 
Sbjct  63   EDQLDNELLPFHGAIVTAKVMAVGLRFAKCDIISIGDKVYKKRFSALLPKKKLRPLEPEL  122

Query  120  VDIYKSF-KPGDVILARVIN--QLDQSFLLTTAENELGVVIAYASDARKTRVPMVPVGWS  176
             + +K+F +P D ILA+V    ++   F+L+ AE+ELGVV+           PM  V W+
Sbjct  123  SEPFKNFVRPNDYILAKVCEDAEIKDKFVLSIAEDELGVVLCRGRFGE----PMQKVDWN  178

Query  177  EMQCPQTTIKEPRKVAKV-----LPESSI  200
             +   +T   EPRK+AKV     LP  S+
Sbjct  179  TVVSTRTGKTEPRKMAKVPQKCTLPTQSV  207


>Q95XD0_CAEEL unnamed protein product
Length=303

 Score = 37.0 bits (84),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 48/157 (31%), Positives = 71/157 (45%), Gaps = 21/157 (13%)

Query  6    DETIVCLPGERLCRTEDNIVLGIGTYEQNGYIYASKSGIVNIEESGENCQVVSVHKPGFH  65
            DET + +PG  +C      + G GTY ++G I +S SG+V         + +     G  
Sbjct  27   DETKIVIPGHSVCDAPQQFMRGHGTYVRDGEIVSSLSGVVQQLNRLLMVKTIKQRYAG--  84

Query  66   LTIPATGDVVTARVLVTTPKFVKC-------AIFCVRNVLLESSYRGLLRKEDVRETEKD  118
                  GDVV ARV+    K  KC       A   + +VLL     G  R++DV + EK 
Sbjct  85   ----EVGDVVVARVVEVQAKRWKCDVASRLHANLPLGSVLLPG---GDFRRKDVEDEEK-  136

Query  119  RVDIYKSFKPGDVILARVIN-QLDQSFLLTTAENELG  154
               + +  K G++I A V   Q D + +L T  N+ G
Sbjct  137  ---MSEFLKNGELICAEVQQVQHDGTLMLHTRNNKYG  170



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110280.1 putative nuclease HARBI1 [Drosophila elegans]

Length=376
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GEFB_DICDI  unnamed protein product                                   31.2    2.1  
VER3_CAEEL  unnamed protein product                                   30.4    2.8  
ACT1_PLAFX  unnamed protein product                                   29.6    4.9  


>GEFB_DICDI unnamed protein product
Length=1529

 Score = 31.2 bits (69),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 14/44 (32%), Positives = 25/44 (57%), Gaps = 10/44 (23%)

Query  60    RYTKENLRRIIEIVRDDLEIEYYEPLKREQVPIDLQILSAIRLW  103
             RY   NL+ I+           Y+ +++ Q+PI L++L+ +RLW
Sbjct  1125  RYFTPNLKNIVP----------YQFVQKIQIPIQLRVLNVLRLW  1158


>VER3_CAEEL unnamed protein product
Length=1227

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 30/108 (28%), Positives = 51/108 (47%), Gaps = 16/108 (15%)

Query  76   DLEIE---YYEPLKR--EQVPIDLQILSAIRLWGGTEH-----PKLTAMAHGVSLRTLAK  125
            DL +E   YY P     E  P++L+IL+ I    G+ H       L  MA+  S   +  
Sbjct  824  DLPVEERTYYLPYNNDYEIDPVNLEILNPI----GSGHFGVVKKGLLGMAYPKS--KIES  877

Query  126  ITRRVASVLSSKASRYIRMPATLSEKERMMCSFQAIANMPQVIGALLQ  173
             TR   +V SS     + +   ++E+ ++MC+     N+  +IGA+ +
Sbjct  878  KTRLPVAVKSSTNPFNVELQKMMAEELKVMCAIPKNPNVLALIGAVTK  925


>ACT1_PLAFX unnamed protein product
Length=376

 Score = 29.6 bits (65),  Expect = 4.9, Method: Compositional matrix adjust.
 Identities = 14/43 (33%), Positives = 21/43 (49%), Gaps = 5/43 (12%)

Query  251  ILLGNEMVRCSSSLFTPVRFPRNQSEELYNHAHSITYASARKC  293
            I +GNE  RC  +LF P    +  +       H+ T+ S +KC
Sbjct  249  ITVGNERFRCPEALFQPSFLGKEAA-----GIHTTTFNSIKKC  286



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110281.1 uncharacterized protein LOC108134478 isoform X1
[Drosophila elegans]

Length=122
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95NV8_DROME  unnamed protein product                                 210     6e-72
Q9VKK5_DROME  unnamed protein product                                 206     4e-70
ALLS_MANSE  unnamed protein product                                   35.8    4e-04


>Q95NV8_DROME unnamed protein product
Length=121

 Score = 210 bits (535),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/122 (93%), Positives = 118/122 (97%), Gaps = 1/122 (1%)

Query  1    MMKFVQILLCYGLLLTVLFALSDARPSAAGEAGPDSDGLDGQEAEDVRGAYGGGYEMPAQ  60
            MMKFVQILLCYGLLLT+ FALS+ARPS A E GPDSDGLDGQ+AEDVRGAYGGGY+MPAQ
Sbjct  1    MMKFVQILLCYGLLLTLFFALSEARPSGA-ETGPDSDGLDGQDAEDVRGAYGGGYDMPAQ  59

Query  61   AIYPNIPMDRLQMLFAQYRPTYSAYLRSPSYGNVNELYRLPESKRQVRYRQCYFNPISCF  120
            AIYPNIPMDRLQMLFAQYRPTYSAYLRSP+YGNVNELYRLPESKRQVRYRQCYFNPISCF
Sbjct  60   AIYPNIPMDRLQMLFAQYRPTYSAYLRSPTYGNVNELYRLPESKRQVRYRQCYFNPISCF  119

Query  121  RK  122
            RK
Sbjct  120  RK  121


>Q9VKK5_DROME unnamed protein product
Length=122

 Score = 206 bits (523),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 118/123 (96%), Gaps = 2/123 (2%)

Query  1    MMKFVQILLCYGLLLTVLFALSDARPSAAGEAGPDSDGLDGQEAEDVRGAYGGGYEMPAQ  60
            MMKFVQILLCYGLLLT+ FALS+ARPS A E GPDSDGLDGQ+AEDVRGAYGGGY+MPAQ
Sbjct  1    MMKFVQILLCYGLLLTLFFALSEARPSGA-ETGPDSDGLDGQDAEDVRGAYGGGYDMPAQ  59

Query  61   AIYPNIPMDRLQMLFAQYRPT-YSAYLRSPSYGNVNELYRLPESKRQVRYRQCYFNPISC  119
            AIYPNIPMDRLQMLFAQYRPT YSAYLRSP+YGNVNELYRLPESKRQVRYRQCYFNPISC
Sbjct  60   AIYPNIPMDRLQMLFAQYRPTSYSAYLRSPTYGNVNELYRLPESKRQVRYRQCYFNPISC  119

Query  120  FRK  122
            FRK
Sbjct  120  FRK  122


>ALLS_MANSE unnamed protein product
Length=15

 Score = 35.8 bits (81),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)

Query  106  QVRYRQCYFNPISCF  120
            QVR+RQCYFNPISCF
Sbjct  1    QVRFRQCYFNPISCF  15



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110283.1 uncharacterized protein LOC108134478 isoform X2
[Drosophila elegans]

Length=120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95NV8_DROME  unnamed protein product                                 201     2e-68
Q9VKK5_DROME  unnamed protein product                                 201     2e-68
ALLS_MANSE  unnamed protein product                                   35.8    4e-04


>Q95NV8_DROME unnamed protein product
Length=121

 Score = 201 bits (512),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/122 (91%), Positives = 116/122 (95%), Gaps = 3/122 (2%)

Query  1    MMKFVQILLCYGLLLTVLFALSDARPSAAGEAGPDSDGLDGQEAEDVRGAYGGGYEMPAQ  60
            MMKFVQILLCYGLLLT+ FALS+ARPS A E GPDSDGLDGQ+AEDVRGAYGGGY+MPAQ
Sbjct  1    MMKFVQILLCYGLLLTLFFALSEARPSGA-ETGPDSDGLDGQDAEDVRGAYGGGYDMPAQ  59

Query  61   AIYPNIPMDRLQMLFAQYRPT--AYLRSPSYGNVNELYRLPESKRQVRYRQCYFNPISCF  118
            AIYPNIPMDRLQMLFAQYRPT  AYLRSP+YGNVNELYRLPESKRQVRYRQCYFNPISCF
Sbjct  60   AIYPNIPMDRLQMLFAQYRPTYSAYLRSPTYGNVNELYRLPESKRQVRYRQCYFNPISCF  119

Query  119  RK  120
            RK
Sbjct  120  RK  121


>Q9VKK5_DROME unnamed protein product
Length=122

 Score = 201 bits (512),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 116/123 (94%), Gaps = 4/123 (3%)

Query  1    MMKFVQILLCYGLLLTVLFALSDARPSAAGEAGPDSDGLDGQEAEDVRGAYGGGYEMPAQ  60
            MMKFVQILLCYGLLLT+ FALS+ARPS A E GPDSDGLDGQ+AEDVRGAYGGGY+MPAQ
Sbjct  1    MMKFVQILLCYGLLLTLFFALSEARPSGA-ETGPDSDGLDGQDAEDVRGAYGGGYDMPAQ  59

Query  61   AIYPNIPMDRLQMLFAQYRPT---AYLRSPSYGNVNELYRLPESKRQVRYRQCYFNPISC  117
            AIYPNIPMDRLQMLFAQYRPT   AYLRSP+YGNVNELYRLPESKRQVRYRQCYFNPISC
Sbjct  60   AIYPNIPMDRLQMLFAQYRPTSYSAYLRSPTYGNVNELYRLPESKRQVRYRQCYFNPISC  119

Query  118  FRK  120
            FRK
Sbjct  120  FRK  122


>ALLS_MANSE unnamed protein product
Length=15

 Score = 35.8 bits (81),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 14/15 (93%), Positives = 15/15 (100%), Gaps = 0/15 (0%)

Query  104  QVRYRQCYFNPISCF  118
            QVR+RQCYFNPISCF
Sbjct  1    QVRFRQCYFNPISCF  15



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110284.1 protein I'm not dead yet [Drosophila elegans]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

INDY1_DROME  unnamed protein product                                  182     2e-50
NAD1_CAEEL  unnamed protein product                                   97.1    5e-21
NAD3_CAEEL  unnamed protein product                                   91.3    3e-19


>INDY1_DROME unnamed protein product
Length=590

 Score = 182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 145/545 (27%), Positives = 252/545 (46%), Gaps = 43/545 (8%)

Query  1    MATQDYK------PGDVPLE----EQDDRRLFCKF----HYKGVLLLVVPILLAPILAGH  46
            MAT+  K      P D+ +E    EQ    + C      H+KG+++ +VP+L  P++  +
Sbjct  1    MATETTKMIYTPPPLDIKMEIEIGEQPQPPVKCSNFFANHWKGLVVFLVPLLCLPVMLLN  60

Query  47   PVLICRFIYISLCLYLIYILNLMARGGLAFIYIVFIPVAGIAGSGKVSTSYYTDLIFLVY  106
                 R +Y+ L + + ++   +     + I IV  P+ GI  S +    Y+ D + +  
Sbjct  61   EGAEFRCMYLLLVMAIFWVTEALPLYVTSMIPIVAFPIMGIMSSDQTCRLYFKDTLVMFM  120

Query  107  GAIFMGIMMDSSKLSERLGVCVASIVGSSLRYLQIFLTIPVFLLAFLVSPTLAAAFSMKV  166
            G I + + ++   L +RL + V  IVG S R L   L +    L+  +S     A    +
Sbjct  121  GGIMVALAVEYCNLHKRLALRVIQIVGCSPRRLHFGLIMVTMFLSMWISNAACTAMMCPI  180

Query  167  AQAVITEYDNAGIVKMNSD--------ESRYEPGSKPYPTRPVIGIYLTCCYTATLAGSL  218
             QAV+ E    G+ K+N +          +      PYPT+  +  YL   Y ++L G  
Sbjct  181  IQAVLEELQAQGVCKINHEPQYQIVGGNKKNNEDEPPYPTKITLCYYLGIAYASSLGGCG  240

Query  219  SPFVNPNGV----ICDIFWFLSLENM----MLLMVVPGILGLFVMVF-WIQILFLGLFGG  269
            +       +    I +  +  S E M     +   VP +L   ++ F ++Q  F+GL+  
Sbjct  241  TIIGTATNLTFKGIYEARFKNSTEQMDFPTFMFYSVPSMLVYTLLTFVFLQWHFMGLWRP  300

Query  270  SVRRDLAELEGNRAG--FRQSMYDKR-QAMGSWGIYPMLVFILIIILFILVATRNPRLFQ  326
               ++  E++  R G    + + D+R + +G   I+ + V IL I + ++  TR P +F 
Sbjct  301  K-SKEAQEVQRGREGADVAKKVIDQRYKDLGPMSIHEIQVMILFIFMVVMYFTRKPGIFL  359

Query  327  GWDDINTANESGPSVPTIFMAILFFAIPANYFFCKYYVCR-QPETEGTSPSLLGWKAVNT  385
            GW D+  + +   S+PTIF+ ++ F +PANY F +Y   R  P   G +PSL+ WK + T
Sbjct  360  GWADLLNSKDIRNSMPTIFVVVMCFMLPANYAFLRYCTRRGGPVPTGPTPSLITWKFIQT  419

Query  386  NTPWADIFMLGAAFSCVYCAQKSGLYEAVAGAMTNPEGGSGPLQFVCGALFGTLLTNLSP  445
              PW  +F+LG  F+    +++SG+ + +  A+   +     +  +   L    LT  S 
Sbjct  420  KVPWGLVFLLGGGFALAEGSKQSGMAKLIGNALIGLKVLPNSVLLLVVILVAVFLTAFSS  479

Query  446  ATTVAKTALPIMVKAGGT-------FVLPFATALHNQFLLPVSSPSNTIVAGWGNIRPFQ  498
               +A   +P++ +            +LP   A    F LPVS+P N +VAG+ NIR   
Sbjct  480  NVAIANIIIPVLAEMSLAIEIHPLYLILPAGLACSMAFHLPVSTPPNALVAGYANIRTKD  539

Query  499  FLMAG  503
              +AG
Sbjct  540  MAIAG  544


>NAD1_CAEEL unnamed protein product
Length=582

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 111/488 (23%), Positives = 196/488 (40%), Gaps = 78/488 (16%)

Query  75   AFIYIVFIPVAGIAGSGKVSTSYYTDLIFLVYGAIFMGIMMDSSKLSERLGVCVASIVGS  134
            AFI ++  P+ GI  S +V+ +Y  D  FL  G + + + ++  +L  R+ + V   VGS
Sbjct  66   AFIPMILFPLFGIMRSEEVARAYLPDTCFLFMGGLMVALAVEKCELHARVALFVLKTVGS  125

Query  135  S-LRYLQIFLTIPVFLLAFLVSPTLAAAFSMKVAQAVITEY-------DNAGIVKMNSDE  186
               R +  F+ +  FL +  +S T   A  + + Q+VITE        D   + + + + 
Sbjct  126  EPARVMAGFMGVTGFL-SMWISNTATTALMVPILQSVITELVSNHRMEDLVALCEAHHNS  184

Query  187  SR----------------------YEPGSKPYPTRPVIGIYLTCCYTATLAGSLSPFVNP  224
            SR                       +    P   +   G+ L+ C++A + G+       
Sbjct  185  SRKHSVGMRRLSLPNENNEIKREEMDTAMSPREQKMAKGLMLSVCFSANIGGA----ATI  240

Query  225  NGVICDIFWFLSLENMMLLMVVPG----------ILGLFVMVF------WIQILFLGLFG  268
             G   ++     L  +      PG          ++  F MVF      W  +  L L  
Sbjct  241  TGTASNLVLVGQLNELF-----PGADTGVNFLSWLIFAFPMVFCCLIYCWCVLYLLYL--  293

Query  269  GSVRRDLAELEGNRAGFRQSMYDKRQAMGSWGIYPMLVFILIIILFILVATRNPRLFQGW  328
                RD  +         Q  Y++  A     +  +  F L+++L+IL   R P++  GW
Sbjct  294  ----RDAPKGSIIVTRKLQQKYNELHAFSFAEMAVIFCFALLLVLWIL---REPQVVPGW  346

Query  329  DDINTANESGPSVPTIFMAILFFAIPANYFFCKYYVCR-QPETEGTSPSLLGWKAVNTNT  387
             ++        +   +F+ IL F +P      K    R   E    S  LL W  V    
Sbjct  347  GEMFKDEFVSDATSAMFIVILLFTLPE-----KLPSSRGSSEQRKASSGLLDWATVQDRF  401

Query  388  PWADIFMLGAAFSCVYCAQKSGLYEAVAGAMTNPEGGSGPLQFVCGALFGTLLTNLSPAT  447
            PW+ +F+LG  F+     ++SGL   +   M   +  +  +  +   +    LTN+   T
Sbjct  402  PWSVLFLLGGGFALAAGVKESGLSHDIGAIMRYLDVFNHNIIMLICIIISVTLTNVCSNT  461

Query  448  TVAKTALPIMVKAGGT-------FVLPFATALHNQFLLPVSSPSNTIVAGWGNIRPFQFL  500
             +A   +PI+ +   +       F+LP   +    FLLPV++P N IV   G ++ F   
Sbjct  462  VIASIFIPIVAELARSLEIDPLNFMLPVTISASFAFLLPVATPPNAIVFSSGYLKVFDMF  521

Query  501  MAGSVLTI  508
            ++G  +T+
Sbjct  522  VSGLCVTL  529


>NAD3_CAEEL unnamed protein product
Length=566

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 109/502 (22%), Positives = 209/502 (42%), Gaps = 45/502 (9%)

Query  28   KGVLLLVVPILLAPILAGH-PVLICRFIYISLCLYLIYILNLMARGGLAFIYIVFIPVAG  86
             G++L++ P+    +L    P   C +    + +Y  ++  +M     A + +V  P+ G
Sbjct  53   NGLVLVLTPLFFGQMLNWEGPEWKCAYCVCIIAVY--WMSEVMPLAVTAMLPVVLFPLVG  110

Query  87   IAGSGKVSTSYYTDLIFLVYGAIFMGIMMDSSKLSERLGVCVASIVGSSLRYLQI-FLTI  145
            +  +   +  Y  D  FL  G + M   ++   L ER+ + V   VGS  +++ + F+T+
Sbjct  111  VLDANTTAKEYMNDTNFLFIGGLIMAAAVEKCDLHERVALSVLRCVGSEPKWIMLGFMTV  170

Query  146  PVFLLAFLVSPTLAAAFSMKVAQAVITEYDNAGIVKMNSDESRYEPGSKPYPTRPVIGIY  205
               L +F +S T   A  + + Q+V+ +  ++      ++  R   G K   T    G+ 
Sbjct  171  TALLSSF-ISNTATTAMMVPIGQSVVQQLISS-FQHHPTNGERGRLGCKKMAT----GLV  224

Query  206  LTCCYTATLAGSLSPFVNPNGVICDIFWFLSLENMM--LLMVVPGILGLFVMVFWI----  259
            L+ C+ A + G+ +    P+ ++           M+  L  + P + G    V WI    
Sbjct  225  LSICFAANIGGTGTATGTPSNLV-----------MLGQLSALFPKVDGSLNYVTWIFFAY  273

Query  260  QILFLGLFGGSVR------RDLAELEGNRAGFRQSMYDKRQAMGSWGIYPMLVFILIIIL  313
             ++ L LF   +       RD  E +       ++ Y++   M         VF+   IL
Sbjct  274  PLMLLCLFVAWMTLVSFFLRDAPEKDEAVTEMLKTRYNELPRM---TYAEKSVFVCFCIL  330

Query  314  FILVATRNPRLFQGWDDINTANESGPSVPTIFMAILFFAIPANYFFCKYYVCRQPETEGT  373
              L   RNP +  G+           +   + +A L F +P+       Y+  + E    
Sbjct  331  LSLWVFRNPGVVPGFGVFFKKGAYTDATSAMIVAFLLFVLPSERPDLATYI--KKEDLKK  388

Query  374  SPSLLGWKAVNTNTPWADIFMLGAAFSCVYCAQKSGLYEAVAGAMTNPEGGSGPLQFVCG  433
               L+ WK +    PW+ + +LG  F+     ++SGL   +  ++++ E     +  +  
Sbjct  389  RGCLMDWKTMQETFPWSVVLLLGGGFALAAGVKESGLSLLIGNSLSSIEHLPLWILQLLT  448

Query  434  ALFGTLLTNLSPATTVAKTALPIMV----KAGG---TFVLPFATALHNQFLLPVSSPSNT  486
             L   ++TN+   T  A   +PI+     +AG    T +LP   A    F+ PV +P N 
Sbjct  449  MLIAMVITNICSNTVTASIFVPIVATLAQRAGHHPFTLMLPTTLASSFAFIFPVGTPPNA  508

Query  487  IVAGWGNIRPFQFLMAGSVLTI  508
            IV G G ++       G ++++
Sbjct  509  IVFGSGMVKVSDMAFVGGIISL  530



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110286.1 phenoloxidase-activating factor 1-like [Drosophila
elegans]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PPAF3_HOLDI  unnamed protein product                                  97.1    7e-23
PPAF1_HOLDI  unnamed protein product                                  95.9    2e-22
BAEE_BOMMO  unnamed protein product                                   89.4    4e-20


>PPAF3_HOLDI unnamed protein product
Length=351

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 122/267 (46%), Gaps = 22/267 (8%)

Query  35   NEITAPDEYPWIGRVGYVTENGT-SFPCFSVLIHQRYAILTAFCALSNAEFDESFILFGN  93
             E T   EYPW+  +     +G  SF C   LI  RY +  A C +S++ +  + +  G 
Sbjct  100  GEDTDLGEYPWMALLQQTKTSGAKSFGCGGSLISDRYVLTAAHCVVSSS-YTVTMVRLGE  158

Query  94   WRENESFEVRDCRREGNIFQCAAAPQKVDISELVVHPEYKNDIK---HNIALAKLGRDVE  150
            W   +    +DC   G+   C+  PQ + I  +  HP Y+   +   ++IAL +L R V 
Sbjct  159  W---DLRATQDCVGSGSYQYCSPPPQDIGIESITSHPNYEKSSRGVFNDIALIRLARPVN  215

Query  151  FTDYVQPICLPPVPENDGSHIAQRLEIAGFRRPLWEGQKADEEGEWRRKVHVFMASREFC  210
               YVQPICLP   E   + + + L +AG     W   +   + + ++K+ + +     C
Sbjct  216  RNKYVQPICLPLPTER--TPVGENLLVAG-----WGATETKAQSDKKQKLKLPVTDLPAC  268

Query  211  KSVAYPDWQNLSRNHLCALGEEEKTLY---FGSPLMGIEVVDEKPRNFYLVGIPISYMLL  267
            K++     + ++   +CA G + K       G PL G          FY+ GI +SY  +
Sbjct  269  KTLYAKHNKIINDKMICAGGLKGKDSCKGDSGGPLFGQTGAGNA--QFYIEGI-VSYGAI  325

Query  268  NSPKNLTMQIFTRISPYKKWILKNIAV  294
               +     I+TR+S +  WI +N+ V
Sbjct  326  CGTEGFPA-IYTRVSDHLDWIKQNVRV  351


>PPAF1_HOLDI unnamed protein product
Length=365

 Score = 95.9 bits (237),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/278 (27%), Positives = 121/278 (44%), Gaps = 23/278 (8%)

Query  23   CGKLLENQLYSRNEITAPDEYPWIGRVGYV-TENGTSFPCFSVLIHQRYAILTAFCALSN  81
            CG  +E       + T P+E+PW   +GY  + N   F C   LI+ RY +  A C    
Sbjct  101  CGYQVEADKILNGDDTVPEEFPWTAMIGYKNSSNFEQFACGGSLINNRYIVTAAHCVAGR  160

Query  82   A---EFDESFILFGNWRENESFEVRDCRREGNIFQCAA-APQKVDISELVVHPEYKNDIK  137
                    + +  G W         DC   G +  C    P  + I E + HP+Y +  K
Sbjct  161  VLRVVGALNKVRLGEWNTATD---PDCY--GAVRVCVPDKPIDLGIEETIQHPDYVDGSK  215

Query  138  ---HNIALAKLGRDVEFTDYVQPICLPPVPENDGSHIAQRLEIAGFRRPLWEGQKADEEG  194
               H+IAL +L R VEFT+Y++P+CLP    N+   + QRL + G     W   +  +  
Sbjct  216  DRYHDIALIRLNRQVEFTNYIRPVCLP--QPNEEVQVGQRLTVVG-----WGRTETGQYS  268

Query  195  EWRRKVHVFMASREFCKSVAYPDWQNLSRNHLCALGEEEKTLYFGSPLMGIEVVDEKPRN  254
              ++K+ V +   E C          +  + LCA GE+ K    G    G  + +   + 
Sbjct  269  TIKQKLAVPVVHAEQCAKTFGAAGVRVRSSQLCAGGEKAKD-SCGGDSGGPLLAERANQQ  327

Query  255  FYLVGIPISYMLLNSPKNLTMQIFTRISPYKKWILKNI  292
            F+L G+ +S+      +     I+T++  Y+ WI  NI
Sbjct  328  FFLEGL-VSFGATCGTEGWP-GIYTKVGKYRDWIEGNI  363


>BAEE_BOMMO unnamed protein product
Length=369

 Score = 89.4 bits (220),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 117/262 (45%), Gaps = 20/262 (8%)

Query  38   TAPDEYPWIGRVGYVTENGTSFPCFSVLIHQRYAILTAFCALSN---AEFDESFILFGNW  94
            T  DE+PW+  + Y    G  F C  VLI   Y +  A C   +   + +  S +  G W
Sbjct  119  TEIDEHPWMALLRYDKPLGWGFYCGGVLIAPMYVLTAAHCVKGSDLPSSWQLSQVRLGEW  178

Query  95   RENESFEVRDCRREGNIFQCAAAPQKVDISELVVHPEYK---NDIKHNIALAKLGRDVEF  151
              N S E  DC  EG+   C+   Q + + +++ H  Y     D +++IAL +L R+ +F
Sbjct  179  --NTSTET-DCV-EGD---CSGPVQDIPVQQIIAHENYDPNDKDQQNDIALLRLSRNAQF  231

Query  152  TDYVQPICLPPVPE-NDGSHIAQRLEIAGFRRPLWEGQKADEEGEWRRKVHVFMASREFC  210
             D+V PICLP   E       +  +E+AG     W   +   E + + KV V + +RE C
Sbjct  232  NDFVSPICLPTSNELRQNEFESDYMEVAG-----WGKTETRSESDVKLKVRVPIVNREEC  286

Query  211  KSVAYPDWQNLSRNHLCALGEEEKTLYFGSPLMGIEVVDEKPRNFYLVGIPISYMLLNSP  270
             +V     + ++   +CA G   +    G     +     K  N+Y+ G+ +SY      
Sbjct  287  ANVYSNVDRRVTNKQICAGGLAGRDSCRGDSGGALMGQSPKANNWYVFGV-VSYGPSPCG  345

Query  271  KNLTMQIFTRISPYKKWILKNI  292
                  ++TR+  +  WIL  +
Sbjct  346  TEGWPGVYTRVGSFMDWILSKL  367



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110287.1 uncharacterized protein LOC108134481 [Drosophila
elegans]

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKJ5_DROME  unnamed protein product                                 410     5e-147
MHCKA_DICDI  unnamed protein product                                  28.1    7.3   
PCX_DROME  unnamed protein product                                    28.1    9.9   


>Q9VKJ5_DROME unnamed protein product
Length=240

 Score = 410 bits (1053),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 216/241 (90%), Positives = 225/241 (93%), Gaps = 5/241 (2%)

Query  1    MVQISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRI  60
            MVQISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRI
Sbjct  1    MVQISQTEEDIKISIELNRLVTRKPDVVLLPQYLKFNNPPIFFERHLAQEIDEMASFCRI  60

Query  61   FKNEARIVLVKKEKGFWPEMFQKLDKEALMQKRLEIADLIVERNKQRDEKAVERYENKRR  120
            FKNEARIVLVKKEKG WPEMFQKLDKEALMQKRLEIADLIVERNK+RDEKA+ERY+NKRR
Sbjct  61   FKNEARIVLVKKEKGLWPEMFQKLDKEALMQKRLEIADLIVERNKKRDEKALERYDNKRR  120

Query  121  AEIEKEIKRETAMRDRVKQFQENSVREALVVDVRKEANAAPPKLD----PPSSVAASRLA  176
            AEI+KEI+RET MR+RVKQFQENSVREALVVDVRKEA A  PK D    PPSS  ASRLA
Sbjct  121  AEIQKEIQRETDMRERVKQFQENSVREALVVDVRKEAKAT-PKPDTLQYPPSSGGASRLA  179

Query  177  TPLMRPPMSSVRGGGRITVSFTSQHKRETPKRESQANMEKAYAAAGGPNANVQSPMESLD  236
            TPLMRPPMSSVRG GRI V+FT+QHKR TPKRESQA MEKAYAAAGGPNANVQSPMES+D
Sbjct  180  TPLMRPPMSSVRGSGRINVNFTTQHKRVTPKRESQAAMEKAYAAAGGPNANVQSPMESVD  239

Query  237  E  237
            E
Sbjct  240  E  240


>MHCKA_DICDI unnamed protein product
Length=1146

 Score = 28.1 bits (61),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 46/102 (45%), Gaps = 20/102 (20%)

Query  90   MQKRLEIADLIVERNKQRDEKAVERYENKRRAE-----IEKEIKRETAMRDRVKQFQENS  144
            MQ  L+  +  V+R + R+ + ++  ++ +R E     IE EI+      +RV       
Sbjct  442  MQNNLKKYNEFVDRERDRESERLKLQDSIKRLEQNQKKIEAEIQEGNEQVERV-------  494

Query  145  VREALVVDVRKEANAAPPKLDPPSSVAASRLATPLMRPPMSS  186
                    +R+EA+ +P    P S +   R +  L  PPM+S
Sbjct  495  --------LREEASISPISSVPKSPITTKRSSIILNSPPMTS  528


>PCX_DROME unnamed protein product
Length=3413

 Score = 28.1 bits (61),  Expect = 9.9, Method: Composition-based stats.
 Identities = 17/66 (26%), Positives = 32/66 (48%), Gaps = 8/66 (12%)

Query  53    EMASFCRIFKNEARIVLVKKEKGFW------PEMFQKLDKEALMQKRLEIADLIVERNKQ  106
             ++ +F R+      I+L   ++  +      PE+ QKLD     Q++LE  D + E +K+
Sbjct  3243  DLTNFTRLVSMWKEIILDNNKRRLYDMGELSPELLQKLDDAVQQQQQLE--DALAEESKE  3300

Query  107   RDEKAV  112
             +    V
Sbjct  3301  KGTATV  3306



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110288.1 uncharacterized protein LOC108134482 [Drosophila
elegans]

Length=136
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGE2_DROME  unnamed protein product                                 29.6    0.79 
RBP2_PLAVB  unnamed protein product                                   29.3    1.0  
Q8I8U9_DROME  unnamed protein product                                 28.9    1.3  


>Q9VGE2_DROME unnamed protein product
Length=384

 Score = 29.6 bits (65),  Expect = 0.79, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 32/79 (41%), Gaps = 4/79 (5%)

Query  54   EDNLAEALAEDEFQCNLRGQQYTGPNEEELLEILRSHLGGVINKLANKYERLVYLDADIR  113
            ED +      D     L GQQY   NE         H      K+ NK+ R + L AD+R
Sbjct  221  EDRMRRLFRADRISQILTGQQYLEFNEARKTSFYCRHG----EKIKNKFRRFLDLPADLR  276

Query  114  KLKGTIEKAIAVANEESAA  132
                T+     +A+E  AA
Sbjct  277  IPTPTMNILAYLAHETIAA  295


>RBP2_PLAVB unnamed protein product
Length=2867

 Score = 29.3 bits (64),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 21/93 (23%), Positives = 51/93 (55%), Gaps = 3/93 (3%)

Query  24    QKLAAFEA-MSAKRSELDRELGRLRKKQDETEDNLAEALAEDEFQCNLRGQQYTGPNEEE  82
             Q + +++  + ++ SE++  L R+  ++ +  D L ++L+ D    NL  + +   +E+ 
Sbjct  2548  QNVTSYDTEIISRLSEMNNVLERITTRKTKM-DQLLKSLSPDNTSLNLNARTHVRKSED-  2605

Query  83    LLEILRSHLGGVINKLANKYERLVYLDADIRKL  115
             +++ L SH+G +       +E + YL+ ++ KL
Sbjct  2606  IIKQLNSHIGEITELNTYAHEVMTYLENELNKL  2638


>Q8I8U9_DROME unnamed protein product
Length=426

 Score = 28.9 bits (63),  Expect = 1.3, Method: Composition-based stats.
 Identities = 24/79 (30%), Positives = 32/79 (41%), Gaps = 4/79 (5%)

Query  54   EDNLAEALAEDEFQCNLRGQQYTGPNEEELLEILRSHLGGVINKLANKYERLVYLDADIR  113
            ED +      D     L GQQY   NE         H      K+ NK+ R + L AD+R
Sbjct  263  EDRMRRLFRADRISQILTGQQYLEFNEARKTSFYCRHG----EKIKNKFRRFLDLPADLR  318

Query  114  KLKGTIEKAIAVANEESAA  132
                T+     +A+E  AA
Sbjct  319  IPTPTMNILAYLAHETIAA  337



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110289.1 serine/threonine-protein phosphatase 1 regulatory
subunit 10 [Drosophila elegans]

Length=185


***** No hits found *****



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110292.1 uncharacterized protein LOC108134484 [Drosophila
elegans]

Length=275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SURF4_DROME  unnamed protein product                                  47.0    6e-06
SURF4_CAEEL  unnamed protein product                                  33.1    0.19 
Q586T7_TRYB2  unnamed protein product                                 28.9    5.4  


>SURF4_DROME unnamed protein product
Length=270

 Score = 47.0 bits (110),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 81/175 (46%), Gaps = 5/175 (3%)

Query  81   KESSGVTLLLIGRVIHRLFFSIWTVFFYFLFNDSLDVGCLLMLIAAKIRMRDP-KEWPHM  139
            K    V LL    V+  + +SI   F + L N +L    LL+L  A+I  R      P M
Sbjct  90   KVDIAVGLLFFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAEARIEGRSLFAGVPSM  149

Query  140  -EKSNYELLLLGGRICLSSLFIMWL--DESVETEFFSIVSIVLLIFLSLGFHCKLFAYLT  196
             E      + L GRI L+ +FI  +  + SV      I+  +L++ + LG+  KL A + 
Sbjct  150  GENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDIIGSILMVLVVLGYKTKLSALIL  209

Query  197  VISLLYHDVFSNHWSMLFGWNDKLLSIQY-FSLLLCKIGGFLMLSELGGGKWSID  250
            V  L   +++ N W  +  +      ++Y F   L  IGG LM+  LG G  S+D
Sbjct  210  VALLTILNLYHNAWWTIPSYKPLRDFLKYDFFQTLSVIGGLLMIVSLGPGGVSMD  264


>SURF4_CAEEL unnamed protein product
Length=277

 Score = 33.1 bits (74),  Expect = 0.19, Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 62/127 (49%), Gaps = 13/127 (10%)

Query  137  PHMEKSNY--ELLLLGGRICLSSLFIMWLDESVETEFFSIVSIV----LLIFLSLGFHCK  190
            P M  SN     +LL GR+ L  +F+  +    E  F  ++ IV    L+  +S+G+  K
Sbjct  153  PTMGDSNKPKSYMLLAGRVLLIFMFMSLM--HFEMSFMQVLEIVVGFALITLVSIGYKTK  210

Query  191  LFAYLTVISLLYHDVFSNHWSMLFGWNDKLLS--IQY-FSLLLCKIGGFLMLSELGGGKW  247
            L A + VI L   +++ N W  +   +D+     ++Y F   +  IGG L++   G G  
Sbjct  211  LSAIVLVIWLFGLNLWLNAWWTIP--SDRFYRDFMKYDFFQTMSVIGGLLLVIAYGPGGV  268

Query  248  SIDGFRN  254
            S+D ++ 
Sbjct  269  SVDDYKK  275


>Q586T7_TRYB2 unnamed protein product
Length=865

 Score = 28.9 bits (63),  Expect = 5.4, Method: Composition-based stats.
 Identities = 12/38 (32%), Positives = 24/38 (63%), Gaps = 2/38 (5%)

Query  174  IVSIVLLIFLSLGFHCKLFAYLTVISLLYHDVFSNHWS  211
            ++S+  L  ++ G +CK+  ++  +S L H +FS+ WS
Sbjct  106  LLSVAALKDVTAGLYCKILHFM--LSQLQHHIFSHDWS  141



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110293.1 uncharacterized protein LOC108134485 [Drosophila
elegans]

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKN6_DROME  unnamed protein product                                 186     1e-61
A1ZAQ9_DROME  unnamed protein product                                 39.7    1e-04
Q4QE62_LEIMA  unnamed protein product                                 31.6    0.20 


>Q9VKN6_DROME unnamed protein product
Length=138

 Score = 186 bits (471),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 113/140 (81%), Gaps = 3/140 (2%)

Query  1    MSHLNLKLLLLVSCCVHRFQLQAAPFSDPEQ-LENEVLFAGFGDNLDWSRVNWHLVIPWL  59
            MS+L   LLLL+  C+ R + Q   FS PE   +N +   G  D+LDW+  NW LV+ +L
Sbjct  1    MSNLGSILLLLLIICIERSRQQR--FSHPESWTDNGIYVPGSEDDLDWTGANWQLVVRFL  58

Query  60   MERQQLRFCVSLARFDERLVPGTACQAILANGPLMDNCDIGNIEDLTMTMRYAFGEILLD  119
            M+RQQLRFC++LARFDE+LVPGTACQA+LANGPLM NCDIGNIEDLTMT+RYAFGEILLD
Sbjct  59   MQRQQLRFCIALARFDEQLVPGTACQALLANGPLMANCDIGNIEDLTMTLRYAFGEILLD  118

Query  120  TMRKCRPGLELFGVRCRRRA  139
            T RKCRPGLELFGVRCRRRA
Sbjct  119  TSRKCRPGLELFGVRCRRRA  138


>A1ZAQ9_DROME unnamed protein product
Length=118

 Score = 39.7 bits (91),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)

Query  116  ILLDTMRKCRPGLELFGVRCRRRA  139
            ILL+T +KC+PG ELFG RCR+ A
Sbjct  95   ILLETTQKCKPGFELFGKRCRKPA  118


>Q4QE62_LEIMA unnamed protein product
Length=709

 Score = 31.6 bits (70),  Expect = 0.20, Method: Composition-based stats.
 Identities = 20/72 (28%), Positives = 32/72 (44%), Gaps = 6/72 (8%)

Query  28   DPEQLENEVLFAGFGDNLDWSRVNWHLVIPWLMERQQLRFCVSLARFDE------RLVPG  81
            DP+     ++ +G   + DW   NW    P L  R+++     L R+ E      +LV G
Sbjct  129  DPDARPQFLIKSGVSFDCDWYWFNWEKNEPDLYRRRKISKDDPLCRWSEVDRDNKKLVSG  188

Query  82   TACQAILANGPL  93
              C A+  + PL
Sbjct  189  MVCSALPVSRPL  200



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110294.1 uncharacterized protein LOC108134487 isoform X2
[Drosophila elegans]

Length=258
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IKX8_PLAF7  unnamed protein product                                 28.5    7.8  
NWK_DROME  unnamed protein product                                    28.1    8.2  
ALLS_MANSE  unnamed protein product                                   25.0    8.3  


>Q8IKX8_PLAF7 unnamed protein product
Length=1136

 Score = 28.5 bits (62),  Expect = 7.8, Method: Composition-based stats.
 Identities = 16/62 (26%), Positives = 27/62 (44%), Gaps = 0/62 (0%)

Query  129  KRAALLLDRLMVALHHALEQERSEQRIGDFFGDKNMLNGKLGEYHNGLEPHQVREDGMYS  188
            K+  +LL+      +  LE   S   I   F + NML+  + EY+N      + ++    
Sbjct  386  KKKLILLNMQKNYENGELENINSNDIINKIFDNNNMLDSDINEYNNKSNDQNINDETFIE  445

Query  189  DD  190
            DD
Sbjct  446  DD  447


>NWK_DROME unnamed protein product
Length=1075

 Score = 28.1 bits (61),  Expect = 8.2, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (57%), Gaps = 8/44 (18%)

Query  76    LTIGGSAAGEVALPGAGAGDD------KRAGGRSPPSQPEEIFS  113
             L I G AAGE  + G+ AGD+      +  GGR+  S PEE+ S
Sbjct  1013  LDINGEAAGEAIVSGSAAGDEDIEAPKQVVGGRA--SIPEELDS  1054


>ALLS_MANSE unnamed protein product
Length=15

 Score = 25.0 bits (53),  Expect = 8.3, Method: Composition-based stats.
 Identities = 7/12 (58%), Positives = 10/12 (83%), Gaps = 0/12 (0%)

Query  247  YWRCYFNAVSCF  258
            + +CYFN +SCF
Sbjct  4    FRQCYFNPISCF  15



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110295.1 uncharacterized protein LOC108134488 [Drosophila
elegans]

Length=120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VVJ6_DROME  unnamed protein product                                 31.2    0.16 
Q389R0_TRYB2  unnamed protein product                                 30.0    0.42 
Q57Y62_TRYB2  unnamed protein product                                 28.5    1.5  


>Q9VVJ6_DROME unnamed protein product
Length=217

 Score = 31.2 bits (69),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (52%), Gaps = 2/64 (3%)

Query  1    MSSSKIALLILVIVCLVLIAWARPRSRSSIYNEVTSLPAERRMSNEIMDQISPLR--RPH  58
            +S + +ALL + + C+VL        +  +++  T+   +    NE MD++  LR  RP 
Sbjct  125  VSGATLALLFMAMCCVVLYLRHEKLQKQKLHDSTTTTTTDGGCQNEGMDEVDGLRPLRPV  184

Query  59   KRNF  62
            +R F
Sbjct  185  RRPF  188


>Q389R0_TRYB2 unnamed protein product
Length=993

 Score = 30.0 bits (66),  Expect = 0.42, Method: Composition-based stats.
 Identities = 17/55 (31%), Positives = 31/55 (56%), Gaps = 1/55 (2%)

Query  6    IALLILVIVCLVLIAWARPRSRSSIYNEVTSLPAERRMSNEIMDQISPLRRPHKR  60
            +A ++ +++C   IA AR   RS I+NE+  L + R++  + M  ++    PH R
Sbjct  411  VAAVLELLLCEEAIAEARDNRRSFIWNELEVLLSHRKIVGDEM-YVAASGHPHHR  464


>Q57Y62_TRYB2 unnamed protein product
Length=3030

 Score = 28.5 bits (62),  Expect = 1.5, Method: Composition-based stats.
 Identities = 17/40 (43%), Positives = 24/40 (60%), Gaps = 8/40 (20%)

Query  27    RSSIYNEVTSLPAE------RRMSNEIMDQISPLRRPHKR  60
             R+S +  VT +PAE      +R+ + I  QI PLR+PH R
Sbjct  1406  RTSQWRAVTVVPAETTSVGTQRLLDSI--QIIPLRQPHPR  1443



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110296.1 serine protease inhibitor 88Ea [Drosophila elegans]

Length=427
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SP88E_DROME  unnamed protein product                                  797     0.0   
Q9VFC1_DROME  unnamed protein product                                 428     2e-148
Q7JV69_DROME  unnamed protein product                                 154     1e-42 


>SP88E_DROME unnamed protein product
Length=427

 Score = 797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/427 (89%), Positives = 404/427 (95%), Gaps = 0/427 (0%)

Query  1    MHILSLSLMVILPAVALAGLCDVEPDANLLDGRENLYKGQQNFAVSMLDAIRQSTPNENV  60
            MHILS+SLM +LPA+ALAGLC VEPDA LLD R NLYKGQQNFAVSML+ IRQSTPNENV
Sbjct  1    MHILSISLMAVLPAIALAGLCGVEPDAGLLDQRLNLYKGQQNFAVSMLNVIRQSTPNENV  60

Query  61   FFSPYSTYHALLLAYFGSSGETEQELKKVLHLDWADSKELVRSAYVLEKKNRKERQSNMP  120
            FFSPYSTYHALLLAYFGSSG+TE+EL KVLHLDWADSKE+VRSAY+LEK NRKERQS MP
Sbjct  61   FFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKERQSKMP  120

Query  121  LEFSSADRIFFANDLPLTHCAKTRLVDEVKRIDFKNKPEESRKEINDWIAQDTHNQIRNM  180
            LEFSSADRIFFANDL +T CA+ RL +EV++IDFK++ EESRK+INDWIA+ TH+QIRNM
Sbjct  121  LEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNM  180

Query  181  LSADEITPRTRLVLANAAYLKGQWLSQFKTEKTAPMPFYTSPSNLSLVPMMQQKGTFLLN  240
            LSADEITPRTRLVLANAAYLKGQWLSQFKTEKT PMPFYTSPSN SLV MMQQKGTFLLN
Sbjct  181  LSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLN  240

Query  241  VDEQLRAHVLQLPYRTVFESQEKPDSLPDENSDISMVLILPPFNSNSLEDVLSRLNADTL  300
            VDEQLRAHVLQLPYRTVFESQEK DS PDENSDISMVLILPPFNSNSLEDVLSRLNAD+L
Sbjct  241  VDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL  300

Query  301  DESLKQAMPREIEVSLPKFEFEQRLELSPILVKMGVTKMFDESSATFDDLTSEAISIGDS  360
            D+SLKQAMPREIEVSLPKFEFEQRLEL+PIL KMGV+KMFDES ATFDDLTSE ISIGDS
Sbjct  301  DDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDS  360

Query  361  KHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYR  420
            KHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYR
Sbjct  361  KHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYR  420

Query  421  DPKTMKQ  427
            DPKT+KQ
Sbjct  421  DPKTIKQ  427


>Q9VFC1_DROME unnamed protein product
Length=426

 Score = 428 bits (1101),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 218/429 (51%), Positives = 307/429 (72%), Gaps = 5/429 (1%)

Query  1    MHILSLSLMVILPAVALAGLCDVEPDANLLDGRENLYKGQQNFAVSMLDAIRQSTPNENV  60
            MH  SL L+ +LP V +A L   +P+ + L+    ++KG+++F+++++  IR+  P+ N+
Sbjct  1    MHTFSLVLLALLPVVTIAALD--KPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNL  58

Query  61   FFSPYSTYHALLLAYFGSSGETEQELKKVLHLDWADSKELVRSAYVLEKKNRKERQSNMP  120
            FFSP+STY+ALLLAYF SS +TE+EL + L+L WA +K+ V  +Y L ++  + R    P
Sbjct  59   FFSPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSP  118

Query  121  LEFSSADRIFFANDLPLTHCAKTRLVDEVKRIDFKNKPEESRKEINDWIAQDTHNQIRNM  180
            +E SSA+RIF    + +++   T L    K +DFKN PE   KEINDWIA  THNQIR+M
Sbjct  119  MELSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDM  178

Query  181  LSADEITPRTRLVLANAAYLKGQWLSQFKTEKTAPMPFYTSPSNLSLVPMMQQKGTFLLN  240
            LS++EITP T LVLANAAY+KGQWLSQFK E+TA  PF+ +     +V MM + G F + 
Sbjct  179  LSSEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMT  238

Query  241  VDEQLRAHVLQLPYRTVFESQEKPDSLPDENSDISMVLILPPFNSNSLEDVLSRLNADTL  300
            +DE L++ +++LPYRT+++S+E   S P+  SDISM++ILP  N  SL  V+SRLNAD++
Sbjct  239  IDEGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSV  298

Query  301  DESLKQAMPREIEVSLPKFEFEQRLELSPILVKMGVTKMFDESSATFDDLTSEAIS--IG  358
             +  ++A+P++IE+SLPKF+FEQRLEL+PIL  MGV  MF   +ATF DLT++ IS  I 
Sbjct  299  KKWFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTR-NATFGDLTADPISLVID  357

Query  359  DSKHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGI  418
            D++H+AKIKVDE GSTAAAAT+L   RS+R  +P KF CNHPF+F+IYD    +ILF G+
Sbjct  358  DAQHLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGV  417

Query  419  YRDPKTMKQ  427
            Y DP+ M+ 
Sbjct  418  YSDPRQMQH  426


>Q7JV69_DROME unnamed protein product
Length=374

 Score = 154 bits (388),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 117/391 (30%), Positives = 187/391 (48%), Gaps = 39/391 (10%)

Query  38   KGQQNFAVSMLDAIRQSTPNENVFFSPYSTYHALLLAYFGSSGETEQELKKVLHLDWADS  97
            +G   F   +   +      ENV FSP+S    + LA+ GS GET  E+ K LH      
Sbjct  10   RGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFP  69

Query  98   KELVRS-AYVLEKKNRKERQSNMPLEFSSADRIFFANDLPLT----HCAKTRLVDEVKRI  152
             E+ ++  +VLEK     R SN+      A++++      L        K +   E + I
Sbjct  70   PEVAQTFQFVLEKY----RNSNL---LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESI  122

Query  153  DFKNKPEESRKEINDWIAQDTHNQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEK  212
            +F    + + + IN W+   T  +I  ++SAD  +  TRLVL NA + KG W  +F  E+
Sbjct  123  NFALN-DAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEER  181

Query  213  TAPMPFYTSPSNLSLVPMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKPDSLPDENS  272
            T    F+        +  M QK  F     E L    L++PY               ++S
Sbjct  182  TEEDIFWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPY---------------QDS  226

Query  273  DISMVLILPPFNSN--SLEDVLSRLNADTLDESLKQAMPREIEVSLPKFEFEQRLELSPI  330
            D+SM ++LP   +   +L + L  +N   L + L      E+ V  PKF+ +  LEL+  
Sbjct  227  DLSMFVLLPQERTGIYALAEKLKTVNLVDLADKL---TVEEVHVKFPKFKVDYSLELAEK  283

Query  331  LVKMGVTKMFDESSATFDDL--TSEAISIGDSKHVAKIKVDEEGSTAAAATVLFTYRSAR  388
            L ++G+TKMF +  A F +L  + E + +    H A I+V+EEG+ AAAAT +       
Sbjct  284  LKQLGITKMFTD-QAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAAAATGMIMMTRMM  342

Query  389  PVEPAKFECNHPFLFVIYDRTSRSILFTGIY  419
               P +F+ + PFL+VI+++  ++ILF G +
Sbjct  343  TF-PLQFQADRPFLYVIWNK--KNILFAGAF  370



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110297.1 uncharacterized protein LOC108134489 [Drosophila
elegans]

Length=105
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKN6_DROME  unnamed protein product                                 41.6    1e-05
A1ZAQ9_DROME  unnamed protein product                                 38.5    1e-04
Q7K533_DROME  unnamed protein product                                 26.6    4.7  


>Q9VKN6_DROME unnamed protein product
Length=138

 Score = 41.6 bits (96),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 52/111 (47%), Gaps = 25/111 (23%)

Query  13   VFLPLVLMQQDTQTANWQAQIELELQEQPEPDKLAYCRALQQQQQMLRISLRSTGCAAIL  72
            +++P      D   ANWQ  +   +Q Q    +L +C AL +  + L   +  T C A+L
Sbjct  35   IYVPGSEDDLDWTGANWQLVVRFLMQRQ----QLRFCIALARFDEQL---VPGTACQALL  87

Query  73   NN-------------ELAVT-----GKMLLETQPRCWPGWGLFGGRCRKLA  105
             N             +L +T     G++LL+T  +C PG  LFG RCR+ A
Sbjct  88   ANGPLMANCDIGNIEDLTMTLRYAFGEILLDTSRKCRPGLELFGVRCRRRA  138


>A1ZAQ9_DROME unnamed protein product
Length=118

 Score = 38.5 bits (88),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 20/29 (69%), Gaps = 0/29 (0%)

Query  77   AVTGKMLLETQPRCWPGWGLFGGRCRKLA  105
             +  ++LLET  +C PG+ LFG RCRK A
Sbjct  90   VIDNRILLETTQKCKPGFELFGKRCRKPA  118


>Q7K533_DROME unnamed protein product
Length=456

 Score = 26.6 bits (57),  Expect = 4.7, Method: Composition-based stats.
 Identities = 12/29 (41%), Positives = 15/29 (52%), Gaps = 0/29 (0%)

Query  77   AVTGKMLLETQPRCWPGWGLFGGRCRKLA  105
            +V  + L    P+C  G  L  GRCRK A
Sbjct  428  SVNQRSLFNLDPKCAEGLKLMAGRCRKEA  456



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110298.1 enhancer of mRNA-decapping protein 4 homolog
[Drosophila elegans]

Length=1346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EDC4_DROME  unnamed protein product                                   2293    0.0  


>EDC4_DROME unnamed protein product
Length=1354

 Score = 2293 bits (5943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1202/1361 (88%), Positives = 1268/1361 (93%), Gaps = 22/1361 (2%)

Query  1     MLIALFALAHLPIFRKTPPPASPSPPPSATQSPRCG---TATHPPPAE--IRISAPAIDA  55
             MLIALFALAHLPIFRKTP  AS SPPPS  +SPRCG   TA HPPPA+  I I+A AIDA
Sbjct  1     MLIALFALAHLPIFRKTPLSASSSPPPSVHRSPRCGKASTAYHPPPADACISITASAIDA  60

Query  56    ASEMSSGTDQDQPIAANGNAAETQEVEIINFLPHEKQCCRVIRANHTKVLTSGGVHTRGS  115
             AS MS+  +QD+PIAANGNAAE QE+E+I+F   EKQCCRVIR+N TKVLTSGGVHTRGS
Sbjct  61    ASGMSNSAEQDKPIAANGNAAEPQEIEVIHFQAQEKQCCRVIRSNKTKVLTSGGVHTRGS  120

Query  116   SKVKLKNIVDYKWERKYYYPGHLVAVHRDGKHLAYAINVNNKATGMEGMVRVCNISSSMR  175
             SKVKLKNIVDYKWERKYYYPGHLVAVHRDGKHLAYAINVNNKATGMEGMVRVCNI++SMR
Sbjct  121   SKVKLKNIVDYKWERKYYYPGHLVAVHRDGKHLAYAINVNNKATGMEGMVRVCNIATSMR  180

Query  176   ALIKGMSGEVLDLQFAHTDRERILAVIDVSSLFVYKVDQIEGNLLCNLVLKVEDPIANYV  235
             ALIKGMSGEVLDLQFAHTD ERILAVIDVSSLFVYKVDQIEGNLLCNLVLKVEDPIANYV
Sbjct  181   ALIKGMSGEVLDLQFAHTDCERILAVIDVSSLFVYKVDQIEGNLLCNLVLKVEDPIANYV  240

Query  236   PEYDMVSWCPYVCSTNSTVPINDEDDENQLLIWSRSSQFQCFHVKMIVSEHGRGKIQPGA  295
             PEYDMVSWCPYVCS+++TVPIND+DDENQLLIWSRSSQFQCF VKMIVSEHGRGKIQP A
Sbjct  241   PEYDMVSWCPYVCSSSATVPINDDDDENQLLIWSRSSQFQCFQVKMIVSEHGRGKIQPAA  300

Query  296   LETGYLKIEEDSLITCAALSPDGTTVAAACADGLVRFYQIYLFDVRNHRCLHEWKPHDGK  355
             LE+GYLKIEEDSLITCAALSPDGTTVAAACADGLVRFYQIYLFDVRNHRCLHEWKPHDGK
Sbjct  301   LESGYLKIEEDSLITCAALSPDGTTVAAACADGLVRFYQIYLFDVRNHRCLHEWKPHDGK  360

Query  356   KVCSLFFLDNINKPVEDSYWQHVITTSDANTEIKLWNCSLWECLQTINVVASNPSTGQPG  415
             KVCSLFFLDNINKPVE+SYWQHVITTSDANTEIKLWNCSLW+CLQTINVVAS PS+ QP 
Sbjct  361   KVCSLFFLDNINKPVEESYWQHVITTSDANTEIKLWNCSLWKCLQTINVVAS-PSSLQPR  419

Query  416   NFIAGIDRSASYLVLSCLDSLAVYVMQIANTAGVERNDGNSDSEGDGSDSSKRIQNVAEF  475
             NFIAGIDRSA+YLVLSCLDSLAVYVMQI +T G +  + +SDSEG+G D+SKRIQNVAEF
Sbjct  420   NFIAGIDRSANYLVLSCLDSLAVYVMQIGSTGGADSENRSSDSEGEGCDTSKRIQNVAEF  479

Query  476   KLSSGILSFSIVNASMRRVKSSIESYYPIEEPDDFDDDTNSTSALVLHMFVVQAKSLQEC  535
             KLSSGILSFSIVNASMRRVK+SIESYYPIEEPDDFDDD+NSTSALVLHMFVVQAKSLQEC
Sbjct  480   KLSSGILSFSIVNASMRRVKNSIESYYPIEEPDDFDDDSNSTSALVLHMFVVQAKSLQEC  539

Query  536   QIIYQPCVAVAEKPERRSLSSKRSETPEDNLLIKQEPDSPNNGSAGTVQLDALFAKSAKR  595
             QIIYQPCVA  EK ER SL+SKRS+TPEDNLLIK+EP+SPN+G+ G VQLDALFAKSAKR
Sbjct  540   QIIYQPCVA--EKTERSSLNSKRSQTPEDNLLIKEEPESPNSGTVGAVQLDALFAKSAKR  597

Query  596   SSTGSSSAIVAVAAAAAAAPSAVLQDA----------ELGSAYPQHVNLMTPDAFSASGT  645
             +STGSSSA+VAVAAAAAAAPSA+LQDA          +L SAY Q VNLMTPDAFSASGT
Sbjct  598   ASTGSSSAMVAVAAAAAAAPSAILQDATKEAAKSESPQLSSAYTQQVNLMTPDAFSASGT  657

Query  646   SAATAVVVASSTTTTTGTDSSAAGGGGNDRSIDSAVLQTLRMLATVTSKTSENQNAEVLL  705
             +AA AV V++STTT+ GT  S+    G DRSIDSAVLQT+RMLATVTSKTSEN NAEVLL
Sbjct  658   AAAAAVFVSTSTTTSIGT-DSSTTTSGQDRSIDSAVLQTIRMLATVTSKTSENPNAEVLL  716

Query  706   NLMNNTLIEDREQQKLKEKLDARKKFVSIDRNPERNVAENLASGGSSPSREVQEIMATQE  765
             NLMNNTLIEDREQQKLKEKLDARKKF++IDRNPERNVAENLASG SSPSREVQEIMATQ+
Sbjct  717   NLMNNTLIEDREQQKLKEKLDARKKFIAIDRNPERNVAENLASGSSSPSREVQEIMATQD  776

Query  766   DADAYEAELENLDDDDDDEEEELAISSPLLEAVDGNWPIVKLPSLTNSAELQNAAQIMSQ  825
             DADAYEAELENLDDDDDDEEEELA SSPL EAVDG WPIVKL S  +SAELQNAAQIMSQ
Sbjct  777   DADAYEAELENLDDDDDDEEEELANSSPLPEAVDGTWPIVKLSS--HSAELQNAAQIMSQ  834

Query  826   AVQNTNNGNVPPTLGGGSNNNNTSVASNSNNNTATTLNTSNSSSNNNAGGAGDGSSGNGE  885
             AVQNTNNGNVPPTLGGG +NNNTSV SNSNNNTATTL+TSN+SS+NNAGG    SSG GE
Sbjct  835   AVQNTNNGNVPPTLGGG-HNNNTSVGSNSNNNTATTLSTSNTSSSNNAGGTCVDSSGTGE  893

Query  886   LNAKLELLLDLVKAQSKQLNKLEHEVTKLQKQQEAVVAQNSKLDASLEPKNVNQLAYKIE  945
             LNAK+ELL+DLVKAQSKQ+NKLE+EV KLQKQQEA  A +SK D SLEPKN++QLAYKIE
Sbjct  894   LNAKMELLIDLVKAQSKQINKLENEVNKLQKQQEAAAALHSKQDTSLEPKNLSQLAYKIE  953

Query  946   MQLSKLMEQYLKRYENEHKKKLTEFLAARESQNRELRDSVLQVLNQYVMNHFTDIIGNVL  1005
             MQLSKLMEQYLKRYENEHKKKLTEFLAARESQNRELRDSVLQVLNQYVMNHFTDIIGNVL
Sbjct  954   MQLSKLMEQYLKRYENEHKKKLTEFLAARESQNRELRDSVLQVLNQYVMNHFTDIIGNVL  1013

Query  1006  NMELQRQLLPRVNAKMDQLQAQMQVEIVQKLSVFDKTVKENIAQVCKSKQFLDTFGKSVL  1065
             NMELQRQLLPRVNA MDQLQAQMQVEIVQKLSVFDKTVKENIAQVCKSKQFLDTFGKSVL
Sbjct  1014  NMELQRQLLPRVNANMDQLQAQMQVEIVQKLSVFDKTVKENIAQVCKSKQFLDTFGKSVL  1073

Query  1066  IGVQTSLQTAFIESMSSTLIPAYEKSSQNMFKQLHDAFSVGIKDFMVQFNTYLQHMPQPQ  1125
             IGVQTSLQTAFIESMSSTLIPAYEKSSQNMFKQLHDAFSVGIKDFMVQFNTYLQHMPQPQ
Sbjct  1074  IGVQTSLQTAFIESMSSTLIPAYEKSSQNMFKQLHDAFSVGIKDFMVQFNTYLQHMPQPQ  1133

Query  1126  VVGANSEELNNKLTMLKQLVESSLHKHRTELTDAMLETQREVKSLEILLARQVQETIRIE  1185
                 N+EE+NNKL+MLKQLVESSLHKHRTELTDAMLETQREVKSLEILLARQVQETIR E
Sbjct  1134  AGSGNTEEINNKLSMLKQLVESSLHKHRTELTDAMLETQREVKSLEILLARQVQETIRAE  1193

Query  1186  LRKHMETQNMAMRSQAATPAPPYDLRDSIKQLLQTGQINKAFHQALLANDLGLVEFTLRH  1245
             LRKHME QN+AMRSQAATPAPPYDLRDSIKQLL  GQINKAFHQALLANDLGLVEFTLRH
Sbjct  1194  LRKHMEAQNVAMRSQAATPAPPYDLRDSIKQLLMAGQINKAFHQALLANDLGLVEFTLRH  1253

Query  1246  TDSNQAFAPEGCRLEQKVLLSLIQQISADMTNHNELKQRYLNEALLAINMADPITREHAP  1305
             TDSNQAFAPEGCRLEQKVLLSLIQQISADMTNHNELKQRYLNEALLAINMADPITREHAP
Sbjct  1254  TDSNQAFAPEGCRLEQKVLLSLIQQISADMTNHNELKQRYLNEALLAINMADPITREHAP  1313

Query  1306  KVLSDLYRNCQQFIKNSPKNSQFSNVRLLMKAIITYRDQLK  1346
             KVL++LYRNCQQFIKNSPKNSQFSNVRLLMKAIITYRDQLK
Sbjct  1314  KVLTELYRNCQQFIKNSPKNSQFSNVRLLMKAIITYRDQLK  1354



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110299.1 GATOR complex protein Wdr59 [Drosophila elegans]

Length=970
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

WDR59_DROME  unnamed protein product                                  1914    0.0  
RBBD_DICDI  unnamed protein product                                   76.3    3e-14
Q86BR7_DROME  unnamed protein product                                 72.4    1e-12


>WDR59_DROME unnamed protein product
Length=969

 Score = 1914 bits (4957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 924/970 (95%), Positives = 942/970 (97%), Gaps = 1/970 (0%)

Query  1    MPPTETLRPGERGGAGGSGGTGPEQTYIIRQSNKYYEHRDSQATAMSVDYSGQWVLLAGR  60
            MPPTETLRPGERG AGG G   PEQTYI+RQSNKYYEHRDSQATAMSVDYSGQWVLLAGR
Sbjct  1    MPPTETLRPGERGTAGGPGAGAPEQTYIVRQSNKYYEHRDSQATAMSVDYSGQWVLLAGR  60

Query  61   GHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKEYCAIATSQHIDIVRWGIAEPH  120
            GHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKEYCAIATSQHIDIVRWG AEPH
Sbjct  61   GHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKEYCAIATSQHIDIVRWGTAEPH  120

Query  121  YEMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDLREPRKPALSLNAVCMSGATQV  180
            YEMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDLREPRKPALSLNAVCMSGATQV
Sbjct  121  YEMSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDLREPRKPALSLNAVCMSGATQV  180

Query  181  GFNRVSGNLLAAAHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDG  240
            GFNRVSGNLLAAAHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDG
Sbjct  181  GFNRVSGNLLAAAHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATASQDG  240

Query  241  TVKYFDVCNPRRAEKIITTMSPVWRARYTPIGNGLVSIVVPHLGRGENSLLLWSNSKQTD  300
            TVKYFDVCNPRRAEKIITTMSPVWRARYTPIGNGLVSIVVPHLGRGENSLLLWSNSKQTD
Sbjct  241  TVKYFDVCNPRRAEKIITTMSPVWRARYTPIGNGLVSIVVPHLGRGENSLLLWSNSKQTD  300

Query  301  PICSFVGHTDVILDFAWRPNRESSTEIELVTWSRDRTLRVWKIDDNMLKLCEPSAEEEES  360
            PICSFVGHTDVILDFAWRPNRESS EIELVTWSRDRTLRVWKIDDNMLKLCEPSAEE ES
Sbjct  301  PICSFVGHTDVILDFAWRPNRESSNEIELVTWSRDRTLRVWKIDDNMLKLCEPSAEEIES  360

Query  361  RFEPDLSELRVPTPPEFLHPRSILVAASLPISTGDGACNTLPMARSPSFGGGYYRREEPH  420
            RFEPDLSELRVPTPPEFLHPRSILVAASLPISTGDGACNTLPMARSPSFGGGYYRREEPH
Sbjct  361  RFEPDLSELRVPTPPEFLHPRSILVAASLPISTGDGACNTLPMARSPSFGGGYYRREEPH  420

Query  421  IARSLTDQPTCSLHHEFSLLNTNMPHVEVDTLDAIKRYACFKICAGGHTVILQVTFATSY  480
            IARSLTDQPTCSLHHEFSLLNTNMPHVEVDTLDAIKRYACFKICAGGHTVILQVTF TSY
Sbjct  421  IARSLTDQPTCSLHHEFSLLNTNMPHVEVDTLDAIKRYACFKICAGGHTVILQVTFTTSY  480

Query  481  PSPSAPPDFQFCQGTTLSSEVSGVLLKVLRCNSLQRVKKSRTCLEQCLRALVAAMKKRVA  540
            PSPSAPPDFQ CQGTTLSSEVSGVLLKVLRCN+LQRVKKSRTCLEQCLRALVAAMKK+VA
Sbjct  481  PSPSAPPDFQLCQGTTLSSEVSGVLLKVLRCNALQRVKKSRTCLEQCLRALVAAMKKKVA  540

Query  541  AVGGADRSQLLLQSPRLEGALSSTLHDACIPYPRTSGVHFNAVGMLTTFAQPVNNKRLTL  600
            AVGGADRSQLLLQSPRLEGALSSTLHDACIPYPRTSGVHFNA+GMLTTFAQPVNNKRLTL
Sbjct  541  AVGGADRSQLLLQSPRLEGALSSTLHDACIPYPRTSGVHFNAIGMLTTFAQPVNNKRLTL  600

Query  601  RQHTALTPRTFSAINGSGLLGNVMATAQRDANASFYLQERMISGKPGKQRAIRQMNGSPV  660
            RQHTALTPRTFS+INGSGLLGNVMATAQR+ANASFYLQERMISGKPGKQRAIRQMNGSPV
Sbjct  601  RQHTALTPRTFSSINGSGLLGNVMATAQREANASFYLQERMISGKPGKQRAIRQMNGSPV  660

Query  661  VHVYDTSSMLHISRSMAREFSLDKHNIAETCRRNGEICRQHGRLDLVPVWLLAELIATPQ  720
            VHVYDTSS+LHISR MAREFSLDK NIAETCR+NGEICRQHGRLDLVPVWLLAELIATPQ
Sbjct  661  VHVYDTSSLLHISRRMAREFSLDKCNIAETCRKNGEICRQHGRLDLVPVWLLAELIATPQ  720

Query  721  VPHETLNELVFYNDPFKKSLLESLIMHYASAGDIQTAVLLACLFDKCPTGGGVIMDMVSR  780
            +PHETLN+L+FY DPFKKSLLESLIMHYA +GDIQTAVLLACLFDKCPTGGG IM+   R
Sbjct  721  IPHETLNDLLFYKDPFKKSLLESLIMHYAISGDIQTAVLLACLFDKCPTGGGAIMEKTVR  780

Query  781  LPPQLNSQISPYHTVLPLDVKSSFSSITGQQLKQLRSNSWSDSLDLEVKQQVQPDAYACS  840
            LPPQLNSQISPYHTVLPLDVKSS SS T QQLKQLRSNSWSDSLDLE+K Q+Q DAYACS
Sbjct  781  LPPQLNSQISPYHTVLPLDVKSSSSSNTWQQLKQLRSNSWSDSLDLEIK-QIQSDAYACS  839

Query  841  LIRRAKVPLFDQFKRSYAEILFGWQLLSKRALILKHTQNMPPPVQGVEFVTECGTCAKPK  900
            LIRR K+PLFDQFKR+YAEILFGWQLLSKRALILKHTQN PPPVQGVEFVTEC  CAKPK
Sbjct  840  LIRRTKMPLFDQFKRAYAEILFGWQLLSKRALILKHTQNTPPPVQGVEFVTECRKCAKPK  899

Query  901  RTPKCEPCKRPVLFCVLCRLPVKGAANACLACGHGGHMDHMMQWFEKHQVCATCGCKCLE  960
            RTPKCEPCKRPVLFCVLCRLPVKGAANACLACGHGGH+DHMMQWFEKH VCATCGCKCLE
Sbjct  900  RTPKCEPCKRPVLFCVLCRLPVKGAANACLACGHGGHIDHMMQWFEKHNVCATCGCKCLE  959

Query  961  RTSELLALLS  970
            RTSELLALLS
Sbjct  960  RTSELLALLS  969


>RBBD_DICDI unnamed protein product
Length=423

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 116/253 (46%), Gaps = 27/253 (11%)

Query  123  MSLRGHTRTVTDIDWHGKDPNLLVSCSIDTFSHIWDLREPRKPALSLNAVCM-----SGA  177
            + L GH +    I W+ +    L+SCS D    +WD+    K   +L+A+ +     S  
Sbjct  168  LKLTGHKKEGYGISWNPRKEGHLLSCSDDQSICMWDISAASKSDSTLDALNIYNGHTSIV  227

Query  178  TQVGFNRVSGNLLAA-AHDGDLRIWDIRKGSCPTHYITAHLNRVHGINWSHKRETCLATA  236
              V ++ +      +   D  L IWD R G+ P H + AH + V+ ++++   E  +AT 
Sbjct  228  EDVAWHYIHDTFFGSVGDDKKLMIWDTRTGTKPIHVVEAHNSEVNCLSFNPFCEFLVATG  287

Query  237  SQDGTVKYFDVCN-PRRAEKIITTMSPVWRARYTPIGNGLVS-------IVVPHLGR-GE  287
            S D TV  +D+ N   R   +I+    V++ +++P    +++       + V  L R GE
Sbjct  288  STDKTVALWDMRNLGNRLHSLISHTDEVFQVQFSPHNETVLASCGSDRRVNVWDLSRIGE  347

Query  288  NSLLLWSNSKQTD--PICSFV--GHTDVILDFAWRPNRESSTEIELVTWSRDRTLRVWKI  343
                  +N    D  P   F+  GHT  I DF+W PN   S    + + + D  L++W++
Sbjct  348  EQ----NNEDAADGPPELLFIHGGHTSKISDFSWNPNDPWS----IASVAEDNILQIWQM  399

Query  344  DDNMLKLCEPSAE  356
             +N+    E   E
Sbjct  400  AENIYNDREDDLE  412


 Score = 34.3 bits (77),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (41%), Gaps = 25/150 (17%)

Query  206  GSC-PTHYITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNPRRAEKIITTMSPVW  264
            G C P   +T H    +GI+W+ ++E  L + S D ++  +D+    +++  +  ++   
Sbjct  162  GKCSPNLKLTGHKKEGYGISWNPRKEGHLLSCSDDQSICMWDISAASKSDSTLDALN---  218

Query  265  RARYTPIGNGLVSIVVP---------HLGR--GENSLLLWSNSKQTDPICSFVGHTDVIL  313
                  I NG  SIV             G    +  L++W     T PI     H   + 
Sbjct  219  ------IYNGHTSIVEDVAWHYIHDTFFGSVGDDKKLMIWDTRTGTKPIHVVEAHNSEVN  272

Query  314  DFAWRPNRESSTEIELVTWSRDRTLRVWKI  343
              ++ P      E  + T S D+T+ +W +
Sbjct  273  CLSFNP----FCEFLVATGSTDKTVALWDM  298


>Q86BR7_DROME unnamed protein product
Length=777

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 85/373 (23%), Positives = 160/373 (43%), Gaps = 38/373 (10%)

Query  40   DSQATAMSVDYSGQWVLLAGRGHLALQRLGQDDGSLRRHERQSKYEVSVAEFAICPSRKE  99
            +  A A++++     + LAGR  L +  +  +  +   + R     +S +   +  S  +
Sbjct  18   EGHANALALNKDNNQIALAGRSLLKVYSINSNGFTESCNMRGKNQNLSYSANDVAWSTLD  77

Query  100  YCAIATSQHIDIVR-WGIAEPHYEMSL---RGHTRTVTDIDWHGKDPNLLVSCSIDTFSH  155
               +AT+    +V  W +++   +  L     H RT   + +H  +PN+L+S S D    
Sbjct  78   SNLLATAATNGVVSVWDLSKFGRQKQLLVYNEHERTAHTVTFHSSEPNILISGSQDGTIK  137

Query  156  IWDLREPRKPALSLNA-VCMSGATQ-VGFNRVSGNLLAA-AHDGDLRIWDIRKGSCPTHY  212
             +D+R  +    S+N   C S + + V F+  + N+ +A + +G +++WD+RK       
Sbjct  138  CFDIRSDK----SINTYFCNSESVRDVKFSPHTQNIFSAVSENGTVQLWDMRKWDKCMVQ  193

Query  213  ITAHLNRVHGINWSHKRETCLATASQDGTVKYFDVCNPRRAEKIITTMSPVWRARYTPIG  272
             TAH   V+  +W H     LAT S+D  +K +++      E  I T++ V R ++ P  
Sbjct  194  FTAHYGPVYTCDW-HPTRNWLATGSRDKQIKVWNMDGRPGLEHTIHTIAVVGRVKWRPER  252

Query  273  NGLV---SIVVPHLGRGENSLLLWSNSKQTDPICSFVGHTDVILDFAWRPNRESSTEIEL  329
               +   ++VV +      S+ +W   +   P  SF  HT+V    AW    + S    L
Sbjct  253  TYHIASCALVVDY------SVHVWDIRRPYIPFASFNEHTNVTTGIAW----QGSDSHCL  302

Query  330  VTWSRDRTLRVWKIDD-------------NMLKLCEPSAEEEESRFEPDLSELRVPTPPE  376
            ++ S+D T+      D             ++ +  + S   +   +EP  S         
Sbjct  303  LSISKDSTIYKHAFKDATRPALKANAQGASLGRFGDISFANKIKEYEPKTSGASNTKSSS  362

Query  377  FLHPRSILVAASL  389
            F+  R   VA S+
Sbjct  363  FISRRKTNVAGSI  375


 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 37/72 (51%), Gaps = 4/72 (6%)

Query  891  TECGTCAKP---KRTPKCEPCKR-PVLFCVLCRLPVKGAANACLACGHGGHMDHMMQWFE  946
            T CG C +P   K    C+ CK      C +C L V+G    C  C HGGH++H+ ++F 
Sbjct  703  TNCGECGRPMGGKVGWYCDKCKSMQSAKCCVCGLIVRGVYAWCQGCSHGGHIEHLQKYFA  762

Query  947  KHQVCATCGCKC  958
            KH  C  CG  C
Sbjct  763  KHSKCPKCGHLC  774


 Score = 30.4 bits (67),  Expect = 9.8, Method: Compositional matrix adjust.
 Identities = 19/91 (21%), Positives = 38/91 (42%), Gaps = 1/91 (1%)

Query  627  AQRDANASFYLQERMISGKPGKQRAIRQMNGSPVVHVYDTSSMLHISR-SMAREFSLDKH  685
            ++R  N +  +Q  +   K  K       +G P+       +  H S    ARE  +   
Sbjct  365  SRRKTNVAGSIQFHLDHSKMYKFMVNDTFSGYPLSESVSRPTQEHESFIGCARELVISGK  424

Query  686  NIAETCRRNGEICRQHGRLDLVPVWLLAELI  716
             ++E C  N E+ +++G+ +   +W   +L 
Sbjct  425  KLSELCEHNAEVSKKYGKHNATTLWNFIKLF  455



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110300.1 ralBP1-associated Eps domain-containing protein 2
isoform X1 [Drosophila elegans]

Length=896
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MQS4_DROME  unnamed protein product                                 1399    0.0  
M9NDL7_DROME  unnamed protein product                                 1321    0.0  
Q1WWC9_DROME  unnamed protein product                                 65.5    2e-10


>Q8MQS4_DROME unnamed protein product
Length=907

 Score = 1399 bits (3621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 819/909 (90%), Positives = 849/909 (93%), Gaps = 15/909 (2%)

Query  1    MDVSLTEAETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANDIVIEITGLAGIPSTA  60
            MDVSLTE ETRFYSELFQCCDVEKTGKVPMLKATELFRSADIAN+ VIEITGLAGIPSTA
Sbjct  1    MDVSLTEPETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTA  60

Query  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPIPLPHFSWKEAVTAPVAVENGLAALP  120
            LHISRTQFYSCLKLIAAHQAAMPLRQELILATFP+PLPHFSWKEAVTAPVAVENGL ALP
Sbjct  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALP  120

Query  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDEATGHGRGTDGSGLVSSSSR  180
            PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVD+ATGHGRGTDG G+VSSSSR
Sbjct  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDDATGHGRGTDGCGVVSSSSR  180

Query  181  ENVGRRRGGGAAGGSPEAWSTNSDSPTPTNSVA--------LWQGLLGDEHRQLLGTEEE  232
            ENVGRRRGGG  GGSPEAWSTNSDSPTPTNSVA        LWQGLLGDEHRQLLGTEEE
Sbjct  181  ENVGRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQLLGTEEE  240

Query  233  SSDRHSSDDEDNESELVTIYEITPEQREYYNKQFRTVQRDPHGLLSGQAARVFFEKSRIP  292
            SSDRHSSDD+DNESELVTIY+ITPEQREYYNKQFRTVQRDPHGLLSGQAAR FFEKSRIP
Sbjct  241  SSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIP  300

Query  293  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAVAGS  352
            VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAA +GS
Sbjct  301  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAASGS  360

Query  353  GQGVSSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGGSANSKPRPNVPSDKN  412
            GQGV+SSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSG S  SKPRPNVPSDKN
Sbjct  361  GQGVTSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGSSTTSKPRPNVPSDKN  420

Query  413  IMNLSSISTSSQASNSSRREATPQNSLAKNRSISNSPSAEKAVVGAVSSTANAVDASNAS  472
            IMNLSSISTSSQASNSS+REATPQNSL KNRSISNSP+ EK V G VSSTA+AVD++N S
Sbjct  421  IMNLSSISTSSQASNSSKREATPQNSLGKNRSISNSPNVEKPVSGTVSSTASAVDSTNVS  480

Query  473  TQWTKFSESPTTSAAPLQSTTVVAAGAAAPAVSSPG----LKPALFDMKRSAQDVVSNPQ  528
            +QWTKFSESPTTSA  +QSTT  A   AA A +S      LKP LFDMKRSAQDVVSNPQ
Sbjct  481  SQWTKFSESPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQ  540

Query  529  ILHPVPLRVTPIGTAIASSAESSNDNDSVVVLREDSPKAISSTAVNNQSSGSAVSTGVSG  588
            ILHPVPLRVTPIGTAIASSAESSN+N+S V  REDSPKAISST VNNQSS  AV  G+SG
Sbjct  541  ILHPVPLRVTPIGTAIASSAESSNENESAVAQREDSPKAISSTTVNNQSS--AVVPGISG  598

Query  589  -ANSSHRESSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSEPSEQQPSYVASSL  647
             A SSHR+SSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSE  E Q +YVASSL
Sbjct  599  VAGSSHRDSSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSESQEPQAAYVASSL  658

Query  648  ASKKEPPPLPPPRPHRHARSSSLDLNKFKMGSTGGAQQAEITAQASFDMQTSTGFADFTH  707
            ASKKEPPPLPPPRPHRHARSSSLDLNKFK+G+TGGAQQAEITAQASFDMQTSTGFADFTH
Sbjct  659  ASKKEPPPLPPPRPHRHARSSSLDLNKFKIGATGGAQQAEITAQASFDMQTSTGFADFTH  718

Query  708  FADEGAANVVDEQQLHSLPPTAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ  767
            FADEGAANVVDEQQLHSLPP APPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ
Sbjct  719  FADEGAANVVDEQQLHSLPPAAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ  778

Query  768  SPPQQPPPPAPALGLAAQSGQLPNAESFEKRVTAISDSLRHVSFKQGQASTTEVLQRLRE  827
            SPPQQPPPPAPA+GL  Q+GQLP+AESFEKRVTAISDSLRHVSFKQGQA+TTEVLQRLRE
Sbjct  779  SPPQQPPPPAPAVGLTTQTGQLPSAESFEKRVTAISDSLRHVSFKQGQANTTEVLQRLRE  838

Query  828  QNNSLLHLCNDLSDELLNVQTRKEEMRLKLEGLSAGDATGRTSSSISAPVTANVTGGSSG  887
            QNNSLLHLCNDLSDELL+VQTRKEEMRLKLEGL+A D+TGRTSSSI APVTANVTGGSSG
Sbjct  839  QNNSLLHLCNDLSDELLSVQTRKEEMRLKLEGLNASDSTGRTSSSICAPVTANVTGGSSG  898

Query  888  SAGAAYTNV  896
            SAGAAYTNV
Sbjct  899  SAGAAYTNV  907


>M9NDL7_DROME unnamed protein product
Length=878

 Score = 1321 bits (3420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/909 (88%), Positives = 826/909 (91%), Gaps = 44/909 (5%)

Query  1    MDVSLTEAETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANDIVIEITGLAGIPSTA  60
            MDVSLTE ETRFYSELFQCCDVEKTGKVPMLKATELFRSADIAN+ VIEITGLAGIPSTA
Sbjct  1    MDVSLTEPETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTA  60

Query  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPIPLPHFSWKEAVTAPVAVENGLAALP  120
            LHISRTQFYSCLKLIAAHQAAMPLRQELILATFP+PLPHFSWKEAVTAPVAVENGL ALP
Sbjct  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALP  120

Query  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDEATGHGRGTDGSGLVSSSSR  180
            PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVD+ATGHGRGTDG G+VSSSSR
Sbjct  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDDATGHGRGTDGCGVVSSSSR  180

Query  181  ENVGRRRGGGAAGGSPEAWSTNSDSPTPTNSVA--------LWQGLLGDEHRQLLGTEEE  232
            ENVGRRRGGG  GGSPEAWSTNSDSPTPTNSVA        LWQGLLGDEHRQLLGTEEE
Sbjct  181  ENVGRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQLLGTEEE  240

Query  233  SSDRHSSDDEDNESELVTIYEITPEQREYYNKQFRTVQRDPHGLLSGQAARVFFEKSRIP  292
            SSDRHSSDD+DNESELVTIY+ITPEQREYYNKQFRTVQRDPHGLLSGQAAR FFEKSRIP
Sbjct  241  SSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIP  300

Query  293  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAVAGS  352
            VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAA +GS
Sbjct  301  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAASGS  360

Query  353  GQGVSSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGGSANSKPRPNVPSDKN  412
            GQGV+SSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSG S  SKPRPNVPSDKN
Sbjct  361  GQGVTSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGSSTTSKPRPNVPSDKN  420

Query  413  IMNLSSISTSSQASNSSRREATPQNSLAKNRSISNSPSAEKAVVGAVSSTANAVDASNAS  472
            IMNLSSISTSSQASNSS+REATPQNSL KNRSISNSP+ EK V G VSSTA+AVD++N S
Sbjct  421  IMNLSSISTSSQASNSSKREATPQNSLGKNRSISNSPNVEKPVSGTVSSTASAVDSTNVS  480

Query  473  TQWTKFSESPTTSAAPLQSTT----VVAAGAAAPAVSSPGLKPALFDMKRSAQDVVSNPQ  528
            +QWTKFSESPTTSA  +QSTT    VVAAGAAA   SSPGLKP LFDMKRSAQDVVSNPQ
Sbjct  481  SQWTKFSESPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQ  540

Query  529  ILHPVPLRVTPIGTAIASSAESSNDNDSVVVLREDSPKAISSTAVNNQSSGSAVSTGVSG  588
            ILHPVPLRVTPIGTAIASSAESSN+N+S V  REDSPKAISST VNNQS  SAV  G+SG
Sbjct  541  ILHPVPLRVTPIGTAIASSAESSNENESAVAQREDSPKAISSTTVNNQS--SAVVPGISG  598

Query  589  -ANSSHRESSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSEPSEQQPSYVASSL  647
             A SSHR+SSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSE  E Q +YVASSL
Sbjct  599  VAGSSHRDSSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSESQEPQAAYVASSL  658

Query  648  ASKKEPPPLPPPRPHRHARSSSLDLNKFKMGSTGGAQQAEITAQASFDMQTSTGFADFTH  707
            ASKKEPPPLPPPRPHRHARSSSLDLNKFK+G+TGGAQQAE                    
Sbjct  659  ASKKEPPPLPPPRPHRHARSSSLDLNKFKIGATGGAQQAE--------------------  698

Query  708  FADEGAANVVDEQQLHSLPPTAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ  767
                     VDEQQLHSLPP APPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ
Sbjct  699  ---------VDEQQLHSLPPAAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ  749

Query  768  SPPQQPPPPAPALGLAAQSGQLPNAESFEKRVTAISDSLRHVSFKQGQASTTEVLQRLRE  827
            SPPQQPPPPAPA+GL  Q+GQLP+AESFEKRVTAISDSLRHVSFKQGQA+TTEVLQRLRE
Sbjct  750  SPPQQPPPPAPAVGLTTQTGQLPSAESFEKRVTAISDSLRHVSFKQGQANTTEVLQRLRE  809

Query  828  QNNSLLHLCNDLSDELLNVQTRKEEMRLKLEGLSAGDATGRTSSSISAPVTANVTGGSSG  887
            QNNSLLHLCNDLSDELL+VQTRKEEMRLKLEGL+A D+TGRTSSSI APVTANVTGGSSG
Sbjct  810  QNNSLLHLCNDLSDELLSVQTRKEEMRLKLEGLNASDSTGRTSSSICAPVTANVTGGSSG  869

Query  888  SAGAAYTNV  896
            SAGAAYTNV
Sbjct  870  SAGAAYTNV  878


>Q1WWC9_DROME unnamed protein product
Length=1096

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 3/93 (3%)

Query  249  VTIYEITPEQREYYNKQFRTVQRDPH-GLLSGQAARVFFEKSRIPVEELRHIWQLCDVTR  307
            V  + +TP +R  Y +QFR +Q  P  G ++G  A+ FF +S++P   L  IW L D   
Sbjct  5    VDAWAVTPRERLKYQEQFRALQ--PQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDS  62

Query  308  DGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCL  340
            DG ++++EF+ A  L+ L+   + +P  LP  L
Sbjct  63   DGKMNINEFSIACKLINLKLRGMDVPKVLPPSL  95


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 4/109 (4%)

Query  234  SDRHSSDDEDNESELVTIYEITPEQREYYNKQFRTVQRDPHGLLSGQAARVFFEKSRIPV  293
            S+R  S +  N+ E    + +   Q+  Y + F    R   G L+G  AR    +S++P 
Sbjct  171  SERAPSIESVNQGE----WAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVLVQSKLPQ  226

Query  294  EELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHP  342
              L  IW L D+  DG L+  EF  AM L         +P +LP    P
Sbjct  227  VTLAQIWTLSDIDGDGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVP  275



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110301.1 ralBP1-associated Eps domain-containing protein 2
isoform X2 [Drosophila elegans]

Length=867
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NDL7_DROME  unnamed protein product                                 1337    0.0  
Q8MQS4_DROME  unnamed protein product                                 1323    0.0  
Q1WWC9_DROME  unnamed protein product                                 65.5    2e-10


>M9NDL7_DROME unnamed protein product
Length=878

 Score = 1337 bits (3461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/880 (91%), Positives = 826/880 (94%), Gaps = 15/880 (2%)

Query  1    MDVSLTEAETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANDIVIEITGLAGIPSTA  60
            MDVSLTE ETRFYSELFQCCDVEKTGKVPMLKATELFRSADIAN+ VIEITGLAGIPSTA
Sbjct  1    MDVSLTEPETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTA  60

Query  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPIPLPHFSWKEAVTAPVAVENGLAALP  120
            LHISRTQFYSCLKLIAAHQAAMPLRQELILATFP+PLPHFSWKEAVTAPVAVENGL ALP
Sbjct  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALP  120

Query  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDEATGHGRGTDGSGLVSSSSR  180
            PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVD+ATGHGRGTDG G+VSSSSR
Sbjct  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDDATGHGRGTDGCGVVSSSSR  180

Query  181  ENVGRRRGGGAAGGSPEAWSTNSDSPTPTNSVA--------LWQGLLGDEHRQLLGTEEE  232
            ENVGRRRGGG  GGSPEAWSTNSDSPTPTNSVA        LWQGLLGDEHRQLLGTEEE
Sbjct  181  ENVGRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQLLGTEEE  240

Query  233  SSDRHSSDDEDNESELVTIYEITPEQREYYNKQFRTVQRDPHGLLSGQAARVFFEKSRIP  292
            SSDRHSSDD+DNESELVTIY+ITPEQREYYNKQFRTVQRDPHGLLSGQAAR FFEKSRIP
Sbjct  241  SSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIP  300

Query  293  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAVAGS  352
            VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAA +GS
Sbjct  301  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAASGS  360

Query  353  GQGVSSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGGSANSKPRPNVPSDKN  412
            GQGV+SSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSG S  SKPRPNVPSDKN
Sbjct  361  GQGVTSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGSSTTSKPRPNVPSDKN  420

Query  413  IMNLSSISTSSQASNSSRREATPQNSLAKNRSISNSPSAEKAVVGAVSSTANAVDASNAS  472
            IMNLSSISTSSQASNSS+REATPQNSL KNRSISNSP+ EK V G VSSTA+AVD++N S
Sbjct  421  IMNLSSISTSSQASNSSKREATPQNSLGKNRSISNSPNVEKPVSGTVSSTASAVDSTNVS  480

Query  473  TQWTKFSESPTTSAAPLQSTT----VVAAGAAAPAVSSPGLKPALFDMKRSAQDVVSNPQ  528
            +QWTKFSESPTTSA  +QSTT    VVAAGAAA   SSPGLKP LFDMKRSAQDVVSNPQ
Sbjct  481  SQWTKFSESPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQ  540

Query  529  ILHPVPLRVTPIGTAIASSAESSNDNDSVVVLREDSPKAISSTAVNNQSSGSAVSTGVSG  588
            ILHPVPLRVTPIGTAIASSAESSN+N+S V  REDSPKAISST VNNQS  SAV  G+SG
Sbjct  541  ILHPVPLRVTPIGTAIASSAESSNENESAVAQREDSPKAISSTTVNNQS--SAVVPGISG  598

Query  589  -ANSSHRESSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSEPSEQQPSYVASSL  647
             A SSHR+SSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSE  E Q +YVASSL
Sbjct  599  VAGSSHRDSSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSESQEPQAAYVASSL  658

Query  648  ASKKEPPPLPPPRPHRHARSSSLDLNKFKMGSTGGAQQAEVDEQQLHSLPPTAPPPQAAV  707
            ASKKEPPPLPPPRPHRHARSSSLDLNKFK+G+TGGAQQAEVDEQQLHSLPP APPPQAAV
Sbjct  659  ASKKEPPPLPPPRPHRHARSSSLDLNKFKIGATGGAQQAEVDEQQLHSLPPAAPPPQAAV  718

Query  708  VPPTRITLQQAQQRVSAFEVYRKPQTPRGSQSPPQQPPPPAPALGLAAQSGQLPNAESFE  767
            VPPTRITLQQAQQRVSAFEVYRKPQTPRGSQSPPQQPPPPAPA+GL  Q+GQLP+AESFE
Sbjct  719  VPPTRITLQQAQQRVSAFEVYRKPQTPRGSQSPPQQPPPPAPAVGLTTQTGQLPSAESFE  778

Query  768  KRVTAISDSLRHVSFKQGQASTTEVLQRLREQNNSLLHLCNDLSDELLNVQTRKEEMRLK  827
            KRVTAISDSLRHVSFKQGQA+TTEVLQRLREQNNSLLHLCNDLSDELL+VQTRKEEMRLK
Sbjct  779  KRVTAISDSLRHVSFKQGQANTTEVLQRLREQNNSLLHLCNDLSDELLSVQTRKEEMRLK  838

Query  828  LEGLSAGDATGRTSSSISAPVTANVTGGSSGSAGAAYTNV  867
            LEGL+A D+TGRTSSSI APVTANVTGGSSGSAGAAYTNV
Sbjct  839  LEGLNASDSTGRTSSSICAPVTANVTGGSSGSAGAAYTNV  878


>Q8MQS4_DROME unnamed protein product
Length=907

 Score = 1323 bits (3425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/909 (87%), Positives = 820/909 (90%), Gaps = 44/909 (5%)

Query  1    MDVSLTEAETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANDIVIEITGLAGIPSTA  60
            MDVSLTE ETRFYSELFQCCDVEKTGKVPMLKATELFRSADIAN+ VIEITGLAGIPSTA
Sbjct  1    MDVSLTEPETRFYSELFQCCDVEKTGKVPMLKATELFRSADIANETVIEITGLAGIPSTA  60

Query  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPIPLPHFSWKEAVTAPVAVENGLAALP  120
            LHISRTQFYSCLKLIAAHQAAMPLRQELILATFP+PLPHFSWKEAVTAPVAVENGL ALP
Sbjct  61   LHISRTQFYSCLKLIAAHQAAMPLRQELILATFPLPLPHFSWKEAVTAPVAVENGLTALP  120

Query  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDEATGHGRGTDGSGLVSSSSR  180
            PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVD+ATGHGRGTDG G+VSSSSR
Sbjct  121  PPPPTDRRNSLRRNSQQEQLQDTSDVPSTDSEVEQNESVDDATGHGRGTDGCGVVSSSSR  180

Query  181  ENVGRRRGGGAAGGSPEAWSTNSDSPTPTNSVA--------LWQGLLGDEHRQLLGTEEE  232
            ENVGRRRGGG  GGSPEAWSTNSDSPTPTNSVA        LWQGLLGDEHRQLLGTEEE
Sbjct  181  ENVGRRRGGGTGGGSPEAWSTNSDSPTPTNSVAERPWAQDTLWQGLLGDEHRQLLGTEEE  240

Query  233  SSDRHSSDDEDNESELVTIYEITPEQREYYNKQFRTVQRDPHGLLSGQAARVFFEKSRIP  292
            SSDRHSSDD+DNESELVTIY+ITPEQREYYNKQFRTVQRDPHGLLSGQAAR FFEKSRIP
Sbjct  241  SSDRHSSDDDDNESELVTIYQITPEQREYYNKQFRTVQRDPHGLLSGQAARNFFEKSRIP  300

Query  293  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAVAGS  352
            VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAA +GS
Sbjct  301  VEELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHPNVLQAAASGS  360

Query  353  GQGVSSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGGSANSKPRPNVPSDKN  412
            GQGV+SSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSG S  SKPRPNVPSDKN
Sbjct  361  GQGVTSSSSAALPQEPPEADLLHLNDDDEDDHTDNTIIAGNLSGSSTTSKPRPNVPSDKN  420

Query  413  IMNLSSISTSSQASNSSRREATPQNSLAKNRSISNSPSAEKAVVGAVSSTANAVDASNAS  472
            IMNLSSISTSSQASNSS+REATPQNSL KNRSISNSP+ EK V G VSSTA+AVD++N S
Sbjct  421  IMNLSSISTSSQASNSSKREATPQNSLGKNRSISNSPNVEKPVSGTVSSTASAVDSTNVS  480

Query  473  TQWTKFSESPTTSAAPLQSTTVVAAGAAAPAVSSPG----LKPALFDMKRSAQDVVSNPQ  528
            +QWTKFSESPTTSA  +QSTT  A   AA A +S      LKP LFDMKRSAQDVVSNPQ
Sbjct  481  SQWTKFSESPTTSAVSVQSTTGAAPVVAAGAAASGASSPGLKPVLFDMKRSAQDVVSNPQ  540

Query  529  ILHPVPLRVTPIGTAIASSAESSNDNDSVVVLREDSPKAISSTAVNNQSSGSAVSTGVSG  588
            ILHPVPLRVTPIGTAIASSAESSN+N+S V  REDSPKAISST VNNQSS  AV  G+SG
Sbjct  541  ILHPVPLRVTPIGTAIASSAESSNENESAVAQREDSPKAISSTTVNNQSS--AVVPGISG  598

Query  589  -ANSSHRESSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSEPSEQQPSYVASSL  647
             A SSHR+SSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSE  E Q +YVASSL
Sbjct  599  VAGSSHRDSSDLRAIQRPQAKKLPAKNSALPPPPQREPSIGSTGPSESQEPQAAYVASSL  658

Query  648  ASKKEPPPLPPPRPHRHARSSSLDLNKFKMGSTGGAQQAE--------------------  687
            ASKKEPPPLPPPRPHRHARSSSLDLNKFK+G+TGGAQQAE                    
Sbjct  659  ASKKEPPPLPPPRPHRHARSSSLDLNKFKIGATGGAQQAEITAQASFDMQTSTGFADFTH  718

Query  688  ---------VDEQQLHSLPPTAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ  738
                     VDEQQLHSLPP APPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ
Sbjct  719  FADEGAANVVDEQQLHSLPPAAPPPQAAVVPPTRITLQQAQQRVSAFEVYRKPQTPRGSQ  778

Query  739  SPPQQPPPPAPALGLAAQSGQLPNAESFEKRVTAISDSLRHVSFKQGQASTTEVLQRLRE  798
            SPPQQPPPPAPA+GL  Q+GQLP+AESFEKRVTAISDSLRHVSFKQGQA+TTEVLQRLRE
Sbjct  779  SPPQQPPPPAPAVGLTTQTGQLPSAESFEKRVTAISDSLRHVSFKQGQANTTEVLQRLRE  838

Query  799  QNNSLLHLCNDLSDELLNVQTRKEEMRLKLEGLSAGDATGRTSSSISAPVTANVTGGSSG  858
            QNNSLLHLCNDLSDELL+VQTRKEEMRLKLEGL+A D+TGRTSSSI APVTANVTGGSSG
Sbjct  839  QNNSLLHLCNDLSDELLSVQTRKEEMRLKLEGLNASDSTGRTSSSICAPVTANVTGGSSG  898

Query  859  SAGAAYTNV  867
            SAGAAYTNV
Sbjct  899  SAGAAYTNV  907


>Q1WWC9_DROME unnamed protein product
Length=1096

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 53/93 (57%), Gaps = 3/93 (3%)

Query  249  VTIYEITPEQREYYNKQFRTVQRDPH-GLLSGQAARVFFEKSRIPVEELRHIWQLCDVTR  307
            V  + +TP +R  Y +QFR +Q  P  G ++G  A+ FF +S++P   L  IW L D   
Sbjct  5    VDAWAVTPRERLKYQEQFRALQ--PQAGFVTGAQAKGFFLQSQLPPLILGQIWALADTDS  62

Query  308  DGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCL  340
            DG ++++EF+ A  L+ L+   + +P  LP  L
Sbjct  63   DGKMNINEFSIACKLINLKLRGMDVPKVLPPSL  95


 Score = 53.1 bits (126),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 4/109 (4%)

Query  234  SDRHSSDDEDNESELVTIYEITPEQREYYNKQFRTVQRDPHGLLSGQAARVFFEKSRIPV  293
            S+R  S +  N+ E    + +   Q+  Y + F    R   G L+G  AR    +S++P 
Sbjct  171  SERAPSIESVNQGE----WAVQAAQKRKYTQVFNANDRTRSGYLTGSQARGVLVQSKLPQ  226

Query  294  EELRHIWQLCDVTRDGALSLSEFTAAMHLVVLRRNNIPLPTSLPHCLHP  342
              L  IW L D+  DG L+  EF  AM L         +P +LP    P
Sbjct  227  VTLAQIWTLSDIDGDGRLNCDEFILAMFLCEKAMAGEKIPVTLPQEWVP  275



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


Query= XP_017110302.1 coiled-coil and C2 domain-containing protein 1-like
isoform X1 [Drosophila elegans]

Length=836
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C2D1_DROME  unnamed protein product                                   1301    0.0  
Q45ZT6_STRPU  unnamed protein product                                 37.7    0.052
M9NDA1_DROME  unnamed protein product                                 32.0    2.4  


>C2D1_DROME unnamed protein product
Length=816

 Score = 1301 bits (3368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 739/835 (89%), Positives = 768/835 (92%), Gaps = 20/835 (2%)

Query  1    MFSRKKPEPAKRRQHDLSQFGLTEIPDDFDPSAGYGDDDGGDSDLEAELAAIASGGGARP  60
            MFSRKKPEPAKRRQHDLSQFGLTEIPDDFDPSAGYG+DDGGDSDLEAELAAI  G GA+P
Sbjct  1    MFSRKKPEPAKRRQHDLSQFGLTEIPDDFDPSAGYGEDDGGDSDLEAELAAITGGEGAKP  60

Query  61   KPKPKAKLVPASDLDKMIADSLRDVSDDDDDDDDNLEHDSELLGELSGIGGVVEAEEEEP  120
            KPKPKAKL+PASDLDKMIADSLRDVSDDDDDD+   + D  LLGELSGIGG+ EAEEEEP
Sbjct  61   KPKPKAKLLPASDLDKMIADSLRDVSDDDDDDNLESDPD--LLGELSGIGGLEEAEEEEP  118

Query  121  AAQPPAGSDEPVQTFLPTTTVDTLSVIKQRLEMYKQAEANAKAAGDSGKARRFGRGLKTL  180
             AQPPA S+EPVQTFLPTTTVDTLS+IKQRLEMYKQAEANAK AGDSGKARRFGRGLKTL
Sbjct  119  VAQPPAASEEPVQTFLPTTTVDTLSIIKQRLEMYKQAEANAKTAGDSGKARRFGRGLKTL  178

Query  181  QDLHKQAAAGKSINVDDIPPEVSVKPAGGQAPQVAAEEPPAPSTPASPPPVPSRAAPAPP  240
            +DLH+QAAAGKSINVDDIPPEVSVKP GGQAP V AEE PAPSTPASPPPVPSRAAP PP
Sbjct  179  KDLHRQAAAGKSINVDDIPPEVSVKPIGGQAPPVPAEESPAPSTPASPPPVPSRAAPDPP  238

Query  241  TPTSPVASTTPVAPTTPQNPLVAQMRSRQNEYKAAALQSKRSGDTATALQFLKVVKQFDV  300
            TP +PV  TT VAPT+P NPLV QMRSRQ +YKAAALQSKRSGD +TALQFLKVVKQFDV
Sbjct  239  TPGTPVEPTTSVAPTSPPNPLVTQMRSRQTDYKAAALQSKRSGDISTALQFLKVVKQFDV  298

Query  301  VVKMCEDGQEVDLSDMPPPPAEFLEFLNKLKEGAAPEVVAEPTPAPAPEPVAPAPAPAAA  360
            V+KMCEDGQEVDLSDMPPPPAEFLEFL K++E AA E VAEPT AP P PVAPAP  AAA
Sbjct  299  VIKMCEDGQEVDLSDMPPPPAEFLEFLKKMQEEAAAEAVAEPTAAPEPTPVAPAPVLAAA  358

Query  361  TNMMEALQQRLEKYQSVEATAKAENNTGKARRFGRIVKQYEDAIKLYNAGKPVPYDELPV  420
            TNM+EALQQRLEKYQSVEA AKAENN+GKARRFGRIVKQYEDAIKLY AGKPVPYDELPV
Sbjct  359  TNMLEALQQRLEKYQSVEAAAKAENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPV  418

Query  421  PPGFGPLPTGDAAPAAPTPSLPTSPTSPPATASTSAGGTPSSSGTTTPTAPRKAPSPPQA  480
            PPGFGPLPT DAAP APTPSLPTSPTSPP TASTSAGGTPSSS  TTPTAPRKAPSPP+ 
Sbjct  419  PPGFGPLPTADAAPVAPTPSLPTSPTSPPPTASTSAGGTPSSSSATTPTAPRKAPSPPKP  478

Query  481  KELTTRTSGNQQKNNLAEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKIYKGFDSL  540
            KELTTRTSGNQQKNN+AEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKI+KGFDSL
Sbjct  479  KELTTRTSGNQQKNNIAEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKIFKGFDSL  538

Query  541  LNAASSGLPVDLNTLPVPPSQRDNLEASFAIVSAEECDPGDDICEIGVRMEEQLAKQLMM  600
            LNAASSGLPVDL+TLPVPPSQRDNLEASFAIVSAEECDP DDICEIGVRMEEQLAKQLMM
Sbjct  539  LNAASSGLPVDLSTLPVPPSQRDNLEASFAIVSAEECDPTDDICEIGVRMEEQLAKQLMM  598

Query  601  CKNTRDHHKAMGDVAGMNRFENLALTVQKDLDLVRYTKRKNESLPKFHYEKRSFNIVHCN  660
            CKNTRDHHKAMGDVAGMNRFENLALTVQKDLDLVRY+KRKNE LPKFHYEKRSFNIVHCN
Sbjct  599  CKNTRDHHKAMGDVAGMNRFENLALTVQKDLDLVRYSKRKNEPLPKFHYEKRSFNIVHCN  658

Query  661  TDLTDCELEIVVVRGINYNVTNPKDVDTYVRVEFPLLNEETFKTKTNVIRDTSSPDYDER  720
            TDLTD ELEIVVVRGI+YNV NPKDVDTYVRVEFPLLN+E+FKTKTNVIRDTSSPDYDER
Sbjct  659  TDLTDSELEIVVVRGISYNVANPKDVDTYVRVEFPLLNDESFKTKTNVIRDTSSPDYDER  718

Query  721  FKVDIQRANRQFQRIFKRHGVKFEIYSRGCSIDCCGLSRKLPLCCFRGFLRSDTLIGTVN  780
            FKVDIQR NRQFQRIFKRHGVKFEIYSRG                  GFLRSDTLIGTVN
Sbjct  719  FKVDIQRTNRQFQRIFKRHGVKFEIYSRG------------------GFLRSDTLIGTVN  760

Query  781  VKLQPLETKCDIHDTYDLMDGRKQVGGKLEVKIRVRNPILTKQIEHINEKWLVLD  835
            VKLQPLETKC+IHDTYDLMDGRKQVGGKLEVKIRVRNPILTKQ+EHI EKWLVLD
Sbjct  761  VKLQPLETKCEIHDTYDLMDGRKQVGGKLEVKIRVRNPILTKQMEHITEKWLVLD  815


>Q45ZT6_STRPU unnamed protein product
Length=983

 Score = 37.7 bits (86),  Expect = 0.052, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 3/70 (4%)

Query  420  VPPGFGPLPTGDAAPAAPTPSLPTSPT-SPPATASTSAGGTPSSSGTTTPTAPRKAPSPP  478
             P    PL     AP  PT + P +PT + P T + +A  TP+++ + TPTA   AP PP
Sbjct  229  TPTATAPLTPTATAPLTPTATAPLTPTATAPLTPTATALLTPTATASLTPTA--TAPLPP  286

Query  479  QAKELTTRTS  488
             A  L T T+
Sbjct  287  TATALLTPTA  296


 Score = 33.9 bits (76),  Expect = 0.76, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query  191  KSINVDDIPP-EVSVKPAGGQAPQVAAEEPPAPSTP-ASPPPVPSRAAPAPPTPTSPVAS  248
            K++  DD+PP E+      G   Q A+    AP  P A+ P  P+  AP  PT T+P+ +
Sbjct  187  KAVGTDDLPPPEIPSAAVSGLDEQQASCSFTAPLPPTATAPLTPTATAPLTPTATAPL-T  245

Query  249  TTPVAPTTP  257
             T  AP TP
Sbjct  246  PTATAPLTP  254


 Score = 30.8 bits (68),  Expect = 6.7, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 9/65 (14%)

Query  420  VPPGFGPLPTGDAAPAAPTPSLPTSPT-----SPPATASTSAGGT----PSSSGTTTPTA  470
             P    PL     AP  PT + P +PT     +P ATAS +   T    P+++   TPTA
Sbjct  237  TPTATAPLTPTATAPLTPTATAPLTPTATALLTPTATASLTPTATAPLPPTATALLTPTA  296

Query  471  PRKAP  475
             R  P
Sbjct  297  TRYRP  301


>M9NDA1_DROME unnamed protein product
Length=1230

 Score = 32.0 bits (71),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 74/167 (44%), Gaps = 17/167 (10%)

Query  122  AQPPAGSDEPVQTFLPTTTVDTLSV-IKQRLEMYKQAEANAKAAGDSGKARRFGRGLKTL  180
            + PPAG     Q+   TT   TLS  +++ L    +A+AN+   GD  +         T+
Sbjct  692  SSPPAG-----QSQNDTTASFTLSAPVRRSLSTEGEADANSDPEGDQDQT--VVSASYTI  744

Query  181  QDLHKQAAAGKSINVDDIPPEVSVKPAGGQAPQVAAEEPPAPSTPASPPPVPSRAAPAPP  240
                ++     S NV+ I      +P    + +  +EEPP  + P   P +P+ AAP+  
Sbjct  745  MP-RRERLPESSENVESIRSPQKTEPVAKSSSEDKSEEPPH-ARPTDLPLIPAPAAPSTE  802

Query  241  TPTSPVASTTPVAPTTPQNPLVAQMRSRQNEYKAAALQSKRSGDTAT  287
               S  A+TTP A  +P       +R R     + + +S+   DTA+
Sbjct  803  AIKSSSAATTPAALESP-------VRLRDKRGLSGSQESETKSDTAS  842



Lambda      K        H
   0.310    0.128    0.355 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3635010066


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110303.1 coiled-coil and C2 domain-containing protein 1-like
isoform X2 [Drosophila elegans]

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C2D1_DROME  unnamed protein product                                   1315    0.0  
Q45ZT6_STRPU  unnamed protein product                                 37.4    0.060
M9NDA1_DROME  unnamed protein product                                 32.0    2.8  


>C2D1_DROME unnamed protein product
Length=816

 Score = 1315 bits (3403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 739/817 (90%), Positives = 768/817 (94%), Gaps = 2/817 (0%)

Query  1    MFSRKKPEPAKRRQHDLSQFGLTEIPDDFDPSAGYGDDDGGDSDLEAELAAIASGGGARP  60
            MFSRKKPEPAKRRQHDLSQFGLTEIPDDFDPSAGYG+DDGGDSDLEAELAAI  G GA+P
Sbjct  1    MFSRKKPEPAKRRQHDLSQFGLTEIPDDFDPSAGYGEDDGGDSDLEAELAAITGGEGAKP  60

Query  61   KPKPKAKLVPASDLDKMIADSLRDVSDDDDDDDDNLEHDSELLGELSGIGGVVEAEEEEP  120
            KPKPKAKL+PASDLDKMIADSLRDVSDDDDDD+   + D  LLGELSGIGG+ EAEEEEP
Sbjct  61   KPKPKAKLLPASDLDKMIADSLRDVSDDDDDDNLESDPD--LLGELSGIGGLEEAEEEEP  118

Query  121  AAQPPAGSDEPVQTFLPTTTVDTLSVIKQRLEMYKQAEANAKAAGDSGKARRFGRGLKTL  180
             AQPPA S+EPVQTFLPTTTVDTLS+IKQRLEMYKQAEANAK AGDSGKARRFGRGLKTL
Sbjct  119  VAQPPAASEEPVQTFLPTTTVDTLSIIKQRLEMYKQAEANAKTAGDSGKARRFGRGLKTL  178

Query  181  QDLHKQAAAGKSINVDDIPPEVSVKPAGGQAPQVAAEEPPAPSTPASPPPVPSRAAPAPP  240
            +DLH+QAAAGKSINVDDIPPEVSVKP GGQAP V AEE PAPSTPASPPPVPSRAAP PP
Sbjct  179  KDLHRQAAAGKSINVDDIPPEVSVKPIGGQAPPVPAEESPAPSTPASPPPVPSRAAPDPP  238

Query  241  TPTSPVASTTPVAPTTPQNPLVAQMRSRQNEYKAAALQSKRSGDTATALQFLKVVKQFDV  300
            TP +PV  TT VAPT+P NPLV QMRSRQ +YKAAALQSKRSGD +TALQFLKVVKQFDV
Sbjct  239  TPGTPVEPTTSVAPTSPPNPLVTQMRSRQTDYKAAALQSKRSGDISTALQFLKVVKQFDV  298

Query  301  VVKMCEDGQEVDLSDMPPPPAEFLEFLNKLKEGAAPEVVAEPTPAPAPEPVAPAPAPAAA  360
            V+KMCEDGQEVDLSDMPPPPAEFLEFL K++E AA E VAEPT AP P PVAPAP  AAA
Sbjct  299  VIKMCEDGQEVDLSDMPPPPAEFLEFLKKMQEEAAAEAVAEPTAAPEPTPVAPAPVLAAA  358

Query  361  TNMMEALQQRLEKYQSVEATAKAENNTGKARRFGRIVKQYEDAIKLYNAGKPVPYDELPV  420
            TNM+EALQQRLEKYQSVEA AKAENN+GKARRFGRIVKQYEDAIKLY AGKPVPYDELPV
Sbjct  359  TNMLEALQQRLEKYQSVEAAAKAENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELPV  418

Query  421  PPGFGPLPTGDAAPAAPTPSLPTSPTSPPATASTSAGGTPSSSGTTTPTAPRKAPSPPQA  480
            PPGFGPLPT DAAP APTPSLPTSPTSPP TASTSAGGTPSSS  TTPTAPRKAPSPP+ 
Sbjct  419  PPGFGPLPTADAAPVAPTPSLPTSPTSPPPTASTSAGGTPSSSSATTPTAPRKAPSPPKP  478

Query  481  KELTTRTSGNQQKNNLAEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKIYKGFDSL  540
            KELTTRTSGNQQKNN+AEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKI+KGFDSL
Sbjct  479  KELTTRTSGNQQKNNIAEQQMKLLLERQKEFKLAAIEAKKAGEIDQAKEYLKIFKGFDSL  538

Query  541  LNAASSGLPVDLNTLPVPPSQRDNLEASFAIVSAEECDPGDDICEIGVRMEEQLAKQLMM  600
            LNAASSGLPVDL+TLPVPPSQRDNLEASFAIVSAEECDP DDICEIGVRMEEQLAKQLMM
Sbjct  539  LNAASSGLPVDLSTLPVPPSQRDNLEASFAIVSAEECDPTDDICEIGVRMEEQLAKQLMM  598

Query  601  CKNTRDHHKAMGDVAGMNRFENLALTVQKDLDLVRYTKRKNESLPKFHYEKRSFNIVHCN  660
            CKNTRDHHKAMGDVAGMNRFENLALTVQKDLDLVRY+KRKNE LPKFHYEKRSFNIVHCN
Sbjct  599  CKNTRDHHKAMGDVAGMNRFENLALTVQKDLDLVRYSKRKNEPLPKFHYEKRSFNIVHCN  658

Query  661  TDLTDCELEIVVVRGINYNVTNPKDVDTYVRVEFPLLNEETFKTKTNVIRDTSSPDYDER  720
            TDLTD ELEIVVVRGI+YNV NPKDVDTYVRVEFPLLN+E+FKTKTNVIRDTSSPDYDER
Sbjct  659  TDLTDSELEIVVVRGISYNVANPKDVDTYVRVEFPLLNDESFKTKTNVIRDTSSPDYDER  718

Query  721  FKVDIQRANRQFQRIFKRHGVKFEIYSRGGFLRSDTLIGTVNVKLQPLETKCDIHDTYDL  780
            FKVDIQR NRQFQRIFKRHGVKFEIYSRGGFLRSDTLIGTVNVKLQPLETKC+IHDTYDL
Sbjct  719  FKVDIQRTNRQFQRIFKRHGVKFEIYSRGGFLRSDTLIGTVNVKLQPLETKCEIHDTYDL  778

Query  781  MDGRKQVGGKLEVKIRVRNPILTKQIEHINEKWLVLD  817
            MDGRKQVGGKLEVKIRVRNPILTKQ+EHI EKWLVLD
Sbjct  779  MDGRKQVGGKLEVKIRVRNPILTKQMEHITEKWLVLD  815


>Q45ZT6_STRPU unnamed protein product
Length=983

 Score = 37.4 bits (85),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 37/70 (53%), Gaps = 3/70 (4%)

Query  420  VPPGFGPLPTGDAAPAAPTPSLPTSPT-SPPATASTSAGGTPSSSGTTTPTAPRKAPSPP  478
             P    PL     AP  PT + P +PT + P T + +A  TP+++ + TPTA   AP PP
Sbjct  229  TPTATAPLTPTATAPLTPTATAPLTPTATAPLTPTATALLTPTATASLTPTA--TAPLPP  286

Query  479  QAKELTTRTS  488
             A  L T T+
Sbjct  287  TATALLTPTA  296


 Score = 33.9 bits (76),  Expect = 0.77, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query  191  KSINVDDIPP-EVSVKPAGGQAPQVAAEEPPAPSTP-ASPPPVPSRAAPAPPTPTSPVAS  248
            K++  DD+PP E+      G   Q A+    AP  P A+ P  P+  AP  PT T+P+ +
Sbjct  187  KAVGTDDLPPPEIPSAAVSGLDEQQASCSFTAPLPPTATAPLTPTATAPLTPTATAPL-T  245

Query  249  TTPVAPTTP  257
             T  AP TP
Sbjct  246  PTATAPLTP  254


 Score = 30.4 bits (67),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 30/65 (46%), Gaps = 9/65 (14%)

Query  420  VPPGFGPLPTGDAAPAAPTPSLPTSPT-----SPPATASTSAGGT----PSSSGTTTPTA  470
             P    PL     AP  PT + P +PT     +P ATAS +   T    P+++   TPTA
Sbjct  237  TPTATAPLTPTATAPLTPTATAPLTPTATALLTPTATASLTPTATAPLPPTATALLTPTA  296

Query  471  PRKAP  475
             R  P
Sbjct  297  TRYRP  301


>M9NDA1_DROME unnamed protein product
Length=1230

 Score = 32.0 bits (71),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 74/167 (44%), Gaps = 17/167 (10%)

Query  122  AQPPAGSDEPVQTFLPTTTVDTLSV-IKQRLEMYKQAEANAKAAGDSGKARRFGRGLKTL  180
            + PPAG     Q+   TT   TLS  +++ L    +A+AN+   GD  +         T+
Sbjct  692  SSPPAG-----QSQNDTTASFTLSAPVRRSLSTEGEADANSDPEGDQDQT--VVSASYTI  744

Query  181  QDLHKQAAAGKSINVDDIPPEVSVKPAGGQAPQVAAEEPPAPSTPASPPPVPSRAAPAPP  240
                ++     S NV+ I      +P    + +  +EEPP  + P   P +P+ AAP+  
Sbjct  745  MP-RRERLPESSENVESIRSPQKTEPVAKSSSEDKSEEPPH-ARPTDLPLIPAPAAPSTE  802

Query  241  TPTSPVASTTPVAPTTPQNPLVAQMRSRQNEYKAAALQSKRSGDTAT  287
               S  A+TTP A  +P       +R R     + + +S+   DTA+
Sbjct  803  AIKSSSAATTPAALESP-------VRLRDKRGLSGSQESETKSDTAS  842



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110304.1 alpha-L-iduronidase [Drosophila elegans]

Length=637
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q582F1_TRYB2  unnamed protein product                                 31.6    2.7  
Q585J6_TRYB2  unnamed protein product                                 30.8    3.4  
Q54GR0_DICDI  unnamed protein product                                 30.4    6.1  


>Q582F1_TRYB2 unnamed protein product
Length=842

 Score = 31.6 bits (70),  Expect = 2.7, Method: Compositional matrix adjust.
 Identities = 38/154 (25%), Positives = 66/154 (43%), Gaps = 30/154 (19%)

Query  170  EPDIRGYNKLNFTAQSYLDYVQAVRRGLSKAGNPDTQDGKLQLPMYRSLRGPAGLFKDPN  229
            EP+ RG++ LN++ +      QA+R  L    NP T            ++GP G  K   
Sbjct  363  EPEPRGHHNLNYSQE------QALRVALR---NPLTL-----------IQGPPGTGKTST  402

Query  230  NHPLCWKLLEHCSQRVVYC-PIDILTFH-RKGVEGTATEIVNGSLSLMAKIYEEYP----  283
            +  +  +L  H   R++ C P ++   H  + V GT  ++V     L AK   + P    
Sbjct  403  SVAIIRELHSHVKSRILVCAPSNVAVDHLAQRVSGTGLKVVR----LQAKYRNDIPCSVE  458

Query  284  NLKLLPVANDEADPVAGWETPREFQADVRYGITL  317
            ++ L     D  +  +G E  +E    ++ G +L
Sbjct  459  SIGLERQVGDYINASSGLERLKELLDSMQTGKSL  492


>Q585J6_TRYB2 unnamed protein product
Length=379

 Score = 30.8 bits (68),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 28/117 (24%), Positives = 52/117 (44%), Gaps = 10/117 (9%)

Query  514  INSASIPLPWVALLRVCSASWPKLRRPQQLSIVEVTHREVFITWMEHPKSTQCLLSYEVW  573
            I S S+ +  V  L +C+  + ++ RP+      V      ++W+ +  S    +S ++ 
Sbjct  110  IISDSLAIDAVHQLMLCTRCFTRIIRPRTYRPSRVVPFPSLLSWLNYTPSRVMEMSEDIA  169

Query  574  FKERDSLGPSADWQLI------SRDWH---LPYPSFQYAPSDQGSVNGFYKVRGVDA  621
             +  +++ PSAD   +      SR  H   LP  +     S+ G+V G    RG+ A
Sbjct  170  SRPAEAVAPSADRVAVPTIPGGSRPTHIQQLPATAMNTV-SNAGNVGGALLARGMTA  225


>Q54GR0_DICDI unnamed protein product
Length=1036

 Score = 30.4 bits (67),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 26/51 (51%), Gaps = 10/51 (20%)

Query  224  LFKDPNNHPLCWKLLEHCSQRVVYCPIDILTFHRKGVEGTATEIVNGSLSL  274
            L  DP  + LC KLLEHC+ R        LT     +E   T+IV  S+++
Sbjct  755  LMTDPFGNYLCQKLLEHCNDR------QRLTI----IEKVGTDIVRISMNM  795



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110305.1 U5 small nuclear ribonucleoprotein 40 kDa protein
[Drosophila elegans]

Length=347
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VPL0_DROME  unnamed protein product                                 714     0.0  
WDS_DROME  unnamed protein product                                    154     1e-43
Q57W14_TRYB2  unnamed protein product                                 146     3e-40


>Q9VPL0_DROME unnamed protein product
Length=347

 Score = 714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/347 (97%), Positives = 345/347 (99%), Gaps = 0/347 (0%)

Query  1    MGTKRPNNSVVLAQEAKRSKSDLVAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFT  60
            MGTKRPNNSV+LAQEAKRSK+DL+AYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFT
Sbjct  1    MGTKRPNNSVILAQEAKRSKNDLMAYTNRDKALLESGVRRTSNLQAPIMQLEGHEGEIFT  60

Query  61   AEFHPEGELLLSSGFDRQIYIWQVYDDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDK  120
            AEFHPEGELLLSSGFDRQIYIWQVY+DCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDK
Sbjct  61   AEFHPEGELLLSSGFDRQIYIWQVYEDCENVMAMSGHSGAVMEAHFTPDGSHIFTCSTDK  120

Query  121  TLAIWDIVTGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLE  180
            TLA WDI TGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLE
Sbjct  121  TLAFWDIATGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDARKKHAAHTLE  180

Query  181  SPFQVTAVCFGDTGEQVISGGIDNELKIWDIRKQAVLHHLRGHTDTITGMSLSPEGDFVL  240
            SPFQVTAVCFGDTGEQVISGGIDNE+KIWDIRKQAVLHHLRGH+DTITGMSLSPEGDF+L
Sbjct  181  SPFQVTAVCFGDTGEQVISGGIDNEVKIWDIRKQAVLHHLRGHSDTITGMSLSPEGDFIL  240

Query  241  SNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKISSGSADRHVYI  300
            +NAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKI+SGSADRHVYI
Sbjct  241  TNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDKITSGSADRHVYI  300

Query  301  WDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE  347
            WDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE
Sbjct  301  WDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKTLYLGEIDE  347


>WDS_DROME unnamed protein product
Length=361

 Score = 154 bits (389),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 157/303 (52%), Gaps = 13/303 (4%)

Query  49   MQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYDDCENVMAMSGHSGAVMEAHFTP  108
              L GH   +   +F P GE L SS  D+ I IW  YD  +    +SGH   + +  ++ 
Sbjct  66   FTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDG-KFEKTISGHKLGISDVAWSS  124

Query  109  DGSHIFTCSTDKTLAIWDIVTGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIW  168
            D   + + S DKTL +W++ TG+  +  KGH N+V     + +   L+ SGS D +++IW
Sbjct  125  DSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQ-SNLIVSGSFDESVRIW  183

Query  169  DARKKHAAHTLES-PFQVTAVCFGDTGEQVISGGIDNELKIWDIRKQAVLHHLRGHTDT-  226
            D R      TL +    V+AV F   G  ++S   D   +IWD      L  L    +  
Sbjct  184  DVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPP  243

Query  227  ITGMSLSPEGDFVLSNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWS-PG  285
            ++ +  SP G ++L+  +DNTL++WD   Y+ G +C+K + GH++  EK  +   +S  G
Sbjct  244  VSFVKFSPNGKYILAATLDNTLKLWD---YSKG-KCLKTYTGHKN--EKYCIFANFSVTG  297

Query  286  SDKISSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGS--SDKTLYLG  343
               I SGS D  VYIW++ ++ ++ KL GH  +V      P E +I S +  +DKT+ L 
Sbjct  298  GKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW  357

Query  344  EID  346
            + D
Sbjct  358  KSD  360


 Score = 96.7 bits (239),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 130/269 (48%), Gaps = 31/269 (12%)

Query  51   LEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYDDCENVMAMSGHSGAVMEAHFTPDG  110
            + GH+  I    +  +  LL+S   D+ + +W++    +++  + GHS  V   +F P  
Sbjct  110  ISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTG-KSLKTLKGHSNYVFCCNFNPQS  168

Query  111  SHIFTCSTDKTLAIWDIVTGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWDA  170
            + I + S D+++ IWD+ TG+  +    H + V++V  +R G  L+ S S D   +IWD 
Sbjct  169  NLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDG-SLIVSSSYDGLCRIWDT  227

Query  171  RKKHAAHTL---ESPFQVTAVCFGDTGEQVISGGIDNELKIWDIRKQAVLHHLRGHTD--  225
                   TL   ++P  V+ V F   G+ +++  +DN LK+WD  K   L    GH +  
Sbjct  228  ASGQCLKTLIDDDNP-PVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEK  286

Query  226  -------TITGMSLSPEGDFVLSNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLL  278
                   ++TG      G +++S + DN + +W+++     +  V+  QGH       +L
Sbjct  287  YCIFANFSVTG------GKWIVSGSEDNMVYIWNLQ----SKEVVQKLQGHT----DTVL  332

Query  279  RCAWSPGSDKISSGSA--DRHVYIWDVNT  305
              A  P  + I+S +   D+ + +W  +T
Sbjct  333  CTACHPTENIIASAALENDKTIKLWKSDT  361


>Q57W14_TRYB2 unnamed protein product
Length=419

 Score = 146 bits (369),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/294 (30%), Positives = 143/294 (49%), Gaps = 12/294 (4%)

Query  48   IMQLEGHEGEIFTAEFH-PEGELLLSSGFDRQIYIWQVYDDCENVMAMSGHSGAVMEAHF  106
            I+ LEGH   +++  F+ P G  + +  FD+   IW      +    ++GH   ++   F
Sbjct  130  IVSLEGHRNVVYSVSFNNPYGNRVATGSFDKTCKIWDA-RTAQCYCTLAGHMAEIVCMSF  188

Query  107  TPDGSHIFTCSTDKTLAIWDIVTGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIK  166
             P  +H+ + S D T  +W++ TGQ      GH   + S+  +  G  +L +GS D T K
Sbjct  189  NPQSTHLSSGSMDYTAKVWNVETGQELYTLLGHTAEIVSLNFNTNGDLIL-TGSFDTTAK  247

Query  167  IWDARKKHAAHTLES-PFQVTAVCFGDTGEQVISGGIDNELKIWDIRKQAVLHHLRGHTD  225
            +WD R     HTL S   ++++  F   G   ++G ID   K+WD+     +  LRGHTD
Sbjct  248  LWDVRTGKCVHTLSSHRAEISSTQFNFAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTD  307

Query  226  TITGMSLSPEGDFVLSNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPG  285
             I  ++ S  G  +++ + D T RV+D   +     CV    GH    E  + +  ++P 
Sbjct  308  EILDVAFSTSGSQIVTASADATARVYDTATF----NCVASLVGH----EGEISKVQFNPQ  359

Query  286  SDKISSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKT  339
              KI S + D+   +W V T + L  L GHN  + +  F+ +   IL+GS D T
Sbjct  360  GTKIISAANDKTCRVWSVETGQNLQTLTGHNDEIFSCAFNYEGDTILTGSKDNT  413


 Score = 127 bits (318),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 134/291 (46%), Gaps = 12/291 (4%)

Query  51   LEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYDDCENVMAMSGHSGAVMEAHF-TPD  109
            L  H   +    F+  G+  ++  +DR   +W      E ++++ GH   V    F  P 
Sbjct  91   LRAHMLPLTNCAFNKGGDSFITGSYDRTCKVWDTATGNE-IVSLEGHRNVVYSVSFNNPY  149

Query  110  GSHIFTCSTDKTLAIWDIVTGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKIWD  169
            G+ + T S DKT  IWD  T Q      GH   +  +  + +    L SGS D T K+W+
Sbjct  150  GNRVATGSFDKTCKIWDARTAQCYCTLAGHMAEIVCMSFNPQSTH-LSSGSMDYTAKVWN  208

Query  170  ARKKHAAHTLES-PFQVTAVCFGDTGEQVISGGIDNELKIWDIRKQAVLHHLRGHTDTIT  228
                   +TL     ++ ++ F   G+ +++G  D   K+WD+R    +H L  H   I+
Sbjct  209  VETGQELYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTGKCVHTLSSHRAEIS  268

Query  229  GMSLSPEGDFVLSNAMDNTLRVWDVRPYAPGERCVKVFQGHQHNFEKNLLRCAWSPGSDK  288
                +  G+  ++  +D T ++WDV       +CV   +GH       +L  A+S    +
Sbjct  269  STQFNFAGNLCVTGCIDRTSKLWDV----GSGQCVSTLRGHT----DEILDVAFSTSGSQ  320

Query  289  ISSGSADRHVYIWDVNTRRILYKLPGHNGSVNAVDFSPKEPLILSGSSDKT  339
            I + SAD    ++D  T   +  L GH G ++ V F+P+   I+S ++DKT
Sbjct  321  IVTASADATARVYDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKT  371


 Score = 98.2 bits (243),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/205 (28%), Positives = 97/205 (47%), Gaps = 3/205 (1%)

Query  48   IMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQVYDDCENVMAMSGHSGAVMEAHFT  107
            +  L GH  EI +  F+  G+L+L+  FD    +W V    + V  +S H   +    F 
Sbjct  215  LYTLLGHTAEIVSLNFNTNGDLILTGSFDTTAKLWDVRTG-KCVHTLSSHRAEISSTQFN  273

Query  108  PDGSHIFTCSTDKTLAIWDIVTGQRQRRFKGHGNFVNSVQGSRRGQQLLCSGSDDRTIKI  167
              G+   T   D+T  +WD+ +GQ     +GH + +  V  S  G Q++ + S D T ++
Sbjct  274  FAGNLCVTGCIDRTSKLWDVGSGQCVSTLRGHTDEILDVAFSTSGSQIV-TASADATARV  332

Query  168  WDARKKHAAHTLES-PFQVTAVCFGDTGEQVISGGIDNELKIWDIRKQAVLHHLRGHTDT  226
            +D    +   +L     +++ V F   G ++IS   D   ++W +     L  L GH D 
Sbjct  333  YDTATFNCVASLVGHEGEISKVQFNPQGTKIISAANDKTCRVWSVETGQNLQTLTGHNDE  392

Query  227  ITGMSLSPEGDFVLSNAMDNTLRVW  251
            I   + + EGD +L+ + DNT  +W
Sbjct  393  IFSCAFNYEGDTILTGSKDNTCGIW  417


 Score = 32.3 bits (72),  Expect = 0.50, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 4/54 (7%)

Query  30   DKALLESGVRRTSNLQAPIMQLEGHEGEIFTAEFHPEGELLLSSGFDRQIYIWQ  83
            DK      V    NLQ     L GH  EIF+  F+ EG+ +L+   D    IW+
Sbjct  369  DKTCRVWSVETGQNLQT----LTGHNDEIFSCAFNYEGDTILTGSKDNTCGIWK  418



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110306.1 kinesin-like protein KIN-7O isoform X1 [Drosophila
elegans]

Length=2257
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PD87_DROME  unnamed protein product                                 2558    0.0  
M9PFL9_DROME  unnamed protein product                                 2551    0.0  
Q9VKI0_DROME  unnamed protein product                                 2275    0.0  


>M9PD87_DROME unnamed protein product
Length=2134

 Score = 2558 bits (6631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1387/2315 (60%), Positives = 1687/2315 (73%), Gaps = 239/2315 (10%)

Query  1     MSAKNASSIQVCIKVRPCEPELTSLWQVKEGCSIHLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCEP LTSLWQVKE  SIHLADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDGQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGD QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGMVNVNCEECIITSEDDLLRLLCMGN  180
             DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG+VNVNCEECIITSE DLLRLLC+GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGETNMNERSSRSHAIFRIIIESRKSDRSADDAVIQSVLNLVDLAGSERADQTGAR  240
             KERTVGETNMNERSSRSHAIF+IIIESRKSD S DDAVIQSVLNLVDLAGSERADQTGAR
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  241   GARLKEGGHINKSLLFLSNVIKSLSENVDNKFISFRDSKLTRILQASLGGNAFTSIICTI  300
             GARLKEGGHINKSLLFLSNVIKSLSEN DN+F ++RDSKLTRILQASLGGNAFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKELKDKLAEEERKNES  360
             KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIK LKDKLAEEERKNE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  361   QLKVQDLERRIKSDMHKIISSTSLGDKCRQKRRRTWCPTASGQELDPPESGTANDCLVQF  420
             Q KV+ LER+IK DMHKII   SL DK +QKRRRTWCPTASG  L+  E+GT  D + QF
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQF  420

Query  421   SKMSALPKPTFFPHSNFGRRLGNIPQTINILGSLNISTDGNVDDEQFLPAECVDFGSPGM  480
              K+S LPKP FF  SN G+R  NIP+TINILGSL+I T+ N   E+FLPAEC+DFGSP  
Sbjct  421   PKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPR-  479

Query  481   DVQMARLTSRQLPDLALTPITSQMGPVIKEKIKREIQDLQMFTSLEKQCEADFEEVKVLK  540
                         PD+ L P+ +           R++ DL +                   
Sbjct  480   ------------PDV-LKPMLT----------IRQLPDLPLTP-----------------  499

Query  541   ERLEENTAQREQLELDYSTEKERCESLQAEVTNLTAANQAANSKIHDLEEQLSALKETMT  600
                        +  L Y       ++L+ EVT+L A N+AANSKI +LEE+LS LK+TM 
Sbjct  500   -----------KGPLTY-------DALEKEVTSLRADNEAANSKISELEEKLSTLKQTMR  541

Query  601   ALEVANRDAVSLEFEFEAHKKSSKLRVNELLSVLSEKDLAIEKLRNSLDECNREVLRNSK  660
              +EV N+ AV LEFEFEAHKKSSKLRV++LLS L EK+  IE L+ SLD   R+VLRNSK
Sbjct  542   IMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSK  601

Query  661   EARMRSICQAPEE---SVDGTCNKCEQLE-----------SCECDHLRAEIAATRAKLDS  706
             E  M SI  APE+   + D  CNKCE+LE           SCECD LR EI + R KL+S
Sbjct  602   EGHMLSI--APEQEDIAGDSICNKCEELEKLIADLESKKNSCECDQLRLEIVSVRDKLES  659

Query  707   VQSALSQASSEVYVKTTDCERLSKQISTAQDDFELLQTKYNTLEQQWQGQQLAIEALQSN  766
             V+SA + ASSE+  K TDCERLSK++ST+Q+ F  LQ +Y+ L+QQWQ QQ  I  L   
Sbjct  660   VESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQAGITTLHEK  719

Query  767   HDTIQANYQKLQEEYEHL-GRTSKASEA-------DNSKLQTEIETLKEQVMEAQSMLKD  818
             H+ +Q  YQKLQEEYE L  R   AS A       DN+K Q +I +L E++ EAQ+ML +
Sbjct  720   HEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEEAQNMLTE  779

Query  819   AQVSASLAEEFKAKNQELKAKITDLESNLSEIQSEYDCLSNQLMESVQENDALREELKQR  878
              Q S S  E+ + +N EL AKI +LE+N  E+Q EYDCLSNQLMESVQENDALREE+KQR
Sbjct  780   VQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDALREEIKQR  839

Query  879   PSSFEVDSMKSSGVGTECSEPEHELDLESDLLQQFVQLSESIHQIELQHHSGCSRLFRAI  938
             P+S   +SM+SSG+ ++  E + +++L    L QFVQLSES+ QIELQHHSG SRLFRA 
Sbjct  840   PTSHVEESMRSSGISSDFDEQKQDINL----LHQFVQLSESVQQIELQHHSGISRLFRAN  895

Query  939   NLDRDLEEPGLKLCLESADCIESDSRQLDASDSISLKGSFKRHRFQIRRLTQEQVILEEE  998
              +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+QE V + EE
Sbjct  896   QMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEE  955

Query  999   RRLLDIISQLEQEVAEKSALMEATEATINEMREQMSSLESALLEKSVIVNKVEDYQRQIE  1058
             +RLLDIISQLEQE+ EKSALMEATEATINEMREQM++LESALLEKSVI+NKVEDYQRQIE
Sbjct  956   KRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKVEDYQRQIE  1015

Query  1059  SLEKQNAEMTMVYEELQDKVIRESSMSENLLVIPPDDDTLPGVHPSTPGMKDQEPQEVAT  1118
             SLEKQNAEMTMVYEELQD+V RESSMSE+LL +PPD+DTLPG  P++P  ++QE   VAT
Sbjct  1016  SLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGC-PTSPSRREQE---VAT  1071

Query  1119  LKASLAELRTRVCAMQEEIDSQLRQMQLKDENIAKLYTEIEEMSERCLSMEVRMAELEED  1178
             LK S+ EL+++V  ++ E+++ LRQ+QLKD NIA+L T+ EEMSERCLSMEVR+AEL+ED
Sbjct  1072  LKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAELDED  1131

Query  1179  AKQKQELLDCQAQKLSDGVRLIDQLQEKNAQLVQQTTK--------------VEAPSEYV  1224
              KQKQELLD QAQKLSD + LIDQLQ+KNAQLV+Q  K              +   S+Y 
Sbjct  1132  TKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYD  1191

Query  1225  NQIEELRESLRTANEELRDTKRVKEDEINALQLKYMMKMEASESENCAKLRLCSQELEEC  1284
             +QIE+L + L  A +EL D +R+K+DEI+AL++++++++E +E EN AK      EL+E 
Sbjct  1192  SQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF---YAELQET  1248

Query  1285  KDRYESSVAALKDQLTQAGEELASVTARCQTELEGIRGTLQEKINHAEEERNKLNAQHQA  1344
             KDRYES+VA LK++L Q  E L+SVT RCQ ELE ++   +E I+ A EERN L  QHQA
Sbjct  1249  KDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQA  1308

Query  1345  ELDGLREALEKKIAEAEAQQLSIE-----------TTLKEQLSQAQEEREKATSKLEEMK  1393
             E++ +RE L+ K+AEA  QQ  +E            TL EQL+Q +E+R+K  SKLEE+K
Sbjct  1309  EMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVK  1368

Query  1394  ITLEEMIGHRNTMRETIAELEKSKSDHELALDKVKAERMQFENLYEKSQEQLQIQLSNME  1453
              TLE+MI     M +TIAELEK+K++ +LA++K+  + ++ E    K+QEQLQ++    +
Sbjct  1369  KTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQLQMESLTRD  1428

Query  1454  QNNLDTQAHSEQLE--------KITELQAQCEQQVQDMEKLSQEKMTLQLEIQEANEHLS  1505
             Q + + +AH ++LE        +I EL+ +C+QQV +++K   EK++L+ EIQ+AN   S
Sbjct  1429  QISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHS  1488

Query  1506  NSLKKCEELELQMNALKTQNVMEKSDLEAKLETFTAKMSDLEEALQKAQLKTLEHDDLIS  1565
              +++K +EL+ +M  L  +N  EK D E KLETFT K++DLEE L++AQ K + +DDL+S
Sbjct  1489  CTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVS  1548

Query  1566  QHERLKICLSEANEVSCNLEKKIECLNSELLTSQEGISNRDDEIKQLRLELKHALDAKDT  1625
             QHERLKICL+EANE+S NL+KK+  L++EL+ SQ+GIS+RD EI +LR ELK A+DAK T
Sbjct  1549  QHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKAT  1608

Query  1626  TRSEQLELVAQLKAVEDKMSTQAGNFQRELTDLKGSMDELQLKLKSLQETKDNLEAGNEE  1685
               +EQ+ LV QLK VE++M+ QA  F RE  +LKGS++EL LKL S+QETKD LE+GNEE
Sbjct  1609  ASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEE  1668

Query  1686  LKLKLRNAQDLQNALEEEQKLCTSLRANIANLEQSKTRLEEQMR---VEVDQRFMEMSRN  1742
             LK +LRN+Q+L+N L+EE K+C SL+  +  LE +KT LE+Q+R    E+ QR  E+++ 
Sbjct  1669  LKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKE  1728

Query  1743  FELSQNTIGELTTKCENLRSQLETETNNFQRKKESLDLIISDLEKEKQELEEKLSILKEK  1802
              EL +N IGELT KCE L S LE             D I  DL+                
Sbjct  1729  VELGRNRIGELTKKCEELCSDLENS-----------DQIRLDLQ----------------  1761

Query  1803  DETIDRLKAQLTSNEATLSSLQEAMEAANNKSLEMGQKVDELSRECEMLRSELQSKEACF  1862
              ET ++LK  L +N                  L   QKVDE++RECE LR ++QSKE   
Sbjct  1762  -ETKEQLKKTLENN------------------LGWQQKVDEVTRECEKLRFDMQSKEV--  1800

Query  1863  QKEKHMSDGTISSLLEDKRGLEKKLCTFNDILSKHEEFTKECENLRSTLKSKDASFRMEK  1922
             Q E                             SK +E   ECE LRSTLKSK+ASF+ EK
Sbjct  1801  QNE-----------------------------SKVQELISECEELRSTLKSKEASFQSEK  1831

Query  1923  ERMDGTISSLLEDKRNLEEKLCTVNDIVTKLQGELTALQAIKGNGSNASFESNASNGSPV  1982
             E MD TISSLLEDKRNLEEKLC+ NDIV KL+ E+ AL+                     
Sbjct  1832  ESMDRTISSLLEDKRNLEEKLCSANDIVAKLETEIAALRP--------------------  1871

Query  1983  NAPARKSLDRNPGASGPRKSLTSETEVRRNRRISVHDERRQSYWNDFRECGTMTDPVDNN  2042
                 RKSLDRNP    PRKS+T E+E+R+NRRISVHDERRQSYWND RE G MTDPVDNN
Sbjct  1872  ----RKSLDRNPV---PRKSITFESEIRKNRRISVHDERRQSYWNDVREFGIMTDPVDNN  1924

Query  2043  CNCAELNARLQECQRDFFICESKVTALNMELKHHPLKDENAQLKRRVLEEQEKARAEQKR  2102
             CNCAELN++LQ+CQR+ FI ES+VTAL MEL HHPLKDENAQL +RV+EEQ+KA+ EQKR
Sbjct  1925  CNCAELNSKLQDCQRELFIRESQVTALKMELDHHPLKDENAQLTKRVIEEQDKAKVEQKR  1984

Query  2103  FKAKLHDLNARINDLTDAAASSAMPIADQQEQAKNSVRPEMVTRDTQTESELEAILEKTN  2162
              K KL DLNARINDLT A+A    P ++Q  QA    +P  V   TQTES+LE ILEKTN
Sbjct  1985  LKMKLQDLNARINDLTTASAKE--PESNQMAQA---AKPATVAAQTQTESDLETILEKTN  2039

Query  2163  TKYQDAVQLLRFRYNLIKELEGKVRQNENNDTSNITSLTAGQNSALKAQCEAQKRELAVI  2222
              KYQ+AV++LR+RY+LI+EL+ K+RQNEN+DTSNITSL+AGQ SALKAQCE+QK+E+  I
Sbjct  2040  VKYQEAVRMLRYRYHLIQELKEKLRQNENSDTSNITSLSAGQTSALKAQCESQKKEILAI  2099

Query  2223  RNKYESAKRVLGMRKDEMDKIRAKLAQYEAGESTK  2257
             + KYE+AKR+L +R D++D +R KLA+YE   S K
Sbjct  2100  KYKYEAAKRILAIRNDDLDALREKLAKYETTTSDK  2134


>M9PFL9_DROME unnamed protein product
Length=2132

 Score = 2551 bits (6611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1385/2315 (60%), Positives = 1685/2315 (73%), Gaps = 241/2315 (10%)

Query  1     MSAKNASSIQVCIKVRPCEPELTSLWQVKEGCSIHLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCEP LTSLWQVKE  SIHLADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDGQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGD QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGMVNVNCEECIITSEDDLLRLLCMGN  180
             DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG+VNVNCEECIITSE DLLRLLC+GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGETNMNERSSRSHAIFRIIIESRKSDRSADDAVIQSVLNLVDLAGSERADQTGAR  240
             KERTVGETNMNERSSRSHAIF+IIIESRKSD S DDAVIQSVLNLVDLAGSERADQTGAR
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  241   GARLKEGGHINKSLLFLSNVIKSLSENVDNKFISFRDSKLTRILQASLGGNAFTSIICTI  300
             GARLKEGGHINKSLLFLSNVIKSLSEN DN+F ++RDSKLTRILQASLGGNAFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKELKDKLAEEERKNES  360
             KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIK LKDKLAEEERKNE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  361   QLKVQDLERRIKSDMHKIISSTSLGDKCRQKRRRTWCPTASGQELDPPESGTANDCLVQF  420
             Q KV+ LER+IK DMHKII   SL DK +QKRRRTWCPTASG  L+  E+GT  D + QF
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQF  420

Query  421   SKMSALPKPTFFPHSNFGRRLGNIPQTINILGSLNISTDGNVDDEQFLPAECVDFGSPGM  480
              K+S LPKP FF  SN G+R  NIP+TINILGSL+I T+ N   E+FLPAEC+DFGSP  
Sbjct  421   PKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPR-  479

Query  481   DVQMARLTSRQLPDLALTPITSQMGPVIKEKIKREIQDLQMFTSLEKQCEADFEEVKVLK  540
                         PD+ L P+ +           R++ DL +                   
Sbjct  480   ------------PDV-LKPMLT----------IRQLPDLPLTP-----------------  499

Query  541   ERLEENTAQREQLELDYSTEKERCESLQAEVTNLTAANQAANSKIHDLEEQLSALKETMT  600
                        +  L Y       ++L+ EVT+L A N+AANSKI +LEE+LS LK+TM 
Sbjct  500   -----------KGPLTY-------DALEKEVTSLRADNEAANSKISELEEKLSTLKQTMR  541

Query  601   ALEVANRDAVSLEFEFEAHKKSSKLRVNELLSVLSEKDLAIEKLRNSLDECNREVLRNSK  660
              +EV N+ AV LEFEFEAHKKSSKLRV++LLS L EK+  IE L+ SLD   R+VLRNSK
Sbjct  542   IMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSK  601

Query  661   EARMRSICQAPEE---SVDGTCNKCEQLE-----------SCECDHLRAEIAATRAKLDS  706
             E  M SI  APE+   + D  CNKCE+LE           SCECD LR EI + R KL+S
Sbjct  602   EGHMLSI--APEQEDIAGDSICNKCEELEKLIADLESKKNSCECDQLRLEIVSVRDKLES  659

Query  707   VQSALSQASSEVYVKTTDCERLSKQISTAQDDFELLQTKYNTLEQQWQGQQLAIEALQSN  766
             V+SA + ASSE+  K TDCERLSK++ST+Q+ F  LQ +Y+ L+QQWQ QQ  I  L   
Sbjct  660   VESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQAGITTLHEK  719

Query  767   HDTIQANYQKLQEEYEHL-GRTSKASEA-------DNSKLQTEIETLKEQVMEAQSMLKD  818
             H+ +Q  YQKLQEEYE L  R   AS A       DN+K Q +I +L E++ EAQ+ML +
Sbjct  720   HEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEEAQNMLTE  779

Query  819   AQVSASLAEEFKAKNQELKAKITDLESNLSEIQSEYDCLSNQLMESVQENDALREELKQR  878
              Q S S  E+ + +N EL AKI +LE+N  E+Q EYDCLSNQLMESVQENDALREE+KQR
Sbjct  780   VQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDALREEIKQR  839

Query  879   PSSFEVDSMKSSGVGTECSEPEHELDLESDLLQQFVQLSESIHQIELQHHSGCSRLFRAI  938
             P+S   +SM+SSG+ ++  E + +++L    L QFVQLSES+ QIELQHHSG SRLFRA 
Sbjct  840   PTSHVEESMRSSGISSDFDEQKQDINL----LHQFVQLSESVQQIELQHHSGISRLFRAN  895

Query  939   NLDRDLEEPGLKLCLESADCIESDSRQLDASDSISLKGSFKRHRFQIRRLTQEQVILEEE  998
              +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+QE V + EE
Sbjct  896   QMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEE  955

Query  999   RRLLDIISQLEQEVAEKSALMEATEATINEMREQMSSLESALLEKSVIVNKVEDYQRQIE  1058
             +RLLDIISQLEQE+ EKSALMEATEATINEMREQM++LESALLEKSVI+NKVEDYQRQIE
Sbjct  956   KRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKVEDYQRQIE  1015

Query  1059  SLEKQNAEMTMVYEELQDKVIRESSMSENLLVIPPDDDTLPGVHPSTPGMKDQEPQEVAT  1118
             SLEKQNAEMTMVYEELQD+V RESSMSE+LL +PPD+DTLPG  P++P  ++QE   VAT
Sbjct  1016  SLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGC-PTSPSRREQE---VAT  1071

Query  1119  LKASLAELRTRVCAMQEEIDSQLRQMQLKDENIAKLYTEIEEMSERCLSMEVRMAELEED  1178
             LK S+ EL+++V  ++ E+++ LRQ+QLKD NIA+L T+ EEMSERCLSMEVR+AEL+ED
Sbjct  1072  LKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAELDED  1131

Query  1179  AKQKQELLDCQAQKLSDGVRLIDQLQEKNAQLVQQTTK--------------VEAPSEYV  1224
              KQKQELLD QAQKLSD + LIDQLQ+KNAQLV+Q  K              +   S+Y 
Sbjct  1132  TKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYD  1191

Query  1225  NQIEELRESLRTANEELRDTKRVKEDEINALQLKYMMKMEASESENCAKLRLCSQELEEC  1284
             +QIE+L + L  A +EL D +R+K+DEI+AL++++++++E +E EN AK      EL+E 
Sbjct  1192  SQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF---YAELQET  1248

Query  1285  KDRYESSVAALKDQLTQAGEELASVTARCQTELEGIRGTLQEKINHAEEERNKLNAQHQA  1344
             KDRYES+VA LK++L Q  E L+SVT RCQ ELE ++   +E I+ A EERN L  QHQA
Sbjct  1249  KDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQA  1308

Query  1345  ELDGLREALEKKIAEAEAQQLSIE-----------TTLKEQLSQAQEEREKATSKLEEMK  1393
             E++ +RE L+ K+AEA  QQ  +E            TL EQL+Q +E+R+K  SKLEE+K
Sbjct  1309  EMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVK  1368

Query  1394  ITLEEMIGHRNTMRETIAELEKSKSDHELALDKVKAERMQFENLYEKSQEQLQIQLSNME  1453
              TLE+MI     M +TIAELEK+K++ +LA++K+  + ++ E    K+QEQLQ++    +
Sbjct  1369  KTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQLQMESLTRD  1428

Query  1454  QNNLDTQAHSEQLE--------KITELQAQCEQQVQDMEKLSQEKMTLQLEIQEANEHLS  1505
             Q + + +AH ++LE        +I EL+ +C+QQV +++K   EK++L+ EIQ+AN   S
Sbjct  1429  QISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHS  1488

Query  1506  NSLKKCEELELQMNALKTQNVMEKSDLEAKLETFTAKMSDLEEALQKAQLKTLEHDDLIS  1565
              +++K +EL+ +M  L  +N  EK D E KLETFT K++DLEE L++AQ K + +DDL+S
Sbjct  1489  CTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVS  1548

Query  1566  QHERLKICLSEANEVSCNLEKKIECLNSELLTSQEGISNRDDEIKQLRLELKHALDAKDT  1625
             QHERLKICL+EANE+S NL+KK+  L++EL+ SQ+GIS+RD EI +LR ELK A+DAK T
Sbjct  1549  QHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKAT  1608

Query  1626  TRSEQLELVAQLKAVEDKMSTQAGNFQRELTDLKGSMDELQLKLKSLQETKDNLEAGNEE  1685
               +EQ+ LV QLK VE++M+ QA  F RE  +LKGS++EL LKL S+QETKD LE+GNEE
Sbjct  1609  ASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEE  1668

Query  1686  LKLKLRNAQDLQNALEEEQKLCTSLRANIANLEQSKTRLEEQMR---VEVDQRFMEMSRN  1742
             LK +LRN+Q+L+N L+EE K+C SL+  +  LE +KT LE+Q+R    E+ QR  E+++ 
Sbjct  1669  LKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKE  1728

Query  1743  FELSQNTIGELTTKCENLRSQLETETNNFQRKKESLDLIISDLEKEKQELEEKLSILKEK  1802
              EL +N IGELT KCE L S LE             D I  DL+                
Sbjct  1729  VELGRNRIGELTKKCEELCSDLENS-----------DQIRLDLQ----------------  1761

Query  1803  DETIDRLKAQLTSNEATLSSLQEAMEAANNKSLEMGQKVDELSRECEMLRSELQSKEACF  1862
              ET ++LK  L +N                  L   QKVDE++RECE LR ++QSKE   
Sbjct  1762  -ETKEQLKKTLENN------------------LGWQQKVDEVTRECEKLRFDMQSKEV--  1800

Query  1863  QKEKHMSDGTISSLLEDKRGLEKKLCTFNDILSKHEEFTKECENLRSTLKSKDASFRMEK  1922
             Q E                             SK +E   ECE LRSTLKSK+ASF+ EK
Sbjct  1801  QNE-----------------------------SKVQELISECEELRSTLKSKEASFQSEK  1831

Query  1923  ERMDGTISSLLEDKRNLEEKLCTVNDIVTKLQGELTALQAIKGNGSNASFESNASNGSPV  1982
             E MD TISSLLEDKRNLEEKLC+ NDIV KL+ E+ AL+                     
Sbjct  1832  ESMDRTISSLLEDKRNLEEKLCSANDIVAKLETEIAALRP--------------------  1871

Query  1983  NAPARKSLDRNPGASGPRKSLTSETEVRRNRRISVHDERRQSYWNDFRECGTMTDPVDNN  2042
                 RKSLDRNP    PRKS+T E+E+R+NRRISVHDERRQSYWND RE G MTDPVDNN
Sbjct  1872  ----RKSLDRNPV---PRKSITFESEIRKNRRISVHDERRQSYWNDVREFGIMTDPVDNN  1924

Query  2043  CNCAELNARLQECQRDFFICESKVTALNMELKHHPLKDENAQLKRRVLEEQEKARAEQKR  2102
             CNCAELN++LQ+CQR+ FI ES+VTAL MEL HHPLKDENAQL +RV+EEQ+KA+ EQKR
Sbjct  1925  CNCAELNSKLQDCQRELFIRESQVTALKMELDHHPLKDENAQLTKRVIEEQDKAKVEQKR  1984

Query  2103  FKAKLHDLNARINDLTDAAASSAMPIADQQEQAKNSVRPEMVTRDTQTESELEAILEKTN  2162
              K KL DLNARINDLT A+A    P ++Q  QA    +P  V   TQTES+LE ILEKTN
Sbjct  1985  LKMKLQDLNARINDLTTASAKE--PESNQMAQA---AKPATVAAQTQTESDLETILEKTN  2039

Query  2163  TKYQDAVQLLRFRYNLIKELEGKVRQNENNDTSNITSLTAGQNSALKAQCEAQKRELAVI  2222
              KYQ+AV++LR+RY+LI+EL+ K+RQNEN+DTSNITSL+AGQ SALK  CE+QK+E+  I
Sbjct  2040  VKYQEAVRMLRYRYHLIQELKEKLRQNENSDTSNITSLSAGQTSALK--CESQKKEILAI  2097

Query  2223  RNKYESAKRVLGMRKDEMDKIRAKLAQYEAGESTK  2257
             + KYE+AKR+L +R D++D +R KLA+YE   S K
Sbjct  2098  KYKYEAAKRILAIRNDDLDALREKLAKYETTTSDK  2132


>Q9VKI0_DROME unnamed protein product
Length=2189

 Score = 2275 bits (5895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1223/1958 (62%), Positives = 1488/1958 (76%), Gaps = 100/1958 (5%)

Query  1     MSAKNASSIQVCIKVRPCEPELTSLWQVKEGCSIHLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCEP LTSLWQVKE  SIHLADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDGQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGD QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGMVNVNCEECIITSEDDLLRLLCMGN  180
             DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG+VNVNCEECIITSE DLLRLLC+GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGETNMNERSSRSHAIFRIIIESRKSDRSADDAVIQSVLNLVDLAGSERADQTGAR  240
             KERTVGETNMNERSSRSHAIF+IIIESRKSD S DDAVIQSVLNLVDLAGSERADQTGAR
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  241   GARLKEGGHINKSLLFLSNVIKSLSENVDNKFISFRDSKLTRILQASLGGNAFTSIICTI  300
             GARLKEGGHINKSLLFLSNVIKSLSEN DN+F ++RDSKLTRILQASLGGNAFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKELKDKLAEEERKNES  360
             KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIK LKDKLAEEERKNE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  361   QLKVQDLERRIKSDMHKIISSTSLGDKCRQKRRRTWCPTASGQELDPPESGTANDCLVQF  420
             Q KV+ LER+IK DMHKII   SL DK +QKRRRTWCPTASG  L+  E+GT  D + QF
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQF  420

Query  421   SKMSALPKPTFFPHSNFGRRLGNIPQTINILGSLNISTDGNVDDEQFLPAECVDFGSPGM  480
              K+S LPKP FF  SN G+R  NIP+TINILGSL+I T+ N   E+FLPAEC+DFGSP  
Sbjct  421   PKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPRP  480

Query  481   DVQMARLTSRQLPDLALTPITSQMGPVIKEKIKREIQDLQMFTSLEKQCEADFEEVKVLK  540
             DV    LT RQLPDL LTP     GP+  +KIK+EIQDLQMFTSLEK  E + EEV+ LK
Sbjct  481   DVLKPMLTIRQLPDLPLTP----KGPLTTDKIKKEIQDLQMFTSLEKHFEVECEEVQGLK  536

Query  541   ERLEENTAQREQLELDYSTEKERCESLQAEVTNLTAANQAANSKIHDLEEQLSALKETMT  600
             E+L E TAQR+ LE +   EKER ++L+ EVT+L A N+AANSKI +LEE+LS LK+TM 
Sbjct  537   EKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRADNEAANSKISELEEKLSTLKQTMR  596

Query  601   ALEVANRDAVSLEFEFEAHKKSSKLRVNELLSVLSEKDLAIEKLRNSLDECNREVLRNSK  660
              +EV N+ AV LEFEFEAHKKSSKLRV++LLS L EK+  IE L+ SLD   R+VLRNSK
Sbjct  597   IMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSK  656

Query  661   EARMRSICQAPEE---SVDGTCNKCEQLE-----------SCECDHLRAEIAATRAKLDS  706
             E  M SI  APE+   + D  CNKCE+LE           SCECD LR EI + R KL+S
Sbjct  657   EGHMLSI--APEQEDIAGDSICNKCEELEKLIADLESKKNSCECDQLRLEIVSVRDKLES  714

Query  707   VQSALSQASSEVYVKTTDCERLSKQISTAQDDFELLQTKYNTLEQQWQGQQLAIEALQSN  766
             V+SA + ASSE+  K TDCERLSK++ST+Q+ F  LQ +Y+ L+QQWQ QQ  I  L   
Sbjct  715   VESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQAGITTLHEK  774

Query  767   HDTIQANYQKLQEEYEHL-GRTSKASEA-------DNSKLQTEIETLKEQVMEAQSMLKD  818
             H+ +Q  YQKLQEEYE L  R   AS A       DN+K Q +I +L E++ EAQ+ML +
Sbjct  775   HEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEEAQNMLTE  834

Query  819   AQVSASLAEEFKAKNQELKAKITDLESNLSEIQSEYDCLSNQLMESVQENDALREELKQR  878
              Q S S  E+ + +N EL AKI +LE+N  E+Q EYDCLSNQLMESVQENDALREE+KQR
Sbjct  835   VQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDALREEIKQR  894

Query  879   PSSFEVDSMKSSGVGTECSEPEHELDLESDLLQQFVQLSESIHQIELQHHSGCSRLFRAI  938
             P+S   +SM+SSG+ ++  E + ++    +LL QFVQLSES+ QIELQHHSG SRLFRA 
Sbjct  895   PTSHVEESMRSSGISSDFDEQKQDI----NLLHQFVQLSESVQQIELQHHSGISRLFRAN  950

Query  939   NLDRDLEEPGLKLCLESADCIESDSRQLDASDSISLKGSFKRHRFQIRRLTQEQVILEEE  998
              +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+QE V + EE
Sbjct  951   QMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEE  1010

Query  999   RRLLDIISQLEQEVAEKSALMEATEATINEMREQMSSLESALLEKSVIVNKVEDYQRQIE  1058
             +RLLDIISQLEQE+ EKSALMEATEATINEMREQM++LESALLEKSVI+NKVEDYQRQIE
Sbjct  1011  KRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKVEDYQRQIE  1070

Query  1059  SLEKQNAEMTMVYEELQDKVIRESSMSENLLVIPPDDDTLPGVHPSTPGMKDQEPQEVAT  1118
             SLEKQNAEMTMVYEELQD+V RESSMSE+LL +PPD+DTLPG  P++P  ++   QEVAT
Sbjct  1071  SLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGC-PTSPSRRE---QEVAT  1126

Query  1119  LKASLAELRTRVCAMQEEIDSQLRQMQLKDENIAKLYTEIEEMSERCLSMEVRMAELEED  1178
             LK S+ EL+++V  ++ E+++ LRQ+QLKD NIA+L T+ EEMSERCLSMEVR+AEL+ED
Sbjct  1127  LKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAELDED  1186

Query  1179  AKQKQELLDCQAQKLSDGVRLIDQLQEKNAQLVQQTTK--------------VEAPSEYV  1224
              KQKQELLD QAQKLSD + LIDQLQ+KNAQLV+Q  K              +   S+Y 
Sbjct  1187  TKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYD  1246

Query  1225  NQIEELRESLRTANEELRDTKRVKEDEINALQLKYMMKMEASESENCAKLRLCSQELEEC  1284
             +QIE+L + L  A +EL D +R+K+DEI+AL++++++++E +E EN AK      EL+E 
Sbjct  1247  SQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF---YAELQET  1303

Query  1285  KDRYESSVAALKDQLTQAGEELASVTARCQTELEGIRGTLQEKINHAEEERNKLNAQHQA  1344
             KDRYES+VA LK++L Q  E L+SVT RCQ ELE ++   +E I+ A EERN L  QHQA
Sbjct  1304  KDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQA  1363

Query  1345  ELDGLREALEKKIAEAEAQQLSIE-----------TTLKEQLSQAQEEREKATSKLEEMK  1393
             E++ +RE L+ K+AEA  QQ  +E            TL EQL+Q +E+R+K  SKLEE+K
Sbjct  1364  EMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVK  1423

Query  1394  ITLEEMIGHRNTMRETIAELEKSKSDHELALDKVKAERMQFENLYEKSQEQLQIQLSNME  1453
              TLE+MI     M +TIAELEK+K++ +LA++K+  + ++ E    K+QEQLQ++    +
Sbjct  1424  KTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQLQMESLTRD  1483

Query  1454  QNNLDTQAHSEQLE--------KITELQAQCEQQVQDMEKLSQEKMTLQLEIQEANEHLS  1505
             Q + + +AH ++LE        +I EL+ +C+QQV +++K   EK++L+ EIQ+AN   S
Sbjct  1484  QISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHS  1543

Query  1506  NSLKKCEELELQMNALKTQNVMEKSDLEAKLETFTAKMSDLEEALQKAQLKTLEHDDLIS  1565
              +++K +EL+ +M  L  +N  EK D E KLETFT K++DLEE L++AQ K + +DDL+S
Sbjct  1544  CTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVS  1603

Query  1566  QHERLKICLSEANEVSCNLEKKIECLNSELLTSQEGISNRDDEIKQLRLELKHALDAKDT  1625
             QHERLKICL+EANE+S NL+KK+  L++EL+ SQ+GIS+RD EI +LR ELK A+DAK T
Sbjct  1604  QHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKAT  1663

Query  1626  TRSEQLELVAQLKAVEDKMSTQAGNFQRELTDLKGSMDELQLKLKSLQETKDNLEAGNEE  1685
               +EQ+ LV QLK VE++M+ QA  F RE  +LKGS++EL LKL S+QETKD LE+GNEE
Sbjct  1664  ASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEE  1723

Query  1686  LKLKLRNAQDLQNALEEEQKLCTSLRANIANLEQSKTRLEEQMR---VEVDQRFMEMSRN  1742
             LK +LRN+Q+L+N L+EE K+C SL+  +  LE +KT LE+Q+R    E+ QR  E+++ 
Sbjct  1724  LKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKE  1783

Query  1743  FELSQNTIGELTTKCENLRSQLETETNNFQRKKESLDLIISDLEKEKQELEEKLSILKEK  1802
              EL +N IGELT KCE L S LE             D I  DL++ K++L++ L      
Sbjct  1784  VELGRNRIGELTKKCEELCSDLENS-----------DQIRLDLQETKEQLKKTLE-----  1827

Query  1803  DETIDRLKAQLTSNEAT--LSSLQEAMEAANNKSLEMGQKVDELSRECEMLRSELQSKEA  1860
                 + L  Q   +E T     L+  M++   K ++   KV EL  ECE LRS L+SKEA
Sbjct  1828  ----NNLGWQQKVDEVTRECEKLRFDMQS---KEVQNESKVQELISECEELRSTLKSKEA  1880

Query  1861  CFQKEKHMSDGTISSLLEDKRGLEKKLCTFNDILSKHE  1898
              FQ EK   D TISSLLEDKR LE+KLC+ NDI++K E
Sbjct  1881  SFQSEKESMDRTISSLLEDKRNLEEKLCSANDIVAKLE  1918



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110307.1 kinesin-like protein KIN-7O isoform X2 [Drosophila
elegans]

Length=2202
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKI0_DROME  unnamed protein product                                 2584    0.0  
M9PCX3_DROME  unnamed protein product                                 2573    0.0  
Q9NCG0_DROME  unnamed protein product                                 2506    0.0  


>Q9VKI0_DROME unnamed protein product
Length=2189

 Score = 2584 bits (6697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1396/2315 (60%), Positives = 1687/2315 (73%), Gaps = 239/2315 (10%)

Query  1     MSAKNASSIQVCIKVRPCEPELTSLWQVKEGCSIHLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCEP LTSLWQVKE  SIHLADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDGQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGD QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGMVNVNCEECIITSEDDLLRLLCMGN  180
             DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG+VNVNCEECIITSE DLLRLLC+GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGETNMNERSSRSHAIFRIIIESRKSDRSADDAVIQSVLNLVDLAGSERADQTGAR  240
             KERTVGETNMNERSSRSHAIF+IIIESRKSD S DDAVIQSVLNLVDLAGSERADQTGAR
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  241   GARLKEGGHINKSLLFLSNVIKSLSENVDNKFISFRDSKLTRILQASLGGNAFTSIICTI  300
             GARLKEGGHINKSLLFLSNVIKSLSEN DN+F ++RDSKLTRILQASLGGNAFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKELKDKLAEEERKNES  360
             KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIK LKDKLAEEERKNE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  361   QLKVQDLERRIKSDMHKIISSTSLGDKCRQKRRRTWCPTASGQELDPPESGTANDCLVQF  420
             Q KV+ LER+IK DMHKII   SL DK +QKRRRTWCPTASG  L+  E+GT  D + QF
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQF  420

Query  421   SKMSALPKPTFFPHSNFGRRLGNIPQTINILGSLNISTDGNVDDEQFLPAECVDFGSPGM  480
              K+S LPKP FF  SN G+R  NIP+TINILGSL+I T+ N   E+FLPAEC+DFGSP  
Sbjct  421   PKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPRP  480

Query  481   DVQMARLTSRQLPDLALTPITSQMGP------------------------VICESLQA--  514
             DV    LT RQLPDL LTP     GP                        V CE +Q   
Sbjct  481   DVLKPMLTIRQLPDLPLTP----KGPLTTDKIKKEIQDLQMFTSLEKHFEVECEEVQGLK  536

Query  515   -----------------------------EVTNLTAANQAANSKIHDLEEQLSALKETMT  545
                                          EVT+L A N+AANSKI +LEE+LS LK+TM 
Sbjct  537   EKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRADNEAANSKISELEEKLSTLKQTMR  596

Query  546   ALEVANRDAVSLEFEFEAHKKSSKLRVNELLSVLSEKDLAIEKLRNSLDECNREVLRNSK  605
              +EV N+ AV LEFEFEAHKKSSKLRV++LLS L EK+  IE L+ SLD   R+VLRNSK
Sbjct  597   IMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSK  656

Query  606   EARMRSICQAPEE---SVDGTCNKCEQLE-----------SCECDHLRAEIAATRAKLDS  651
             E  M SI  APE+   + D  CNKCE+LE           SCECD LR EI + R KL+S
Sbjct  657   EGHMLSI--APEQEDIAGDSICNKCEELEKLIADLESKKNSCECDQLRLEIVSVRDKLES  714

Query  652   VQSALSQASSEVYVKTTDCERLSKQISTAQDDFELLQTKYNTLEQQWQGQQLAIEALQSN  711
             V+SA + ASSE+  K TDCERLSK++ST+Q+ F  LQ +Y+ L+QQWQ QQ  I  L   
Sbjct  715   VESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQAGITTLHEK  774

Query  712   HDTIQANYQKLQEEYEHL-GRTSKASEA-------DNSKLQTEIETLKEQVMEAQSMLKD  763
             H+ +Q  YQKLQEEYE L  R   AS A       DN+K Q +I +L E++ EAQ+ML +
Sbjct  775   HEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEEAQNMLTE  834

Query  764   AQVSASLAEEFKAKNQELKAKITDLESNLSEIQSEYDCLSNQLMESVQENDALREELKQR  823
              Q S S  E+ + +N EL AKI +LE+N  E+Q EYDCLSNQLMESVQENDALREE+KQR
Sbjct  835   VQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDALREEIKQR  894

Query  824   PSSFEVDSMKSSGVGTECSEPEHELDLESDLLQQFVQLSESIHQIELQHHSGCSRLFRAI  883
             P+S   +SM+SSG+ ++  E + +++L    L QFVQLSES+ QIELQHHSG SRLFRA 
Sbjct  895   PTSHVEESMRSSGISSDFDEQKQDINL----LHQFVQLSESVQQIELQHHSGISRLFRAN  950

Query  884   NLDRDLEEPGLKLCLESADCIESDSRQLDASDSISLKGSFKRHRFQIRRLTQEQVILEEE  943
              +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+QE V + EE
Sbjct  951   QMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEE  1010

Query  944   RRLLDIISQLEQEVAEKSALMEATEATINEMREQMSSLESALLEKSVIVNKVEDYQRQIE  1003
             +RLLDIISQLEQE+ EKSALMEATEATINEMREQM++LESALLEKSVI+NKVEDYQRQIE
Sbjct  1011  KRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKVEDYQRQIE  1070

Query  1004  SLEKQNAEMTMVYEELQDKVIRESSMSENLLVIPPDDDTLPGVHPSTPGMKDQEPQEVAT  1063
             SLEKQNAEMTMVYEELQD+V RESSMSE+LL +PPD+DTLPG  P++P  ++QE   VAT
Sbjct  1071  SLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGC-PTSPSRREQE---VAT  1126

Query  1064  LKASLAELRTRVCAMQEEIDSQLRQMQLKDENIAKLYTEIEEMSERCLSMEVRMAELEED  1123
             LK S+ EL+++V  ++ E+++ LRQ+QLKD NIA+L T+ EEMSERCLSMEVR+AEL+ED
Sbjct  1127  LKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAELDED  1186

Query  1124  AKQKQELLDCQAQKLSDGVRLIDQLQEKNAQLVQQTTK--------------VEAPSEYV  1169
              KQKQELLD QAQKLSD + LIDQLQ+KNAQLV+Q  K              +   S+Y 
Sbjct  1187  TKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYD  1246

Query  1170  NQIEELRESLRTANEELRDTKRVKEDEINALQLKYMMKMEASESENCAKLRLCSQELEEC  1229
             +QIE+L + L  A +EL D +R+K+DEI+AL++++++++E +E EN AK      EL+E 
Sbjct  1247  SQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF---YAELQET  1303

Query  1230  KDRYESSVAALKDQLTQAGEELASVTARCQTELEGIRGTLQEKINHAEEERNKLNAQHQA  1289
             KDRYES+VA LK++L Q  E L+SVT RCQ ELE ++   +E I+ A EERN L  QHQA
Sbjct  1304  KDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQA  1363

Query  1290  ELDGLREALEKKIAEAEAQQLSIE-----------TTLKEQLSQAQEEREKATSKLEEMK  1338
             E++ +RE L+ K+AEA  QQ  +E            TL EQL+Q +E+R+K  SKLEE+K
Sbjct  1364  EMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVK  1423

Query  1339  ITLEEMIGHRNTMRETIAELEKSKSDHELALDKVKAERMQFENLYEKSQEQLQIQLSNME  1398
              TLE+MI     M +TIAELEK+K++ +LA++K+  + ++ E    K+QEQLQ++    +
Sbjct  1424  KTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQLQMESLTRD  1483

Query  1399  QNNLDTQAHSEQLE--------KITELQAQCEQQVQDMEKLSQEKMTLQLEIQEANEHLS  1450
             Q + + +AH ++LE        +I EL+ +C+QQV +++K   EK++L+ EIQ+AN   S
Sbjct  1484  QISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHS  1543

Query  1451  NSLKKCEELELQMNALKTQNVMEKSDLEAKLETFTAKMSDLEEALQKAQLKTLEHDDLIS  1510
              +++K +EL+ +M  L  +N  EK D E KLETFT K++DLEE L++AQ K + +DDL+S
Sbjct  1544  CTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVS  1603

Query  1511  QHERLKICLSEANEVSCNLEKKIECLNSELLTSQEGISNRDDEIKQLRLELKHALDAKDT  1570
             QHERLKICL+EANE+S NL+KK+  L++EL+ SQ+GIS+RD EI +LR ELK A+DAK T
Sbjct  1604  QHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKAT  1663

Query  1571  TRSEQLELVAQLKAVEDKMSTQAGNFQRELTDLKGSMDELQLKLKSLQETKDNLEAGNEE  1630
               +EQ+ LV QLK VE++M+ QA  F RE  +LKGS++EL LKL S+QETKD LE+GNEE
Sbjct  1664  ASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEE  1723

Query  1631  LKLKLRNAQDLQNALEEEQKLCTSLRANIANLEQSKTRLEEQMR---VEVDQRFMEMSRN  1687
             LK +LRN+Q+L+N L+EE K+C SL+  +  LE +KT LE+Q+R    E+ QR  E+++ 
Sbjct  1724  LKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKE  1783

Query  1688  FELSQNTIGELTTKCENLRSQLETETNNFQRKKESLDLIISDLEKEKQELEEKLSILKEK  1747
              EL +N IGELT KCE L S LE             D I  DL+                
Sbjct  1784  VELGRNRIGELTKKCEELCSDLENS-----------DQIRLDLQ----------------  1816

Query  1748  DETIDRLKAQLTSNEATLSSLQEAMEAANNKSLEMGQKVDELSRECEMLRSELQSKEACF  1807
              ET ++LK  L +N                  L   QKVDE++RECE LR ++QSKE   
Sbjct  1817  -ETKEQLKKTLENN------------------LGWQQKVDEVTRECEKLRFDMQSKEV--  1855

Query  1808  QKEKHMSDGTISSLLEDKRGLEKKLCTFNDILSKHEEFTKECENLRSTLKSKDASFRMEK  1867
             Q E                             SK +E   ECE LRSTLKSK+ASF+ EK
Sbjct  1856  QNE-----------------------------SKVQELISECEELRSTLKSKEASFQSEK  1886

Query  1868  ERMDGTISSLLEDKRNLEEKLCTVNDIVTKLQGELTALQAIKGNGSNASFESNASNGSPV  1927
             E MD TISSLLEDKRNLEEKLC+ NDIV KL+ E+ AL+                     
Sbjct  1887  ESMDRTISSLLEDKRNLEEKLCSANDIVAKLETEIAALRP--------------------  1926

Query  1928  NAPARKSLDRNPGASGPRKSLTSETEVRRNRRISVHDERRQSYWNDFRECGTMTDPVDNN  1987
                 RKSLDRNP    PRKS+T E+E+R+NRRISVHDERRQSYWND RE G MTDPVDNN
Sbjct  1927  ----RKSLDRNPV---PRKSITFESEIRKNRRISVHDERRQSYWNDVREFGIMTDPVDNN  1979

Query  1988  CNCAELNARLQECQRDFFICESKVTALNMELKHHPLKDENAQLKRRVLEEQEKARAEQKR  2047
             CNCAELN++LQ+CQR+ FI ES+VTAL MEL HHPLKDENAQL +RV+EEQ+KA+ EQKR
Sbjct  1980  CNCAELNSKLQDCQRELFIRESQVTALKMELDHHPLKDENAQLTKRVIEEQDKAKVEQKR  2039

Query  2048  FKAKLHDLNARINDLTDAAASSAMPIADQQEQAKNSVRPEMVTRDTQTESELEAILEKTN  2107
              K KL DLNARINDLT A+A    P ++Q  QA    +P  V   TQTES+LE ILEKTN
Sbjct  2040  LKMKLQDLNARINDLTTASAKE--PESNQMAQA---AKPATVAAQTQTESDLETILEKTN  2094

Query  2108  TKYQDAVQLLRFRYNLIKELEGKVRQNENNDTSNITSLTAGQNSALKAQCEAQKRELAVI  2167
              KYQ+AV++LR+RY+LI+EL+ K+RQNEN+DTSNITSL+AGQ SALKAQCE+QK+E+  I
Sbjct  2095  VKYQEAVRMLRYRYHLIQELKEKLRQNENSDTSNITSLSAGQTSALKAQCESQKKEILAI  2154

Query  2168  RNKYESAKRVLGMRKDEMDKIRAKLAQYEAGESTK  2202
             + KYE+AKR+L +R D++D +R KLA+YE   S K
Sbjct  2155  KYKYEAAKRILAIRNDDLDALREKLAKYETTTSDK  2189


>M9PCX3_DROME unnamed protein product
Length=2186

 Score = 2573 bits (6668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1393/2315 (60%), Positives = 1684/2315 (73%), Gaps = 242/2315 (10%)

Query  1     MSAKNASSIQVCIKVRPCEPELTSLWQVKEGCSIHLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCEP LTSLWQVKE  SIHLADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDGQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGD QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGMVNVNCEECIITSEDDLLRLLCMGN  180
             DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG+VNVNCEECIITSE DLLRLLC+GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGETNMNERSSRSHAIFRIIIESRKSDRSADDAVIQSVLNLVDLAGSERADQTGAR  240
             KERTVGETNMNERSSRSHAIF+IIIESRKSD S DDAVIQSVLNLVDLAGSERADQTGAR
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  241   GARLKEGGHINKSLLFLSNVIKSLSENVDNKFISFRDSKLTRILQASLGGNAFTSIICTI  300
             GARLKEGGHINKSLLFLSNVIKSLSEN DN+F ++RDSKLTRILQASLGGNAFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKELKDKLAEEERKNES  360
             KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIK LKDKLAEEERKNE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  361   QLKVQDLERRIKSDMHKIISSTSLGDKCRQKRRRTWCPTASGQELDPPESGTANDCLVQF  420
             Q KV+ LER+IK DMHKII   SL DK +QKRRRTWCPTASG  L+  E+GT  D + QF
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQF  420

Query  421   SKMSALPKPTFFPHSNFGRRLGNIPQTINILGSLNISTDGNVDDEQFLPAECVDFGSPGM  480
              K+S LPKP FF  SN G+R  NIP+TINILGSL+I T+ N   E+FLPAEC+DFGSP  
Sbjct  421   PKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPRP  480

Query  481   DVQMARLTSRQLPDLALTPITSQMGP------------------------VICESLQA--  514
             DV    LT RQLPDL LTP     GP                        V CE +Q   
Sbjct  481   DVLKPMLTIRQLPDLPLTP----KGPLTTDKIKKEIQDLQMFTSLEKHFEVECEEVQGLK  536

Query  515   -----------------------------EVTNLTAANQAANSKIHDLEEQLSALKETMT  545
                                          EVT+L A N+AANSKI +LEE+LS LK+TM 
Sbjct  537   EKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRADNEAANSKISELEEKLSTLKQTMR  596

Query  546   ALEVANRDAVSLEFEFEAHKKSSKLRVNELLSVLSEKDLAIEKLRNSLDECNREVLRNSK  605
              +EV N+ AV LEFEFEAHKKSSKLRV++LLS L EK+  IE L+ SLD   R+VLRNSK
Sbjct  597   IMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSK  656

Query  606   EARMRSICQAPEE---SVDGTCNKCEQLE-----------SCECDHLRAEIAATRAKLDS  651
             E  M SI  APE+   + D  CNKCE+LE           SCECD LR EI + R KL+S
Sbjct  657   EGHMLSI--APEQEDIAGDSICNKCEELEKLIADLESKKNSCECDQLRLEIVSVRDKLES  714

Query  652   VQSALSQASSEVYVKTTDCERLSKQISTAQDDFELLQTKYNTLEQQWQGQQLAIEALQSN  711
             V+SA + ASSE+  K TDCERLSK++ST+Q+ F  LQ +Y+ L+QQWQ QQ  I  L   
Sbjct  715   VESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQAGITTLHEK  774

Query  712   HDTIQANYQKLQEEYEHL-GRTSKASEA-------DNSKLQTEIETLKEQVMEAQSMLKD  763
             H+ +Q  YQKLQEEYE L  R   AS A       DN+K Q +I +L E++ EAQ+ML +
Sbjct  775   HEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEEAQNMLTE  834

Query  764   AQVSASLAEEFKAKNQELKAKITDLESNLSEIQSEYDCLSNQLMESVQENDALREELKQR  823
              Q S S  E+ + +N EL AKI +LE+N  E+Q EYDCLSNQLMESVQENDALREE+KQR
Sbjct  835   VQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDALREEIKQR  894

Query  824   PSSFEVDSMKSSGVGTECSEPEHELDLESDLLQQFVQLSESIHQIELQHHSGCSRLFRAI  883
             P+S   +SM+SSG+ ++  E + +++L    L QFVQLSES+ QIELQHHSG SRLFRA 
Sbjct  895   PTSHVEESMRSSGISSDFDEQKQDINL----LHQFVQLSESVQQIELQHHSGISRLFRAN  950

Query  884   NLDRDLEEPGLKLCLESADCIESDSRQLDASDSISLKGSFKRHRFQIRRLTQEQVILEEE  943
              +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+QE V + EE
Sbjct  951   QMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEE  1010

Query  944   RRLLDIISQLEQEVAEKSALMEATEATINEMREQMSSLESALLEKSVIVNKVEDYQRQIE  1003
             +RLLDIISQLEQE+ EKSALMEATEATINEMREQM++LESALLEKSVI+NKVEDYQRQIE
Sbjct  1011  KRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKVEDYQRQIE  1070

Query  1004  SLEKQNAEMTMVYEELQDKVIRESSMSENLLVIPPDDDTLPGVHPSTPGMKDQEPQEVAT  1063
             SLEKQNAEMTMVYEELQD+V RESSMSE+LL +PPD+DTLPG  P++P  ++QE   VAT
Sbjct  1071  SLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGC-PTSPSRREQE---VAT  1126

Query  1064  LKASLAELRTRVCAMQEEIDSQLRQMQLKDENIAKLYTEIEEMSERCLSMEVRMAELEED  1123
             LK S+ EL+++V  ++ E+++ LRQ+QLKD NIA+L T+ EEMSERCLSMEVR+AEL+ED
Sbjct  1127  LKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAELDED  1186

Query  1124  AKQKQELLDCQAQKLSDGVRLIDQLQEKNAQLVQQTTK--------------VEAPSEYV  1169
              KQKQELLD QAQKLSD + LIDQLQ+KNAQLV+Q  K              +   S+Y 
Sbjct  1187  TKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYD  1246

Query  1170  NQIEELRESLRTANEELRDTKRVKEDEINALQLKYMMKMEASESENCAKLRLCSQELEEC  1229
             +QIE+L + L  A +EL D +R+K+DEI+AL++++++++E +E EN AK      EL+E 
Sbjct  1247  SQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF---YAELQET  1303

Query  1230  KDRYESSVAALKDQLTQAGEELASVTARCQTELEGIRGTLQEKINHAEEERNKLNAQHQA  1289
             KDRYES+VA LK++L Q  E L+SVT RCQ ELE ++   +E I+ A EERN L  QHQA
Sbjct  1304  KDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQA  1363

Query  1290  ELDGLREALEKKIAEAEAQQLSIE-----------TTLKEQLSQAQEEREKATSKLEEMK  1338
             E++ +RE L+ K+AEA  QQ  +E            TL EQL+Q +E+R+K  SKLEE+K
Sbjct  1364  EMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVK  1423

Query  1339  ITLEEMIGHRNTMRETIAELEKSKSDHELALDKVKAERMQFENLYEKSQEQLQIQLSNME  1398
              TLE+MI     M +TIAELEK+K++ +LA++K+  + ++ E    K+QEQLQ++    +
Sbjct  1424  KTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQLQMESLTRD  1483

Query  1399  QNNLDTQAHSEQLE--------KITELQAQCEQQVQDMEKLSQEKMTLQLEIQEANEHLS  1450
             Q + + +AH ++LE        +I EL+ +C+QQV +++K   EK++L+ EIQ+AN   S
Sbjct  1484  QISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHS  1543

Query  1451  NSLKKCEELELQMNALKTQNVMEKSDLEAKLETFTAKMSDLEEALQKAQLKTLEHDDLIS  1510
              +++K +EL+ +M  L  +N  EK D E KLETFT K++DLEE L++AQ K + +DDL+S
Sbjct  1544  CTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVS  1603

Query  1511  QHERLKICLSEANEVSCNLEKKIECLNSELLTSQEGISNRDDEIKQLRLELKHALDAKDT  1570
             QHERLKICL+EANE+S NL+KK+  L++EL+ SQ+GIS+RD EI +LR ELK A+DAK T
Sbjct  1604  QHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKAT  1663

Query  1571  TRSEQLELVAQLKAVEDKMSTQAGNFQRELTDLKGSMDELQLKLKSLQETKDNLEAGNEE  1630
               +EQ+ LV QLK VE++M+ QA  F RE  +LKGS++EL LKL S+QETKD LE+GNEE
Sbjct  1664  ASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEE  1723

Query  1631  LKLKLRNAQDLQNALEEEQKLCTSLRANIANLEQSKTRLEEQMR---VEVDQRFMEMSRN  1687
             LK +LRN+Q+L+N L+EE K+C SL+  +  LE +KT LE+Q+R    E+ QR  E+++ 
Sbjct  1724  LKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKE  1783

Query  1688  FELSQNTIGELTTKCENLRSQLETETNNFQRKKESLDLIISDLEKEKQELEEKLSILKEK  1747
              EL +N IGELT KCE L S LE             D I  DL+                
Sbjct  1784  VELGRNRIGELTKKCEELCSDLENS-----------DQIRLDLQ----------------  1816

Query  1748  DETIDRLKAQLTSNEATLSSLQEAMEAANNKSLEMGQKVDELSRECEMLRSELQSKEACF  1807
              ET ++LK  L +N                  L   QKVDE++RECE LR ++QSKE   
Sbjct  1817  -ETKEQLKKTLENN------------------LGWQQKVDEVTRECEKLRFDMQSKEV--  1855

Query  1808  QKEKHMSDGTISSLLEDKRGLEKKLCTFNDILSKHEEFTKECENLRSTLKSKDASFRMEK  1867
             Q E                             SK +E   ECE LRSTL   +ASF+ EK
Sbjct  1856  QNE-----------------------------SKVQELISECEELRSTL---EASFQSEK  1883

Query  1868  ERMDGTISSLLEDKRNLEEKLCTVNDIVTKLQGELTALQAIKGNGSNASFESNASNGSPV  1927
             E MD TISSLLEDKRNLEEKLC+ NDIV KL+ E+ AL+                     
Sbjct  1884  ESMDRTISSLLEDKRNLEEKLCSANDIVAKLETEIAALRP--------------------  1923

Query  1928  NAPARKSLDRNPGASGPRKSLTSETEVRRNRRISVHDERRQSYWNDFRECGTMTDPVDNN  1987
                 RKSLDRNP    PRKS+T E+E+R+NRRISVHDERRQSYWND RE G MTDPVDNN
Sbjct  1924  ----RKSLDRNPV---PRKSITFESEIRKNRRISVHDERRQSYWNDVREFGIMTDPVDNN  1976

Query  1988  CNCAELNARLQECQRDFFICESKVTALNMELKHHPLKDENAQLKRRVLEEQEKARAEQKR  2047
             CNCAELN++LQ+CQR+ FI ES+VTAL MEL HHPLKDENAQL +RV+EEQ+KA+ EQKR
Sbjct  1977  CNCAELNSKLQDCQRELFIRESQVTALKMELDHHPLKDENAQLTKRVIEEQDKAKVEQKR  2036

Query  2048  FKAKLHDLNARINDLTDAAASSAMPIADQQEQAKNSVRPEMVTRDTQTESELEAILEKTN  2107
              K KL DLNARINDLT A+A    P ++Q  QA    +P  V   TQTES+LE ILEKTN
Sbjct  2037  LKMKLQDLNARINDLTTASAKE--PESNQMAQA---AKPATVAAQTQTESDLETILEKTN  2091

Query  2108  TKYQDAVQLLRFRYNLIKELEGKVRQNENNDTSNITSLTAGQNSALKAQCEAQKRELAVI  2167
              KYQ+AV++LR+RY+LI+EL+ K+RQNEN+DTSNITSL+AGQ SALKAQCE+QK+E+  I
Sbjct  2092  VKYQEAVRMLRYRYHLIQELKEKLRQNENSDTSNITSLSAGQTSALKAQCESQKKEILAI  2151

Query  2168  RNKYESAKRVLGMRKDEMDKIRAKLAQYEAGESTK  2202
             + KYE+AKR+L +R D++D +R KLA+YE   S K
Sbjct  2152  KYKYEAAKRILAIRNDDLDALREKLAKYETTTSDK  2186


>Q9NCG0_DROME unnamed protein product
Length=2244

 Score = 2506 bits (6495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1370/2310 (59%), Positives = 1655/2310 (72%), Gaps = 269/2310 (12%)

Query  1     MSAKNASSIQVCIKVRPCEPELTSLWQVKEGCSIHLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCEP LTSLWQVKEG SIHLADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKEGRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDGQNPGVMVLAAKEIFQQISTETDR  120
             DRMA+HIVHACMQGFNGTIFAYGQTSSGKTYTMMGD QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMARHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGMVNVNCEECIITSEDDLLRLLCMGN  180
             DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG+VNVNCEECIITSE DLLRLLC+GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGETNMNERSSRSHAIFRIIIESRKSDRSADDAVIQSVLNLVDLAGSERADQTGAR  240
             KERTVGETNMNERSSRSHAIF+IIIESRKSD S DDAVIQSVLNLVDLAGSERADQTGAR
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  241   GARLKEGGHINKSLLFLSNVIKSLSENVDNKFISFRDSKLTRILQASLGGNAFTSIICTI  300
             GARLKEGGHINKSLLFLSNVIKSLSEN DN+F ++RDSKLTRILQASLGGNAFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKELKDKLAEEERKNES  360
             KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIK LKDKLAEEERKNE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  361   QLKVQDLERRIKSDMHKIISSTSLGDKCRQKRRRTWCPTASGQELDPPESGTANDCLVQF  420
             Q KV+ LER+IK DMHKII   SL DK +QKRRRTWCPTASG  L+  E+GT  D + QF
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTTEDRIDQF  420

Query  421   SKMSALPKPTFFPHSNFGRRLGNIPQTINILGSLNISTDGNVDDEQFLPAECVDFGSPGM  480
              K+S LPKP FF  SN G+R  NIP+TINILGSL+I T+ N   E+FLPAEC+DFGSP  
Sbjct  421   PKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAECIDFGSPRP  480

Query  481   DVQMARLTSRQLPDLALTPITSQMGP------------------------VICESLQA--  514
             DV    LT RQLPDL LTP     GP                        V CE +Q   
Sbjct  481   DVLKPMLTIRQLPDLPLTP----KGPLTTDKIKKEIQDLQMFTSLEKHFEVECEEVQGLK  536

Query  515   -----------------------------EVTNLTAANQAANSKIHDLEEQLSALKETMT  545
                                          EVT+L A N+AANSKI +LEE+LS LK+TM 
Sbjct  537   EKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRADNEAANSKISELEEKLSTLKQTMR  596

Query  546   ALEVANRDAVSLEFEFEAHKKSSKLRVNELLSVLSEKDLAIEKLRNSLDECNREVLRNSK  605
              +EV N+ AV LEFEFEAHKKSSKLRV++LLS L EK+  IE L+ SLD   R+VLRNSK
Sbjct  597   IMEVENQVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTRDVLRNSK  656

Query  606   EARMRSICQAPEE---SVDGTCNKCEQLE-----------SCECDHLRAEIAATRAKLDS  651
             E  M SI  APE+   + D  CNKCE+LE           SCECD LR EI + R KL+S
Sbjct  657   EGHMLSI--APEQEDVAGDSICNKCEELEKLIADLESKKNSCECDQLRLEIVSVRDKLES  714

Query  652   VQSALSQASSEVYVKTTDCERLSKQISTAQDDFELLQTKYNTLEQQWQGQQLAIEALQSN  711
             V+SA + ASS +  K TDCERLSK++ST+Q+ F  LQ +Y+ L+QQWQ QQ  I  L + 
Sbjct  715   VESAFNLASSGIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQAGITTLHNE  774

Query  712   HDTIQANYQKLQEEYEHL-GRTSKASEA-------DNSKLQTEIETLKEQVMEAQSMLKD  763
             H+ +Q  YQKLQEEYE L  R   AS A       DN+K Q +I +L E++ EAQ+ML +
Sbjct  775   HEHVQEIYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLEEAQNMLTE  834

Query  764   AQVSASLAEEFKAKNQELKAKITDLESNLSEIQSEYDCLSNQLMESVQENDALREELKQR  823
              Q S S  E+ + +N EL AKI +LE+N  E+Q EYDCL NQLMESVQENDALREE+KQR
Sbjct  835   VQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLFNQLMESVQENDALREEIKQR  894

Query  824   PSSFEVDSMKSSGVGTECSEPEHELDLESDLLQQFVQLSESIHQIELQHHSGCSRLFRAI  883
             P+S   +SM+SSG+ ++  E + +++L    L QFVQLSES+ QIELQHHSG SRLFRA 
Sbjct  895   PTSHVEESMRSSGISSDFDEQKQDINL----LHQFVQLSESVQQIELQHHSGISRLFRAN  950

Query  884   NLDRDLEEPGLKLCLESADCIESDSRQLDASDSISLKGSFKRHRFQIRRLTQEQVILEEE  943
              +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+QE V + EE
Sbjct  951   QMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQEHVDMGEE  1010

Query  944   RRLLDIISQLEQEVAEKSALMEATEATINEMREQMSSLESALLEKSVIVNKVEDYQRQIE  1003
             +RLLDIISQLEQE+ EKSALMEATEATINEMREQM++LESALLEKSVI+NKVEDYQRQIE
Sbjct  1011  KRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKVEDYQRQIE  1070

Query  1004  SLEKQNAEMTMVYEELQDKVIRESSMSENLLVIPPDDDTLPGVHPSTPGMKDQEPQEVAT  1063
             SLEKQNAEMTMVYEELQD+V RESSMSE+LL +PPD+DTLPG  P++P  ++QE   VAT
Sbjct  1071  SLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGC-PTSPSRREQE---VAT  1126

Query  1064  LKASLAELRTRVCAMQEEIDSQLRQMQLKDENIAKLYTEIEEMSERCLSMEVRMAELEED  1123
             LK S+ EL+++V  +  E+++ LRQ+QLKD NIA+L T+ EEMSERCLSMEVR+AEL+ED
Sbjct  1127  LKTSITELQSQVSDLNAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVRLAELDED  1186

Query  1124  AKQKQELLDCQAQKLSDGVRLIDQLQEKNAQLVQQTTK--------------VEAPSEYV  1169
              KQKQELLD QAQKLSD + LIDQLQ+KNAQLV+Q  K              +   S+Y 
Sbjct  1187  TKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQILLSSQYD  1246

Query  1170  NQIEELRESLRTANEELRDTKRVKEDEINALQLKYMMKMEASESENCAKLRLCSQELEEC  1229
             +QIE+L + L  A +EL D +R+K+DEI+AL++++++++E +E EN AK      EL+E 
Sbjct  1247  SQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF---YAELQET  1303

Query  1230  KDRYESSVAALKDQLTQAGEELASVTARCQTELEGIRGTLQEKINHAEEERNKLNAQHQA  1289
             KDRYES+VA LK++L Q  E L+SVT RCQ ELE ++   +E I+ A EERN L  QHQA
Sbjct  1304  KDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNNLIVQHQA  1363

Query  1290  ELDGLREALEKKIAEAEAQQLSIE-----------TTLKEQLSQAQEEREKATSKLEEMK  1338
             E++ +RE L+ K+AEA  QQ  +E            TL EQL+Q +E+R+K  SKLEE+K
Sbjct  1364  EMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGASKLEEVK  1423

Query  1339  ITLEEMIGHRNTMRETIAELEKSKSDHELALDKVKAERMQFENLYEKSQEQLQIQLSNME  1398
              TLE+MI     M +TIAELEK+K++ +LA++K+  + ++ E    K+QEQLQ++    +
Sbjct  1424  KTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQLQMESLTRD  1483

Query  1399  QNNLDTQAHSEQLE--------KITELQAQCEQQVQDMEKLSQEKMTLQLEIQEANEHLS  1450
             Q + + +AH ++LE        +I EL+ +C+QQV +++K   EK++L+ EIQ+AN   S
Sbjct  1484  QISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSEHS  1543

Query  1451  NSLKKCEELELQMNALKTQNVMEKSDLEAKLETFTAKMSDLEEALQKAQLKTLEHDDLIS  1510
              +++K +EL+ +M  L  +N  EK D E KLETFT K++DLEE L++AQ K + +DDL+S
Sbjct  1544  CTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHKVILYDDLVS  1603

Query  1511  QHERLKICLSEANEVSCNLEKKIECLNSELLTSQEGISNRDDEIKQLRLELKHALDAKDT  1570
             QHERLKICL+EANE+S NL+KK+  L++EL+ SQ+GIS+RD EI +LR ELK A+DAK T
Sbjct  1604  QHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREELKAAMDAKAT  1663

Query  1571  TRSEQLELVAQLKAVEDKMSTQAGNFQRELTDLKGSMDELQLKLKSLQETKDNLEAGNEE  1630
               +EQ+ LV QLK VE++M+ QA  F RE  +LKGS++EL LKL S+QETKD LE+GNEE
Sbjct  1664  ASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETKDMLESGNEE  1723

Query  1631  LKLKLRNAQDLQNALEEEQKLCTSLRANIANLEQSKTRLEEQMR---VEVDQRFMEMSRN  1687
             LK +LRN+Q+L+N L+EE K+C SL+  +  LE +KT LE+Q+R    E+ QR  E+++ 
Sbjct  1724  LKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKE  1783

Query  1688  FELSQNTIGELTTKCENLRSQLETETNNFQRKKESLDLIISDLEKEKQELEEKLSILKEK  1747
              EL +N IGELT KCE L S LE             D I  DL+                
Sbjct  1784  VELGRNRIGELTKKCEELCSDLENS-----------DQIRLDLQ----------------  1816

Query  1748  DETIDRLKAQLTSNEATLSSLQEAMEAANNKSLEMGQKVDELSRECEMLRSELQSKEACF  1807
              ET ++LK  L +N                  L   QKVDE++RECE LR ++QSKE   
Sbjct  1817  -ETKEQLKKTLENN------------------LGWQQKVDEVTRECEKLRFDMQSKEV--  1855

Query  1808  QKEKHMSDGTISSLLEDKRGLEKKLCTFNDILSKHEEFTKECENLRSTLKSKDASFRMEK  1867
             Q E                             SK +E   ECE LRSTLKSK+ASF+ EK
Sbjct  1856  QNE-----------------------------SKVQELISECEELRSTLKSKEASFQSEK  1886

Query  1868  ERMDGTISSLLEDKRNLEEKLCTVNDIVTKLQGELTALQAIKGNGSNASFESNASNGSPV  1927
             E MD TISSLLEDKRNLEEKLC+ NDIV KL+ E+ AL+                     
Sbjct  1887  ESMDRTISSLLEDKRNLEEKLCSANDIVAKLETEIAALRP--------------------  1926

Query  1928  NAPARKSLDRNPGASGPRKSLTSETEVRRNRRISVHDERRQSYWNDFRECGTMTDPVD--  1985
                 RKSLDRNP    PRKS+T E+E+R+NRRISVHDERRQSYWND RE G MTDPV   
Sbjct  1927  ----RKSLDRNPV---PRKSITFESEIRKNRRISVHDERRQSYWNDVREFGIMTDPVGMS  1979

Query  1986  ------------------NNCNCAELNARLQECQRDFFICESKVTALNMELKHHPLKDEN  2027
                               +NCNCAELN++LQ+CQR+ FI ES+VTAL MEL HHPLKDEN
Sbjct  1980  SCSVFPLVFPLNESNFRQHNCNCAELNSKLQDCQRELFIRESQVTALKMELDHHPLKDEN  2039

Query  2028  AQLKRRVLEEQEKARAEQKRFKAKLHDLNARINDLTDAAASSAMPIADQQEQAKNSVRPE  2087
             AQL +RV+EEQ+KA+ EQKR K KL DLNARINDLT A+A    P ++Q  QA    +P 
Sbjct  2040  AQLTKRVIEEQDKAKVEQKRLKMKLQDLNARINDLTTASAKE--PESNQMAQA---AKPA  2094

Query  2088  MVTRDTQTESELEAILEKTNTKYQDAVQLLRFRYNLIKELEGKVRQNENNDTSNITSLTA  2147
              V   TQTES+LE ILEKTN KY++AV++LR+RYNLI+EL+ K+RQNEN+DTSNITSL+A
Sbjct  2095  TVAAQTQTESDLETILEKTNVKYEEAVRMLRYRYNLIQELKEKLRQNENSDTSNITSLSA  2154

Query  2148  GQNSALKAQCEAQKRELAVIRNKYESAKRV  2177
             GQ SALK            I N+Y S+  +
Sbjct  2155  GQTSALK----------VAISNRYSSSSYI  2174



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110308.1 serine protease inhibitor 88Ea [Drosophila elegans]

Length=424
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFC1_DROME  unnamed protein product                                 513     0.0   
SP88E_DROME  unnamed protein product                                  481     2e-169
Q8MPN6_DROME  unnamed protein product                                 158     4e-44 


>Q9VFC1_DROME unnamed protein product
Length=426

 Score = 513 bits (1321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/426 (59%), Positives = 328/426 (77%), Gaps = 2/426 (0%)

Query  1    MHTLSLFLLGILPIIVLAGFGNHDQSLLKNRSRIFEGEREFSITMLKQIRKNYPNGNMFF  60
            MHT SL LL +LP++ +A     + S L   S+IF+GER+FS+ ++KQIR+ YP+GN+FF
Sbjct  1    MHTFSLVLLALLPVVTIAALDKPELSFLNEFSQIFKGERDFSLALMKQIREIYPSGNLFF  60

Query  61   SPYSVYNALLIAFFGSSGATEAQLVNGLNLNWASSKSQVQSAYVVQKKLDEKRAFQNPLE  120
            SP+S YNALL+A+F SS  TE +L   LNL WA +K QV  +Y + ++ DE R  Q+P+E
Sbjct  61   SPFSTYNALLLAYFSSSEQTERELAQALNLGWALNKQQVLVSYTLAQRQDEFRWRQSPME  120

Query  121  LSSANRIFVDKKVEVVQIFKTLLYDEIKQTDFKNQPMKSLQEINDWISNKTYNQIHDILS  180
            LSSANRIFVD+ + V   F TLLY   K+ DFKN P   L+EINDWI++KT+NQI D+LS
Sbjct  121  LSSANRIFVDRTINVSNKFNTLLYGATKELDFKNDPETGLKEINDWIADKTHNQIRDMLS  180

Query  181  ADEITSNTMLVLANAAYMKGQWLSQFKVERTTPKPFYITPNIQEVVPMMRQKGTFKMNIA  240
            ++EIT +TMLVLANAAYMKGQWLSQFKVE T  KPF+I    QE+V MM + G FKM I 
Sbjct  181  SEEITPHTMLVLANAAYMKGQWLSQFKVEETALKPFFINEREQEMVYMMHKTGAFKMTID  240

Query  241  ENLQSQILRLPFRTQYESADKLNATPDDKSDVSMVLILPTSSAVSIDDVITRLDANSLET  300
            E LQSQI++LP+RT Y+S +   +TP+ KSD+SM++ILP S+ +S++ VI+RL+A+S++ 
Sbjct  241  EGLQSQIIKLPYRTIYKSKETHISTPESKSDISMIIILPNSNKISLNRVISRLNADSVKK  300

Query  301  LIENCVPREIELSLPKFQFEQRTGITPILANMGITQMFTGDATFDDLTAEHVSF--DDAQ  358
              E  +P++IELSLPKFQFEQR  +TPIL+ MG+  MFT +ATF DLTA+ +S   DDAQ
Sbjct  301  WFERALPQKIELSLPKFQFEQRLELTPILSLMGVNTMFTRNATFGDLTADPISLVIDDAQ  360

Query  359  HVAKIKVDELGTTAAAATVLFSSRSARPADPNQFNCNHPFLFLIYDHNVKTILFAGVYSD  418
            H+AKIKVDE+G+TAAAAT+L  SRS+R  DP +FNCNHPF+FLIYD  V TILFAGVYSD
Sbjct  361  HLAKIKVDEVGSTAAAATILLVSRSSRQPDPTKFNCNHPFVFLIYDEKVDTILFAGVYSD  420

Query  419  PREMQH  424
            PR+MQH
Sbjct  421  PRQMQH  426


>SP88E_DROME unnamed protein product
Length=427

 Score = 481 bits (1239),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 226/427 (53%), Positives = 323/427 (76%), Gaps = 3/427 (1%)

Query  1    MHTLSLFLLGILPIIVLAGFGN--HDQSLLKNRSRIFEGEREFSITMLKQIRKNYPNGNM  58
            MH LS+ L+ +LP I LAG      D  LL  R  +++G++ F+++ML  IR++ PN N+
Sbjct  1    MHILSISLMAVLPAIALAGLCGVEPDAGLLDQRLNLYKGQQNFAVSMLNVIRQSTPNENV  60

Query  59   FFSPYSVYNALLIAFFGSSGATEAQLVNGLNLNWASSKSQVQSAYVVQKKLDEKRAFQNP  118
            FFSPYS Y+ALL+A+FGSSG TE +L   L+L+WA SK  V+SAY+++K   ++R  + P
Sbjct  61   FFSPYSTYHALLLAYFGSSGDTEKELAKVLHLDWADSKEVVRSAYILEKMNRKERQSKMP  120

Query  119  LELSSANRIFVDKKVEVVQIFKTLLYDEIKQTDFKNQPMKSLQEINDWISNKTYNQIHDI  178
            LE SSA+RIF    + V +  +  L +E++Q DFK+Q  +S ++INDWI+ +T++QI ++
Sbjct  121  LEFSSADRIFFANDLHVTECARNRLAEEVQQIDFKSQTEESRKQINDWIAKQTHDQIRNM  180

Query  179  LSADEITSNTMLVLANAAYMKGQWLSQFKVERTTPKPFYITPNIQEVVPMMRQKGTFKMN  238
            LSADEIT  T LVLANAAY+KGQWLSQFK E+T P PFY +P+   +V MM+QKGTF +N
Sbjct  181  LSADEITPRTRLVLANAAYLKGQWLSQFKTEKTVPMPFYTSPSNYSLVSMMQQKGTFLLN  240

Query  239  IAENLQSQILRLPFRTQYESADKLNATPDDKSDVSMVLILPTSSAVSIDDVITRLDANSL  298
            + E L++ +L+LP+RT +ES +K +++PD+ SD+SMVLILP  ++ S++DV++RL+A+SL
Sbjct  241  VDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMVLILPPFNSNSLEDVLSRLNADSL  300

Query  299  ETLIENCVPREIELSLPKFQFEQRTGITPILANMGITQMFTGD-ATFDDLTAEHVSFDDA  357
            +  ++  +PREIE+SLPKF+FEQR  + PILA MG+++MF    ATFDDLT+E +S  D+
Sbjct  301  DDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMFDESVATFDDLTSETISIGDS  360

Query  358  QHVAKIKVDELGTTAAAATVLFSSRSARPADPNQFNCNHPFLFLIYDHNVKTILFAGVYS  417
            +HVAKIKVDE G+TAAAATVLF+ RSARP +P +F CNHPFLF+IYD   ++ILF G+Y 
Sbjct  361  KHVAKIKVDEEGSTAAAATVLFTYRSARPVEPAKFECNHPFLFVIYDRTSRSILFTGIYR  420

Query  418  DPREMQH  424
            DP+ ++ 
Sbjct  421  DPKTIKQ  427


>Q8MPN6_DROME unnamed protein product
Length=379

 Score = 158 bits (399),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 117/383 (31%), Positives = 192/383 (50%), Gaps = 33/383 (9%)

Query  41   FSITMLKQIRKNYPNGNMFFSPYSVYNALLIAFFGSSGATEAQLVNGLNLNWASSKSQVQ  100
            FSI +  ++    P  N+ FSP+S+     +A  G+   T  QL  GL L  ASS  + Q
Sbjct  16   FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGL--ASSDPE-Q  72

Query  101  SAYVVQKKLDEKRAFQNPLELSSANRIFVDKKVEVVQIFKTLLYDEI----KQTDFKNQP  156
             A+   + L    A+Q+   L  AN+IFV    ++ Q F  LL  +     +  DF ++ 
Sbjct  73   IAHSFHQVL---AAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDF-SKN  128

Query  157  MKSLQEINDWISNKTYNQIHDILSADEITSNTMLVLANAAYMKGQWLSQFKVERTTPKPF  216
            +++   IN+W+  +T + I D++ AD + S + LVL NA + KG W  QF    T P  F
Sbjct  129  VQAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTF  188

Query  217  YITPNIQEVVPMMRQKGTFKMNIAENLQSQILRLPFRTQYESADKLNATPDDKSDVSMVL  276
            ++       VPMM  K  F+      L +  L LP++                SD+SM++
Sbjct  189  HLDGERTVQVPMMSLKERFRYADLPALDAMALELPYK---------------DSDLSMLI  233

Query  277  ILPTSSAVSIDDVITRLDANSLETLIENCVPREIELSLPKFQFEQRTGITPILANMGITQ  336
            +LP +    +  +  +L   +L  + ++    ++ L LP+F+ E +  ++ +   +G+++
Sbjct  234  VLPNTK-TGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQVELSEVFQKLGMSR  292

Query  337  MFTGDATFDDL--TAEHVSFDDAQHVAKIKVDELGTTAAAATVLFSSRSARP---ADPNQ  391
            MF+  A F  +  + E +      H A I+V+E GT AAAAT +F S ++ P    DP +
Sbjct  293  MFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMFMSLTSLPMPKPDPIR  352

Query  392  FNCNHPFLFLIYDHNVKTILFAG  414
            FN +HPF F I + +  T LFAG
Sbjct  353  FNVDHPFTFYILNKD-STALFAG  374



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110309.1 protein abrupt isoform X1 [Drosophila elegans]

Length=922
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABRU_DROME  unnamed protein product                                   1335    0.0  
LOLAL_DROME  unnamed protein product                                  155     5e-44
BRC1_DROME  unnamed protein product                                   159     3e-40


>ABRU_DROME unnamed protein product
Length=904

 Score = 1335 bits (3454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/926 (89%), Positives = 867/926 (94%), Gaps = 26/926 (3%)

Query  1    MTESTQLQTAENNNAGVVKMEPPPPVTSSVSVSAAAAAHALSSLSSLSMAATGSALSPAT  60
            MTESTQLQTAENNNAGVVKMEPPPP TSSVSVSAAAAAHALSSLSSL+MAATGSALSPAT
Sbjct  1    MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMAATGSALSPAT  60

Query  61   PPPSLNHSHQQQHSQQQQQQQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF  120
            PPPSLN S       QQQQ QQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF
Sbjct  61   PPPSLNLS------HQQQQHQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF  114

Query  121  TAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDF  180
            TAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDF
Sbjct  115  TAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDF  174

Query  181  LKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSSSNNNSNSNSLSNNNNNNNNAESSNH  240
            LKTAHLLQIRGLADVNGGYPYSKALSAALSHNSS++NNN++S++ S +NNNNNN  ++  
Sbjct  175  LKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSNNNNNNSSSNNSLSNNNNNNNNNAES  234

Query  241  N---KISSYLPPNQTSAPSNNNGSSSNNHSSSSNSNNNNSSNNNNNNNLSGSLNSSLNSP  297
            +   KISSYL PNQTSA       + NN S+S+++N+++S NN+++NN+SGSLNSSLNSP
Sbjct  235  SNHNKISSYLSPNQTSA-------ACNNSSNSNSNNHSSSHNNSSSNNISGSLNSSLNSP  287

Query  298  FSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATVSGSSSASGQSGG-TSVTPAIQEL  356
            FSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAAT + + S+S  + G TS TPAIQEL
Sbjct  288  FSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTPAIQEL  347

Query  357  KASSAASPVRNPNQTPNPGKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGI  416
            KASSAASPVRNPN  PNP KASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGI
Sbjct  348  KASSAASPVRNPN--PNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGI  405

Query  417  SPERLLLDREFPVAGQHPLTRNRGGRDTSKDRERNMELRESLLGQALENSNGQQANQKHD  476
            SPERLLLDREFPVAGQHPLTRNR GRDTSKDRERN+ELRESLLGQALENSNGQQAN KH+
Sbjct  406  SPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANPKHE  465

Query  477  LGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGIN  536
            LGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGIN
Sbjct  466  LGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGIN  525

Query  537  SDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSR  596
            SDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSR
Sbjct  526  SDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSR  585

Query  597  NSLHSHMSRQHRGISTKDLPVLPMPSAFDPDLASRLLAKAGVKISPAELRARASPTGGSG  656
            NSLHSHMSRQHRGISTKDLPVLPMPSAFDP+LASRLLAKAGVKISPAELRARASPTGGSG
Sbjct  586  NSLHSHMSRQHRGISTKDLPVLPMPSAFDPELASRLLAKAGVKISPAELRARASPTGGSG  645

Query  657  GSSGGGGSGGGGGGSGQAKLDLSNASGGALDDAEDSDEDPEDLTTGNGLYGMGGSSSDLS  716
             S GGGG      GS QAKLDLSNASGG +DDAEDSD+DPEDLTTGNGLYGMGGSSSDLS
Sbjct  646  SSGGGGGG-----GSSQAKLDLSNASGGPMDDAEDSDDDPEDLTTGNGLYGMGGSSSDLS  700

Query  717  RYHESLLSNFGHARMRNEAAAAAATAAALGQPKDLGVQMPNSNAAGQSLLDTYLQFITEN  776
            RYHESLLSNFGHARMRNEAAA AATAAALGQPKDLGVQ+PNSNA GQSLLDTYLQFITEN
Sbjct  701  RYHESLLSNFGHARMRNEAAAVAATAAALGQPKDLGVQLPNSNAPGQSLLDTYLQFITEN  760

Query  777  TFGMGMSQEQAAAAALRAKMAQLNAMGHSLDSLPPGLMPGQFDLSKLAAGNPAFGQSGPG  836
            TFGMGMSQEQAAAAALRAKMAQLNAMGHSLD+LPPGL+PGQFDLSKLAAGNPAFGQSGPG
Sbjct  761  TFGMGMSQEQAAAAALRAKMAQLNAMGHSLDNLPPGLLPGQFDLSKLAAGNPAFGQSGPG  820

Query  837  LTIEPILRHDQAAGSLSPNAHRPLALNSGGRMLGHEEMADHEGDSRRDGSEPMDLGLDIN  896
            LTIEPI+RH+QAAG+LSPN  RPLALNSGGRM+GH+EMA+++GD RR+GSEPMDLGLD N
Sbjct  821  LTIEPIMRHEQAAGNLSPN--RPLALNSGGRMMGHDEMAENDGDMRREGSEPMDLGLDNN  878

Query  897  QSGSNHEVANSDAEENYSEDEGVHNT  922
            QSGSNHEVANSDAEENYSEDEGVHNT
Sbjct  879  QSGSNHEVANSDAEENYSEDEGVHNT  904


>LOLAL_DROME unnamed protein product
Length=127

 Score = 155 bits (392),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 69/113 (61%), Positives = 92/113 (81%), Gaps = 0/113 (0%)

Query  82   QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKAN  141
            Q + LKWNDFQ+++++SFRHLRDE+ F DVTLAC+ ++  AHK+VLSACSPYF+ LL+ N
Sbjct  6    QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN  65

Query  142  PCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLAD  194
            P +HPI+IL+DV    ++ +L FMY GEVNVS EQLP FLKTA  L+++GLA+
Sbjct  66   PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE  118


>BRC1_DROME unnamed protein product
Length=727

 Score = 159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%), Gaps = 0/111 (0%)

Query  82   QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKAN  141
            QH+ L+WN++QSSI S+F +LRD+E FVDVTLAC+ RS  AH+VVLSACSPYFR LLK+ 
Sbjct  5    QHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKST  64

Query  142  PCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGL  192
            PC+HP+++L+DV   D+  L+ F+Y+GEVNV  + L  FLKTA +L++ GL
Sbjct  65   PCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGL  115


 Score = 31.2 bits (69),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 5/57 (9%)

Query  557  CPKCGKIYRSAHTLRTHLEDKH---TVCPGYRCVLCGTVAKSRNSLHSHMSRQHRGI  610
            C  C K   S   L+ H+++ H   T  P   C +C  V  S NSL +H S  HR +
Sbjct  638  CNPCNKNLSSLTRLKRHIQNVHMRPTKEP--VCNICKRVYSSLNSLRNHKSIYHRNL  692



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110310.1 protein abrupt isoform X1 [Drosophila elegans]

Length=922
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ABRU_DROME  unnamed protein product                                   1335    0.0  
LOLAL_DROME  unnamed protein product                                  155     5e-44
BRC1_DROME  unnamed protein product                                   159     3e-40


>ABRU_DROME unnamed protein product
Length=904

 Score = 1335 bits (3454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 823/926 (89%), Positives = 867/926 (94%), Gaps = 26/926 (3%)

Query  1    MTESTQLQTAENNNAGVVKMEPPPPVTSSVSVSAAAAAHALSSLSSLSMAATGSALSPAT  60
            MTESTQLQTAENNNAGVVKMEPPPP TSSVSVSAAAAAHALSSLSSL+MAATGSALSPAT
Sbjct  1    MTESTQLQTAENNNAGVVKMEPPPPATSSVSVSAAAAAHALSSLSSLTMAATGSALSPAT  60

Query  61   PPPSLNHSHQQQHSQQQQQQQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF  120
            PPPSLN S       QQQQ QQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF
Sbjct  61   PPPSLNLS------HQQQQHQQHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSF  114

Query  121  TAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDF  180
            TAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDF
Sbjct  115  TAHKVVLSACSPYFRRLLKANPCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDF  174

Query  181  LKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSSSNNNSNSNSLSNNNNNNNNAESSNH  240
            LKTAHLLQIRGLADVNGGYPYSKALSAALSHNSS++NNN++S++ S +NNNNNN  ++  
Sbjct  175  LKTAHLLQIRGLADVNGGYPYSKALSAALSHNSSNNNNNNSSSNNSLSNNNNNNNNNAES  234

Query  241  N---KISSYLPPNQTSAPSNNNGSSSNNHSSSSNSNNNNSSNNNNNNNLSGSLNSSLNSP  297
            +   KISSYL PNQTSA       + NN S+S+++N+++S NN+++NN+SGSLNSSLNSP
Sbjct  235  SNHNKISSYLSPNQTSA-------ACNNSSNSNSNNHSSSHNNSSSNNISGSLNSSLNSP  287

Query  298  FSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATVSGSSSASGQSGG-TSVTPAIQEL  356
            FSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAAT + + S+S  + G TS TPAIQEL
Sbjct  288  FSAPQIPPPVTASSAAAAAAAAASLTAAVAAAAAATAASAGSSSSAASGQTSGTPAIQEL  347

Query  357  KASSAASPVRNPNQTPNPGKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGI  416
            KASSAASPVRNPN  PNP KASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGI
Sbjct  348  KASSAASPVRNPN--PNPSKASSSNHWDMGEMEGSRKSHLTPPPQKRIKSADLFRAQHGI  405

Query  417  SPERLLLDREFPVAGQHPLTRNRGGRDTSKDRERNMELRESLLGQALENSNGQQANQKHD  476
            SPERLLLDREFPVAGQHPLTRNR GRDTSKDRERN+ELRESLLGQALENSNGQQAN KH+
Sbjct  406  SPERLLLDREFPVAGQHPLTRNRSGRDTSKDRERNLELRESLLGQALENSNGQQANPKHE  465

Query  477  LGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGIN  536
            LGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGIN
Sbjct  466  LGQSAGEDSNSSDTEPSDRGDGQHDGTLDGIDNQRSHSFPNAFLGLQGIPGLLPGPSGIN  525

Query  537  SDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSR  596
            SDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSR
Sbjct  526  SDFVSRRSLEMRVRATDPRPCPKCGKIYRSAHTLRTHLEDKHTVCPGYRCVLCGTVAKSR  585

Query  597  NSLHSHMSRQHRGISTKDLPVLPMPSAFDPDLASRLLAKAGVKISPAELRARASPTGGSG  656
            NSLHSHMSRQHRGISTKDLPVLPMPSAFDP+LASRLLAKAGVKISPAELRARASPTGGSG
Sbjct  586  NSLHSHMSRQHRGISTKDLPVLPMPSAFDPELASRLLAKAGVKISPAELRARASPTGGSG  645

Query  657  GSSGGGGSGGGGGGSGQAKLDLSNASGGALDDAEDSDEDPEDLTTGNGLYGMGGSSSDLS  716
             S GGGG      GS QAKLDLSNASGG +DDAEDSD+DPEDLTTGNGLYGMGGSSSDLS
Sbjct  646  SSGGGGGG-----GSSQAKLDLSNASGGPMDDAEDSDDDPEDLTTGNGLYGMGGSSSDLS  700

Query  717  RYHESLLSNFGHARMRNEAAAAAATAAALGQPKDLGVQMPNSNAAGQSLLDTYLQFITEN  776
            RYHESLLSNFGHARMRNEAAA AATAAALGQPKDLGVQ+PNSNA GQSLLDTYLQFITEN
Sbjct  701  RYHESLLSNFGHARMRNEAAAVAATAAALGQPKDLGVQLPNSNAPGQSLLDTYLQFITEN  760

Query  777  TFGMGMSQEQAAAAALRAKMAQLNAMGHSLDSLPPGLMPGQFDLSKLAAGNPAFGQSGPG  836
            TFGMGMSQEQAAAAALRAKMAQLNAMGHSLD+LPPGL+PGQFDLSKLAAGNPAFGQSGPG
Sbjct  761  TFGMGMSQEQAAAAALRAKMAQLNAMGHSLDNLPPGLLPGQFDLSKLAAGNPAFGQSGPG  820

Query  837  LTIEPILRHDQAAGSLSPNAHRPLALNSGGRMLGHEEMADHEGDSRRDGSEPMDLGLDIN  896
            LTIEPI+RH+QAAG+LSPN  RPLALNSGGRM+GH+EMA+++GD RR+GSEPMDLGLD N
Sbjct  821  LTIEPIMRHEQAAGNLSPN--RPLALNSGGRMMGHDEMAENDGDMRREGSEPMDLGLDNN  878

Query  897  QSGSNHEVANSDAEENYSEDEGVHNT  922
            QSGSNHEVANSDAEENYSEDEGVHNT
Sbjct  879  QSGSNHEVANSDAEENYSEDEGVHNT  904


>LOLAL_DROME unnamed protein product
Length=127

 Score = 155 bits (392),  Expect = 5e-44, Method: Composition-based stats.
 Identities = 69/113 (61%), Positives = 92/113 (81%), Gaps = 0/113 (0%)

Query  82   QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKAN  141
            Q + LKWNDFQ+++++SFRHLRDE+ F DVTLAC+ ++  AHK+VLSACSPYF+ LL+ N
Sbjct  6    QQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMVLSACSPYFKALLEEN  65

Query  142  PCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGLAD  194
            P +HPI+IL+DV    ++ +L FMY GEVNVS EQLP FLKTA  L+++GLA+
Sbjct  66   PSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQLPAFLKTADRLKVKGLAE  118


>BRC1_DROME unnamed protein product
Length=727

 Score = 159 bits (403),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%), Gaps = 0/111 (0%)

Query  82   QHYALKWNDFQSSILSSFRHLRDEEDFVDVTLACDERSFTAHKVVLSACSPYFRRLLKAN  141
            QH+ L+WN++QSSI S+F +LRD+E FVDVTLAC+ RS  AH+VVLSACSPYFR LLK+ 
Sbjct  5    QHFCLRWNNYQSSITSAFENLRDDEAFVDVTLACEGRSIKAHRVVLSACSPYFRELLKST  64

Query  142  PCEHPIVILRDVRCDDVENLLSFMYNGEVNVSHEQLPDFLKTAHLLQIRGL  192
            PC+HP+++L+DV   D+  L+ F+Y+GEVNV  + L  FLKTA +L++ GL
Sbjct  65   PCKHPVILLQDVNFMDLHALVEFIYHGEVNVHQKSLQSFLKTAEVLRVSGL  115


 Score = 31.2 bits (69),  Expect = 5.6, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 5/57 (9%)

Query  557  CPKCGKIYRSAHTLRTHLEDKH---TVCPGYRCVLCGTVAKSRNSLHSHMSRQHRGI  610
            C  C K   S   L+ H+++ H   T  P   C +C  V  S NSL +H S  HR +
Sbjct  638  CNPCNKNLSSLTRLKRHIQNVHMRPTKEP--VCNICKRVYSSLNSLRNHKSIYHRNL  692



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110312.1 pneumococcal serine-rich repeat protein [Drosophila
elegans]

Length=957
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKL0_DROME  unnamed protein product                                 873     0.0  
A0MSJ4_DROME  unnamed protein product                                 825     0.0  
M9PB98_DROME  unnamed protein product                                 708     0.0  


>Q9VKL0_DROME unnamed protein product
Length=968

 Score = 873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 763/993 (77%), Positives = 821/993 (83%), Gaps = 61/993 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSS   N+ 
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNH  234

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGG---  293
             S QP    +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RG GGG    
Sbjct  235  QSSQPS---LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGG  291

Query  294  VSPSQQQQQSQQQQQQ----RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
            VSPS QQQQ QQQQ      RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  292  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  351

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  352  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  411

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SAP+SALK+A
Sbjct  412  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTA  471

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            SSS+ S     T+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  472  SSSTGS-----TTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  526

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  527  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  586

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  587  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  646

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAPIGGGGSSIAS  695
            AQLQQQQQQQQQQ Q+QQQQQ QH        ASRQSSPRSTNDS+TVAPIG GG   + 
Sbjct  647  AQLQQQQQQQQQQHQRQQQQQSQH--------ASRQSSPRSTNDSTTVAPIGDGGGGSSI  698

Query  696  AA--PLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            A+  PLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  699  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  758

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GT +G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  759  ATLGTRSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  818

Query  814  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  873
            SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA
Sbjct  819  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  878

Query  874  LQ---------TGGAASATPAATTAAAAAAATTSCSIKSEIFNGGSNGSSSSNNSNSNSN  924
            LQ             A     A   A A +ATTSCSIKSEIFNGGSNGSSS ++SN  S+
Sbjct  879  LQTGGAAAATGATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSD  938

Query  925  QGSDIAATPATASSPSSNMLLPVLPCSGLHDAS  957
                 A   ATASSPSSNMLLPVLPCSGL DAS
Sbjct  939  VA---APPAATASSPSSNMLLPVLPCSGLQDAS  968


>A0MSJ4_DROME unnamed protein product
Length=965

 Score = 825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/993 (75%), Positives = 809/993 (81%), Gaps = 64/993 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVT   +NNNN    NN++SSSSSI NNHQ
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVT--IHNNNNNNTINNNNSSSSSIINNHQ  232

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGGVSP  296
            SSQ      +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RGGGGG    
Sbjct  233  SSQP----SLGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGGGGGAGGG  288

Query  297  SQQQQQSQQQQQQ-------RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
                 Q QQQQQQ       RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  289  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  348

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  349  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  408

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SA      S+
Sbjct  409  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSA-----PSS  463

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            +  S S+S  ST+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  464  ALKSASSSTGSTTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  523

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  524  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  583

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  584  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  643

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAPIGGGGSSIAS  695
            AQLQQQQQQQQQQ Q+QQQQQ QH        ASRQSSPRSTNDS+TVAPIG GG   + 
Sbjct  644  AQLQQQQQQQQQQHQRQQQQQSQH--------ASRQSSPRSTNDSTTVAPIGDGGGGSSI  695

Query  696  AA--PLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            A+  PLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  696  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  755

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GTG+G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  756  ATLGTGSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  815

Query  814  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  873
            SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA
Sbjct  816  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  875

Query  874  LQ---------TGGAASATPAATTAAAAAAATTSCSIKSEIFNGGSNGSSSSNNSNSNSN  924
            LQ             A     A   A A +ATTSCSIKSEIFNGGSNGSSS ++SN  S+
Sbjct  876  LQTGGAAAAAAATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSD  935

Query  925  QGSDIAATPATASSPSSNMLLPVLPCSGLHDAS  957
              +      ATASSPSSNMLLPVLPCSGL DAS
Sbjct  936  VAA---PPAATASSPSSNMLLPVLPCSGLQDAS  965


>M9PB98_DROME unnamed protein product
Length=846

 Score = 708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/845 (78%), Positives = 709/845 (84%), Gaps = 49/845 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSS   N+ 
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNH  234

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGG---  293
             S QP    +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RG GGG    
Sbjct  235  QSSQPS---LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGG  291

Query  294  VSPSQQQQQSQQQQQQ----RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
            VSPS QQQQ QQQQ      RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  292  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  351

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  352  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  411

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SAP+SALK+A
Sbjct  412  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTA  471

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            SSS+ S     T+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  472  SSSTGS-----TTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  526

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  527  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  586

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  587  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  646

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAP--IGGGGSSI  693
            AQLQQQQQQQQQQ Q+QQQQQ Q        HASRQSSPRSTNDS+TVAP   GGGGSSI
Sbjct  647  AQLQQQQQQQQQQHQRQQQQQSQ--------HASRQSSPRSTNDSTTVAPIGDGGGGSSI  698

Query  694  ASAAPLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            ASAAPLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  699  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  758

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GT +G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  759  ATLGTRSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  818

Query  814  SFRDQ  818
              + +
Sbjct  819  LIKQE  823



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


Query= XP_017110313.1 pneumococcal serine-rich repeat protein [Drosophila
elegans]

Length=957
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKL0_DROME  unnamed protein product                                 873     0.0  
A0MSJ4_DROME  unnamed protein product                                 825     0.0  
M9PB98_DROME  unnamed protein product                                 708     0.0  


>Q9VKL0_DROME unnamed protein product
Length=968

 Score = 873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 763/993 (77%), Positives = 821/993 (83%), Gaps = 61/993 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSS   N+ 
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNH  234

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGG---  293
             S QP    +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RG GGG    
Sbjct  235  QSSQPS---LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGG  291

Query  294  VSPSQQQQQSQQQQQQ----RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
            VSPS QQQQ QQQQ      RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  292  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  351

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  352  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  411

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SAP+SALK+A
Sbjct  412  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTA  471

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            SSS+ S     T+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  472  SSSTGS-----TTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  526

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  527  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  586

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  587  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  646

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAPIGGGGSSIAS  695
            AQLQQQQQQQQQQ Q+QQQQQ QH        ASRQSSPRSTNDS+TVAPIG GG   + 
Sbjct  647  AQLQQQQQQQQQQHQRQQQQQSQH--------ASRQSSPRSTNDSTTVAPIGDGGGGSSI  698

Query  696  AA--PLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            A+  PLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  699  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  758

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GT +G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  759  ATLGTRSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  818

Query  814  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  873
            SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA
Sbjct  819  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  878

Query  874  LQ---------TGGAASATPAATTAAAAAAATTSCSIKSEIFNGGSNGSSSSNNSNSNSN  924
            LQ             A     A   A A +ATTSCSIKSEIFNGGSNGSSS ++SN  S+
Sbjct  879  LQTGGAAAATGATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSD  938

Query  925  QGSDIAATPATASSPSSNMLLPVLPCSGLHDAS  957
                 A   ATASSPSSNMLLPVLPCSGL DAS
Sbjct  939  VA---APPAATASSPSSNMLLPVLPCSGLQDAS  968


>A0MSJ4_DROME unnamed protein product
Length=965

 Score = 825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/993 (75%), Positives = 809/993 (81%), Gaps = 64/993 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVT   +NNNN    NN++SSSSSI NNHQ
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVT--IHNNNNNNTINNNNSSSSSIINNHQ  232

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGGVSP  296
            SSQ      +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RGGGGG    
Sbjct  233  SSQP----SLGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGGGGGAGGG  288

Query  297  SQQQQQSQQQQQQ-------RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
                 Q QQQQQQ       RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  289  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  348

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  349  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  408

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SA      S+
Sbjct  409  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSA-----PSS  463

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            +  S S+S  ST+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  464  ALKSASSSTGSTTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  523

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  524  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  583

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  584  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  643

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAPIGGGGSSIAS  695
            AQLQQQQQQQQQQ Q+QQQQQ QH        ASRQSSPRSTNDS+TVAPIG GG   + 
Sbjct  644  AQLQQQQQQQQQQHQRQQQQQSQH--------ASRQSSPRSTNDSTTVAPIGDGGGGSSI  695

Query  696  AA--PLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            A+  PLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  696  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  755

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GTG+G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  756  ATLGTGSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  815

Query  814  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  873
            SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA
Sbjct  816  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  875

Query  874  LQ---------TGGAASATPAATTAAAAAAATTSCSIKSEIFNGGSNGSSSSNNSNSNSN  924
            LQ             A     A   A A +ATTSCSIKSEIFNGGSNGSSS ++SN  S+
Sbjct  876  LQTGGAAAAAAATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSD  935

Query  925  QGSDIAATPATASSPSSNMLLPVLPCSGLHDAS  957
              +      ATASSPSSNMLLPVLPCSGL DAS
Sbjct  936  VAA---PPAATASSPSSNMLLPVLPCSGLQDAS  965


>M9PB98_DROME unnamed protein product
Length=846

 Score = 708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/845 (78%), Positives = 709/845 (84%), Gaps = 49/845 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSS   N+ 
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNH  234

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGG---  293
             S QP    +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RG GGG    
Sbjct  235  QSSQPS---LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGG  291

Query  294  VSPSQQQQQSQQQQQQ----RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
            VSPS QQQQ QQQQ      RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  292  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  351

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  352  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  411

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SAP+SALK+A
Sbjct  412  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTA  471

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            SSS+ S     T+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  472  SSSTGS-----TTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  526

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  527  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  586

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  587  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  646

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAP--IGGGGSSI  693
            AQLQQQQQQQQQQ Q+QQQQQ Q        HASRQSSPRSTNDS+TVAP   GGGGSSI
Sbjct  647  AQLQQQQQQQQQQHQRQQQQQSQ--------HASRQSSPRSTNDSTTVAPIGDGGGGSSI  698

Query  694  ASAAPLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            ASAAPLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  699  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  758

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GT +G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  759  ATLGTRSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  818

Query  814  SFRDQ  818
              + +
Sbjct  819  LIKQE  823



Lambda      K        H
   0.311    0.130    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10178380646


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110314.1 pneumococcal serine-rich repeat protein [Drosophila
elegans]

Length=957
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKL0_DROME  unnamed protein product                                 873     0.0  
A0MSJ4_DROME  unnamed protein product                                 825     0.0  
M9PB98_DROME  unnamed protein product                                 708     0.0  


>Q9VKL0_DROME unnamed protein product
Length=968

 Score = 873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 763/993 (77%), Positives = 821/993 (83%), Gaps = 61/993 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSS   N+ 
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNH  234

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGG---  293
             S QP    +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RG GGG    
Sbjct  235  QSSQPS---LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGG  291

Query  294  VSPSQQQQQSQQQQQQ----RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
            VSPS QQQQ QQQQ      RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  292  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  351

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  352  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  411

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SAP+SALK+A
Sbjct  412  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTA  471

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            SSS+ S     T+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  472  SSSTGS-----TTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  526

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  527  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  586

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  587  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  646

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAPIGGGGSSIAS  695
            AQLQQQQQQQQQQ Q+QQQQQ QH        ASRQSSPRSTNDS+TVAPIG GG   + 
Sbjct  647  AQLQQQQQQQQQQHQRQQQQQSQH--------ASRQSSPRSTNDSTTVAPIGDGGGGSSI  698

Query  696  AA--PLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            A+  PLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  699  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  758

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GT +G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  759  ATLGTRSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  818

Query  814  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  873
            SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA
Sbjct  819  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  878

Query  874  LQ---------TGGAASATPAATTAAAAAAATTSCSIKSEIFNGGSNGSSSSNNSNSNSN  924
            LQ             A     A   A A +ATTSCSIKSEIFNGGSNGSSS ++SN  S+
Sbjct  879  LQTGGAAAATGATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSD  938

Query  925  QGSDIAATPATASSPSSNMLLPVLPCSGLHDAS  957
                 A   ATASSPSSNMLLPVLPCSGL DAS
Sbjct  939  VA---APPAATASSPSSNMLLPVLPCSGLQDAS  968


>A0MSJ4_DROME unnamed protein product
Length=965

 Score = 825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 748/993 (75%), Positives = 809/993 (81%), Gaps = 64/993 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVT   +NNNN    NN++SSSSSI NNHQ
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVT--IHNNNNNNTINNNNSSSSSIINNHQ  232

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGGVSP  296
            SSQ      +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RGGGGG    
Sbjct  233  SSQP----SLGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGGGGGAGGG  288

Query  297  SQQQQQSQQQQQQ-------RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
                 Q QQQQQQ       RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  289  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  348

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  349  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  408

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SA      S+
Sbjct  409  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSA-----PSS  463

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            +  S S+S  ST+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  464  ALKSASSSTGSTTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  523

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  524  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  583

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  584  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  643

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAPIGGGGSSIAS  695
            AQLQQQQQQQQQQ Q+QQQQQ QH        ASRQSSPRSTNDS+TVAPIG GG   + 
Sbjct  644  AQLQQQQQQQQQQHQRQQQQQSQH--------ASRQSSPRSTNDSTTVAPIGDGGGGSSI  695

Query  696  AA--PLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            A+  PLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  696  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  755

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GTG+G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  756  ATLGTGSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  815

Query  814  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  873
            SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA
Sbjct  816  SFRDQSIDGTGLPLLTEDHLVNSLGMKLGPALKLRSILAKKLGGPCPCVACVAQAQQMLA  875

Query  874  LQ---------TGGAASATPAATTAAAAAAATTSCSIKSEIFNGGSNGSSSSNNSNSNSN  924
            LQ             A     A   A A +ATTSCSIKSEIFNGGSNGSSS ++SN  S+
Sbjct  876  LQTGGAAAAAAATAGAGTVTGAVAGAGATSATTSCSIKSEIFNGGSNGSSSGSSSNQGSD  935

Query  925  QGSDIAATPATASSPSSNMLLPVLPCSGLHDAS  957
              +      ATASSPSSNMLLPVLPCSGL DAS
Sbjct  936  VAA---PPAATASSPSSNMLLPVLPCSGLQDAS  965


>M9PB98_DROME unnamed protein product
Length=846

 Score = 708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/845 (78%), Positives = 709/845 (84%), Gaps = 49/845 (6%)

Query  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQQAATTATA  60
            MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQ+AATTA+ 
Sbjct  1    MKEIDTETTVVWPAWCYSGNAPTDILQQKPAKATTAIVGGRSAAQPATHDDQEAATTAST  60

Query  61   T-KRKHLERLASDLRQLGQKGRRS-SESPVSSYPSIAATAKMLSERSLLLSGYGAIESNA  118
              KRKHLERLASDLRQLG+KGRRS S SP S YP++A TA+MLSERSLLLSGYGAIES+A
Sbjct  61   ATKRKHLERLASDLRQLGKKGRRSRSVSPCSRYPAVAETARMLSERSLLLSGYGAIESSA  120

Query  119  KKLSEAATGGAGGGVAVSQAAT--PSLGAPASAASSSSSSSSSASSAGNTACTANANTAS  176
            KKLSEAATGGAGGG   +      P+    ++ ASS+SSSS S+SSAG+T CT NANTAS
Sbjct  121  KKLSEAATGGAGGGGGGAAGQAATPTTSQLSAPASSASSSSMSSSSAGST-CTTNANTAS  179

Query  177  VAAAYAALYLEKVKHEKLSPLQMDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSISNNHQ  236
            VAAAYAA YLEKVKHEK     MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSS   N+ 
Sbjct  180  VAAAYAAFYLEKVKHEK-----MDNHKDAPMVTIHNNNNNNTINNNNSSSSSSSSIINNH  234

Query  237  SSQQPHPHHMGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSFRGGGGGG---  293
             S QP    +GHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSS+RG GGG    
Sbjct  235  QSSQPS---LGHSVKRERLSPGSNSSSHNGELTVSSFARSRSATPSSSSYRGAGGGAGGG  291

Query  294  VSPSQQQQQSQQQQQQ----RLSPPSGPATATTTTTATSSSSSTAAAT---------HMP  340
            VSPS QQQQ QQQQ      RLSPPSGP+ AT TTT++ SSSS+A+A+         HMP
Sbjct  292  VSPSHQQQQQQQQQSLQQQQRLSPPSGPSMATATTTSSLSSSSSASASASASASAATHMP  351

Query  341  LHNLSTNLLNSIQQAAASQ---QHRNSSSSNSNSHSSNTAKTEAAAASNATDFSTRNYSD  397
            LHNLSTNLLNSIQQAAASQ   +  NS+SS++ S SSN  K++  AASNATDFSTRNYSD
Sbjct  352  LHNLSTNLLNSIQQAAASQQQLRSSNSNSSSNISGSSNNTKSDGGAASNATDFSTRNYSD  411

Query  398  IMRCLAAKYNNTNPNDNNATRRNSYYDSSNSGSSSTATGSGGGAAGGGATSAPTSALKSA  457
            IMRCLAAKYNN NPNDNNATRRNSYYD S S +++T    GGG   GG+ SAP+SALK+A
Sbjct  412  IMRCLAAKYNNANPNDNNATRRNSYYDGSTSATTATGGAGGGGGGAGGSNSAPSSALKTA  471

Query  458  SSSSTSNSGTSTSATAKKLSPSASSAANAAAVSLPKEAKVSGAGGAGVGGAASTGGGSS-  516
            SSS+ S     T+ TAKKLSPSA+SAAN+AAVSL KE+KVS  GGAGVGGA ++ GG   
Sbjct  472  SSSTGS-----TTTTAKKLSPSAASAANSAAVSLSKESKVSAVGGAGVGGAVASSGGGGS  526

Query  517  -LSQLAPPPAAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIYPPLIDMSSTQALLT  575
             +SQLAPPP APSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGI+PPLIDMSSTQALLT
Sbjct  527  SMSQLAPPPTAPSPTEQAKSQMAAVVAAASVSPFMTNFLPFSSGIFPPLIDMSSTQALLT  586

Query  576  LARAVKDAEIQEILRSKQQRSGSNASSPSASATGTPRSSSTLNAALHQAAQFVTPALIYS  635
            LARAVKDAEIQEILRSKQQRSGSNASSPSASA GTPRSSSTLNAALHQAAQFVTPALIYS
Sbjct  587  LARAVKDAEIQEILRSKQQRSGSNASSPSASAAGTPRSSSTLNAALHQAAQFVTPALIYS  646

Query  636  AQLQQQQQQQQQQQQQQQQQQQQHQRQQQPHHASRQSSPRSTNDSSTVAP--IGGGGSSI  693
            AQLQQQQQQQQQQ Q+QQQQQ Q        HASRQSSPRSTNDS+TVAP   GGGGSSI
Sbjct  647  AQLQQQQQQQQQQHQRQQQQQSQ--------HASRQSSPRSTNDSTTVAPIGDGGGGSSI  698

Query  694  ASAAPLDLSSQPPAAKRFKSERRASSTATTATTATTGSSASTPSPPPLEQHDEINSGIAN  753
            ASAAPLDLSSQPPAAKRFK+ERRASSTATTATTATTGSS STPSPPPLEQHD+INSG AN
Sbjct  699  ASAAPLDLSSQPPAAKRFKAERRASSTATTATTATTGSSTSTPSPPPLEQHDDINSGNAN  758

Query  754  AAMGTGTGEGIASGSGTGSGSGAGKSRRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  813
            A +GT +G G    S  GSG+G  K+RRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ
Sbjct  759  ATLGTRSGTGTGESSAAGSGAGVAKARRRCQAQSEEVNSWSVDDVCGFVGGIDICAEYVQ  818

Query  814  SFRDQ  818
              + +
Sbjct  819  LIKQE  823



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110315.1 accessory gland protein Acp32CD [Drosophila elegans]

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A32CD_DROME  unnamed protein product                                  143     9e-42


>A32CD_DROME unnamed protein product
Length=252

 Score = 143 bits (360),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 142/271 (52%), Positives = 159/271 (59%), Gaps = 42/271 (15%)

Query  1    MWRMRTRLLTGYLVLLALGHLATEHGVVGQKYYMNFAFNNNNPDAEGGGGPVPGGGPGGQ  60
            MWRMR RLLTGYLVLLALG L  EHG +GQKYYMNFAFNNNNPD EGG G   GGG  G 
Sbjct  1    MWRMRMRLLTGYLVLLALGQL-PEHGALGQKYYMNFAFNNNNPDGEGGTGVDGGGGGAGG  59

Query  61   EG---------PPHTDGEDSGTPDGPPGENPDAPADTSRGESGSGDSDGESNDNDDNENS  111
                        PH+   D       P ++    AD S    G      ES    D ++ 
Sbjct  60   GAAGPGGGTGDSPHSQEGDGSAATDNPNDDHATSADNSLATDGDAIGKKESGGGSDGKSD  119

Query  112  DNDSNDSNDSNDSSGNSGSQNDSEDETNDGHDDDNDDSDSKDSKDRRIKAEESERSQEGN  171
              DS+  ND+  +               +GHDDDNDDSDSKD+KDR+ K EE+   QEG 
Sbjct  120  SKDSSGGNDATPA---------------NGHDDDNDDSDSKDAKDRQDKEEEA--GQEGK  162

Query  172  NRGDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSKAGSNQRDSGP---GPQDSSA  228
             R DHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGS AGSNQRD+G      ++  A
Sbjct  163  -RTDHSHHSSYEISIDDSFGGRYVRSIYESSESHGHSGSNAGSNQRDNGARESSQENQDA  221

Query  229  EEVPSNTADPRA---PD--------DDYEEM  248
            +EV S     RA   PD        DDYEEM
Sbjct  222  KEVASEAPAQRAGNVPDGPETGAKEDDYEEM  252



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110316.1 uncharacterized protein LOC108134501 [Drosophila
elegans]

Length=120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B0G115_DICDI  unnamed protein product                                 28.5    1.7  
ITA1_DROME  unnamed protein product                                   27.3    4.1  
Q9N537_CAEEL  unnamed protein product                                 25.8    8.8  


>B0G115_DICDI unnamed protein product
Length=887

 Score = 28.5 bits (62),  Expect = 1.7, Method: Composition-based stats.
 Identities = 15/49 (31%), Positives = 25/49 (51%), Gaps = 3/49 (6%)

Query  73   EQRLRRRMRFLEMR---REHYNNMLEHSERCHMESSEDEDHKDHEDQKE  118
            E R  R M   E+    R H+   ++  E  + ES +DE+  D+E+ K+
Sbjct  821  EFRKSRSMVIHEIENILRNHFKKKIQDEEEVNQESEDDENEGDNEENKD  869


>ITA1_DROME unnamed protein product
Length=1146

 Score = 27.3 bits (59),  Expect = 4.1, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query  57   VSLPEIESENLAEETAEQRLRRRMRFLEMRREHYNNMLEHSERCHMESSEDEDHKD  112
            ++L     EN A  +A  ++R    F    R  +N  L HS+R +  SS  +DH D
Sbjct  897  LNLASGSRENPAYLSAPAQMRM---FPSQSRHSFNKSLIHSQRSYYSSSHRDDHSD  949


>Q9N537_CAEEL unnamed protein product
Length=193

 Score = 25.8 bits (55),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 15/29 (52%), Positives = 19/29 (66%), Gaps = 1/29 (3%)

Query  63   ESENLAEETAEQRLRRRMRFLEMRREHYN  91
            +SE+ A+ T EQR  RR  F + RR HYN
Sbjct  135  DSEDEADLTEEQRAHRR-DFEKKRRAHYN  162



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110317.1 protein piwi [Drosophila elegans]

Length=874
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PIWI_DROME  unnamed protein product                                   1479    0.0  
AUB_DROME  unnamed protein product                                    739     0.0  
SIWI_BOMMO  unnamed protein product                                   654     0.0  


>PIWI_DROME unnamed protein product
Length=843

 Score = 1479 bits (3830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 712/874 (81%), Positives = 774/874 (89%), Gaps = 31/874 (4%)

Query  1    MADDQGRGRRRPLDDDEPSTSRGSRDEPRSKIFKDSSSGGSRSDPRAQPSNSDSRAGASR  60
            MADDQGRGRRRPL++D+ STSRGS D PR K+F+ SSSG    DPRA             
Sbjct  1    MADDQGRGRRRPLNEDDSSTSRGSGDGPRVKVFRGSSSG----DPRA-------------  43

Query  61   SDPRVERSGAPSDRERVGGSQAPAGATRQERRDESGSTDRRPRGDRFDMVATRPAELVSK  120
             DPR+E S     RER    +AP        R E G T+R+P GD++D + TRPAELVSK
Sbjct  44   -DPRIEAS-----RERRALEEAP--------RREGGPTERKPWGDQYDYLNTRPAELVSK  89

Query  121  LGKDGRPIRLQTNFFRLNTKPEWRIVHYCVEFEPSIENPRVRMGILSEHANVLGSGYLFD  180
             G DG P+ LQTNFFRL TKPEWRIVHY VEFEPSIENPRVRMG+LS HAN+LGSGYLFD
Sbjct  90   KGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSGYLFD  149

Query  181  GLQLFTTRKFEQELTVLRGKSRLDIDYTIRIKCVGFISTAEPRFLQVLNLILRRSMKGLK  240
            GLQLFTTRKFEQE+TVL GKS+LDI+Y I IK VGFIS AEPRFLQVLNLILRRSMKGL 
Sbjct  150  GLQLFTTRKFEQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLN  209

Query  241  LELVGRNFFDPHAKIEIREHKLELWPGYETSIRQHEKDILLCTEIAHKVMRTETVYDILR  300
            LELVGRN FDP AKIEIRE K+ELWPGYETSIRQHEKDILL TEI HKVMRTET+YDI+R
Sbjct  210  LELVGRNLFDPRAKIEIREFKMELWPGYETSIRQHEKDILLGTEITHKVMRTETIYDIMR  269

Query  301  RCSQNPSRHQDEFRLNVLDLIVLTDYNNKTYRINDVDFGQTPKSTFSCKGRDISFVEYYQ  360
            RCS NP+RHQDE R+NVLDLIVLTDYNN+TYRINDVDFGQTPKSTFSCKGRDISFVEYY 
Sbjct  270  RCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYL  329

Query  361  TKYNIRIRDHNQPLLISKNRDKAQKTNASELVVLIPELCRVTGLNDNMRSNFQLMRSMSE  420
            TKYNIRIRDHNQPLLISKNRDKA KTNASELVVLIPELCRVTGLN  MRSNFQLMR+MS 
Sbjct  330  TKYNIRIRDHNQPLLISKNRDKALKTNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSS  389

Query  421  YTRMNPNRRIDRLRSFNRRLHSTPESVKVLRDWHMDLDQNLTEVQGRIIEQQKIVFHHGK  480
            YTRMNP +R DRLR+FN RL +TPESVKVLRDW+M+LD+N+TEVQGRII QQ IVFH+GK
Sbjct  390  YTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGK  449

Query  481  VPAGETADWTRSFRDQKMLTTPSDGIDRWAIIAPERNSYELKTLLDNLFRAANGMGLKFR  540
            VPAGE ADW R FRDQ+MLTTPSDG+DRWA+IAP+RNS+EL+TLLD+L+RAA+GMGL+ R
Sbjct  450  VPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIR  509

Query  541  SPHEVKIYDDRTGTYVRAMDDCVRMDPKLILCLVPNNNVERYSAIKKRGYIDRAVPTQVV  600
            SP E  IYDDRTGTYVRAMDDCVR DPKLILCLVPN+N ERYS+IKKRGY+DRAVPTQVV
Sbjct  510  SPQEFIIYDDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVV  569

Query  601  TIKTAKNRGLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGAL  660
            T+KT KNR LMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGAL
Sbjct  570  TLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGAL  629

Query  661  VASMDLQQNSTYFSTVSECSAFDVMSNTLWPMMAKALRQYSREHKKLPTRIVFYRDGVSS  720
            +ASMDLQQNSTYFSTV+ECSAFDV++NTLWPM+AKALRQY  EH+KLP+RIVFYRDGVSS
Sbjct  630  IASMDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSS  689

Query  721  GSLKQLFEYEVKDIVEKLDAEYKRVGADPPQLAYIVVTKSMNARFFANGGNPPPGTVVDD  780
            GSLKQLFE+EVKDI+EKL  EY RV   PPQLAYIVVT+SMN RFF NG NPPPGT+VDD
Sbjct  690  GSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDD  749

Query  781  VITLPERYDFYLVSQQVRQGTVSPTSYNVVYSSMGISPDKMQKLTYKMCHLYYNWSGTTR  840
            VITLPERYDFYLVSQQVRQGTVSPTSYNV+YSSMG+SP+KMQKLTYKMCHLYYNWSGTTR
Sbjct  750  VITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGLSPEKMQKLTYKMCHLYYNWSGTTR  809

Query  841  VPAVCQYAKKLATLVGTNLHAIPQNALEKKFYYL  874
            VPAVCQYAKKLATLVGTNLH+IPQNALEKKFYYL
Sbjct  810  VPAVCQYAKKLATLVGTNLHSIPQNALEKKFYYL  843


>AUB_DROME unnamed protein product
Length=866

 Score = 739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/884 (44%), Positives = 552/884 (62%), Gaps = 42/884 (5%)

Query  5    QGRGRRRPLDDDEPSTSRGSRDEPRSKIFKDSSSGGSRSDPRAQPSNSDSRAGASRSDPR  64
            +GRGR R  ++ E   +RG            + S G +SDP     N  S       D +
Sbjct  11   RGRGRGRKPNNVE--ANRGF-----------APSLGQKSDPSHSEGNQASGGNGGGGDAQ  57

Query  65   VERSGAPSDRERVGGSQAPAGATRQERRDESGSTDRRPRGDRF--DMVATRPAELVSKLG  122
            V     PS    +  S   A    +   D  GS     RG R   D+V +RP  + SK G
Sbjct  58   V----GPS----IEKSSLSAVQMHKSEGDPRGSV----RGRRLITDLVYSRPPGMTSKKG  105

Query  123  KDGRPIRLQTNFFRLNTKPEWRIVHYCVEFEPSIENPRVRMGILSEHANVLGSGYLFDGL  182
              G  I +Q N+F++  +P W I  Y V+F P +E  R+R   L EH  +LG GY+FDG 
Sbjct  106  VVGTHITVQANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILG-GYIFDGT  164

Query  183  QLFTTRKFEQ-----ELTVLRGKSRLDIDYTIRIKCVGFISTAEPRFLQVLNLILRRSMK  237
             +F   +F+       +  L  KSR   +  I+IK VG + + +    QVLNLILRR+M+
Sbjct  165  NMFCINQFKAVQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAME  224

Query  238  GLKLELVGRNFFDPHAKIEIREHKLELWPGYETSIRQHEKDILLCTEIAHKVMRTETVYD  297
            GL L+LV R ++DP AKI +   +++LWPGY+TSIRQHE DILLC+EI HKVMRTET+Y+
Sbjct  225  GLDLKLVSRYYYDPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICHKVMRTETLYN  284

Query  298  ILRRCSQNPSRHQDEFRLNVLDLIVLTDYNNKTYRINDVDFGQTPKSTFSCKGRDISFVE  357
            IL    ++   +Q  F+  V+ +++LTDYNNKTYRI+DVDF  TP   F     +IS+V+
Sbjct  285  ILSDAIRDSDDYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVD  344

Query  358  YYQTKYNIRIRDHNQPLLISKNRDKAQKTNASELVVLIPELCRVTGLNDNMRSNFQLMRS  417
            YY+ +YNI IRD  QPL++S+  DK  +    + +++IPEL R TG+ D MR++F+ +R+
Sbjct  345  YYKKRYNIIIRDLKQPLVMSRPTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRA  404

Query  418  MSEYTRMNPNRRIDRLRSFNRRLHSTPESVKVLRDWHMDLDQNLTEVQGRIIEQQKIVFH  477
            MSE+TR+NP+RRI+RLR FN+RL S  +SV+ L+ W+++LD  L E+  R++  +KI+F 
Sbjct  405  MSEHTRLNPDRRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFG  464

Query  478  HGKVPAGET-ADWTRSFRDQKMLTTPSDGIDRWAIIAPERNSYELKTLLDNLFRAANGMG  536
            + K+   +  ADWT  FR   M       I+RW +I P RN  E +  +    R A+ M 
Sbjct  465  NQKIFVCDARADWTNEFRTCSMFKNVH--INRWYVITPSRNLRETQEFVQMCIRTASSMK  522

Query  537  LKFRSPHEVKIYDDRTGTYVRAMDDCVRMDPKLILCLVPNNNVERYSAIKKRGYIDRAVP  596
            +   +P   +I DDR GTY +A+D+    DP++++ ++ + N E+YS IKKR  +DR VP
Sbjct  523  MNICNPIYEEIPDDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVP  582

Query  597  TQVVTIKTAKNR-----GLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTR  651
            +QVVT+K    R     GLMSIATK+ IQ+N KL   PW + +PL GLMT+GFD+  S +
Sbjct  583  SQVVTLKVIAPRQQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPK  642

Query  652  DRKRAYGALVASMDLQQNSTYFSTVSECSAFDVMSNTLWPMMAKALRQYSREHKKLPTRI  711
            ++ ++YGA VA+MD +++  YFSTV+E      +S  +   MA ALR Y  +H+ LP RI
Sbjct  643  NKNKSYGAFVATMDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERI  702

Query  712  VFYRDGVSSGSLKQLFEYEVKDIVEKLDAEYKRVG-ADPPQLAYIVVTKSMNARFFANGG  770
            +F+RDGV  G L Q+   EV  + ++LD  YK  G  +  ++ +I+V+K +N+R+F    
Sbjct  703  LFFRDGVGDGQLYQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHR  762

Query  771  NPPPGTVVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVVYSSMGISPDKMQKLTYKMCH  830
            NP PGTVVDDVITLPERYDF+LVSQ VR GTVSPTSYNV+  +MG++ DK+Q L+YKM H
Sbjct  763  NPVPGTVVDDVITLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADKLQMLSYKMTH  822

Query  831  LYYNWSGTTRVPAVCQYAKKLATLVGTNLHAIPQNALEKKFYYL  874
            +YYN+SGT RVPAVC YA KLA LV  +++  P   L+ + Y+L
Sbjct  823  MYYNYSGTIRVPAVCHYAHKLAFLVAESINRAPSAGLQNQLYFL  866


>SIWI_BOMMO unnamed protein product
Length=899

 Score = 654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/779 (41%), Positives = 504/779 (65%), Gaps = 16/779 (2%)

Query  105  DRFDMVATRPAELVSKLGKDGRPIRLQTNFFRLNTKPEWRIVHYCVEFEPSIENPRVRMG  164
            +   ++ TRP  + SK G  G P+ L  N+F + T P+W +  Y V+  P  ++  VR  
Sbjct  128  ETISILRTRPEAVTSKKGTSGTPLDLLANYFTVETTPKWGLYQYHVDISPEEDSTGVRKA  187

Query  165  ILSEHANVLGSGYLFDGLQLFTTRKFEQELTVLRGKSRLDID-YTIRIKCVGFISTAEPR  223
            ++  H+  LG GYLFDG  L+T  +   +   L    + D +   I IK    +S  +  
Sbjct  188  LMRVHSKTLG-GYLFDGTVLYTVNRLHPDPMELYSDRKTDNERMRILIKLTCEVSPGDYH  246

Query  224  FLQVLNLILRRSMKGLKLELVGRNFFDPHAKIEIREHKLELWPGYETSIRQHEKDILLCT  283
            ++Q+ N+I+R+    LKL+L+GR++FDP AKI+I E KL++WPGY+T+I Q+E  +LL T
Sbjct  247  YIQIFNIIIRKCFNLLKLQLMGRDYFDPEAKIDIPEFKLQIWPGYKTTINQYEDRLLLVT  306

Query  284  EIAHKVMRTETVYDILRR-CSQNPSRHQDEFRLNVLDLIVLTDYNNKTYRINDVDFGQTP  342
            EIAHKV+R +TV  +L    +   + ++  F  +V+  IV+TDYN +TYR++DV +  +P
Sbjct  307  EIAHKVLRMDTVLQMLSEYAATKGNNYKKIFLEDVVGKIVMTDYNKRTYRVDDVAWNVSP  366

Query  343  KSTFSCKGRDISFVEYYQTKYNIRIRDHNQPLLISKNRDKAQKTNASELVVLIPELCRVT  402
            KSTF  +  +I+++EYY  KYN+RI+D  QPLLIS+++ +  +    EL+ L+PELCR T
Sbjct  367  KSTFKMRDENITYIEYYYKKYNLRIQDPGQPLLISRSKPREIRAGLPELIYLVPELCRQT  426

Query  403  GLNDNMRSNFQLMRSMSEYTRMNPNRRIDRLRSFNRRLHSTPESVKVLRDWHMDLDQNLT  462
            GL+D MR+NF+LMRS+  +T++ P++RI++L +FNRR  STPE V+ L  W + L + L 
Sbjct  427  GLSDEMRANFKLMRSLDVHTKIGPDKRIEKLNNFNRRFTSTPEVVEELATWSLKLSKELV  486

Query  463  EVQGRIIEQQKIV-FHHGKVPAGETAD-WTRSFRDQKMLTTPSDGIDRWAIIAPERNSYE  520
            +++GR +  + I+  ++ K PAG+T + WTR  R + +L      ++ W +I PER   +
Sbjct  487  KIKGRQLPPENIIQANNVKYPAGDTTEGWTRDMRSKHLLAIAQ--LNSWVVITPERQRRD  544

Query  521  LKTLLDNLFRAANGMGLKFRSPHEVKIYDDRTGTYVRAMDDCV-RMDPKLILCLVPNNNV  579
             ++ +D + +   G+G + RSP  V I  D    Y    ++ + R +P LILC++  N  
Sbjct  545  TESFIDLIIKTGGGVGFRMRSPDLVVIRHDGPIEYANMCEEVIARKNPALILCVLARNYA  604

Query  580  ERYSAIKKRGYIDRAVPTQVVTIKTAKNRGLMSIATKIAIQLNCKLGYTPWMIELPLSGL  639
            +RY AIKK+  +DRAVPTQVV  +   ++  MSIATK+AIQ+NCKLG +PW +++PL  L
Sbjct  605  DRYEAIKKKCTVDRAVPTQVVCARNMSSKSAMSIATKVAIQINCKLGGSPWTVDIPLPSL  664

Query  640  MTIGFDIAKSTRDRKRAYGALVASMDLQQNSTYFSTVSECSAFDVMSNTLWPMMAKALRQ  699
            M +G+D+   TR +++++GA VA++D +Q + Y+S V+  ++ + +S+ +   +A A+++
Sbjct  665  MVVGYDVCHDTRSKEKSFGAFVATLD-KQMTQYYSIVNAHTSGEELSSHMGFNIASAVKK  723

Query  700  YSREHKKLPTRIVFYRDGVSSGSLKQLFEYEVKDIVEKLDAEYKRVGADPPQLAYIVVTK  759
            +  ++   P RI  YRDGV  G +  +  +EV +I +KL   Y  V     +LA+I+V+K
Sbjct  724  FREKNGTYPARIFIYRDGVGDGQIPYVHSHEVAEIKKKLAEIYAGVEI---KLAFIIVSK  780

Query  760  SMNARFFA----NGGNPPPGTVVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVVYSSMG  815
             +N R F     +G NP PGTV+DDV+TLPERYDFYLVSQ VR+GT++PTSYNV+  + G
Sbjct  781  RINTRIFVQRGRSGENPRPGTVIDDVVTLPERYDFYLVSQNVREGTIAPTSYNVIEDTTG  840

Query  816  ISPDKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVGTNLHAIPQNALEKKFYYL  874
            ++PD++Q+LTYK+ HLY+N S   RVP+VCQYA KLA L   +LH  P  +L +  Y+L
Sbjct  841  LNPDRIQRLTYKLTHLYFNCSSQVRVPSVCQYAHKLAFLAANSLHNQPHYSLNETLYFL  899



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110318.1 wiskott-Aldrich syndrome protein family member 3
isoform X1 [Drosophila elegans]

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

F2FB81_DROME  unnamed protein product                                 1334    0.0  
X2J5L4_DROME  unnamed protein product                                 1265    0.0  
M9NCT2_DROME  unnamed protein product                                 1251    0.0  


>F2FB81_DROME unnamed protein product
Length=674

 Score = 1334 bits (3453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/684 (96%), Positives = 665/684 (97%), Gaps = 11/684 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDTIKPYNMLSHLENNSNV  300
            VNEEAGYGIQLVKIQTV E DIDLR STLDAHHQVVGNIQDVDT+KPYNMLSHLENNSNV
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQVVGNIQDVDTVKPYNMLSHLENNSNV  300

Query  301  TKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360
            TKQTAVAIADMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG
Sbjct  301  TKQTAVAIADMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360

Query  361  GPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPA  420
            GP    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPA
Sbjct  361  GP----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPA  416

Query  421  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKL  480
            PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKL
Sbjct  417  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKL  476

Query  481  LGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVP  540
            LGRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVP
Sbjct  477  LGRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVP  530

Query  541  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVP  599
            DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVP
Sbjct  531  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVP  590

Query  600  HIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  659
            HIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE
Sbjct  591  HIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  650

Query  660  LSESEDSDSEDDSEGWIEPNETSA  683
            LSESEDSDSEDDSEGW+EPNETSA
Sbjct  651  LSESEDSDSEDDSEGWMEPNETSA  674


>X2J5L4_DROME unnamed protein product
Length=647

 Score = 1265 bits (3273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/684 (92%), Positives = 638/684 (93%), Gaps = 38/684 (6%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDTIKPYNMLSHLENNSNV  300
            VNEEAGYGIQLVKIQTV E DIDLR STLDAHHQVVGNIQDV                  
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQVVGNIQDV------------------  282

Query  301  TKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360
                     DMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG
Sbjct  283  ---------DMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  333

Query  361  GPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPA  420
            GP    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPA
Sbjct  334  GP----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPA  389

Query  421  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKL  480
            PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKL
Sbjct  390  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKL  449

Query  481  LGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVP  540
            LGRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVP
Sbjct  450  LGRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVP  503

Query  541  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVP  599
            DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVP
Sbjct  504  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVP  563

Query  600  HIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  659
            HIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE
Sbjct  564  HIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  623

Query  660  LSESEDSDSEDDSEGWIEPNETSA  683
            LSESEDSDSEDDSEGW+EPNETSA
Sbjct  624  LSESEDSDSEDDSEGWMEPNETSA  647


>M9NCT2_DROME unnamed protein product
Length=640

 Score = 1251 bits (3237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/684 (91%), Positives = 634/684 (93%), Gaps = 45/684 (7%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDTIKPYNMLSHLENNSNV  300
            VNEEAGYG                                  +T+KPYNMLSHLENNSNV
Sbjct  241  VNEEAGYG----------------------------------NTVKPYNMLSHLENNSNV  266

Query  301  TKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360
            TKQTAVAIADMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG
Sbjct  267  TKQTAVAIADMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  326

Query  361  GPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPA  420
            GP    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPA
Sbjct  327  GP----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPA  382

Query  421  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKL  480
            PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKL
Sbjct  383  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKL  442

Query  481  LGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVP  540
            LGRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVP
Sbjct  443  LGRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVP  496

Query  541  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVP  599
            DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVP
Sbjct  497  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVP  556

Query  600  HIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  659
            HIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE
Sbjct  557  HIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  616

Query  660  LSESEDSDSEDDSEGWIEPNETSA  683
            LSESEDSDSEDDSEGW+EPNETSA
Sbjct  617  LSESEDSDSEDDSEGWMEPNETSA  640



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110319.1 wiskott-Aldrich syndrome protein family member 3
isoform X1 [Drosophila elegans]

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

F2FB81_DROME  unnamed protein product                                 1334    0.0  
X2J5L4_DROME  unnamed protein product                                 1265    0.0  
M9NCT2_DROME  unnamed protein product                                 1251    0.0  


>F2FB81_DROME unnamed protein product
Length=674

 Score = 1334 bits (3453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 657/684 (96%), Positives = 665/684 (97%), Gaps = 11/684 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDTIKPYNMLSHLENNSNV  300
            VNEEAGYGIQLVKIQTV E DIDLR STLDAHHQVVGNIQDVDT+KPYNMLSHLENNSNV
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQVVGNIQDVDTVKPYNMLSHLENNSNV  300

Query  301  TKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360
            TKQTAVAIADMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG
Sbjct  301  TKQTAVAIADMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360

Query  361  GPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPA  420
            GP    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPA
Sbjct  361  GP----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPA  416

Query  421  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKL  480
            PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKL
Sbjct  417  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKL  476

Query  481  LGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVP  540
            LGRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVP
Sbjct  477  LGRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVP  530

Query  541  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVP  599
            DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVP
Sbjct  531  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVP  590

Query  600  HIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  659
            HIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE
Sbjct  591  HIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  650

Query  660  LSESEDSDSEDDSEGWIEPNETSA  683
            LSESEDSDSEDDSEGW+EPNETSA
Sbjct  651  LSESEDSDSEDDSEGWMEPNETSA  674


>X2J5L4_DROME unnamed protein product
Length=647

 Score = 1265 bits (3273),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/684 (92%), Positives = 638/684 (93%), Gaps = 38/684 (6%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDTIKPYNMLSHLENNSNV  300
            VNEEAGYGIQLVKIQTV E DIDLR STLDAHHQVVGNIQDV                  
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQVVGNIQDV------------------  282

Query  301  TKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360
                     DMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG
Sbjct  283  ---------DMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  333

Query  361  GPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPA  420
            GP    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPA
Sbjct  334  GP----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPA  389

Query  421  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKL  480
            PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKL
Sbjct  390  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKL  449

Query  481  LGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVP  540
            LGRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVP
Sbjct  450  LGRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVP  503

Query  541  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVP  599
            DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVP
Sbjct  504  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVP  563

Query  600  HIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  659
            HIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE
Sbjct  564  HIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  623

Query  660  LSESEDSDSEDDSEGWIEPNETSA  683
            LSESEDSDSEDDSEGW+EPNETSA
Sbjct  624  LSESEDSDSEDDSEGWMEPNETSA  647


>M9NCT2_DROME unnamed protein product
Length=640

 Score = 1251 bits (3237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/684 (91%), Positives = 634/684 (93%), Gaps = 45/684 (7%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDTIKPYNMLSHLENNSNV  300
            VNEEAGYG                                  +T+KPYNMLSHLENNSNV
Sbjct  241  VNEEAGYG----------------------------------NTVKPYNMLSHLENNSNV  266

Query  301  TKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  360
            TKQTAVAIADMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG
Sbjct  267  TKQTAVAIADMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMG  326

Query  361  GPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPA  420
            GP    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPA
Sbjct  327  GP----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPA  382

Query  421  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKL  480
            PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKL
Sbjct  383  PPSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKL  442

Query  481  LGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVP  540
            LGRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVP
Sbjct  443  LGRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVP  496

Query  541  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVP  599
            DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVP
Sbjct  497  DQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVP  556

Query  600  HIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  659
            HIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE
Sbjct  557  HIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIE  616

Query  660  LSESEDSDSEDDSEGWIEPNETSA  683
            LSESEDSDSEDDSEGW+EPNETSA
Sbjct  617  LSESEDSDSEDDSEGWMEPNETSA  640



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110320.1 thialysine N-epsilon-acetyltransferase [Drosophila
elegans]

Length=174
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q383G8_TRYB2  unnamed protein product                                 32.7    0.067
SSAT_CRYPI  unnamed protein product                                   32.7    0.082
Q4GYC9_TRYB2  unnamed protein product                                 29.6    1.0  


>Q383G8_TRYB2 unnamed protein product
Length=147

 Score = 32.7 bits (73),  Expect = 0.067, Method: Compositional matrix adjust.
 Identities = 31/144 (22%), Positives = 58/144 (40%), Gaps = 11/144 (8%)

Query  1    MSKSEEFTFRRAKADDIKDVLSMIQELADFEKMSNGPQLTEEDLKRDAGLTGGQEYCEVY  60
            M+   +   R  +  D+   L ++  L +   +S        D++R AG+          
Sbjct  1    MTDIVDLELRVLEESDLSSHLELLGHLTEAPPLSGVELANIADMRRRAGIV-------TK  53

Query  61   VLIDNANNQAIGY-SICYKAYSTWQGRYF-FVEDIYVRPEHRKRGAGKRIFLEVSARAVE  118
            V         +G  S+  +   T  GR    +ED+ V P +R  G GK + +++   +  
Sbjct  54   VFCHQPTGGIVGSASLMIQPKFTRGGRAVGHIEDVVVDPSYRGAGLGKALIMDLCEISRS  113

Query  119  LQCPRLEFNVLEWNPARQFYERLG  142
              C ++  +  E +    FYE+LG
Sbjct  114  KGCYKVILDSSEKS--LPFYEKLG  135


>SSAT_CRYPI unnamed protein product
Length=152

 Score = 32.7 bits (73),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%), Gaps = 2/83 (2%)

Query  60   YVLIDNANNQAIGYSICYKAYSTWQGRYFFVEDIYVRPEHRKRGAGKRIFLEVSARAV-E  118
            Y L+D  N + +GY+  Y      +     +E + +  E+R RG G+ +  ++   A  +
Sbjct  49   YCLVDTENGRIVGYAGFYIIPHLGRKNDSRIEHVIISKEYRNRGLGRLLCKQIIEDAKNK  108

Query  119  LQCPRLEFNVLEWNPARQFYERL  141
              C R++  V E + A++ Y  L
Sbjct  109  FNCGRIDLTV-ESHIAKKLYSSL  130


>Q4GYC9_TRYB2 unnamed protein product
Length=172

 Score = 29.6 bits (65),  Expect = 1.0, Method: Compositional matrix adjust.
 Identities = 11/47 (23%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query  64   DNANNQAIGYSICYKAYSTWQGRYFF-VEDIYVRPEHRKRGAGKRIF  109
            + ++ Q +G       +S W+G+ F  ++ +Y+ P  RK+G  ++ +
Sbjct  75   NRSSPQIVGVMTVTYEWSDWRGKLFLWIQSVYIIPSKRKQGIFQKFY  121



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110322.1 wiskott-Aldrich syndrome protein family member 2
isoform X2 [Drosophila elegans]

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

X2J5L4_DROME  unnamed protein product                                 1278    0.0  
H5V8D0_DROME  unnamed protein product                                 1259    0.0  
M9NCT2_DROME  unnamed protein product                                 1208    0.0  


>X2J5L4_DROME unnamed protein product
Length=647

 Score = 1278 bits (3307),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/657 (96%), Positives = 638/657 (97%), Gaps = 11/657 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDMGVYETRPPRPNSIELR  300
            VNEEAGYGIQLVKIQTV E DIDLR STLDAHHQVVGNIQDVDMGVY+TRPPRPNSIEL 
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQVVGNIQDVDMGVYDTRPPRPNSIELN  300

Query  301  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHAL  360
            RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHAL
Sbjct  301  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHAL  356

Query  361  YGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  420
            YGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST
Sbjct  357  YGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  416

Query  421  SRDALPPPPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMV  480
            SRDALPPPPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMV
Sbjct  417  SRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMV  472

Query  481  MTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  540
            MTQL+NTFHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM
Sbjct  473  MTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  530

Query  541  GSGNQHTLRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGI  599
            GSGNQHTLRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGI
Sbjct  531  GSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGI  590

Query  600  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  656
            TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  591  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  647


>H5V8D0_DROME unnamed protein product
Length=641

 Score = 1259 bits (3259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/657 (95%), Positives = 632/657 (96%), Gaps = 17/657 (3%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDMGVYETRPPRPNSIELR  300
            VNEEAGYGIQLVKIQTV E DIDLR STLDAHHQV      VDMGVY+TRPPRPNSIEL 
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQV------VDMGVYDTRPPRPNSIELN  294

Query  301  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHAL  360
            RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHAL
Sbjct  295  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHAL  350

Query  361  YGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  420
            YGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST
Sbjct  351  YGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  410

Query  421  SRDALPPPPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMV  480
            SRDALPPPPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMV
Sbjct  411  SRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMV  466

Query  481  MTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  540
            MTQL+NTFHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM
Sbjct  467  MTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  524

Query  541  GSGNQHTLRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGI  599
            GSGNQHTLRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGI
Sbjct  525  GSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGI  584

Query  600  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  656
            TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  585  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  641


>M9NCT2_DROME unnamed protein product
Length=640

 Score = 1208 bits (3125),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/657 (92%), Positives = 616/657 (94%), Gaps = 18/657 (3%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGIQLVKIQTVSEVDIDLRQSTLDAHHQVVGNIQDVDMGVYETRPPRPNSIELR  300
            VNEEAGYG  +     +S ++ +   +   A       +   DMGVY+TRPPRPNSIEL 
Sbjct  241  VNEEAGYGNTVKPYNMLSHLENNSNVTKQTA-------VAIADMGVYDTRPPRPNSIELN  293

Query  301  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHAL  360
            RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHAL
Sbjct  294  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHAL  349

Query  361  YGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  420
            YGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST
Sbjct  350  YGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  409

Query  421  SRDALPPPPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMV  480
            SRDALPPPPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMV
Sbjct  410  SRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMV  465

Query  481  MTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  540
            MTQL+NTFHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM
Sbjct  466  MTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  523

Query  541  GSGNQHTLRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGI  599
            GSGNQHTLRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGI
Sbjct  524  GSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGI  583

Query  600  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  656
            TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  584  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  640



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110323.1 wiskott-Aldrich syndrome protein family member 2
isoform X3 [Drosophila elegans]

Length=649
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NCT2_DROME  unnamed protein product                                 1271    0.0  
H5V8D0_DROME  unnamed protein product                                 1209    0.0  
X2J5L4_DROME  unnamed protein product                                 1205    0.0  


>M9NCT2_DROME unnamed protein product
Length=640

 Score = 1271 bits (3288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/650 (96%), Positives = 634/650 (98%), Gaps = 11/650 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGNTIKPYNMLSHLENNSNVTKQTAVAIADMGVYETRPPRPNSIELRRSYQSEQ  300
            VNEEAGYGNT+KPYNMLSHLENNSNVTKQTAVAIADMGVY+TRPPRPNSIEL RSYQSEQ
Sbjct  241  VNEEAGYGNTVKPYNMLSHLENNSNVTKQTAVAIADMGVYDTRPPRPNSIELNRSYQSEQ  300

Query  301  IDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQG  360
            IDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHALYGQTGQG
Sbjct  301  IDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHALYGQTGQG  356

Query  361  VMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPP  420
            VMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPP
Sbjct  357  VMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPP  416

Query  421  PPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNT  480
            PPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMVMTQL+NT
Sbjct  417  PPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMVMTQLSNT  472

Query  481  FHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHT  540
            FHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHT
Sbjct  473  FHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHT  530

Query  541  LRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEK  599
            LRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEK
Sbjct  531  LRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEK  590

Query  600  SEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  649
            SEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  591  SEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  640


>H5V8D0_DROME unnamed protein product
Length=641

 Score = 1209 bits (3128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 604/653 (92%), Positives = 618/653 (95%), Gaps = 16/653 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGNTIKPYNMLSHLENNSNVTKQTAVA---IADMGVYETRPPRPNSIELRRSYQ  297
            VNEEAGYG  I+   + +  E + ++   T  A   + DMGVY+TRPPRPNSIEL RSYQ
Sbjct  241  VNEEAGYG--IQLVKIQTVGEADIDLRHSTLDAHHQVVDMGVYDTRPPRPNSIELNRSYQ  298

Query  298  SEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHALYGQT  357
            SEQIDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHALYGQT
Sbjct  299  SEQIDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHALYGQT  354

Query  358  GQGVMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDA  417
            GQGVMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDA
Sbjct  355  GQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDA  414

Query  418  LPPPPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMVMTQL  477
            LPPPPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMVMTQL
Sbjct  415  LPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMVMTQL  470

Query  478  NNTFHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGN  537
            +NTFHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGN
Sbjct  471  SNTFHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGN  528

Query  538  QHTLRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGITLRK  596
            QHTLRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGITLRK
Sbjct  529  QHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGITLRK  588

Query  597  VEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  649
            VEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  589  VEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  641


>X2J5L4_DROME unnamed protein product
Length=647

 Score = 1205 bits (3117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/657 (92%), Positives = 617/657 (94%), Gaps = 18/657 (3%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYG------NTIKPYNM-LSHLENNSNVTKQTAVAIADMGVYETRPPRPNSIELR  293
            VNEEAGYG       T+   ++ L H   +++      +   DMGVY+TRPPRPNSIEL 
Sbjct  241  VNEEAGYGIQLVKIQTVGEADIDLRHSTLDAHHQVVGNIQDVDMGVYDTRPPRPNSIELN  300

Query  294  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHAL  353
            RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHAL
Sbjct  301  RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHAL  356

Query  354  YGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  413
            YGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST
Sbjct  357  YGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMST  416

Query  414  SRDALPPPPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMV  473
            SRDALPPPPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMV
Sbjct  417  SRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMV  472

Query  474  MTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  533
            MTQL+NTFHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM
Sbjct  473  MTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGM  530

Query  534  GSGNQHTLRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGI  592
            GSGNQHTLRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGI
Sbjct  531  GSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGI  590

Query  593  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  649
            TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  591  TLRKVEKSEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  647



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110324.1 wiskott-Aldrich syndrome protein family member 3
isoform X4 [Drosophila elegans]

Length=622
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PCP4_DROME  unnamed protein product                                 1215    0.0  
Q9VKM2_DROME  unnamed protein product                                 1213    0.0  
M9NCT2_DROME  unnamed protein product                                 1201    0.0  


>M9PCP4_DROME unnamed protein product
Length=632

 Score = 1215 bits (3143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/623 (96%), Positives = 607/623 (97%), Gaps = 11/623 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGNMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGG  300
            VNEEAGYGNMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGG
Sbjct  241  VNEEAGYGNMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGG  300

Query  301  PQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPAP  360
            P    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPAP
Sbjct  301  P----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAP  356

Query  361  PSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKLL  420
            PSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKLL
Sbjct  357  PSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLL  416

Query  421  GRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVPD  480
            GRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVPD
Sbjct  417  GRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVPD  470

Query  481  QHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVPH  539
            QHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVPH
Sbjct  471  QHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPH  530

Query  540  IVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIEL  599
            IVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIEL
Sbjct  531  IVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIEL  590

Query  600  SESEDSDSEDDSEGWIEPNETSA  622
            SESEDSDSEDDSEGW+EPNETSA
Sbjct  591  SESEDSDSEDDSEGWMEPNETSA  613


>Q9VKM2_DROME unnamed protein product
Length=613

 Score = 1213 bits (3138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/623 (96%), Positives = 607/623 (97%), Gaps = 11/623 (2%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGNMGVYETRPPRPNSIELRRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGG  300
            VNEEAGYGNMGVY+TRPPRPNSIEL RSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGG
Sbjct  241  VNEEAGYGNMGVYDTRPPRPNSIELNRSYQSEQIDGSTYEQLPPQMGNQYAATFGNGMGG  300

Query  301  PQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQGVMSPEPIYGPGTPSRTKPRPSQPPPAP  360
            P    QQMHMQHQQMYDAG+YQSHALYGQTGQGVMSPEPIYGPGTPSR KPRPSQPPPAP
Sbjct  301  P----QQMHMQHQQMYDAGMYQSHALYGQTGQGVMSPEPIYGPGTPSRNKPRPSQPPPAP  356

Query  361  PSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGANSGHMAAKLL  420
            PSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNG NSGHMAAKLL
Sbjct  357  PSNGSGGGTPTASNANTPTRGRSMSTSRDALPPPPPVPDVISPMSGMNGVNSGHMAAKLL  416

Query  421  GRANSSSGAGSPQMTPNSVQNANDMVMTQLNNTFHSMAMGMAGNQLNSLSDLPPPPPVPD  480
            GRANSSSGAGS    PNSVQNANDMVMTQL+NTFHS  +GM GNQLNSLSDLPPPPPVPD
Sbjct  417  GRANSSSGAGS----PNSVQNANDMVMTQLSNTFHS--IGMTGNQLNSLSDLPPPPPVPD  470

Query  481  QHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM-QPGQQNGVPH  539
            QHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEM QPGQQNGVPH
Sbjct  471  QHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHTLRPHQILPKSLANGEMQQPGQQNGVPH  530

Query  540  IVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIEL  599
            IVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIEL
Sbjct  531  IVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEKSEQKEIERNAAPLDVASILARRVAIEL  590

Query  600  SESEDSDSEDDSEGWIEPNETSA  622
            SESEDSDSEDDSEGW+EPNETSA
Sbjct  591  SESEDSDSEDDSEGWMEPNETSA  613


>M9NCT2_DROME unnamed protein product
Length=640

 Score = 1201 bits (3106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/650 (92%), Positives = 607/650 (93%), Gaps = 38/650 (6%)

Query  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60
            MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD
Sbjct  1    MPLPKRSIEPVHVARSVYQQDELQSVELETVTNTTLTNIIRQLSSLSKHAEDVFGELARD  60

Query  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120
            VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP
Sbjct  61   VGNIGDRANSLQARIDRLAIKVTQLDSTVEEVPLTDITRKKAFKSAKVFDQQIFSRATMP  120

Query  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180
            APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK
Sbjct  121  APMMDTYAQCDKPPPLDKLNVYRDDGKDGLKFYTDPNYFFELWRQEMLKDTERVMHDKGK  180

Query  181  KLNRPRQEGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240
            KLNRPRQ+GGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM
Sbjct  181  KLNRPRQDGGAGGAAGRGNKKQKTKIRVPHNTREQQRQRALVHGETLMPNNVIYRTPNSM  240

Query  241  VNEEAGYGN---------------------------MGVYETRPPRPNSIELRRSYQSEQ  273
            VNEEAGYGN                           MGVY+TRPPRPNSIEL RSYQSEQ
Sbjct  241  VNEEAGYGNTVKPYNMLSHLENNSNVTKQTAVAIADMGVYDTRPPRPNSIELNRSYQSEQ  300

Query  274  IDGSTYEQLPPQMGNQYAATFGNGMGGPQQQQQQMHMQHQQMYDAGLYQSHALYGQTGQG  333
            IDGSTYEQLPPQMGNQYAATFGNGMGGP    QQMHMQHQQMYDAG+YQSHALYGQTGQG
Sbjct  301  IDGSTYEQLPPQMGNQYAATFGNGMGGP----QQMHMQHQQMYDAGMYQSHALYGQTGQG  356

Query  334  VMSPEPIYGPGTPSRTKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPP  393
            VMSPEPIYGPGTPSR KPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPP
Sbjct  357  VMSPEPIYGPGTPSRNKPRPSQPPPAPPSNGSGGGTPTASNANTPTRGRSMSTSRDALPP  416

Query  394  PPPVPDVISPMSGMNGANSGHMAAKLLGRANSSSGAGSPQMTPNSVQNANDMVMTQLNNT  453
            PPPVPDVISPMSGMNG NSGHMAAKLLGRANSSSGAGS    PNSVQNANDMVMTQL+NT
Sbjct  417  PPPVPDVISPMSGMNGVNSGHMAAKLLGRANSSSGAGS----PNSVQNANDMVMTQLSNT  472

Query  454  FHSMAMGMAGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHT  513
            FHS  +GM GNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHT
Sbjct  473  FHS--IGMTGNQLNSLSDLPPPPPVPDQHSPKMSPPNAAPPPPPPPPPVEEGMGSGNQHT  530

Query  514  LRPHQILPKSLANGEM-QPGQQNGVPHIVAPKKMVAPFHDPRNDLMKAIRDGITLRKVEK  572
            LRPHQILPKSLANGEM QPGQQNGVPHIVAPKKM+ PFHDPRNDLMKAIRDGITLRKVEK
Sbjct  531  LRPHQILPKSLANGEMQQPGQQNGVPHIVAPKKMLPPFHDPRNDLMKAIRDGITLRKVEK  590

Query  573  SEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWIEPNETSA  622
            SEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGW+EPNETSA
Sbjct  591  SEQKEIERNAAPLDVASILARRVAIELSESEDSDSEDDSEGWMEPNETSA  640



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110325.1 ATP synthase subunit g, mitochondrial [Drosophila
elegans]

Length=99
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ATPL2_CAEEL  unnamed protein product                                  76.6    2e-19
GR98B_DROME  unnamed protein product                                  26.6    3.8  
Q17968_CAEEL  unnamed protein product                                 26.2    5.1  


>ATPL2_CAEEL unnamed protein product
Length=131

 Score = 76.6 bits (187),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 46/69 (67%), Gaps = 0/69 (0%)

Query  31   KVELTPPTPADIPAIRQGLGNIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIG  90
            K EL PP  AD PAI+     +    +TG YKNL++RE  + T VT EV+FWF++GE IG
Sbjct  39   KHELAPPRQADWPAIKADWAKVQSFIQTGGYKNLSIREGLVYTAVTLEVVFWFFVGEMIG  98

Query  91   KRHIVGYNV  99
            +R+I GY V
Sbjct  99   RRYIFGYLV  107


>GR98B_DROME unnamed protein product
Length=403

 Score = 26.6 bits (57),  Expect = 3.8, Method: Composition-based stats.
 Identities = 13/25 (52%), Positives = 17/25 (68%), Gaps = 3/25 (12%)

Query  13  NRLLTQARPQLDVFLKYAKVELTPP  37
           +RLL +A P LD+F  +A   LTPP
Sbjct  6   SRLLARAFPYLDIFSVFA---LTPP  27


>Q17968_CAEEL unnamed protein product
Length=793

 Score = 26.2 bits (56),  Expect = 5.1, Method: Composition-based stats.
 Identities = 11/30 (37%), Positives = 18/30 (60%), Gaps = 0/30 (0%)

Query  14   RLLTQARPQLDVFLKYAKVELTPPTPADIP  43
            RL T+A+ QL+  +K+  V   P T  ++P
Sbjct  256  RLSTRAQSQLNAMVKHLFVPAAPTTSTEVP  285



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110326.1 voltage-dependent L-type calcium channel subunit
beta-4 isoform X1 [Drosophila elegans]

Length=606
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9ND67_DROME  unnamed protein product                                 1196    0.0  
M9NEF5_DROME  unnamed protein product                                 1123    0.0  
Q7KTE8_DROME  unnamed protein product                                 925     0.0  


>M9ND67_DROME unnamed protein product
Length=745

 Score = 1196 bits (3094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/606 (97%), Positives = 589/606 (97%), Gaps = 13/606 (2%)

Query  1    MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK  60
            MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK
Sbjct  1    MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK  60

Query  61   ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE  120
            ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE
Sbjct  61   ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE  120

Query  121  KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA  180
            KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA
Sbjct  121  KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA  180

Query  181  EPSRGSTPPTPGDESDSMGPGRHGKTPVASANKEKRKPFFKKQETASPYDVVPSMRPVVL  240
            EPSR           DSMGPGRHGKTP A+ANKEKRKPFFKKQETASPYDVVPSMRPVVL
Sbjct  181  EPSR-----------DSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVL  229

Query  241  VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS  300
            VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS
Sbjct  230  VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS  289

Query  301  SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ  360
            SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ
Sbjct  290  SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ  349

Query  361  RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH  420
            RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH
Sbjct  350  RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH  409

Query  421  PDIRAVPPIARPLPQEASPSADPTRLGPTPPGGSSYQHSRRQPTSVRHQERGGGVGAGGG  480
            PDIRAVPPIARPLPQEASPSADP RLGPTPPGG+SYQHSRRQPTSVRHQERGGGVGAGGG
Sbjct  410  PDIRAVPPIARPLPQEASPSADPARLGPTPPGGTSYQHSRRQPTSVRHQERGGGVGAGGG  469

Query  481  GGIGGGGVGYERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHL  540
            G  GG G GYERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHL
Sbjct  470  G--GGVGGGYERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHL  527

Query  541  SRGGRLLDDPDFEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSR  600
            SRGGRLL+DPDFEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSR
Sbjct  528  SRGGRLLEDPDFEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSR  587

Query  601  RMLNAM  606
            RMLNAM
Sbjct  588  RMLNAM  593


>M9NEF5_DROME unnamed protein product
Length=733

 Score = 1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/578 (96%), Positives = 559/578 (97%), Gaps = 10/578 (2%)

Query  29   SYQSGYNKLFTQGSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVR  88
            SY+   NK   +GSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVR
Sbjct  14   SYKPFRNK-NRRGSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVR  72

Query  89   TNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLD  148
            TNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLD
Sbjct  73   TNVAYDGAIDDDSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLD  132

Query  149  NIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPV  208
            NIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSRG       DESDSMGPGRHGKTP 
Sbjct  133  NIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSRG-------DESDSMGPGRHGKTPA  185

Query  209  ASANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEG  268
            A+ANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEG
Sbjct  186  AAANKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEG  245

Query  269  RIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVL  328
            RIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVL
Sbjct  246  RIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVL  305

Query  329  DCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCP  388
            DCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCP
Sbjct  306  DCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCP  365

Query  389  PDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPTRLGP  448
            PDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADP RLGP
Sbjct  366  PDMFDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPARLGP  425

Query  449  TPPGGSSYQHSRRQPTSVRHQERGGGVGAGGGGGIGGGGVGYERDRERERYERRERDLMH  508
            TPPGG+SYQHSRRQPTSVRHQERGGGVGAGGGG  GG G GYERDRERERYERRERDLMH
Sbjct  426  TPPGGTSYQHSRRQPTSVRHQERGGGVGAGGGG--GGVGGGYERDRERERYERRERDLMH  483

Query  509  YDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLDDPDFEREEAQMRMSSSRYGP  568
            YDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLL+DPDFEREEAQMRMSSSRYGP
Sbjct  484  YDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLEDPDFEREEAQMRMSSSRYGP  543

Query  569  STRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAM  606
            STRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAM
Sbjct  544  STRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAM  581


>Q7KTE8_DROME unnamed protein product
Length=466

 Score = 925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/452 (99%), Positives = 449/452 (99%), Gaps = 0/452 (0%)

Query  1    MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK  60
            MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK
Sbjct  1    MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK  60

Query  61   ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE  120
            ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE
Sbjct  61   ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE  120

Query  121  KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA  180
            KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA
Sbjct  121  KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA  180

Query  181  EPSRGSTPPTPGDESDSMGPGRHGKTPVASANKEKRKPFFKKQETASPYDVVPSMRPVVL  240
            EPSRGSTPPTPGDESDSMGPGRHGKTP A+ANKEKRKPFFKKQETASPYDVVPSMRPVVL
Sbjct  181  EPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVL  240

Query  241  VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS  300
            VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS
Sbjct  241  VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS  300

Query  301  SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ  360
            SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ
Sbjct  301  SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ  360

Query  361  RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH  420
            RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH
Sbjct  361  RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH  420

Query  421  PDIRAVPPIARPLPQEASPSADPTRLGPTPPG  452
            PDIRAVPPIARPLPQEASPSADP RLGPTPP 
Sbjct  421  PDIRAVPPIARPLPQEASPSADPARLGPTPPA  452



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110327.1 voltage-dependent L-type calcium channel subunit
beta-2 isoform X2 [Drosophila elegans]

Length=925
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PD84_DROME  unnamed protein product                                 1661    0.0  
Q7KTE7_DROME  unnamed protein product                                 1345    0.0  
M9PCW6_DROME  unnamed protein product                                 1118    0.0  


>M9PD84_DROME unnamed protein product
Length=844

 Score = 1661 bits (4301),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 817/850 (96%), Positives = 830/850 (98%), Gaps = 7/850 (1%)

Query  77   MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK  136
            MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK
Sbjct  1    MVQRASSSDAPSVQGGQHRESRFGLGYPSYQSGYNKLFTQGSADSNYSQPSSDLSLDEEK  60

Query  137  ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE  196
            ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE
Sbjct  61   ESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDDDSPVQGGAVSFEIREFLHIKE  120

Query  197  KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA  256
            KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA
Sbjct  121  KYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPSRLYGTKGSSSGNLGAGGQAGA  180

Query  257  EPSRGSTPPTPGDESDSMGPGRHGKTPVASANKEKRKPFFKKQETASPYDVVPSMRPVVL  316
            EPSRGSTPPTPGDESDSMGPGRHGKTP A+ANKEKRKPFFKKQETASPYDVVPSMRPVVL
Sbjct  181  EPSRGSTPPTPGDESDSMGPGRHGKTPAAAANKEKRKPFFKKQETASPYDVVPSMRPVVL  240

Query  317  VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS  376
            VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS
Sbjct  241  VGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADISLAKRSIMNNPSKRAIMERSS  300

Query  377  SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ  436
            SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ
Sbjct  301  SRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQ  360

Query  437  RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH  496
            RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH
Sbjct  361  RLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDENQLEDACEHIAEYLETYWKATH  420

Query  497  PDIRAVPPIARPLPQEASPSADPTRLGPTPPVDGEEFIDEQDPRMGISGGEREGSRERDR  556
            PDIRAVPPIARPLPQEASPSADP RLGPTPPVDGEEF+DEQDPRMG+SGG+REGSRERDR
Sbjct  421  PDIRAVPPIARPLPQEASPSADPARLGPTPPVDGEEFVDEQDPRMGMSGGDREGSRERDR  480

Query  557  DSRERERERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQG  616
            DSRERERERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQG
Sbjct  481  DSRERERERERERDYWDREFNRDRSSKDRERDLEWERERAREWERERERDWDREFDWDQG  540

Query  617  GSSYQHSRRQPTSVRHQERGGGVGAGGGGGIGGGGVGYERDRERERYERRERDLMHYDLN  676
            G+SYQHSRRQPTSVRHQERGGGVGAGGGG  GG G GYERDRERERYERRERDLMHYDLN
Sbjct  541  GTSYQHSRRQPTSVRHQERGGGVGAGGGG--GGVGGGYERDRERERYERRERDLMHYDLN  598

Query  677  SDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLDDPDFEREEAQMRMSSSRYGPSTRI  736
            SDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLL+DPDFEREEAQMRMSSSRYGPSTRI
Sbjct  599  SDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLEDPDFEREEAQMRMSSSRYGPSTRI  658

Query  737  DDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLGLPRQSSLPSNRAPVSYLPRQS  796
            DDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLGLPRQSSLPSNRAPVSYLPRQS
Sbjct  659  DDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLGLPRQSSLPSNRAPVSYLPRQS  718

Query  797  SLGTHWLSSSSQSTLEPGHRSRQELYPLLHQPQSYPQARSHYT-HLYTAAPQHPNQSRSQ  855
            SLGTHWLSSSSQS L+ G +SR+ELYPLLHQPQSY Q RS YT H YT+APQH +QSRSQ
Sbjct  719  SLGTHWLSSSSQSNLDQGPQSRRELYPLLHQPQSYSQPRSQYTSHSYTSAPQHTSQSRSQ  778

Query  856  SQSQSQSQSHGHSQYRYAVQDTSFAHPPRTLREEFLSPTMSKVEAVTHAIRNKIIVEEDE  915
            SQS SQS    HSQYRY+VQDTSFAHPPR+LREEFLSPTMSKVEAVTHAIRNKIIVEEDE
Sbjct  779  SQSHSQS----HSQYRYSVQDTSFAHPPRSLREEFLSPTMSKVEAVTHAIRNKIIVEEDE  834

Query  916  EDILSTDRFY  925
            EDILSTDRFY
Sbjct  835  EDILSTDRFY  844


>Q7KTE7_DROME unnamed protein product
Length=817

 Score = 1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 762/811 (94%), Positives = 776/811 (96%), Gaps = 18/811 (2%)

Query  116  QGSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDD  175
            +GSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDD
Sbjct  24   RGSADSNYSQPSSDLSLDEEKESLRREKERQALSQLDKARSKPVAFAVRTNVAYDGAIDD  83

Query  176  DSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPS  235
            DSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPS
Sbjct  84   DSPVQGGAVSFEIREFLHIKEKYDNNWWIGRLVKEGCDVGFIPSPAKLDNIRMQNQTRPS  143

Query  236  RLYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPVASANKEKRKPF  295
            RLYGTKGSSSGNLGAGGQAGAEPSR           DSMGPGRHGKTP A+ANKEKRKPF
Sbjct  144  RLYGTKGSSSGNLGAGGQAGAEPSR-----------DSMGPGRHGKTPAAAANKEKRKPF  192

Query  296  FKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADI  355
            FKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADI
Sbjct  193  FKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVMADI  252

Query  356  SLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQL  415
            SLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQL
Sbjct  253  SLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCDTINHPSQL  312

Query  416  AKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDEN  475
            AKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDEN
Sbjct  313  AKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDMFDVILDEN  372

Query  476  QLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPTRLGPTPPVDGEEFID  535
            QLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADP RLGPTPPVDGEEF+D
Sbjct  373  QLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPARLGPTPPVDGEEFVD  432

Query  536  EQDPRMGISGGEREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRERDLEWERER  595
            EQDPRMG+SGG+REGSRERDRDSRERERERERERDYWDREFNRDRSSKDRERDLEWERER
Sbjct  433  EQDPRMGMSGGDREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRERDLEWERER  492

Query  596  AREWERERERDWDREFDWDQGGSSYQHSRRQPTSVRHQERGGGVGAGGGGGIGGGGVGYE  655
            AREWERERERDWDREFDWDQGG+SYQHSRRQPTSVRHQERGGGVGAGGGGG  GGG   E
Sbjct  493  AREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERGGGVGAGGGGGGVGGGY--E  550

Query  656  RDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLDDPD  715
            RDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLL+DPD
Sbjct  551  RDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRGGRLLEDPD  610

Query  716  FEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLG  775
            FEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLG
Sbjct  611  FEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRMLNAMSRPLG  670

Query  776  LPRQSSLPSNRAPVSYLPRQSSLGTHWLSSSSQSTLEPGHRSRQELYPLLHQPQSYPQAR  835
            LPRQSSLPSNRAPVSYLPRQSSLGTHWLSSSSQS L+ G +SR+ELYPLLHQPQSY Q R
Sbjct  671  LPRQSSLPSNRAPVSYLPRQSSLGTHWLSSSSQSNLDQGPQSRRELYPLLHQPQSYSQPR  730

Query  836  SHYT-HLYTAAPQHPNQSRSQSQSQSQSQSHGHSQYRYAVQDTSFAHPPRTLREEFLSPT  894
            S YT H YT+AP    Q  SQS+SQSQS S  HSQYRY+VQDTSFAHPPR+LREEFLSPT
Sbjct  731  SQYTSHSYTSAP----QHTSQSRSQSQSHSQSHSQYRYSVQDTSFAHPPRSLREEFLSPT  786

Query  895  MSKVEAVTHAIRNKIIVEEDEEDILSTDRFY  925
            MSKVEAVTHAIRNKIIVEEDEEDILSTDRFY
Sbjct  787  MSKVEAVTHAIRNKIIVEEDEEDILSTDRFY  817


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 30/39 (77%), Gaps = 0/39 (0%)

Query  1   MKKLHLGAKHKGKSYKPFRNKNRRPTPPQPPSQQSSSSS  39
           MKKLHLGAKHKGKSYKPFRNKNRR +     SQ SS  S
Sbjct  1   MKKLHLGAKHKGKSYKPFRNKNRRGSADSNYSQPSSDLS  39


>M9PCW6_DROME unnamed protein product
Length=682

 Score = 1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/699 (93%), Positives = 664/699 (95%), Gaps = 18/699 (3%)

Query  228  MQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSRGSTPPTPGDESDSMGPGRHGKTPVASA  287
            MQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSR           DSMGPGRHGKTP A+A
Sbjct  1    MQNQTRPSRLYGTKGSSSGNLGAGGQAGAEPSR-----------DSMGPGRHGKTPAAAA  49

Query  288  NKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRII  347
            NKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRII
Sbjct  50   NKEKRKPFFKKQETASPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRII  109

Query  348  ITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCD  407
            ITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCD
Sbjct  110  ITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVVLDCD  169

Query  408  TINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDM  467
            TINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDM
Sbjct  170  TINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQCPPDM  229

Query  468  FDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPTRLGPTPP  527
            FDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADP RLGPTPP
Sbjct  230  FDVILDENQLEDACEHIAEYLETYWKATHPDIRAVPPIARPLPQEASPSADPARLGPTPP  289

Query  528  VDGEEFIDEQDPRMGISGGEREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRER  587
            VDGEEF+DEQDPRMG+SGG+REGSRERDRDSRERERERERERDYWDREFNRDRSSKDRER
Sbjct  290  VDGEEFVDEQDPRMGMSGGDREGSRERDRDSRERERERERERDYWDREFNRDRSSKDRER  349

Query  588  DLEWERERAREWERERERDWDREFDWDQGGSSYQHSRRQPTSVRHQERGGGVGAGGGGGI  647
            DLEWERERAREWERERERDWDREFDWDQGG+SYQHSRRQPTSVRHQERGGGVGAGGGGG 
Sbjct  350  DLEWERERAREWERERERDWDREFDWDQGGTSYQHSRRQPTSVRHQERGGGVGAGGGGGG  409

Query  648  GGGGVGYERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRG  707
             GGG   ERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRG
Sbjct  410  VGGGY--ERDRERERYERRERDLMHYDLNSDELLDERNFEYPAMRSGPSGASHHGHLSRG  467

Query  708  GRLLDDPDFEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRML  767
            GRLL+DPDFEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRML
Sbjct  468  GRLLEDPDFEREEAQMRMSSSRYGPSTRIDDPRDLPRGATVVDRDEYSPHRGGGSSRRML  527

Query  768  NAMSRPLGLPRQSSLPSNRAPVSYLPRQSSLGTHWLSSSSQSTLEPGHRSRQELYPLLHQ  827
            NAMSRPLGLPRQSSLPSNRAPVSYLPRQSSLGTHWLSSSSQS L+ G +SR+ELYPLLHQ
Sbjct  528  NAMSRPLGLPRQSSLPSNRAPVSYLPRQSSLGTHWLSSSSQSNLDQGPQSRRELYPLLHQ  587

Query  828  PQSYPQARSHYT-HLYTAAPQHPNQSRSQSQSQSQSQSHGHSQYRYAVQDTSFAHPPRTL  886
            PQSY Q RS YT H YT+AP    Q  SQS+SQSQS S  HSQYRY+VQDTSFAHPPR+L
Sbjct  588  PQSYSQPRSQYTSHSYTSAP----QHTSQSRSQSQSHSQSHSQYRYSVQDTSFAHPPRSL  643

Query  887  REEFLSPTMSKVEAVTHAIRNKIIVEEDEEDILSTDRFY  925
            REEFLSPTMSKVEAVTHAIRNKIIVEEDEEDILSTDRFY
Sbjct  644  REEFLSPTMSKVEAVTHAIRNKIIVEEDEEDILSTDRFY  682



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110328.1 uncharacterized protein LOC108134508 [Drosophila
elegans]

Length=259
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4FKF8_TRYB2  unnamed protein product                                 30.4    1.4  
Q9NI44_9TRYP  unnamed protein product                                 30.4    1.4  
Q8I507_PLAF7  unnamed protein product                                 29.6    2.9  


>Q4FKF8_TRYB2 unnamed protein product
Length=487

 Score = 30.4 bits (67),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  211  TSVGNPSALVPPVAQPAASGLPADSVDRLQAELL  244
            T++G P+A    VAQP  + LP DS++ L A+LL
Sbjct  236  TTLGAPAARGYSVAQPTQTKLPYDSMNALVAQLL  269


>Q9NI44_9TRYP unnamed protein product
Length=487

 Score = 30.4 bits (67),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  211  TSVGNPSALVPPVAQPAASGLPADSVDRLQAELL  244
            T++G P+A    VAQP  + LP DS++ L A+LL
Sbjct  236  TTLGAPAARGYSVAQPTQTKLPYDSMNALVAQLL  269


>Q8I507_PLAF7 unnamed protein product
Length=639

 Score = 29.6 bits (65),  Expect = 2.9, Method: Compositional matrix adjust.
 Identities = 25/81 (31%), Positives = 39/81 (48%), Gaps = 15/81 (19%)

Query  25   CSTAGCKVATVVDKTKRKCSQFISSP----YIMPKPLVVNGHTSIFQVGGEMAKMG-DIP  79
            C+T GC  +T +D  K+  +Q I S      I PKP +      IFQ+GG    M  + P
Sbjct  164  CATKGCMKSTPIDFIKKCNTQVILSNTFHLLIQPKPHI------IFQLGGLHKFMNWNSP  217

Query  80   ALSQATGGDGGQPVYRIKPGT  100
             L+ +    GG  ++ +  G+
Sbjct  218  ILTDS----GGYQIFSMSFGS  234



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110329.1 vitelline membrane protein Vm32E [Drosophila elegans]

Length=108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VTU4_DROME  unnamed protein product                                   134     3e-42
VTU1_DROME  unnamed protein product                                   65.9    7e-15
VTU2_DROME  unnamed protein product                                   62.0    4e-13


>VTU4_DROME unnamed protein product
Length=116

 Score = 134 bits (338),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 84/105 (80%), Gaps = 8/105 (8%)

Query  1    MKIVALIVSALVAFAGASCPNSGYSAP--------GYPAPPCPTNYLFSCQPNLAPAPCA  52
            M+IVAL + A VA AGASCP +  +          GYPAPPCPTNYLFSCQPNLAPAPCA
Sbjct  1    MQIVALTLVAFVAIAGASCPYAAPAPAYSAPAASSGYPAPPCPTNYLFSCQPNLAPAPCA  60

Query  53   QQSASYGSSGAYTEQVPLYVNNPNREQVQQFQQRIGMAALMEELR  97
            Q++ +YGS+GAYTEQVP YV +PNREQ+QQF QRIGMAALMEELR
Sbjct  61   QEAPAYGSAGAYTEQVPHYVGSPNREQLQQFHQRIGMAALMEELR  105


>VTU1_DROME unnamed protein product
Length=141

 Score = 65.9 bits (159),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 2/58 (3%)

Query  30   PAPPCPTNYLFSCQPNLAPAPCAQQSASYGSSGAYTEQVPLYVNNPNREQVQQFQQRI  87
            PAPPCP NYLFSCQPNLAP PC+  + SYGS+GAY+  V  YV  PN   V Q QQ++
Sbjct  73   PAPPCPKNYLFSCQPNLAPVPCSAPAPSYGSAGAYSSPVATYV-APNYG-VPQHQQQL  128


>VTU2_DROME unnamed protein product
Length=168

 Score = 62.0 bits (149),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 0/49 (0%)

Query  30   PAPPCPTNYLFSCQPNLAPAPCAQQSASYGSSGAYTEQVPLYVNNPNRE  78
            P+PPCP NYLFSCQP+L P PC+  + SYGS+GAY++ VP Y     RE
Sbjct  119  PSPPCPKNYLFSCQPSLQPVPCSAPAQSYGSAGAYSQYVPQYAVPFVRE  167



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110332.1 tubulin polyglutamylase TTLL4 isoform X1 [Drosophila
elegans]

Length=1092
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NEE5_DROME  unnamed protein product                                 1910    0.0  
Q8IPB2_DROME  unnamed protein product                                 1909    0.0  
Q9VKL9_DROME  unnamed protein product                                 1535    0.0  


>M9NEE5_DROME unnamed protein product
Length=1070

 Score = 1910 bits (4947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 949/1089 (87%), Positives = 1001/1089 (92%), Gaps = 33/1089 (3%)

Query  1     MRNNSGY----SNSLNNNAAAAPAPAPAPASRYCNADNTFCYYNYDNCNLIAPSWSSRQG  56
             MRNNSGY    SNSLNNN A        PASRYCNADNTFCYY+YDNCNLIAP+W +RQ 
Sbjct  1     MRNNSGYHIPASNSLNNNGA--------PASRYCNADNTFCYYSYDNCNLIAPAWGNRQ-  51

Query  57    QSQSQNQNQVPNQNHNLPSKRIPTKQAARSNYHQSVANSAPDSSHYADAFGQHSLVHQRI  116
                +QNQN VPNQNHNLP+KRIPTKQ+ARS+YHQS ANSAPDSS + DAFGQ SLV+QRI
Sbjct  52    ---NQNQNSVPNQNHNLPTKRIPTKQSARSSYHQSAANSAPDSSLFTDAFGQQSLVNQRI  108

Query  117   AGNKSCEYVYQTVRRSEDQHPHPHQHSNGQYKVTTRAYVADKEQQQ-MLLQSSIVNFDDP  175
             AGNKSCEYVYQTV+RSEDQH      SN QYK   R+Y  DKEQQQ MLLQ SIV FD  
Sbjct  109   AGNKSCEYVYQTVQRSEDQH------SNRQYK-QARSYAVDKEQQQQMLLQPSIVYFD-A  160

Query  176   ELKKRKARAAGRVSSDYLDNSPERYRALNSHSPEPTWDTILTERPAQYQTTNQHYQHYFS  235
             ELKKRK R  GRVS+DY+DNSP+RYR LNS SPEPTWD IL+ERP QYQTTNQHYQHYFS
Sbjct  161   ELKKRKDRG-GRVSNDYVDNSPDRYRPLNSPSPEPTWDNILSERPVQYQTTNQHYQHYFS  219

Query  236   YFYNRGAEKVSKPQFVVANSRKLPMSKFQKSGSSRRELRDVDDTITIGRRDNSEDRSWQS  295
             YFYNRGAEK+SKP F  ANSRK+PMSKFQK+G+SRR+ R+VD T+ IGRRDNSEDR+WQ 
Sbjct  220   YFYNRGAEKLSKPTFAAANSRKVPMSKFQKAGASRRDSREVDGTVIIGRRDNSEDRTWQG  279

Query  296   PKYDKHVLKEKLPSNDVEADYLDNGWG-ETGSGEDYRDIKDGYDPAIVIDNDLDQV--HR  352
              KY+KHVLKEKLPSND++ADYLDNGWG + GS +DYRDIKD YDP +VIDN L+QV  HR
Sbjct  280   QKYEKHVLKEKLPSNDLKADYLDNGWGGDPGSEDDYRDIKDSYDPVVVIDNGLEQVGVHR  339

Query  353   RYCRKSENTVLDDAADTLINNNNNEMKVMRKSTDQPAPRLPMTPKRVKGGAVSAKKPMPT  412
             RYCR +ENTVLD + DTLINNNNNE+K+MRKSTDQP PRLPMTPKR KGG VS KKPMPT
Sbjct  340   RYCRMTENTVLDGSGDTLINNNNNELKIMRKSTDQPMPRLPMTPKRAKGGTVSTKKPMPT  399

Query  413   VHRVLLYSTQSPRMGRKQPFSSQRLSIKQQNTKSLGGGDEGQTVILLEPETKPEDHRSAI  472
             VHRVLLYSTQSPR+GRKQ FS+QRLS+KQQ++K LG GDE QTV+LLEPE K EDHRSAI
Sbjct  400   VHRVLLYSTQSPRLGRKQQFSTQRLSVKQQSSKVLGAGDERQTVLLLEPEHKQEDHRSAI  459

Query  473   DFDRNDDFDEDDDLDNLSNFDESDTASVISDTEDGYRAHAYKLTHSVDRFSSPQSTPSFM  532
             DFDRNDDFDEDDDLDNLSNFDESDTASV+SDTEDGYRAHA+KLTHSVDRFSSPQSTPSF+
Sbjct  460   DFDRNDDFDEDDDLDNLSNFDESDTASVLSDTEDGYRAHAFKLTHSVDRFSSPQSTPSFL  519

Query  533   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKKGPRVPPDLHRVLKWRITNIMPKVV  592
             SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTK+GPRVPPDLHRVLKWRITNIMPKVV
Sbjct  520   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVV  579

Query  593   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  652
             RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ
Sbjct  580   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  639

Query  653   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYSQRNTKWIIKPPASARGAGIRVINRW  712
             RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKY+QRNTKWIIKPPASARGAGIRVINRW
Sbjct  640   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRW  699

Query  713   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  772
             GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK
Sbjct  700   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  759

Query  773   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  832
             TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL
Sbjct  760   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  819

Query  833   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  892
             RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL
Sbjct  820   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  879

Query  893   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  952
             PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE
Sbjct  880   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  939

Query  953   EKVKHNTFTRKSMEDRNEYVNAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTYKY  1012
             EK+KHNTFTRKSMEDRNEYV+AILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQT+KY
Sbjct  940   EKIKHNTFTRKSMEDRNEYVDAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTHKY  999

Query  1013  LKYNDSPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK----YIEGD  1068
             LKYND+PRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK    +I   
Sbjct  1000  LKYNDTPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKKVRSLFINSA  1059

Query  1069  HTAYSLHLS  1077
                +  HL+
Sbjct  1060  EAFHKTHLN  1068


>Q8IPB2_DROME unnamed protein product
Length=1071

 Score = 1909 bits (4944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1071 (88%), Positives = 995/1071 (93%), Gaps = 29/1071 (3%)

Query  1     MRNNSGY----SNSLNNNAAAAPAPAPAPASRYCNADNTFCYYNYDNCNLIAPSWSSRQG  56
             MRNNSGY    SNSLNNN A        PASRYCNADNTFCYY+YDNCNLIAP+W +RQ 
Sbjct  1     MRNNSGYHIPASNSLNNNGA--------PASRYCNADNTFCYYSYDNCNLIAPAWGNRQ-  51

Query  57    QSQSQNQNQVPNQNHNLPSKRIPTKQAARSNYHQSVANSAPDSSHYADAFGQHSLVHQRI  116
                +QNQN VPNQNHNLP+KRIPTKQ+ARS+YHQS ANSAPDSS + DAFGQ SLV+QRI
Sbjct  52    ---NQNQNSVPNQNHNLPTKRIPTKQSARSSYHQSAANSAPDSSLFTDAFGQQSLVNQRI  108

Query  117   AGNKSCEYVYQTVRRSEDQHPHPHQHSNGQYKVTTRAYVADKEQQQ-MLLQSSIVNFDDP  175
             AGNKSCEYVYQTV+RSEDQH      SN QYK   R+Y  DKEQQQ MLLQ SIV FD  
Sbjct  109   AGNKSCEYVYQTVQRSEDQH------SNRQYK-QARSYAVDKEQQQQMLLQPSIVYFD-A  160

Query  176   ELKKRKARAAGRVSSDYLDNSPERYRALNSHSPEPTWDTILTERPAQYQTTNQHYQHYFS  235
             ELKKRK R  GRVS+DY+DNSP+RYR LNS SPEPTWD IL+ERP QYQTTNQHYQHYFS
Sbjct  161   ELKKRKDRG-GRVSNDYVDNSPDRYRPLNSPSPEPTWDNILSERPVQYQTTNQHYQHYFS  219

Query  236   YFYNRGAEKVSKPQFVVANSRKLPMSKFQKSGSSRRELRDVDDTITIGRRDNSEDRSWQS  295
             YFYNRGAEK+SKP F  ANSRK+PMSKFQK+G+SRR+ R+VD T+ IGRRDNSEDR+WQ 
Sbjct  220   YFYNRGAEKLSKPTFAAANSRKVPMSKFQKAGASRRDSREVDGTVIIGRRDNSEDRTWQG  279

Query  296   PKYDKHVLKEKLPSNDVEADYLDNGWG-ETGSGEDYRDIKDGYDPAIVIDNDLDQV--HR  352
              KY+KHVLKEKLPSND++ADYLDNGWG + GS +DYRDIKD YDP +VIDN L+QV  HR
Sbjct  280   QKYEKHVLKEKLPSNDLKADYLDNGWGGDPGSEDDYRDIKDSYDPVVVIDNGLEQVGVHR  339

Query  353   RYCRKSENTVLDDAADTLINNNNNEMKVMRKSTDQPAPRLPMTPKRVKGGAVSAKKPMPT  412
             RYCR +ENTVLD + DTLINNNNNE+K+MRKSTDQP PRLPMTPKR KGG VS KKPMPT
Sbjct  340   RYCRMTENTVLDGSGDTLINNNNNELKIMRKSTDQPMPRLPMTPKRAKGGTVSTKKPMPT  399

Query  413   VHRVLLYSTQSPRMGRKQPFSSQRLSIKQQNTKSLGGGDEGQTVILLEPETKPEDHRSAI  472
             VHRVLLYSTQSPR+GRKQ FS+QRLS+KQQ++K LG GDE QTV+LLEPE K EDHRSAI
Sbjct  400   VHRVLLYSTQSPRLGRKQQFSTQRLSVKQQSSKVLGAGDERQTVLLLEPEHKQEDHRSAI  459

Query  473   DFDRNDDFDEDDDLDNLSNFDESDTASVISDTEDGYRAHAYKLTHSVDRFSSPQSTPSFM  532
             DFDRNDDFDEDDDLDNLSNFDESDTASV+SDTEDGYRAHA+KLTHSVDRFSSPQSTPSF+
Sbjct  460   DFDRNDDFDEDDDLDNLSNFDESDTASVLSDTEDGYRAHAFKLTHSVDRFSSPQSTPSFL  519

Query  533   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKKGPRVPPDLHRVLKWRITNIMPKVV  592
             SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTK+GPRVPPDLHRVLKWRITNIMPKVV
Sbjct  520   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVV  579

Query  593   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  652
             RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ
Sbjct  580   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  639

Query  653   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYSQRNTKWIIKPPASARGAGIRVINRW  712
             RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKY+QRNTKWIIKPPASARGAGIRVINRW
Sbjct  640   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRW  699

Query  713   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  772
             GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK
Sbjct  700   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  759

Query  773   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  832
             TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL
Sbjct  760   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  819

Query  833   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  892
             RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL
Sbjct  820   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  879

Query  893   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  952
             PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE
Sbjct  880   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  939

Query  953   EKVKHNTFTRKSMEDRNEYVNAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTYKY  1012
             EK+KHNTFTRKSMEDRNEYV+AILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQT+KY
Sbjct  940   EKIKHNTFTRKSMEDRNEYVDAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTHKY  999

Query  1013  LKYNDSPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK  1063
             LKYND+PRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK
Sbjct  1000  LKYNDTPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK  1050


>Q9VKL9_DROME unnamed protein product
Length=828

 Score = 1535 bits (3975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 749/807 (93%), Positives = 781/807 (97%), Gaps = 3/807 (0%)

Query  260   MSKFQKSGSSRRELRDVDDTITIGRRDNSEDRSWQSPKYDKHVLKEKLPSNDVEADYLDN  319
             MSKFQK+G+SRR+ R+VD T+ IGRRDNSEDR+WQ  KY+KHVLKEKLPSND++ADYLDN
Sbjct  1     MSKFQKAGASRRDSREVDGTVIIGRRDNSEDRTWQGQKYEKHVLKEKLPSNDLKADYLDN  60

Query  320   GWG-ETGSGEDYRDIKDGYDPAIVIDNDLDQV--HRRYCRKSENTVLDDAADTLINNNNN  376
             GWG + GS +DYRDIKD YDP +VIDN L+QV  HRRYCR +ENTVLD + DTLINNNNN
Sbjct  61    GWGGDPGSEDDYRDIKDSYDPVVVIDNGLEQVGVHRRYCRMTENTVLDGSGDTLINNNNN  120

Query  377   EMKVMRKSTDQPAPRLPMTPKRVKGGAVSAKKPMPTVHRVLLYSTQSPRMGRKQPFSSQR  436
             E+K+MRKSTDQP PRLPMTPKR KGG VS KKPMPTVHRVLLYSTQSPR+GRKQ FS+QR
Sbjct  121   ELKIMRKSTDQPMPRLPMTPKRAKGGTVSTKKPMPTVHRVLLYSTQSPRLGRKQQFSTQR  180

Query  437   LSIKQQNTKSLGGGDEGQTVILLEPETKPEDHRSAIDFDRNDDFDEDDDLDNLSNFDESD  496
             LS+KQQ++K LG GDE QTV+LLEPE K EDHRSAIDFDRNDDFDEDDDLDNLSNFDESD
Sbjct  181   LSVKQQSSKVLGAGDERQTVLLLEPEHKQEDHRSAIDFDRNDDFDEDDDLDNLSNFDESD  240

Query  497   TASVISDTEDGYRAHAYKLTHSVDRFSSPQSTPSFMSSQSSEDDLKNPDSLLVPSLFPYV  556
             TASV+SDTEDGYRAHA+KLTHSVDRFSSPQSTPSF+SSQSSEDDLKNPDSLLVPSLFPYV
Sbjct  241   TASVLSDTEDGYRAHAFKLTHSVDRFSSPQSTPSFLSSQSSEDDLKNPDSLLVPSLFPYV  300

Query  557   PPYLSFSSNTKKGPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGK  616
             PPYLSFSSNTK+GPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGK
Sbjct  301   PPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGK  360

Query  617   HLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDL  676
             HLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDL
Sbjct  361   HLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDL  420

Query  677   GALRRHWPKYSQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGS  736
             GALRRHWPKY+QRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGS
Sbjct  421   GALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGS  480

Query  737   KFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYS  796
             KFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYS
Sbjct  481   KFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYS  540

Query  797   KNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVE  856
             KNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVE
Sbjct  541   KNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVE  600

Query  857   SKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPP  916
             SKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPP
Sbjct  601   SKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPP  660

Query  917   KLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEKVKHNTFTRKSMEDRNEYVNAIL  976
             KLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEK+KHNTFTRKSMEDRNEYV+AIL
Sbjct  661   KLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEKIKHNTFTRKSMEDRNEYVDAIL  720

Query  977   NNLTPDDVRCLIIAEDELARCAPLERIFPTDQTYKYLKYNDSPRYYNRLLDAWESRYANN  1036
             NNLTPDDVRCLIIAEDELARCAPLERIFPTDQT+KYLKYND+PRYYNRLLDAWESRYANN
Sbjct  721   NNLTPDDVRCLIIAEDELARCAPLERIFPTDQTHKYLKYNDTPRYYNRLLDAWESRYANN  780

Query  1037  RTEGIALLRDYCQNKYHLQVPTPPAKK  1063
             RTEGIALLRDYCQNKYHLQVPTPPAKK
Sbjct  781   RTEGIALLRDYCQNKYHLQVPTPPAKK  807



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


Query= XP_017110333.1 E3 ubiquitin-protein ligase RNF123 [Drosophila
elegans]

Length=1333
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7WN66_CAEEL  unnamed protein product                                 75.9    2e-13
I2HAA7_CAEEL  unnamed protein product                                 75.9    2e-13
Q94279_CAEEL  unnamed protein product                                 75.9    2e-13


>B7WN66_CAEEL unnamed protein product
Length=5085

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 10/135 (7%)

Query  123   VRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQFNENSGVGDTKCSYGYDGSKQQIWHI  182
               A   V GG+W +E  + T G M+IGW           G  D   SY +DG   + WH 
Sbjct  1082  AEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDR--SYAFDGYLGRKWHQ  1139

Query  183   STKKYGDKWQIGDVIGVTIDVEKEVIEYYRNGRSM------GVAFNKLEKGPGITFFAAI  236
               + YG +W+IGDV+G  +D+    I +  NG  +       +AF+ +  G G+    A+
Sbjct  1140  GAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLV--PAM  1197

Query  237   SLGYTQGIGANFGNR  251
             +LG  Q    NFG +
Sbjct  1198  TLGSGQRGRLNFGQQ  1212


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 70/153 (46%), Gaps = 26/153 (17%)

Query  133  RWMYE-----IHLHTKGV--MQIGWASNSCQFNE---------NSGVGDTKCSYGYDGSK  176
            +W +E     I   TK    ++IGWA NS  F            +GVGD   SYG+DG K
Sbjct  670  KWYFEAEVEHIETMTKQTPYLRIGWA-NSVGFKPFPGSGDKMGCNGVGDDFYSYGFDG-K  727

Query  177  QQIWHISTKKYGDKW-QIGDVIGVTIDVEKEVIEYYRNGRSMGVAFNKLEKG----PGIT  231
               +   +++ G K  + GDVIG +ID+    I++  NG  M  +F K        P ++
Sbjct  728  SMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMS  787

Query  232  FFAAISLGYTQGIGANFGNRPFMYPVAGFQPLM  264
              A +S  +   +G N G R    P  GF  ++
Sbjct  788  LSAKVSCRFI--LGGNQG-RLRYGPPTGFSAVV  817


>I2HAA7_CAEEL unnamed protein product
Length=5071

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/135 (32%), Positives = 64/135 (47%), Gaps = 10/135 (7%)

Query  123   VRANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQFNENSGVGDTKCSYGYDGSKQQIWHI  182
               A   V GG+W +E  + T G M+IGW           G  D   SY +DG   + WH 
Sbjct  1082  AEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDR--SYAFDGYLGRKWHQ  1139

Query  183   STKKYGDKWQIGDVIGVTIDVEKEVIEYYRNGRSM------GVAFNKLEKGPGITFFAAI  236
               + YG +W+IGDV+G  +D+    I +  NG  +       +AF+ +  G G+    A+
Sbjct  1140  GAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLV--PAM  1197

Query  237   SLGYTQGIGANFGNR  251
             +LG  Q    NFG +
Sbjct  1198  TLGSGQRGRLNFGQQ  1212


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 70/153 (46%), Gaps = 26/153 (17%)

Query  133  RWMYE-----IHLHTKGV--MQIGWASNSCQFNE---------NSGVGDTKCSYGYDGSK  176
            +W +E     I   TK    ++IGWA NS  F            +GVGD   SYG+DG K
Sbjct  670  KWYFEAEVEHIETMTKQTPYLRIGWA-NSVGFKPFPGSGDKMGCNGVGDDFYSYGFDG-K  727

Query  177  QQIWHISTKKYGDKW-QIGDVIGVTIDVEKEVIEYYRNGRSMGVAFNKLEKG----PGIT  231
               +   +++ G K  + GDVIG +ID+    I++  NG  M  +F K        P ++
Sbjct  728  SMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMS  787

Query  232  FFAAISLGYTQGIGANFGNRPFMYPVAGFQPLM  264
              A +S  +   +G N G R    P  GF  ++
Sbjct  788  LSAKVSCRFI--LGGNQG-RLRYGPPTGFSAVV  817


>Q94279_CAEEL unnamed protein product
Length=5201

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 64/133 (48%), Gaps = 10/133 (8%)

Query  125   ANCCVYGGRWMYEIHLHTKGVMQIGWASNSCQFNENSGVGDTKCSYGYDGSKQQIWHIST  184
             A   V GG+W +E  + T G M+IGW           G  D   SY +DG   + WH   
Sbjct  1084  ATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGADDR--SYAFDGYLGRKWHQGA  1141

Query  185   KKYGDKWQIGDVIGVTIDVEKEVIEYYRNGRSM------GVAFNKLEKGPGITFFAAISL  238
             + YG +W+IGDV+G  +D+    I +  NG  +       +AF+ +  G G+    A++L
Sbjct  1142  ETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLV--PAMTL  1199

Query  239   GYTQGIGANFGNR  251
             G  Q    NFG +
Sbjct  1200  GSGQRGRLNFGQQ  1212


 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/153 (31%), Positives = 70/153 (46%), Gaps = 26/153 (17%)

Query  133  RWMYE-----IHLHTKGV--MQIGWASNSCQFNE---------NSGVGDTKCSYGYDGSK  176
            +W +E     I   TK    ++IGWA NS  F            +GVGD   SYG+DG K
Sbjct  670  KWYFEAEVEHIETMTKQTPYLRIGWA-NSVGFKPFPGSGDKMGCNGVGDDFYSYGFDG-K  727

Query  177  QQIWHISTKKYGDKW-QIGDVIGVTIDVEKEVIEYYRNGRSMGVAFNKLEKG----PGIT  231
               +   +++ G K  + GDVIG +ID+    I++  NG  M  +F K        P ++
Sbjct  728  SMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMS  787

Query  232  FFAAISLGYTQGIGANFGNRPFMYPVAGFQPLM  264
              A +S  +   +G N G R    P  GF  ++
Sbjct  788  LSAKVSCRFI--LGGNQG-RLRYGPPTGFSAVV  817



Lambda      K        H
   0.302    0.114    0.307 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 12143787370


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110334.1 tubulin polyglutamylase TTLL4 isoform X2 [Drosophila
elegans]

Length=1084
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IPB2_DROME  unnamed protein product                                 1923    0.0  
M9NEE5_DROME  unnamed protein product                                 1907    0.0  
Q9VKL9_DROME  unnamed protein product                                 1551    0.0  


>Q8IPB2_DROME unnamed protein product
Length=1071

 Score = 1923 bits (4982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 954/1092 (87%), Positives = 1007/1092 (92%), Gaps = 29/1092 (3%)

Query  1     MRNNSGY----SNSLNNNAAAAPAPAPAPASRYCNADNTFCYYNYDNCNLIAPSWSSRQG  56
             MRNNSGY    SNSLNNN A        PASRYCNADNTFCYY+YDNCNLIAP+W +RQ 
Sbjct  1     MRNNSGYHIPASNSLNNNGA--------PASRYCNADNTFCYYSYDNCNLIAPAWGNRQ-  51

Query  57    QSQSQNQNQVPNQNHNLPSKRIPTKQAARSNYHQSVANSAPDSSHYADAFGQHSLVHQRI  116
                +QNQN VPNQNHNLP+KRIPTKQ+ARS+YHQS ANSAPDSS + DAFGQ SLV+QRI
Sbjct  52    ---NQNQNSVPNQNHNLPTKRIPTKQSARSSYHQSAANSAPDSSLFTDAFGQQSLVNQRI  108

Query  117   AGNKSCEYVYQTVRRSEDQHPHPHQHSNGQYKVTTRAYVADKEQQQ-MLLQSSIVNFDDP  175
             AGNKSCEYVYQTV+RSEDQH      SN QYK   R+Y  DKEQQQ MLLQ SIV FD  
Sbjct  109   AGNKSCEYVYQTVQRSEDQH------SNRQYK-QARSYAVDKEQQQQMLLQPSIVYFD-A  160

Query  176   ELKKRKARAAGRVSSDYLDNSPERYRALNSHSPEPTWDTILTERPAQYQTTNQHYQHYFS  235
             ELKKRK R  GRVS+DY+DNSP+RYR LNS SPEPTWD IL+ERP QYQTTNQHYQHYFS
Sbjct  161   ELKKRKDRG-GRVSNDYVDNSPDRYRPLNSPSPEPTWDNILSERPVQYQTTNQHYQHYFS  219

Query  236   YFYNRGAEKVSKPQFVVANSRKLPMSKFQKSGSSRRELRDVDDTITIGRRDNSEDRSWQS  295
             YFYNRGAEK+SKP F  ANSRK+PMSKFQK+G+SRR+ R+VD T+ IGRRDNSEDR+WQ 
Sbjct  220   YFYNRGAEKLSKPTFAAANSRKVPMSKFQKAGASRRDSREVDGTVIIGRRDNSEDRTWQG  279

Query  296   PKYDKHVLKEKLPSNDVEADYLDNGWG-ETGSGEDYRDIKDGYDPAIVIDNDLDQV--HR  352
              KY+KHVLKEKLPSND++ADYLDNGWG + GS +DYRDIKD YDP +VIDN L+QV  HR
Sbjct  280   QKYEKHVLKEKLPSNDLKADYLDNGWGGDPGSEDDYRDIKDSYDPVVVIDNGLEQVGVHR  339

Query  353   RYCRKSENTVLDDAADTLINNNNNEMKVMRKSTDQPAPRLPMTPKRVKGGAVSAKKPMPT  412
             RYCR +ENTVLD + DTLINNNNNE+K+MRKSTDQP PRLPMTPKR KGG VS KKPMPT
Sbjct  340   RYCRMTENTVLDGSGDTLINNNNNELKIMRKSTDQPMPRLPMTPKRAKGGTVSTKKPMPT  399

Query  413   VHRVLLYSTQSPRMGRKQPFSSQRLSIKQQNTKSLGGGDEGQTVILLEPETKPEDHRSAI  472
             VHRVLLYSTQSPR+GRKQ FS+QRLS+KQQ++K LG GDE QTV+LLEPE K EDHRSAI
Sbjct  400   VHRVLLYSTQSPRLGRKQQFSTQRLSVKQQSSKVLGAGDERQTVLLLEPEHKQEDHRSAI  459

Query  473   DFDRNDDFDEDDDLDNLSNFDESDTASVISDTEDGYRAHAYKLTHSVDRFSSPQSTPSFM  532
             DFDRNDDFDEDDDLDNLSNFDESDTASV+SDTEDGYRAHA+KLTHSVDRFSSPQSTPSF+
Sbjct  460   DFDRNDDFDEDDDLDNLSNFDESDTASVLSDTEDGYRAHAFKLTHSVDRFSSPQSTPSFL  519

Query  533   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKKGPRVPPDLHRVLKWRITNIMPKVV  592
             SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTK+GPRVPPDLHRVLKWRITNIMPKVV
Sbjct  520   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVV  579

Query  593   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  652
             RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ
Sbjct  580   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  639

Query  653   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYSQRNTKWIIKPPASARGAGIRVINRW  712
             RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKY+QRNTKWIIKPPASARGAGIRVINRW
Sbjct  640   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRW  699

Query  713   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  772
             GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK
Sbjct  700   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  759

Query  773   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  832
             TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL
Sbjct  760   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  819

Query  833   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  892
             RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL
Sbjct  820   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  879

Query  893   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  952
             PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE
Sbjct  880   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  939

Query  953   EKVKHNTFTRKSMEDRNEYVNAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTYKY  1012
             EK+KHNTFTRKSMEDRNEYV+AILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQT+KY
Sbjct  940   EKIKHNTFTRKSMEDRNEYVDAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTHKY  999

Query  1013  LKYNDSPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKKDLNDEEIIL  1072
             LKYND+PRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKKD NDEE   
Sbjct  1000  LKYNDTPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKKDSNDEETTP  1059

Query  1073  VAPKTIGDDSEA  1084
               P T+ ++ E+
Sbjct  1060  ATPNTVKEEIES  1071


>M9NEE5_DROME unnamed protein product
Length=1070

 Score = 1907 bits (4939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 946/1071 (88%), Positives = 995/1071 (93%), Gaps = 29/1071 (3%)

Query  1     MRNNSGY----SNSLNNNAAAAPAPAPAPASRYCNADNTFCYYNYDNCNLIAPSWSSRQG  56
             MRNNSGY    SNSLNNN A        PASRYCNADNTFCYY+YDNCNLIAP+W +RQ 
Sbjct  1     MRNNSGYHIPASNSLNNNGA--------PASRYCNADNTFCYYSYDNCNLIAPAWGNRQ-  51

Query  57    QSQSQNQNQVPNQNHNLPSKRIPTKQAARSNYHQSVANSAPDSSHYADAFGQHSLVHQRI  116
                +QNQN VPNQNHNLP+KRIPTKQ+ARS+YHQS ANSAPDSS + DAFGQ SLV+QRI
Sbjct  52    ---NQNQNSVPNQNHNLPTKRIPTKQSARSSYHQSAANSAPDSSLFTDAFGQQSLVNQRI  108

Query  117   AGNKSCEYVYQTVRRSEDQHPHPHQHSNGQYKVTTRAYVADKEQQQ-MLLQSSIVNFDDP  175
             AGNKSCEYVYQTV+RSEDQH      SN QYK   R+Y  DKEQQQ MLLQ SIV FD  
Sbjct  109   AGNKSCEYVYQTVQRSEDQH------SNRQYK-QARSYAVDKEQQQQMLLQPSIVYFD-A  160

Query  176   ELKKRKARAAGRVSSDYLDNSPERYRALNSHSPEPTWDTILTERPAQYQTTNQHYQHYFS  235
             ELKKRK R  GRVS+DY+DNSP+RYR LNS SPEPTWD IL+ERP QYQTTNQHYQHYFS
Sbjct  161   ELKKRKDRG-GRVSNDYVDNSPDRYRPLNSPSPEPTWDNILSERPVQYQTTNQHYQHYFS  219

Query  236   YFYNRGAEKVSKPQFVVANSRKLPMSKFQKSGSSRRELRDVDDTITIGRRDNSEDRSWQS  295
             YFYNRGAEK+SKP F  ANSRK+PMSKFQK+G+SRR+ R+VD T+ IGRRDNSEDR+WQ 
Sbjct  220   YFYNRGAEKLSKPTFAAANSRKVPMSKFQKAGASRRDSREVDGTVIIGRRDNSEDRTWQG  279

Query  296   PKYDKHVLKEKLPSNDVEADYLDNGWG-ETGSGEDYRDIKDGYDPAIVIDNDLDQV--HR  352
              KY+KHVLKEKLPSND++ADYLDNGWG + GS +DYRDIKD YDP +VIDN L+QV  HR
Sbjct  280   QKYEKHVLKEKLPSNDLKADYLDNGWGGDPGSEDDYRDIKDSYDPVVVIDNGLEQVGVHR  339

Query  353   RYCRKSENTVLDDAADTLINNNNNEMKVMRKSTDQPAPRLPMTPKRVKGGAVSAKKPMPT  412
             RYCR +ENTVLD + DTLINNNNNE+K+MRKSTDQP PRLPMTPKR KGG VS KKPMPT
Sbjct  340   RYCRMTENTVLDGSGDTLINNNNNELKIMRKSTDQPMPRLPMTPKRAKGGTVSTKKPMPT  399

Query  413   VHRVLLYSTQSPRMGRKQPFSSQRLSIKQQNTKSLGGGDEGQTVILLEPETKPEDHRSAI  472
             VHRVLLYSTQSPR+GRKQ FS+QRLS+KQQ++K LG GDE QTV+LLEPE K EDHRSAI
Sbjct  400   VHRVLLYSTQSPRLGRKQQFSTQRLSVKQQSSKVLGAGDERQTVLLLEPEHKQEDHRSAI  459

Query  473   DFDRNDDFDEDDDLDNLSNFDESDTASVISDTEDGYRAHAYKLTHSVDRFSSPQSTPSFM  532
             DFDRNDDFDEDDDLDNLSNFDESDTASV+SDTEDGYRAHA+KLTHSVDRFSSPQSTPSF+
Sbjct  460   DFDRNDDFDEDDDLDNLSNFDESDTASVLSDTEDGYRAHAFKLTHSVDRFSSPQSTPSFL  519

Query  533   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKKGPRVPPDLHRVLKWRITNIMPKVV  592
             SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTK+GPRVPPDLHRVLKWRITNIMPKVV
Sbjct  520   SSQSSEDDLKNPDSLLVPSLFPYVPPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVV  579

Query  593   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  652
             RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ
Sbjct  580   RLILANSGMRMLKKTNDWMGVWGKHLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQ  639

Query  653   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYSQRNTKWIIKPPASARGAGIRVINRW  712
             RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKY+QRNTKWIIKPPASARGAGIRVINRW
Sbjct  640   RQMGKHSNKEFGFMPRTYIIPNDLGALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRW  699

Query  713   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  772
             GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK
Sbjct  700   GQIPKRRPLIVQKYIERPLLINGSKFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAK  759

Query  773   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  832
             TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL
Sbjct  760   TDTLNDRCMHLTNYSINKFSSNYSKNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEAL  819

Query  833   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  892
             RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL
Sbjct  820   RSLVLRTILAGENGINSMIRANVESKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSEL  879

Query  893   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  952
             PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE
Sbjct  880   PLDAHVKAPLVQGVLNTALYNVPPKLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSRE  939

Query  953   EKVKHNTFTRKSMEDRNEYVNAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTYKY  1012
             EK+KHNTFTRKSMEDRNEYV+AILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQT+KY
Sbjct  940   EKIKHNTFTRKSMEDRNEYVDAILNNLTPDDVRCLIIAEDELARCAPLERIFPTDQTHKY  999

Query  1013  LKYNDSPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK  1063
             LKYND+PRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK
Sbjct  1000  LKYNDTPRYYNRLLDAWESRYANNRTEGIALLRDYCQNKYHLQVPTPPAKK  1050


>Q9VKL9_DROME unnamed protein product
Length=828

 Score = 1551 bits (4015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 757/828 (91%), Positives = 793/828 (96%), Gaps = 3/828 (0%)

Query  260   MSKFQKSGSSRRELRDVDDTITIGRRDNSEDRSWQSPKYDKHVLKEKLPSNDVEADYLDN  319
             MSKFQK+G+SRR+ R+VD T+ IGRRDNSEDR+WQ  KY+KHVLKEKLPSND++ADYLDN
Sbjct  1     MSKFQKAGASRRDSREVDGTVIIGRRDNSEDRTWQGQKYEKHVLKEKLPSNDLKADYLDN  60

Query  320   GWG-ETGSGEDYRDIKDGYDPAIVIDNDLDQV--HRRYCRKSENTVLDDAADTLINNNNN  376
             GWG + GS +DYRDIKD YDP +VIDN L+QV  HRRYCR +ENTVLD + DTLINNNNN
Sbjct  61    GWGGDPGSEDDYRDIKDSYDPVVVIDNGLEQVGVHRRYCRMTENTVLDGSGDTLINNNNN  120

Query  377   EMKVMRKSTDQPAPRLPMTPKRVKGGAVSAKKPMPTVHRVLLYSTQSPRMGRKQPFSSQR  436
             E+K+MRKSTDQP PRLPMTPKR KGG VS KKPMPTVHRVLLYSTQSPR+GRKQ FS+QR
Sbjct  121   ELKIMRKSTDQPMPRLPMTPKRAKGGTVSTKKPMPTVHRVLLYSTQSPRLGRKQQFSTQR  180

Query  437   LSIKQQNTKSLGGGDEGQTVILLEPETKPEDHRSAIDFDRNDDFDEDDDLDNLSNFDESD  496
             LS+KQQ++K LG GDE QTV+LLEPE K EDHRSAIDFDRNDDFDEDDDLDNLSNFDESD
Sbjct  181   LSVKQQSSKVLGAGDERQTVLLLEPEHKQEDHRSAIDFDRNDDFDEDDDLDNLSNFDESD  240

Query  497   TASVISDTEDGYRAHAYKLTHSVDRFSSPQSTPSFMSSQSSEDDLKNPDSLLVPSLFPYV  556
             TASV+SDTEDGYRAHA+KLTHSVDRFSSPQSTPSF+SSQSSEDDLKNPDSLLVPSLFPYV
Sbjct  241   TASVLSDTEDGYRAHAFKLTHSVDRFSSPQSTPSFLSSQSSEDDLKNPDSLLVPSLFPYV  300

Query  557   PPYLSFSSNTKKGPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGK  616
             PPYLSFSSNTK+GPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGK
Sbjct  301   PPYLSFSSNTKRGPRVPPDLHRVLKWRITNIMPKVVRLILANSGMRMLKKTNDWMGVWGK  360

Query  617   HLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDL  676
             HLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDL
Sbjct  361   HLKSPCFKAIRSYQKINHLPGSFRIGRKDSCWKNLQRQMGKHSNKEFGFMPRTYIIPNDL  420

Query  677   GALRRHWPKYSQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGS  736
             GALRRHWPKY+QRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGS
Sbjct  421   GALRRHWPKYAQRNTKWIIKPPASARGAGIRVINRWGQIPKRRPLIVQKYIERPLLINGS  480

Query  737   KFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYS  796
             KFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYS
Sbjct  481   KFDLRLYVLVTSVNPLRVFMYHNGLARFASVKYSAKTDTLNDRCMHLTNYSINKFSSNYS  540

Query  797   KNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVE  856
             KNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVE
Sbjct  541   KNEDVNACHGHKWTIKSLWTYLANRGVRTDCLWEALRSLVLRTILAGENGINSMIRANVE  600

Query  857   SKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPP  916
             SKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPP
Sbjct  601   SKYSCFELFGFDVILDSDLVPWLLEVNISPSLHSELPLDAHVKAPLVQGVLNTALYNVPP  660

Query  917   KLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEKVKHNTFTRKSMEDRNEYVNAIL  976
             KLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEK+KHNTFTRKSMEDRNEYV+AIL
Sbjct  661   KLSLDKQKELAAEFSFPPGTQMCYDKRLYINYLSREEKIKHNTFTRKSMEDRNEYVDAIL  720

Query  977   NNLTPDDVRCLIIAEDELARCAPLERIFPTDQTYKYLKYNDSPRYYNRLLDAWESRYANN  1036
             NNLTPDDVRCLIIAEDELARCAPLERIFPTDQT+KYLKYND+PRYYNRLLDAWESRYANN
Sbjct  721   NNLTPDDVRCLIIAEDELARCAPLERIFPTDQTHKYLKYNDTPRYYNRLLDAWESRYANN  780

Query  1037  RTEGIALLRDYCQNKYHLQVPTPPAKKDLNDEEIILVAPKTIGDDSEA  1084
             RTEGIALLRDYCQNKYHLQVPTPPAKKD NDEE     P T+ ++ E+
Sbjct  781   RTEGIALLRDYCQNKYHLQVPTPPAKKDSNDEETTPATPNTVKEEIES  828



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110339.1 MPN domain-containing protein CG4751 [Drosophila
elegans]

Length=1429


***** No hits found *****



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110340.1 nuclear pore complex protein Nup154 [Drosophila
elegans]

Length=1365
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NU154_DROME  unnamed protein product                                  2538    0.0   
Q95Y15_CAEEL  unnamed protein product                                 364     4e-105
Q95Y13_CAEEL  unnamed protein product                                 165     1e-43 


>NU154_DROME unnamed protein product
Length=1365

 Score = 2538 bits (6578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1211/1366 (89%), Positives = 1280/1366 (94%), Gaps = 2/1366 (0%)

Query  1     MSAPQAQLDFFSTAGSMLEWHDNLDRNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLK  60
             M+ PQAQLDFF+TA SMLEWH NL+RNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLK
Sbjct  1     MTLPQAQLDFFTTATSMLEWHYNLERNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLK  60

Query  61    SDETHNLQQLRTVTKSSIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQT  120
             SD THNLQQ+RTVTKS+IPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQT
Sbjct  61    SDRTHNLQQMRTVTKSAIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQT  120

Query  121   RDVAYYDGLSHLIVSVGLVKPKAGVFVQDVKYLLLLTTPIEVIVLGVTFDESSHNEMQLM  180
             RDVAYYDGLSHLIVSVGLVKPK GVFVQDVKYLL+LTTPIEVIVLGVTF ESS+NEMQLM
Sbjct  121   RDVAYYDGLSHLIVSVGLVKPKPGVFVQDVKYLLVLTTPIEVIVLGVTFGESSYNEMQLM  180

Query  181   NRPIFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEVFYQAESSWFGKRCKKINLSQGLV  240
             NRP+FVIGTDNVSISVIKGTDDGRIFLGGRDGCLYE++YQAESSWFGKRCKKINLSQGLV
Sbjct  181   NRPVFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEIYYQAESSWFGKRCKKINLSQGLV  240

Query  241   SYIVPSFLKVFSEVDPIERIEIDNSRKLLYVLTERGSIEAWDISTDYTNARRLGRITQND  300
             SY+VPSFLKVFSEVDPIE IEIDNSRKLLYVLTE+G IEAWDIST YT ARRLGRITQND
Sbjct  241   SYMVPSFLKVFSEVDPIEHIEIDNSRKLLYVLTEKGVIEAWDISTSYTTARRLGRITQND  300

Query  301   ITNQAVSLITTVDPSIFKSVKAICPLNADDAGKLHLVAVTQCGVRLYFSTTSLNVQQQFG  360
             ITNQAVSLITTVDPSIFKSVKAICPL+ADDA KLHLVAVTQCGVRL+FSTTSLNV+QQFG
Sbjct  301   ITNQAVSLITTVDPSIFKSVKAICPLSADDADKLHLVAVTQCGVRLFFSTTSLNVKQQFG  360

Query  361   PTAACTQAESTGFGQSATQSSLSGGVDAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHY  420
             P   C+  E+TGFGQ A Q  LS   +APKGLYLLHVRLPPGYTPNATTNKPKQVHAAHY
Sbjct  361   PAVPCSPGENTGFGQPAVQPPLSPNAEAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHY  420

Query  421   TEGTMLMITTQQQEQDLLWSVSSAPSVNFTYLVESTALESLDGVVWSMAEVHEPSSPLLK  480
             TEGTMLMITTQQ EQDLLWS+SSAPSVNFTYLVESTALESLDGVVW +AEVHEPS+P  K
Sbjct  421   TEGTMLMITTQQHEQDLLWSLSSAPSVNFTYLVESTALESLDGVVWGLAEVHEPSTPQRK  480

Query  481   SPLNSARHSRKVALLTNQGTHIIELLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREAC  540
             SPLNSARH+RKVALLTNQGTHIIE+LKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREAC
Sbjct  481   SPLNSARHARKVALLTNQGTHIIEVLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREAC  540

Query  541   VTALLLATSDKYRGGDIALWATQAFMLYGGEPCFQHPKFLNASNRNVANQTLGPNAATGR  600
             VTALLLATSD YRG D+ALWA QAFMLYGGEPC+QH KFLNASNRN+ANQTLGPN    R
Sbjct  541   VTALLLATSDTYRGSDVALWAAQAFMLYGGEPCYQHQKFLNASNRNMANQTLGPNTTNVR  600

Query  601   ERLPMFMSTPMPNSAANSPVSYAGAHFNQPISPIGNMQPSQ-AVSNENSSIVFSAKHDGL  659
             ER  MFMSTPMPNS ANSPV + G+ FNQPISPIGNMQP Q AVSNENS IVFSAKHDGL
Sbjct  601   ERQSMFMSTPMPNSVANSPVGFPGSQFNQPISPIGNMQPPQVAVSNENSPIVFSAKHDGL  660

Query  660   YLYVSRMLRSIWQLRCVNEHFCSNLSYSDCAHLQADLRSLRSFLEVHSVHDISSSTRVSF  719
             Y+YVSRML S+WQ+RCVNE FCSNLS S+CA L +DLRSLRSFLEVHSVHDISS+TRVSF
Sbjct  661   YMYVSRMLHSVWQMRCVNEQFCSNLSQSECALLLSDLRSLRSFLEVHSVHDISSTTRVSF  720

Query  720   DPHLDRTNSYSTIMMNNTMLPIPEQRILTEQAQVEEKRSLSALNLFVKHACEVVSLWSIL  779
             D HLDRTNSY+TIMM NT+LPIPEQR+L+EQAQVEE RSLSALNLFVKHACEV+SLW+IL
Sbjct  721   DNHLDRTNSYNTIMMGNTLLPIPEQRVLSEQAQVEETRSLSALNLFVKHACEVISLWNIL  780

Query  780   NAHSFQLICLQLSPEHQKMLKCCTFRDLLLTRSEVCAFLIISLINLYLKDKAGVSEVSMN  839
             N+HSFQLIC+QLSPEHQK+L C TFRDLL+TRSEVCAFLIISLINLYLKD AGVSEVS N
Sbjct  781   NSHSFQLICVQLSPEHQKLLTCSTFRDLLITRSEVCAFLIISLINLYLKDAAGVSEVSKN  840

Query  840   LRENCPNLYRHEDDVTYKATELLMNAKNCTSAAEKEQKLRTTLQMCKEAAPTLPLHSICQ  899
             LRENCPNLYRHEDDVTYKATELLMNAKNCTSA EKE  LRTTL MCKEAAPTLPLHSIC 
Sbjct  841   LRENCPNLYRHEDDVTYKATELLMNAKNCTSATEKEHMLRTTLHMCKEAAPTLPLHSICM  900

Query  900   QFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPAEDREGYTCFATRMNYYKEVQLM  959
             QFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPA+DREGYTCFATRM YYKEVQLM
Sbjct  901   QFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPADDREGYTCFATRMAYYKEVQLM  960

Query  960   LDHIYQIACNKSHIKDQTQSPQLKNGAKASDAKNAAKQTIPKIVAQTLRVKDPLIHVTLY  1019
             LDHIYQ  CNK+H++D++ +P LK  AKASDAKN A QTIPKIVA TL+VKDPLIH+TLY
Sbjct  961   LDHIYQRVCNKTHVQDKSINP-LKGTAKASDAKNGATQTIPKIVAHTLKVKDPLIHITLY  1019

Query  1020  EWLLSHDMLSELLDVVEPSLGEFLRRSVSRNGENVVLIDLLWKYYEKNGHHSQAAQILDN  1079
             EWLL+HDML ELLDVVEPSLGEFLRRSVS+N +NVVLIDLLWKYYEKN HHSQAA ILDN
Sbjct  1020  EWLLAHDMLKELLDVVEPSLGEFLRRSVSQNVDNVVLIDLLWKYYEKNSHHSQAAHILDN  1079

Query  1080  LAMTRSENITLEQRIEYLVRAVMCMRNGNVGSSITNGIFLKELEDKLDIARVQKTVLVAM  1139
             LAMTRSENI LEQRIEYLVRAVMCMRNGNVGSS++NGIFLKELEDKLDIARVQK+VL AM
Sbjct  1080  LAMTRSENINLEQRIEYLVRAVMCMRNGNVGSSLSNGIFLKELEDKLDIARVQKSVLAAM  1139

Query  1140  TELARSKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVW  1199
             TELA  KLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVW
Sbjct  1140  TELASDKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVW  1199

Query  1200  GNIINSVVDEPGSTHERSTRLFTKIELLVREYGESGACFPFAFLIRELEIKACQLRLPEG  1259
             G IINSVVD+PG+T ER  RLFTKIE+LVREYGESG CFPFAFLIRELE+KACQLR PEG
Sbjct  1200  GQIINSVVDKPGTTSERCNRLFTKIEILVREYGESGVCFPFAFLIRELEVKACQLRFPEG  1259

Query  1260  IVPEKLVTMNLDVELLLEYYSRMISMNERIWANEGNEWHLIQSAIRVVSLLADNAQSIWY  1319
             IVPEKLV+MNLD+ELLLEYYSRMISMNER+WANEGNEWHLIQS IRVVSLLADNAQSIWY
Sbjct  1260  IVPEKLVSMNLDIELLLEYYSRMISMNERVWANEGNEWHLIQSVIRVVSLLADNAQSIWY  1319

Query  1320  RSKRRIIGKAQDIVAGCLNICYQKPDTNRLQHSLKELQSRLQRLLV  1365
             RSKRRI+GKAQDIVAGCLNICYQKPDTNRLQHSLKELQS+LQRLL+
Sbjct  1320  RSKRRIVGKAQDIVAGCLNICYQKPDTNRLQHSLKELQSQLQRLLI  1365


>Q95Y15_CAEEL unnamed protein product
Length=1340

 Score = 364 bits (935),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 325/1272 (26%), Positives = 565/1272 (44%), Gaps = 135/1272 (11%)

Query  17    MLEWHDNLDRNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDETHNLQQLRTVTKS  76
             M+E  D  DR          ++QHG   +SGL +  Y               +  +  + 
Sbjct  28    MMETSDFFDR----------LTQHGTTPVSGLGEKFY----------VKGAPEFVSTRRI  67

Query  77    SIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSV  136
              IP E+     +I    +MG F +I R W+ ID+ +Y+W +    D+A++D     I+ V
Sbjct  68    PIPGELQMQMSNIHSEFSMGFFTQISRVWVVIDNNLYMWNYETNDDLAFFDSSDAAILKV  127

Query  137   GLVKPKAGVFVQDVKYLLLLTTPIEVIVLGVTFD--ESSHNEMQLMNRPIFVIGTDNVSI  194
              LV  K GVF  +++Y L++ T I  I L   FD  E+  + + + ++  F I  D  ++
Sbjct  128   SLVNIKPGVFEPEIQYGLVVGT-ISDICLYPVFDFVENGASSISIDSKRCFKIALDGATV  186

Query  195   SVIKGTDDGRIFLGGRDGCLYEVFYQAESSWFGK---RCKKINLSQGLVSYIVPSFLKVF  251
             + I  T +GR+F    D  L+E  Y+ ++ WFG    +C+ +N +  ++  ++   L  F
Sbjct  187   NDISYTSNGRVFYTADDQ-LFEFVYEKQNGWFGSTNHKCRGVNQTASILGTLIS--LPFF  243

Query  252   -SEVDPIERIEIDNSRKLLYVLTERGSIEAWDISTDYTNARRLGRITQNDITNQAVSLIT  310
              S  +P+++I ID SR ++Y+L   G++  WD+  D     +   +  + I ++A  ++T
Sbjct  244   GSSKEPLDQITIDKSRNIMYLLGRAGTVSVWDLGADGAACAKFLSVPISKIAHEA-HILT  302

Query  311   TV--DPSIFKSVKAICPLNADDAGKLHLVAVTQCGVRLYFSTTSLNVQQQFGPTAACTQA  368
                 D + F S+ +I  L A  +  L+LVA T  GVRLYFS ++       GP +     
Sbjct  303   QFGHDETSFHSITSIKALEASQSAALNLVATTAKGVRLYFSVST-------GPQSTMAMF  355

Query  369   ESTGFGQSATQSSLSGGVDAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHYTEGTMLMI  428
              ++G      +   S     P+ L + HVR  PG TP +         +  Y + ++  +
Sbjct  356   NNSGTPNERNRPQTSV---RPQCLRVAHVRFAPGVTPASIYGDGPNGVSVVYADESICAM  412

Query  429   TTQQQEQDLLWSVSSAPSVNFTYLVESTALESLDGVVWSMAEVHE---PSSP--------  477
              T  +     +S    PS  F   VEST    + G VW +  V      S P        
Sbjct  413   ATANRNTIFAFSNFFYPSSQF--FVESTTECDISGHVWEIETVSRCKVKSRPPPRHLVDR  470

Query  478   -----LLKSPLNSARHSRKVALLTNQGTHIIELLKMVDVLRQILLSCNGPHHEEVKMFFQ  532
                    +S L S   ++K+ + +N+G      +  VD LR+ L    G         +Q
Sbjct  471   VHPHSYFRSQLESG--NQKLLVCSNEGVFEFTHVNAVDALREALFD-GGVEGNATLQLWQ  527

Query  533   SQNQREACVTALLLATSDKYRGGDIALWATQAFMLYGGEPCFQHPKFLNASNRNVANQTL  592
                  E    A  + TSD      I   A Q  +LY  +   + P+ +    + + +Q+ 
Sbjct  528   KLGSTEMLCLAFRILTSDAPIDERIRGKAEQ--ILYSLK---EAPEIVENEQQRMLDQST  582

Query  593   ----GPNAAT-----GRERLPMFMSTPMPNSA-ANSPVSYAGAHFNQPISPIGNMQPSQA  642
                  PN ++      R + P+  STP  +    N+  +   AHF+ P SP+ +M  +  
Sbjct  583   TTSWSPNDSSMAEWRHRMKTPLLSSTPRTDGRNGNAGGAPPQAHFSSPFSPMLDMSMASG  642

Query  643   VSNENSSIVFSAKHDGLYLYVSRMLRSIWQLRCVNEHFCSNLSYSDCAHLQADLRSLRSF  702
               N N  +  S +HD L+ Y SR++  +W     N+  C  L+      +  +  S++S 
Sbjct  643   HHNGNMRMSPSRRHDALFYYFSRLVAPVW-----NDTICEVLNGKQLT-ITFEPESIQSL  696

Query  703   LEVHSVHDISSSTRVSFDPHLD---RTNSYSTIMMNNTMLPIPEQRILTEQAQVEEKRSL  759
              E     +I    R+  D  L      N YS+ M +           L  +A   E+ SL
Sbjct  697   KE-----EIQKLARLMDDYRLVPMMEFNGYSSNMTDR----------LNHEATSLERHSL  741

Query  760   SALNLFVKHACEVVSLWSILNAHSFQLICLQLSPEHQKMLKCCTFRDLLLTRSEVCAFLI  819
               L   +    E +SLW +   ++   I   ++P+            L+   S + A LI
Sbjct  742   IGLRKLIDATLETLSLWLLAYEYNLTAISSGMNPQLLPNFSSRKLAHLVSDGSNLNAELI  801

Query  820   ISLINLYLKDKAGVSEVSMNLRENCPNLYRHEDDVTYKATELLMNAKNCTSAAEKEQKLR  879
              ++I  +L D+AG   +S +LR+ CPNLY  +D     A E L  A+     A + + ++
Sbjct  802   RAMIKYFLGDEAGTKILSESLRQLCPNLYSEDDACVTFAMEQLEAARKQGPGAARRRLVQ  861

Query  880   TTLQMCKEAAPTLPLHSICQQFI-SADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPAE  938
             + ++M K++   + L S CQQ   S + +E ++EL  + A+K DP+++ +  Y +G    
Sbjct  862   SAVEMFKQSIGKVVLASTCQQLAESVEDYEPIVELCLLRAAKDDPKQLALLAYKHGRSGS  921

Query  939   DREGYTCFATRMNYYKEVQLMLDHIYQIACNKSHIKDQTQSPQLKNGAKASDAKNAAKQT  998
             D E       R + Y+ +  +LD           ++D+  S   ++ A   D        
Sbjct  922   DAEMLGAEKKREDCYRVITDVLD----------KLEDEATSEVPRDTAVNRDL-------  964

Query  999   IPKIVAQTLRVKDPLIHVTLYEWLLSHDMLSELLDVVEPSLGEFLRRSVSRNGENVVLID  1058
                ++   L   D L H  ++ WLL+ +  + +L    P +  FL + ++  G      D
Sbjct  965   ---MINAVLNSDDQLAHAAVFRWLLTKNKTNVILQSKSPFIEFFLVQEINA-GRGQKYFD  1020

Query  1059  LLWKYYEKNGHHSQAAQILDNLAMTRSENITLEQRIEYLVRAVMCMRNGNVGSSITNGIF  1118
             LLW++YEK+G++ +AA++L  LA   +  + L QR  YL  A++C ++    +  TN   
Sbjct  1021  LLWRFYEKSGNYDKAARLLSKLAENDNWKMGLTQRCAYLSHAILCAQSCKDSTVTTN---  1077

Query  1119  LKELEDKLDIARVQKTVLVAMTELARSKLEAATAVKELNYALYDITQLYQHFAEPFDLWE  1178
             + EL D+LD+A VQ  +  A+   A +       V++L+  +  + +L   +  PF L +
Sbjct  1078  IDELRDRLDVANVQMRIKDALGCSASASARNQEFVRKLDGPILSLQELLLQYVVPFKLHK  1137

Query  1179  CQLSILNCSHHNDPLLIESVWGNIINSVVDEPGSTHERST---RLFTKIELLVREYGESG  1235
              +LS+L+C+       I   W +II    DE  +  +  T   +L   I  L   Y ++ 
Sbjct  1138  IKLSLLHCAGMYVEKHIFETWEDIIQ---DEFTTAQDEGTLCEQLSNTIGELFSVYRDT-  1193

Query  1236  ACFPFAFLIREL  1247
               FP  F+IR +
Sbjct  1194  KYFPREFVIRRI  1205


>Q95Y13_CAEEL unnamed protein product
Length=411

 Score = 165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/421 (29%), Positives = 202/421 (48%), Gaps = 48/421 (11%)

Query  17   MLEWHDNLDRNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDETHNLQQLRTVTKS  76
            M+E  D  DR          ++QHG   +SGL +  Y               +  +  + 
Sbjct  28   MMETSDFFDR----------LTQHGTTPVSGLGEKFY----------VKGAPEFVSTRRI  67

Query  77   SIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSV  136
             IP E+     +I    +MG F +I R W+ ID+ +Y+W +    D+A++D     I+ V
Sbjct  68   PIPGELQMQMSNIHSEFSMGFFTQISRVWVVIDNNLYMWNYETNDDLAFFDSSDAAILKV  127

Query  137  GLVKPKAGVFVQDVKYLLLLTTPIEVIVLGVTFD--ESSHNEMQLMNRPIFVIGTDNVSI  194
             LV  K GVF  +++Y L++ T I  I L   FD  E+  + + + ++  F I  D  ++
Sbjct  128  SLVNIKPGVFEPEIQYGLVVGT-ISDICLYPVFDFVENGASSISIDSKRCFKIALDGATV  186

Query  195  SVIKGTDDGRIFLGGRDGCLYEVFYQAESSWFGK---RCKKINLSQGLVSYIVPSFLKVF  251
            + I  T +GR+F    D  L+E  Y+ ++ WFG    +C+ +N +  ++  ++   L  F
Sbjct  187  NDISYTSNGRVFYTADDQ-LFEFVYEKQNGWFGSTNHKCRGVNQTASILGTLIS--LPFF  243

Query  252  -SEVDPIERIEIDNSRKLLYVLTERGSIEAWDISTDYTNARRLGRITQNDITNQAVSLIT  310
             S  +P+++I ID SR ++Y+L   G++  WD+  D     +   +  + I ++A  ++T
Sbjct  244  GSSKEPLDQITIDKSRNIMYLLGRAGTVSVWDLGADGAACAKFLSVPISKIAHEA-HILT  302

Query  311  TV--DPSIFKSVKAICPLNADDAGKLHLVAVTQCGVRLYFSTTSLNVQQQFGP--TAACT  366
                D + F S+ +I  L A  +  L+LVA T  GVRLYFS ++       GP  T A  
Sbjct  303  QFGHDETSFHSITSIKALEASQSAALNLVATTAKGVRLYFSVST-------GPQSTMAMF  355

Query  367  QAESTGFGQSATQSSLSGGVDAPKGLYLLHVRLPPGYTPNAT-TNKPKQVHAAHYTEGTM  425
                T   ++  Q+S+      P+ L + HVR  PG TP +   + P  V   +  E T 
Sbjct  356  NNSGTPNERNRPQTSVR-----PQCLRVAHVRFAPGVTPASIYGDGPNGVSVVYADECTR  410

Query  426  L  426
            L
Sbjct  411  L  411



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110341.1 probable protein arginine N-methyltransferase 6
[Drosophila elegans]

Length=341
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8SX32_DROME  unnamed protein product                                 675     0.0  
Q9VGW7_DROME  unnamed protein product                                 186     6e-56
ANM1_CAEEL  unnamed protein product                                   180     1e-53


>Q8SX32_DROME unnamed protein product
Length=341

 Score = 675 bits (1741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/341 (94%), Positives = 330/341 (97%), Gaps = 0/341 (0%)

Query  1    MANAYFDEYENLEIHELMLKDRPRQAAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAK  60
            MAN YFDEYENLEIHELMLKDRPRQ AYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAK
Sbjct  1    MANTYFDEYENLEIHELMLKDRPRQEAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAK  60

Query  61   AGARLVYAIEASNVATKVALDLIEDNGLTNVVKVIQSRIEEFVLPADAEKVDIIVSEWMG  120
            AGARLVYA+EASNVATKVALDLIEDNGLTNVVKVIQSR+EEFVLPA+AEKVDIIVSEWMG
Sbjct  61   AGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPAEAEKVDIIVSEWMG  120

Query  121  FYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFAS  180
            FYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFA 
Sbjct  121  FYLLHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDDWHNVDGIKMDTFAR  180

Query  181  KLRAQKSARPEITHLNPADLLHEGVVFHWMNLLDVQPDELDSIQFKEVVTAQKAGNHQGF  240
            KLR QKS+RPEIT LNP DLLHEGVVFHWMNLLDV+  +LDSIQFKEV+TAQKAGNHQGF
Sbjct  181  KLRTQKSSRPEITQLNPQDLLHEGVVFHWMNLLDVEASDLDSIQFKEVITAQKAGNHQGF  240

Query  241  CIWFDVRFPGEDSVLSTSPHSPPTHWKQCVVVLPEESCETLEEKAPIAFQITMKRSASDM  300
            CIWFDV+FPGED VLSTSP SPPTHWKQCVVVLPEESCE LEEK+PIAFQITMKRSA+DM
Sbjct  241  CIWFDVQFPGEDFVLSTSPLSPPTHWKQCVVVLPEESCENLEEKSPIAFQITMKRSAADM  300

Query  301  RKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAHLKMMDTS  341
            RKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAHLKMMDTS
Sbjct  301  RKYNLEVDLLDPNTEEHPVPCSCHMTKCILTEAHLKMMDTS  341


>Q9VGW7_DROME unnamed protein product
Length=376

 Score = 186 bits (473),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 115/311 (37%), Positives = 167/311 (54%), Gaps = 14/311 (5%)

Query  5    YFDEYENLEIHELMLKDRPRQAAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGAR  64
            YFD Y +  IHE MLKD  R   Y NA+  NK LF+ K V+DVG GTGILS F AKAGA 
Sbjct  56   YFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAA  115

Query  65   LVYAIEASNVATKVALDLIEDNGLTNVVKVIQSRIEEFVLPADAEKVDIIVSEWMGFYLL  124
             V A++ SN+  + A  ++ DN L +V+ V++ +IEE  LP   E VDII+SEWMG+ L 
Sbjct  116  QVIAVDCSNI-IEFARQVVIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLF  174

Query  125  HEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFAS  180
            +E MLD+VL ARDK+LK+ G++FP   T+++         D+    W +V G  M    S
Sbjct  175  YESMLDTVLYARDKWLKKDGMMFPDRGTLYITAIEDRQYKDEKINWWDDVYGFDM----S  230

Query  181  KLRAQKSARPEITHLNPADLLHEGVVFHWMNLLDVQPDELDSIQFKEVVTAQKAGNHQGF  240
             +R      P +  ++P  ++    +   ++L  VQ  +L+    K  +  ++    Q  
Sbjct  231  CIRKVAVTEPLVDVVDPKQVVSTSCMVKEVDLYTVQKADLN-FSSKFSLCIKRNDFVQAL  289

Query  241  CIWFDVRFPGEDSVL--STSPHSPPTHWKQCVVVLPEESCETLEEKAPIAFQITMKRSAS  298
              +F++ F      L  STSP S  THWKQ V  L +       E+    FQ  MK +  
Sbjct  290  VTYFNIEFTKCHKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQ--MKPNER  347

Query  299  DMRKYNLEVDL  309
            + R  +  +D+
Sbjct  348  NNRDLDFVIDI  358


>ANM1_CAEEL unnamed protein product
Length=348

 Score = 180 bits (456),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 159/279 (57%), Gaps = 15/279 (5%)

Query  5    YFDEYENLEIHELMLKDRPRQAAYYNAILGNKDLFKDKIVMDVGAGTGILSAFCAKAGAR  64
            YFD Y +  IHE MLKD  R   Y N+I  N  LFKDK+VMDVG+GTGILS F AKAGA+
Sbjct  27   YFDSYAHFGIHEEMLKDEVRTTTYRNSIYHNSHLFKDKVVMDVGSGTGILSMFAAKAGAK  86

Query  65   LVYAIEASNVATKVALDLIEDNGLTNVVKVIQSRIEEF-VLPADAEKVDIIVSEWMGFYL  123
             V+A+E SN+A   +  +I DN L ++V+VIQ+++E+   LP   EKVDII+SEWMG+ L
Sbjct  87   KVFAMEFSNMAL-TSRKIIADNNLDHIVEVIQAKVEDVHELPGGIEKVDIIISEWMGYCL  145

Query  124  LHEGMLDSVLLARDKFLKEGGLLFPSECTIFVAPCSVPSLFDD----WHNVDGIKMDTFA  179
             +E ML++VL+ARD++L   G+LFP +  ++V         +D    W +V G  M    
Sbjct  146  FYESMLNTVLVARDRWLAPNGMLFPDKARLYVCAIEDRQYKEDKIHWWDSVYGFNM----  201

Query  180  SKLRAQKSARPEITHLNPADLLHEGVVFHWMNLLDVQPDELD-SIQFKEVVTAQKAGNHQ  238
            S ++      P +  ++ A +     +   ++L  V+ ++L     FK  +   ++   Q
Sbjct  202  SAIKNVAIKEPLVDIVDNAQVNTNNCLLKDVDLYTVKIEDLTFKSDFK--LRCTRSDYIQ  259

Query  239  GFCIWFDVRFPG--EDSVLSTSPHSPPTHWKQCVVVLPE  275
             F  +F V F    + +  ST P    THWKQ V  L +
Sbjct  260  AFVTFFTVEFSKCHKKTGFSTGPDVQYTHWKQTVFYLKD  298



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110342.1 endoplasmic reticulum transmembrane helix translocase
[Drosophila elegans]

Length=1228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKJ6_DROME  unnamed protein product                                 2307    0.0  
Q9Y139_DROME  unnamed protein product                                 2305    0.0  
Q8MSI5_DROME  unnamed protein product                                 1908    0.0  


>Q9VKJ6_DROME unnamed protein product
Length=1225

 Score = 2307 bits (5978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1125/1228 (92%), Positives = 1174/1228 (96%), Gaps = 3/1228 (0%)

Query  1     MTKAAEAAIPRGEAGDMDTYGKEMRPLAGKAKEPSKLDDLVQYVSLHVRIPTPLTGVVLP  60
             MT+AA A  P G AGD ++YGKEM   +G+ KEP+KLDDLVQYVSLHVRIPTPLTGVVLP
Sbjct  1     MTEAAGATNPGGAAGDAESYGKEMALQSGRPKEPTKLDDLVQYVSLHVRIPTPLTGVVLP  60

Query  61    FVPLYLSAFYLWIHVSGNGEETETSQPELVPGENQTTTDHATTWNDVGFIGVVAIAFLHV  120
             FVPLYLSAFYLWI+V+G G+E +T+  +++  +NQTTTD+ TTWNDVGFIGV+AIAFLH+
Sbjct  61    FVPLYLSAFYLWINVTG-GQENDTTNNDVITADNQTTTDNITTWNDVGFIGVLAIAFLHI  119

Query  121   LTLLFCYWSVHVLAFLTCRRVKLPGANVLAKVVPTANNGNSKIVPLRTSKLEDGSTQYFL  180
             LTLLFCYWSVHVLAFLTCRRVKLPGANVLAKVVPT NNGNSKIVP+R+SKLEDGSTQY+ 
Sbjct  120   LTLLFCYWSVHVLAFLTCRRVKLPGANVLAKVVPTPNNGNSKIVPIRSSKLEDGSTQYYF  179

Query  181   VFQKTKYVWNEDRKTFRAVEFPVNGLLSSYASSRGLETEEAIKRATLTYGNNEMEMVVPE  240
             VFQKTKYVWNEDRKTFRAVEFPVNGLLS+Y+SSRGLETEE IKRAT TYGNNEMEMVVPE
Sbjct  180   VFQKTKYVWNEDRKTFRAVEFPVNGLLSTYSSSRGLETEEDIKRATQTYGNNEMEMVVPE  239

Query  241   FHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMSEIRK  300
             FHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMSEIRK
Sbjct  240   FHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMSEIRK  299

Query  301   MGNKPYLIYAFRQNKWRHIGSDELLPGDLVSVTRSQNDNIVPCDLVILRGSCIVDESMLT  360
             MGNKPYLIYAFRQNKWRH+GSDELLPGDLVS+TRSQNDNIVPCDLVILRGSCIVDESMLT
Sbjct  300   MGNKPYLIYAFRQNKWRHLGSDELLPGDLVSITRSQNDNIVPCDLVILRGSCIVDESMLT  359

Query  361   GESVPLMKESLESLDNLNVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYV  420
             GESVPLMKESLESLDNL+VEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYV
Sbjct  360   GESVPLMKESLESLDNLDVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYV  419

Query  421   IRTGFNTSQGRLLRTILFAANRATENNAETFAFIAFLMVFAVAAASYVWVKGSEDLERSR  480
             IRTGFNTSQG+LLRTILF ANRATENN ETFAFIAFLMVFAVAAASYVWVKGSED ER+R
Sbjct  420   IRTGFNTSQGKLLRTILFGANRATENNVETFAFIAFLMVFAVAAASYVWVKGSEDPERNR  479

Query  481   YKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK  540
             YKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK
Sbjct  480   YKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK  539

Query  541   TGTLTTDNLMVEGIAGLAPNGACVPIEEAEANTVQVLACCHSLALLDDGLVGDPLEKATL  600
             TGTLTTDNLMVEGIAGLAPNGACVPIE+AE NTVQVLACCHSLALLDDGLVGDPLEKATL
Sbjct  540   TGTLTTDNLMVEGIAGLAPNGACVPIEKAEGNTVQVLACCHSLALLDDGLVGDPLEKATL  599

Query  601   AAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAGYLMPYSNEVKHIGAVKG  660
             AAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAG+L+PYSNEVKHIGAVKG
Sbjct  600   AAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAGHLIPYSNEVKHIGAVKG  659

Query  661   APEVIQTMLREVPSDYEKVYLEYARRGARVLALGIKGFGTLGSHQIRELKREEVECDLTF  720
             APEVIQ MLREVP+DYEKVYLEYARRGARVLALGIK  GTLG+ ++RE+KREEVECDLTF
Sbjct  660   APEVIQKMLREVPADYEKVYLEYARRGARVLALGIKDLGTLGAQRVREMKREEVECDLTF  719

Query  721   AGFVIISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKLLILTPPD  780
             AGF+IISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKL+ILTPP+
Sbjct  720   AGFLIISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKLIILTPPE  779

Query  781   LEVKSPWRWVSIDGDQTYELDIKKGSKGLSMLLGTHDLCITGEGLQHLQQHQQQYMRHLL  840
              + K+ W WVSIDGDQ+YELD K GSK LS LL THDLCITGEGLQ+LQQ+Q QYMR LL
Sbjct  780   EDRKNNWSWVSIDGDQSYELDTKPGSKKLSHLLATHDLCITGEGLQYLQQNQPQYMRQLL  839

Query  841   PLITVCARFAPKQKEFVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKR  900
             P ITVCARFAPKQKE VITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKR
Sbjct  840   PQITVCARFAPKQKELVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKR  899

Query  901   TEEEQQQAAAAANAAAAAAQAAAIANQQLTPRERALRRRQEHINQTQARLQNALRDMEEQ  960
             TEEEQQQAAA A A AA AQA A    QLT RERALRRRQEH+NQTQARLQNALRDMEEQ
Sbjct  900   TEEEQQQAAANAAAIAAQAQANANQ--QLTTRERALRRRQEHLNQTQARLQNALRDMEEQ  957

Query  961   TMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVLY  1020
             TMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVLY
Sbjct  958   TMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVLY  1017

Query  1021  IDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHF  1080
             IDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHF
Sbjct  1018  IDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHF  1077

Query  1081  GTLYYLTSQANILAPPRVGKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQVATIAVNY  1140
             GTLYYLTSQANILAPPR GKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQVATIAVNY
Sbjct  1078  GTLYYLTSQANILAPPREGKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQVATIAVNY  1137

Query  1141  KGHPFMESLRSNRMLMYAIGASATLVILLSTGLAPELTEFFEIIDFPTDFRKTLLGVLIL  1200
             KG+PFMESLRSNRMLMYAIGASA LVILLSTGLAPELTEFFEIIDFPTDFRKTLLGVL+L
Sbjct  1138  KGYPFMESLRSNRMLMYAIGASAALVILLSTGLAPELTEFFEIIDFPTDFRKTLLGVLVL  1197

Query  1201  DIMGAFVLDRICSFLFGETRRKSKVLNC  1228
             DI+GAF+LDRICSFLFGETRRKSKVLNC
Sbjct  1198  DIVGAFLLDRICSFLFGETRRKSKVLNC  1225


>Q9Y139_DROME unnamed protein product
Length=1225

 Score = 2305 bits (5973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1124/1228 (92%), Positives = 1174/1228 (96%), Gaps = 3/1228 (0%)

Query  1     MTKAAEAAIPRGEAGDMDTYGKEMRPLAGKAKEPSKLDDLVQYVSLHVRIPTPLTGVVLP  60
             MT+AA A  P G AGD ++YGKEM   +G+ KEP+KLDDLVQYVSLHVRIPTPLTGVVLP
Sbjct  1     MTEAAGATNPGGAAGDAESYGKEMALQSGRPKEPTKLDDLVQYVSLHVRIPTPLTGVVLP  60

Query  61    FVPLYLSAFYLWIHVSGNGEETETSQPELVPGENQTTTDHATTWNDVGFIGVVAIAFLHV  120
             FVPLYLSAFYLWI+V+G G+E +T+  +++  +NQTTTD+ TTWNDVGFIGV+AIAFLH+
Sbjct  61    FVPLYLSAFYLWINVTG-GQENDTTNNDVITADNQTTTDNITTWNDVGFIGVLAIAFLHI  119

Query  121   LTLLFCYWSVHVLAFLTCRRVKLPGANVLAKVVPTANNGNSKIVPLRTSKLEDGSTQYFL  180
             LTLLFCYWSVHVLAFLTCRRVKLPGANVLAKVVPT NNGNSKIVP+R+SKLEDGSTQY+ 
Sbjct  120   LTLLFCYWSVHVLAFLTCRRVKLPGANVLAKVVPTPNNGNSKIVPIRSSKLEDGSTQYYF  179

Query  181   VFQKTKYVWNEDRKTFRAVEFPVNGLLSSYASSRGLETEEAIKRATLTYGNNEMEMVVPE  240
             VFQKTKYVWNEDRKTFRAVEFPVNGLLS+Y+SSRGLETEE IKRAT TYGNNEMEMVVPE
Sbjct  180   VFQKTKYVWNEDRKTFRAVEFPVNGLLSTYSSSRGLETEEDIKRATQTYGNNEMEMVVPE  239

Query  241   FHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMSEIRK  300
             FHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMSEIRK
Sbjct  240   FHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLRNMSEIRK  299

Query  301   MGNKPYLIYAFRQNKWRHIGSDELLPGDLVSVTRSQNDNIVPCDLVILRGSCIVDESMLT  360
             MGNKPYLIYAFRQNKWRH+GSDELLPGDLVS+TRSQNDNIVPCDLVILRGSCIVDESMLT
Sbjct  300   MGNKPYLIYAFRQNKWRHLGSDELLPGDLVSITRSQNDNIVPCDLVILRGSCIVDESMLT  359

Query  361   GESVPLMKESLESLDNLNVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYV  420
             GESVPLMK+SLESLDNL+VEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYV
Sbjct  360   GESVPLMKKSLESLDNLDVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPDGGCIGYV  419

Query  421   IRTGFNTSQGRLLRTILFAANRATENNAETFAFIAFLMVFAVAAASYVWVKGSEDLERSR  480
             IRTGFNTSQG+LLRTILF ANRATENN ETFAFIAFLMVFAVAAASYVWVKGSED ER+R
Sbjct  420   IRTGFNTSQGKLLRTILFGANRATENNVETFAFIAFLMVFAVAAASYVWVKGSEDPERNR  479

Query  481   YKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK  540
             YKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK
Sbjct  480   YKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKVQICCFDK  539

Query  541   TGTLTTDNLMVEGIAGLAPNGACVPIEEAEANTVQVLACCHSLALLDDGLVGDPLEKATL  600
             TGTLTTDNLMVEGIAGLAPNGACVPIE+AE NTVQVLACCHSLALLDDGLVGDPLEKATL
Sbjct  540   TGTLTTDNLMVEGIAGLAPNGACVPIEKAEGNTVQVLACCHSLALLDDGLVGDPLEKATL  599

Query  601   AAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAGYLMPYSNEVKHIGAVKG  660
             AAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAG+L+PYSNEVKHIGAVKG
Sbjct  600   AAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAGHLIPYSNEVKHIGAVKG  659

Query  661   APEVIQTMLREVPSDYEKVYLEYARRGARVLALGIKGFGTLGSHQIRELKREEVECDLTF  720
             APEVIQ MLREVP+DYEKVYLEYARRGARVLALGIK  GTLG+ ++RE+KREEVECDLTF
Sbjct  660   APEVIQKMLREVPADYEKVYLEYARRGARVLALGIKDLGTLGAQRVREMKREEVECDLTF  719

Query  721   AGFVIISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKLLILTPPD  780
             AGF+IISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKL+ILTPP+
Sbjct  720   AGFLIISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKLIILTPPE  779

Query  781   LEVKSPWRWVSIDGDQTYELDIKKGSKGLSMLLGTHDLCITGEGLQHLQQHQQQYMRHLL  840
              + K+ W WVSIDGDQ+YELD K GSK LS LL THDLCITGEGLQ+LQQ+Q QYMR LL
Sbjct  780   EDRKNNWSWVSIDGDQSYELDTKPGSKKLSHLLATHDLCITGEGLQYLQQNQPQYMRQLL  839

Query  841   PLITVCARFAPKQKEFVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKR  900
             P ITVCARFAPKQKE VITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKR
Sbjct  840   PQITVCARFAPKQKELVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTSAPVKRKR  899

Query  901   TEEEQQQAAAAANAAAAAAQAAAIANQQLTPRERALRRRQEHINQTQARLQNALRDMEEQ  960
             TEEEQQQAAA A A AA AQA A    QLT RERALRRRQEH+NQTQARLQNALRDMEEQ
Sbjct  900   TEEEQQQAAANAAAIAAQAQANANQ--QLTTRERALRRRQEHLNQTQARLQNALRDMEEQ  957

Query  961   TMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVLY  1020
             TMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVLY
Sbjct  958   TMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQAYCQSVLY  1017

Query  1021  IDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHF  1080
             IDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHF
Sbjct  1018  IDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTILSQFAVHF  1077

Query  1081  GTLYYLTSQANILAPPRVGKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQVATIAVNY  1140
             GTLYYLTSQANILAPPR GKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQVATIAVNY
Sbjct  1078  GTLYYLTSQANILAPPREGKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQVATIAVNY  1137

Query  1141  KGHPFMESLRSNRMLMYAIGASATLVILLSTGLAPELTEFFEIIDFPTDFRKTLLGVLIL  1200
             KG+PFMESLRSNRMLMYAIGASA LVILLSTGLAPELTEFFEIIDFPTDFRKTLLGVL+L
Sbjct  1138  KGYPFMESLRSNRMLMYAIGASAALVILLSTGLAPELTEFFEIIDFPTDFRKTLLGVLVL  1197

Query  1201  DIMGAFVLDRICSFLFGETRRKSKVLNC  1228
             DI+GAF+LDRICSFLFGETRRKSKVLNC
Sbjct  1198  DIVGAFLLDRICSFLFGETRRKSKVLNC  1225


>Q8MSI5_DROME unnamed protein product
Length=993

 Score = 1908 bits (4942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 936/995 (94%), Positives = 962/995 (97%), Gaps = 2/995 (0%)

Query  234   MEMVVPEFHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLR  293
             MEMVVPEFHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLR
Sbjct  1     MEMVVPEFHELFIERATAPFFVFQVFSVGLWCMDDYWYYSLFTLFMLIAFECTIVKQQLR  60

Query  294   NMSEIRKMGNKPYLIYAFRQNKWRHIGSDELLPGDLVSVTRSQNDNIVPCDLVILRGSCI  353
             NMSEIRKMGNKPYLIYAFRQNKWRH+GSDELLPGDLVS+TRSQNDNIVPCDLVILRGSCI
Sbjct  61    NMSEIRKMGNKPYLIYAFRQNKWRHLGSDELLPGDLVSITRSQNDNIVPCDLVILRGSCI  120

Query  354   VDESMLTGESVPLMKESLESLDNLNVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPD  413
             VDESMLTGESVPLMKESLESLDNL+VEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPD
Sbjct  121   VDESMLTGESVPLMKESLESLDNLDVEMDAEGDGKLFVLFGGTKVVQHTAPTKESLRAPD  180

Query  414   GGCIGYVIRTGFNTSQGRLLRTILFAANRATENNAETFAFIAFLMVFAVAAASYVWVKGS  473
             GGCIGYVIRTGFNTSQG+LLRTILF ANRATENN ETFAFIAFLMVFAVAAASYVWVKGS
Sbjct  181   GGCIGYVIRTGFNTSQGKLLRTILFGANRATENNVETFAFIAFLMVFAVAAASYVWVKGS  240

Query  474   EDLERSRYKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKV  533
             ED ER+RYKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKV
Sbjct  241   EDPERNRYKLFLECTLILTSIIPPDLPIELTLAVNTSLIQLTKLFVFCTEPFRIPFAGKV  300

Query  534   QICCFDKTGTLTTDNLMVEGIAGLAPNGACVPIEEAEANTVQVLACCHSLALLDDGLVGD  593
             QICCFDKTGTLTTDNLMVEGIAGLAPNGACVPIE+AE NTVQVLACCHSLALLDDGLVGD
Sbjct  301   QICCFDKTGTLTTDNLMVEGIAGLAPNGACVPIEKAEGNTVQVLACCHSLALLDDGLVGD  360

Query  594   PLEKATLAAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAGYLMPYSNEVK  653
             PLEKATLAAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAG+L+PYSNEVK
Sbjct  361   PLEKATLAAVDWTLTKMDSVIPKRPQFKPLKIIQRYHFSSALKRMSVLAGHLIPYSNEVK  420

Query  654   HIGAVKGAPEVIQTMLREVPSDYEKVYLEYARRGARVLALGIKGFGTLGSHQIRELKREE  713
             HIGAVKGAPEVIQ MLREVP+DYEKVYLEYARRGARVLALGIK  GTLG+ ++RE+KREE
Sbjct  421   HIGAVKGAPEVIQKMLREVPADYEKVYLEYARRGARVLALGIKDLGTLGAQRVREMKREE  480

Query  714   VECDLTFAGFVIISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKL  773
             VECDLTFAGF+IISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKL
Sbjct  481   VECDLTFAGFLIISCPMKPDSKSVIKELIQSSHKVVMITGDSPLTACHVARELRFTRKKL  540

Query  774   LILTPPDLEVKSPWRWVSIDGDQTYELDIKKGSKGLSMLLGTHDLCITGEGLQHLQQHQQ  833
             +ILTPP+ + K+ W WVSIDGDQ+YELD K GSK LS LL THDLCITGEGLQ+LQQ+Q 
Sbjct  541   IILTPPEEDRKNNWSWVSIDGDQSYELDTKPGSKKLSHLLATHDLCITGEGLQYLQQNQP  600

Query  834   QYMRHLLPLITVCARFAPKQKEFVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTS  893
             QYMR LLP ITVCARFAPKQKE VITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTS
Sbjct  601   QYMRQLLPQITVCARFAPKQKELVITQLKQLGYCTLMCGDGTNDVGALKHANVGVSLLTS  660

Query  894   APVKRKRTEEEQQQAAAAANAAAAAAQAAAIANQQLTPRERALRRRQEHINQTQARLQNA  953
             APVKRKRTEEEQQQAAA A A AA AQA A    QLT RERALRRRQEH+NQTQARLQNA
Sbjct  661   APVKRKRTEEEQQQAAANAAAIAAQAQANANQ--QLTTRERALRRRQEHLNQTQARLQNA  718

Query  954   LRDMEEQTMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQA  1013
             LRDMEEQTMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQA
Sbjct  719   LRDMEEQTMVKLGDASIAAPFTSKSSSIMCVNHIIKQGRCTLVTTLQMFKILALNALIQA  778

Query  1014  YCQSVLYIDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTIL  1073
             YCQSVLYIDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTIL
Sbjct  779   YCQSVLYIDGIKFSDTQATMQGIFIAACFLFITRAKPLKTLSKVAPLPNIFNFYTISTIL  838

Query  1074  SQFAVHFGTLYYLTSQANILAPPRVGKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQV  1133
             SQFAVHFGTLYYLTSQANILAPPR GKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQV
Sbjct  839   SQFAVHFGTLYYLTSQANILAPPREGKVKLYIDMDAEEKTKYDPNIVSSTVYIICLSLQV  898

Query  1134  ATIAVNYKGHPFMESLRSNRMLMYAIGASATLVILLSTGLAPELTEFFEIIDFPTDFRKT  1193
             ATIAVNYKG+PFMESLRSNRMLMYAIGASA LVILLSTGLAPELTEFFEIIDFPTDFRKT
Sbjct  899   ATIAVNYKGYPFMESLRSNRMLMYAIGASAALVILLSTGLAPELTEFFEIIDFPTDFRKT  958

Query  1194  LLGVLILDIMGAFVLDRICSFLFGETRRKSKVLNC  1228
             LLGVL+LDI+GAF+LDRICSFLFGETRRKSKVLNC
Sbjct  959   LLGVLVLDIVGAFLLDRICSFLFGETRRKSKVLNC  993



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110343.1 gustatory and pheromone receptor 32a [Drosophila
elegans]

Length=464
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GR32A_DROME  unnamed protein product                                  841     0.0  
GR68A_DROME  unnamed protein product                                  156     4e-43
G39AC_DROME  unnamed protein product                                  87.0    2e-18


>GR32A_DROME unnamed protein product
Length=461

 Score = 841 bits (2172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/465 (88%), Positives = 426/465 (92%), Gaps = 5/465 (1%)

Query  1    MSPNTWVIEMPNQKTRSHPFPRRISPYRASSVNRDAFTREPPSGPSRNYDHPVFEDIRTI  60
            MSPNTWVIEMP QKTRSHP+PRRISPYR   +NRDAF+R+ P  P+RN+DHPVFEDIRTI
Sbjct  1    MSPNTWVIEMPTQKTRSHPYPRRISPYRPPVLNRDAFSRDAPPMPARNHDHPVFEDIRTI  60

Query  61   LSVLKASGLMPIYEQVSNYEVGPPNKTNEFYSFFVRGVVHALTIFNIYSLFTPNSAQLFY  120
            LSVLKASGLMPIYEQVS+YEVGPP KTNEFYSFFVRGVVHALTIFN+YSLFTP SAQLF+
Sbjct  61   LSVLKASGLMPIYEQVSDYEVGPPTKTNEFYSFFVRGVVHALTIFNVYSLFTPISAQLFF  120

Query  121  SYRETDNVNQWIELLLCILTYTLTVFVCARNTKSMIRIMNEILELDEEIRRQFGANLKQD  180
            SYRETDNVNQWIELLLCILTYTLTVFVCA NT SM+RIMNEIL+LDEE+RRQFGANL Q+
Sbjct  121  SYRETDNVNQWIELLLCILTYTLTVFVCAHNTTSMLRIMNEILQLDEEVRRQFGANLSQN  180

Query  181  FGFSVKFLVGIAASQTYIIVLKIYAVQGVITSTSYILLAFYAIQNGLTATYIVFASALLR  240
            FGF VKFLVGI A Q YIIVLKIYAVQG IT TSYILLAFY IQNGLTATYIVFASALLR
Sbjct  181  FGFLVKFLVGITACQAYIIVLKIYAVQGEITPTSYILLAFYGIQNGLTATYIVFASALLR  240

Query  241  IVYIRFHFINQLLNGYTYGQQQKRKGNGG-GRRQRGSSYPNPNPSPSPAIMEHFPEDSLF  299
            IVYIRFHFINQLLNGYTYGQQ +RK  G   RRQRG   PN N    PA+MEHFPEDSLF
Sbjct  241  IVYIRFHFINQLLNGYTYGQQHRRKEGGARARRQRGDVNPNVN----PALMEHFPEDSLF  296

Query  300  IYRMHNKLLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQITAKGMVSPNILQWCL  359
            IYRMHNKLLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQIT KGMVSPNILQWC 
Sbjct  297  IYRMHNKLLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQITGKGMVSPNILQWCF  356

Query  360  AWLCLHVSLLALLSRSCGLTTREANATSQILSRVYAKCREYQNIIDKFLTKSIKQEVQFT  419
            AWLCLHVSLLALLSRSCGLTT EANATSQIL+RVYAK +EYQNIIDKFLTKSIKQEVQFT
Sbjct  357  AWLCLHVSLLALLSRSCGLTTTEANATSQILARVYAKSKEYQNIIDKFLTKSIKQEVQFT  416

Query  420  AYGFFAIDNSTLFKIFSAVTTYLVILIQFKQLEDSKGEDPVPEST  464
            AYGFFAIDNSTLFKIFSAVTTYLVILIQFKQLEDSK EDPVPE T
Sbjct  417  AYGFFAIDNSTLFKIFSAVTTYLVILIQFKQLEDSKVEDPVPEQT  461


>GR68A_DROME unnamed protein product
Length=389

 Score = 156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 118/174 (68%), Gaps = 7/174 (4%)

Query  290  MEHFPEDSLFIYRMHNKLLRIYKGINDCCNLILVSFLGYSFYTVTTNCYNLFVQITA---  346
            ME++ E S  I  +  K   I + IN    + L+ + G+SFYTVT   Y  F  +TA   
Sbjct  214  MENWRELSNLI-EVLCKFRYITENINCVAGVSLLFYFGFSFYTVTNQSYLAFATLTAGSL  272

Query  347  --KGMVSPNILQWCLAWLCLHVSLLALLSRSCGLTTREANATSQILSRVYAKCREYQNII  404
              K  V+  I   C+  L   ++++ + S   GL + E N T+QIL+R+Y K +++QN+I
Sbjct  273  SSKTEVADTIGLSCIWVLAETITMIVICSACDGLAS-EVNGTAQILARIYGKSKQFQNLI  331

Query  405  DKFLTKSIKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQFKQLEDSKGED  458
            DKFLTKSIKQ++QFTAYGFF+IDNSTLFKIFSAVTTYLVILIQFKQLEDSK ED
Sbjct  332  DKFLTKSIKQDLQFTAYGFFSIDNSTLFKIFSAVTTYLVILIQFKQLEDSKVED  385


 Score = 40.4 bits (93),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 35/59 (59%), Gaps = 1/59 (2%)

Query  110  LFTPNSAQLFYSYR-ETDNVNQWIELLLCILTYTLTVFVCARNTKSMIRIMNEILELDE  167
            LF     +L  S + +T+ +N+ IE LLCI++YT+ V    +N     R +++I ++DE
Sbjct  60   LFASKEYRLVASAQGDTEEINRTIETLLCIISYTMVVLSSVQNASRHFRTLHDIAKIDE  118


>G39AC_DROME unnamed protein product
Length=381

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 77/125 (62%), Gaps = 5/125 (4%)

Query  330  FYTVTTNCYNLFVQITAKGMVSPNILQWCLAWLCLHVSLLALLSRSCGLTTREANATSQI  389
            FY V+T     F Q     ++S   + W L W+ L V     L+       +EAN T+++
Sbjct  255  FYLVSTIFEGRFRQNWQFSLMSFTAILWSLPWIVLLV-----LAMGRNDVQKEANKTAKM  309

Query  390  LSRVYAKCREYQNIIDKFLTKSIKQEVQFTAYGFFAIDNSTLFKIFSAVTTYLVILIQFK  449
            L++V         +I+KFL K+++Q+   TAYGFFA+D STLFK+F+A+ TY+VIL+QFK
Sbjct  310  LTKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFK  369

Query  450  QLEDS  454
            ++E+S
Sbjct  370  EMENS  374



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110344.1 kinesin-like protein KIN-7O isoform X1 [Drosophila
elegans]

Length=2114
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFL9_DROME  unnamed protein product                                 1878    0.0  
M9PD87_DROME  unnamed protein product                                 1877    0.0  
Q9VKI0_DROME  unnamed protein product                                 1860    0.0  


>M9PFL9_DROME unnamed protein product
Length=2132

 Score = 1878 bits (4864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1070/1962 (55%), Positives = 1367/1962 (70%), Gaps = 186/1962 (9%)

Query  1     MSAKNASSIQVCIKVRPCELGLTSLWQVKEGRSIQLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCE GLTSLWQVKE RSI LADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTHTMMGDDQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKT+TMMGD+QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNERIYDLLNKKNQDLKIHESGNGMVNVNCEECIITGEEDLLRLLCTGN  180
             DFLLRVGYIEIYNE+IYDLLNKKNQDLKIHESGNG+VNVNCEECIIT E DLLRLLC GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGET------SHSHAIFRIIIESRKSDRSDGDVVIQSVLNLVDLAGSERANHSAGR  234
             KERTVGET      S SHAIF+IIIESRKSD SD D VIQSVLNLVDLAGSERA+ +  R
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  235   GC---------QSLLFLSNVIKSLSENAD-KFVSFRSSKLTRILQASLGGKAFTSIICTI  284
             G          +SLLFLSNVIKSLSENAD +F ++R SKLTRILQASLGG AFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  285   NPSSVEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRIEREIKMNRDKLAEEERRNES  344
              PS +EESQSTLSFATRAKKIRIKPQVNEMVSDATMMKR+EREIK+ +DKLAEEER+NE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  345   QLKVQELERRIKRDMLKIISSSSLTDQRLQKRRCTWISPASGPEAETATTATIATLPALS  404
             Q KV+ LER+IK DM KII   SL+D+  QKRR TW   ASG   E A T T        
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTT-------  413

Query  405   EESRLPRLSKASNLPKPMF--------RRDVAPKTVSI---------NPALKEEFVPVDI  447
              E R+ +  K S+LPKP+F        R D  PKT++I         + ++ EEF+P + 
Sbjct  414   -EDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAEC  472

Query  448   MDFTSAVPKLLEKEAASSVRSVIKKDQQSVQNCDALQAEVSALTASNQLANETIEKYEEQ  507
             +DF S  P +L+          +    +     DAL+ EV++L A N+ AN  I + EE+
Sbjct  473   IDFGSPRPDVLKPMLTIRQLPDLPLTPKGPLTYDALEKEVTSLRADNEAANSKISELEEK  532

Query  508   VKKLKETIERLEMENSEAAVNHELRFESHKTKSKQVENKLLSTLSEKESTIESLQQSLEK  567
             +  LK+T+  +E+EN + AV  E  FE+HK  SK   + LLS L EKESTIESLQ+SL+ 
Sbjct  533   LSTLKQTMRIMEVEN-QVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDN  591

Query  568   LSRDVLRNSKEEHMRTMCPDLES-SCERICNKCQELEHLLPATDASVIDSIACQCDQLRA  626
             L+RDVLRNSKE HM ++ P+ E  + + ICNKC+ELE L+   ++      +C+CDQLR 
Sbjct  592   LTRDVLRNSKEGHMLSIAPEQEDIAGDSICNKCEELEKLIADLESK---KNSCECDQLRL  648

Query  627   EIAATRTKLESVQSAFSQASCEVSQRTTDCERLSRQISSAQDDFGLLQARYDHLEKQGQA  686
             EI + R KLESV+SAF+ AS E+ Q+ TDCERLS+++S++Q+ FG LQ RYD L++Q QA
Sbjct  649   EIVSVRDKLESVESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQA  708

Query  687   QQLAIESMQAEYHSIQRKYQKLQLEYDHLEQR----SEEQCQQLQADNAKLQAEIGTLKQ  742
             QQ  I ++  ++  +Q KYQKLQ EY+ LE R    S  + Q+LQ DN K QA+I +L +
Sbjct  709   QQAGITTLHEKHEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNE  768

Query  743   RVEEAQRQLLEAPNPESLAEEFKAQNRELKAQLSDLQANFAEIQSEYDCLSNQLMESVQE  802
             R+EEAQ  L E  N ES  E+ + QN EL A++ +L+ NF E+Q EYDCLSNQLMESVQE
Sbjct  769   RLEEAQNMLTEVQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQE  828

Query  803   NDALREELKQRPSSFEVDSMKSSGVGTECSEPEHELDPDSDLLQQFVQLSESIHQIELQH  862
             NDALREE+KQRP+S   +SM+SSG+ ++  E +     D +LL QFVQLSES+ QIELQH
Sbjct  829   NDALREEIKQRPTSHVEESMRSSGISSDFDEQKQ----DINLLHQFVQLSESVQQIELQH  884

Query  863   HSGCSRLFRAINLDRDLEEPGLKLCLESADCIESDSRQLDASDFISLKGSFKRHRFQIRR  922
             HSG SRLFRA  +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+R
Sbjct  885   HSGISRLFRANQMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKR  944

Query  923   LTQEQVEFKEEERLRCVISQLEQEVKEKNTLIGDAEATINELREQIISLESAFVEKSSLE  982
             L+QE V+  EE+RL  +ISQLEQE++EK+ L+   EATINE+REQ+ +LESA +EKS + 
Sbjct  945   LSQEHVDMGEEKRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVII  1004

Query  983   NM---------ELEKQNA------RDQPDKVTTESSMSDSLLECPPDEETLTACHESPAQ  1027
             N           LEKQNA       +  D+VT ESSMS+SLL  PPDE+TL  C  SP++
Sbjct  1005  NKVEDYQRQIESLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGCPTSPSR  1064

Query  1028  KDHESQEVVTLKESLAELKTKVCHLQAELESQLKQMQLKDSNIAKLQTDIEEMGERCLSM  1087
             ++   QEV TLK S+ EL+++V  L+AELE+ L+Q+QLKD NIA+LQTD EEM ERCLSM
Sbjct  1065  RE---QEVATLKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSM  1121

Query  1088  ELKVAQLQEDAQQKQELLDRQAQKLSDDLSLIDQLQQRNANLAE------ESLKLERSKH  1141
             E+++A+L ED +QKQELLDRQAQKLSDDL LIDQLQ++NA L E      ESL L  +K 
Sbjct  1122  EVRLAELDEDTKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKP  1181

Query  1142  EQTIASSIYEKQVEELEESLKRAKENLCILEKQKTVEINAIQLEYMVKMETSEHENRAKF  1201
             +Q + SS Y+ Q+E+L + L  AK+ L  + + K  EI+A+++E+++++ET+E EN+AKF
Sbjct  1182  DQILLSSQYDSQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF  1241

Query  1202  RSYSHELEASKERYESSVATLRDQLSQAGEELSSVTTRFQAELEGIRGTLQEKINHAEEE  1261
              +   EL+ +K+RYES+VA L+++L Q  E LSSVT R QAELE ++   +E I+ A EE
Sbjct  1242  YA---ELQETKDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEE  1298

Query  1262  RSKLNAQHQAELEKIREILKEKLAEAEAKEIRIEADHKAEISHVRLTLKEQLSQAEEERE  1321
             R+ L  QHQAE+E IRE LK KLAEA  ++ ++E   +AEI+ VR TL EQL+Q +E+R+
Sbjct  1299  RNNLIVQHQAEMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRD  1358

Query  1322  KVSSKLEEMEITLEEMISQRRAMEDTIAELEKTKNDRELALDNLKTEKTKLQLLYDKSQE  1381
             K +SKLEE++ TLE+MI+  R M DTIAELEKTK +++LA++ L  +  +L+    K+QE
Sbjct  1359  KGASKLEEVKKTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQE  1418

Query  1382  QLQRQLQLHTRDHNGTGDGEQGEQLD--------KINDIQ---DQQVVDLEKLGREKMTL  1430
             QL  Q++  TRD          ++L+        +I +++   DQQV++L+K   EK++L
Sbjct  1419  QL--QMESLTRDQISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSL  1476

Query  1431  QSEIQ-------IQKQKIQELESHTDVLV----LDKCDLMAKLETFTAKISDLEEALHGA  1479
             +SEIQ          +K+QEL++   VL      +KCD   KLETFT KI+DLEE L  A
Sbjct  1477  ESEIQKANSEHSCTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEA  1536

Query  1480  KLKLLAQDDLVSQHDRLKICLSEANELSCNLQKKVERLHADLLASEEGISSRDVELDQLR  1539
             + K++  DDLVSQH+RLKICL+EANELS NLQKKV  LH +L+ S++GISSRDVE+++LR
Sbjct  1537  QHKVILYDDLVSQHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELR  1596

Query  1540  TELKSAVDAKTTACTEQLILVAQVKKVEERMSVQTEEFKREVAELKGSMNELQLKHKSLQ  1599
              ELK+A+DAK TA  EQ+ LV Q+K VEERM+ Q E+F RE A LKGS+NEL LK  S+Q
Sbjct  1597  EELKAAMDAKATASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQ  1656

Query  1600  ETKDNLEAGNEELKLKLSRSHDLQNMLAEEQALTASLRESLDKLEQSKACLAEEMQTMEA  1659
             ETKD LE+GNEELK +L  S +L+NML EE  +  SL+E L KLE +K  L ++++  ++
Sbjct  1657  ETKDMLESGNEELKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKS  1716

Query  1660  EFAQRSTELSRKLEMGRIATGELSKECENLRSDLETKTKNFQRENKNLESIIFGLQKDKQ  1719
             E  QR TEL++++E+GR   GEL+K+CE L SDLE           N + I   LQ+ K+
Sbjct  1717  EIYQRHTELTKEVELGRNRIGELTKKCEELCSDLE-----------NSDQIRLDLQETKE  1765

Query  1720  QLDEEMVILKEKEEAHKTALASLQEASSKHQLVMEMANNKNLEMAQKVNDLLNKCEGLRF  1779
             QL + +                                  NL   QKV+++  +CE LRF
Sbjct  1766  QLKKTL--------------------------------ENNLGWQQKVDEVTRECEKLRF  1793

Query  1780  DLKEKDEANAGLRTQLISNEEALASLEESSIKNKLAMESANNKCLEMEQRIDDLSKECEQ  1839
             D++ K+  N                                      E ++ +L  ECE+
Sbjct  1794  DMQSKEVQN--------------------------------------ESKVQELISECEE  1815

Query  1840  LRSDLQFKESCFLKEKDQLDGTISNLLEDKLSLEKQLCSLNE  1881
             LRS L+ KE+ F  EK+ +D TIS+LLEDK +LE++LCS N+
Sbjct  1816  LRSTLKSKEASFQSEKESMDRTISSLLEDKRNLEEKLCSAND  1857


 Score = 140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 118/341 (35%), Positives = 175/341 (51%), Gaps = 87/341 (26%)

Query  1771  LNKCEGLRFDLKEKDEANAGLRTQLISNEEALASLEESSIKNKLAMESANNKCL-EME--  1827
             L   + LR  L E+ +    L+ +L+  E+A  SLE+    NK  +   + +   E+E  
Sbjct  1673  LRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKEVELG  1732

Query  1828  -QRIDDLSKECEQLRSDLQFKESCFL---KEKDQLDGTISNLLEDKLSLEKQLCSLNEKL  1883
               RI +L+K+CE+L SDL+  +   L   + K+QL  T    LE+ L  ++++    +++
Sbjct  1733  RNRIGELTKKCEELCSDLENSDQIRLDLQETKEQLKKT----LENNLGWQQKV----DEV  1784

Query  1884  TMKCEKLRKTLKSNLKTYKHQFEEKLSILKEKDEDNARLKMQLTSLHESSSEHELAMKAA  1943
             T +CEKLR  ++S                                               
Sbjct  1785  TRECEKLRFDMQS-----------------------------------------------  1797

Query  1944  NNKSLELEHKIVELTKESEMLRSTLKSRESNFRTEKERMDGTIRSLLEDKRNLEEKLCSL  2003
               K ++ E K+ EL  E E LRSTLKS+E++F++EKE MD TI SLLEDKRNLEEKLCS 
Sbjct  1798  --KEVQNESKVQELISECEELRSTLKSKEASFQSEKESMDRTISSLLEDKRNLEEKLCSA  1855

Query  2004  SEIMSKLELELAAFQPPKSCGSCESNITNGNTTAKKTLDRNATPSVAMKPSMLIESTERK  2063
             ++I++KLE E+AA +P                  +K+LDRN  P    + S+  ES  RK
Sbjct  1856  NDIVAKLETEIAALRP------------------RKSLDRNPVP----RKSITFESEIRK  1893

Query  2064  NRRITAYDERRRQSNWNDFQDCANTTNSSESNCDCTEPNCK  2104
             NRRI+ +DE RRQS WND ++    T+  ++NC+C E N K
Sbjct  1894  NRRISVHDE-RRQSYWNDVREFGIMTDPVDNNCNCAELNSK  1933


>M9PD87_DROME unnamed protein product
Length=2134

 Score = 1877 bits (4861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1070/1962 (55%), Positives = 1367/1962 (70%), Gaps = 186/1962 (9%)

Query  1     MSAKNASSIQVCIKVRPCELGLTSLWQVKEGRSIQLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCE GLTSLWQVKE RSI LADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTHTMMGDDQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKT+TMMGD+QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNERIYDLLNKKNQDLKIHESGNGMVNVNCEECIITGEEDLLRLLCTGN  180
             DFLLRVGYIEIYNE+IYDLLNKKNQDLKIHESGNG+VNVNCEECIIT E DLLRLLC GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGET------SHSHAIFRIIIESRKSDRSDGDVVIQSVLNLVDLAGSERANHSAGR  234
             KERTVGET      S SHAIF+IIIESRKSD SD D VIQSVLNLVDLAGSERA+ +  R
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  235   GC---------QSLLFLSNVIKSLSENAD-KFVSFRSSKLTRILQASLGGKAFTSIICTI  284
             G          +SLLFLSNVIKSLSENAD +F ++R SKLTRILQASLGG AFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  285   NPSSVEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRIEREIKMNRDKLAEEERRNES  344
              PS +EESQSTLSFATRAKKIRIKPQVNEMVSDATMMKR+EREIK+ +DKLAEEER+NE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  345   QLKVQELERRIKRDMLKIISSSSLTDQRLQKRRCTWISPASGPEAETATTATIATLPALS  404
             Q KV+ LER+IK DM KII   SL+D+  QKRR TW   ASG   E A T T        
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTT-------  413

Query  405   EESRLPRLSKASNLPKPMF--------RRDVAPKTVSI---------NPALKEEFVPVDI  447
              E R+ +  K S+LPKP+F        R D  PKT++I         + ++ EEF+P + 
Sbjct  414   -EDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAEC  472

Query  448   MDFTSAVPKLLEKEAASSVRSVIKKDQQSVQNCDALQAEVSALTASNQLANETIEKYEEQ  507
             +DF S  P +L+          +    +     DAL+ EV++L A N+ AN  I + EE+
Sbjct  473   IDFGSPRPDVLKPMLTIRQLPDLPLTPKGPLTYDALEKEVTSLRADNEAANSKISELEEK  532

Query  508   VKKLKETIERLEMENSEAAVNHELRFESHKTKSKQVENKLLSTLSEKESTIESLQQSLEK  567
             +  LK+T+  +E+EN + AV  E  FE+HK  SK   + LLS L EKESTIESLQ+SL+ 
Sbjct  533   LSTLKQTMRIMEVEN-QVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDN  591

Query  568   LSRDVLRNSKEEHMRTMCPDLES-SCERICNKCQELEHLLPATDASVIDSIACQCDQLRA  626
             L+RDVLRNSKE HM ++ P+ E  + + ICNKC+ELE L+   ++      +C+CDQLR 
Sbjct  592   LTRDVLRNSKEGHMLSIAPEQEDIAGDSICNKCEELEKLIADLESK---KNSCECDQLRL  648

Query  627   EIAATRTKLESVQSAFSQASCEVSQRTTDCERLSRQISSAQDDFGLLQARYDHLEKQGQA  686
             EI + R KLESV+SAF+ AS E+ Q+ TDCERLS+++S++Q+ FG LQ RYD L++Q QA
Sbjct  649   EIVSVRDKLESVESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQA  708

Query  687   QQLAIESMQAEYHSIQRKYQKLQLEYDHLEQR----SEEQCQQLQADNAKLQAEIGTLKQ  742
             QQ  I ++  ++  +Q KYQKLQ EY+ LE R    S  + Q+LQ DN K QA+I +L +
Sbjct  709   QQAGITTLHEKHEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNE  768

Query  743   RVEEAQRQLLEAPNPESLAEEFKAQNRELKAQLSDLQANFAEIQSEYDCLSNQLMESVQE  802
             R+EEAQ  L E  N ES  E+ + QN EL A++ +L+ NF E+Q EYDCLSNQLMESVQE
Sbjct  769   RLEEAQNMLTEVQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQE  828

Query  803   NDALREELKQRPSSFEVDSMKSSGVGTECSEPEHELDPDSDLLQQFVQLSESIHQIELQH  862
             NDALREE+KQRP+S   +SM+SSG+ ++  E +     D +LL QFVQLSES+ QIELQH
Sbjct  829   NDALREEIKQRPTSHVEESMRSSGISSDFDEQKQ----DINLLHQFVQLSESVQQIELQH  884

Query  863   HSGCSRLFRAINLDRDLEEPGLKLCLESADCIESDSRQLDASDFISLKGSFKRHRFQIRR  922
             HSG SRLFRA  +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+R
Sbjct  885   HSGISRLFRANQMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKR  944

Query  923   LTQEQVEFKEEERLRCVISQLEQEVKEKNTLIGDAEATINELREQIISLESAFVEKSSLE  982
             L+QE V+  EE+RL  +ISQLEQE++EK+ L+   EATINE+REQ+ +LESA +EKS + 
Sbjct  945   LSQEHVDMGEEKRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVII  1004

Query  983   NM---------ELEKQNA------RDQPDKVTTESSMSDSLLECPPDEETLTACHESPAQ  1027
             N           LEKQNA       +  D+VT ESSMS+SLL  PPDE+TL  C  SP++
Sbjct  1005  NKVEDYQRQIESLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGCPTSPSR  1064

Query  1028  KDHESQEVVTLKESLAELKTKVCHLQAELESQLKQMQLKDSNIAKLQTDIEEMGERCLSM  1087
             ++   QEV TLK S+ EL+++V  L+AELE+ L+Q+QLKD NIA+LQTD EEM ERCLSM
Sbjct  1065  RE---QEVATLKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSM  1121

Query  1088  ELKVAQLQEDAQQKQELLDRQAQKLSDDLSLIDQLQQRNANLAE------ESLKLERSKH  1141
             E+++A+L ED +QKQELLDRQAQKLSDDL LIDQLQ++NA L E      ESL L  +K 
Sbjct  1122  EVRLAELDEDTKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKP  1181

Query  1142  EQTIASSIYEKQVEELEESLKRAKENLCILEKQKTVEINAIQLEYMVKMETSEHENRAKF  1201
             +Q + SS Y+ Q+E+L + L  AK+ L  + + K  EI+A+++E+++++ET+E EN+AKF
Sbjct  1182  DQILLSSQYDSQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKF  1241

Query  1202  RSYSHELEASKERYESSVATLRDQLSQAGEELSSVTTRFQAELEGIRGTLQEKINHAEEE  1261
              +   EL+ +K+RYES+VA L+++L Q  E LSSVT R QAELE ++   +E I+ A EE
Sbjct  1242  YA---ELQETKDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEE  1298

Query  1262  RSKLNAQHQAELEKIREILKEKLAEAEAKEIRIEADHKAEISHVRLTLKEQLSQAEEERE  1321
             R+ L  QHQAE+E IRE LK KLAEA  ++ ++E   +AEI+ VR TL EQL+Q +E+R+
Sbjct  1299  RNNLIVQHQAEMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRD  1358

Query  1322  KVSSKLEEMEITLEEMISQRRAMEDTIAELEKTKNDRELALDNLKTEKTKLQLLYDKSQE  1381
             K +SKLEE++ TLE+MI+  R M DTIAELEKTK +++LA++ L  +  +L+    K+QE
Sbjct  1359  KGASKLEEVKKTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQE  1418

Query  1382  QLQRQLQLHTRDHNGTGDGEQGEQLD--------KINDIQ---DQQVVDLEKLGREKMTL  1430
             QL  Q++  TRD          ++L+        +I +++   DQQV++L+K   EK++L
Sbjct  1419  QL--QMESLTRDQISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSL  1476

Query  1431  QSEIQ-------IQKQKIQELESHTDVLV----LDKCDLMAKLETFTAKISDLEEALHGA  1479
             +SEIQ          +K+QEL++   VL      +KCD   KLETFT KI+DLEE L  A
Sbjct  1477  ESEIQKANSEHSCTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEA  1536

Query  1480  KLKLLAQDDLVSQHDRLKICLSEANELSCNLQKKVERLHADLLASEEGISSRDVELDQLR  1539
             + K++  DDLVSQH+RLKICL+EANELS NLQKKV  LH +L+ S++GISSRDVE+++LR
Sbjct  1537  QHKVILYDDLVSQHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELR  1596

Query  1540  TELKSAVDAKTTACTEQLILVAQVKKVEERMSVQTEEFKREVAELKGSMNELQLKHKSLQ  1599
              ELK+A+DAK TA  EQ+ LV Q+K VEERM+ Q E+F RE A LKGS+NEL LK  S+Q
Sbjct  1597  EELKAAMDAKATASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQ  1656

Query  1600  ETKDNLEAGNEELKLKLSRSHDLQNMLAEEQALTASLRESLDKLEQSKACLAEEMQTMEA  1659
             ETKD LE+GNEELK +L  S +L+NML EE  +  SL+E L KLE +K  L ++++  ++
Sbjct  1657  ETKDMLESGNEELKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKS  1716

Query  1660  EFAQRSTELSRKLEMGRIATGELSKECENLRSDLETKTKNFQRENKNLESIIFGLQKDKQ  1719
             E  QR TEL++++E+GR   GEL+K+CE L SDLE           N + I   LQ+ K+
Sbjct  1717  EIYQRHTELTKEVELGRNRIGELTKKCEELCSDLE-----------NSDQIRLDLQETKE  1765

Query  1720  QLDEEMVILKEKEEAHKTALASLQEASSKHQLVMEMANNKNLEMAQKVNDLLNKCEGLRF  1779
             QL + +                                  NL   QKV+++  +CE LRF
Sbjct  1766  QLKKTL--------------------------------ENNLGWQQKVDEVTRECEKLRF  1793

Query  1780  DLKEKDEANAGLRTQLISNEEALASLEESSIKNKLAMESANNKCLEMEQRIDDLSKECEQ  1839
             D++ K+  N                                      E ++ +L  ECE+
Sbjct  1794  DMQSKEVQN--------------------------------------ESKVQELISECEE  1815

Query  1840  LRSDLQFKESCFLKEKDQLDGTISNLLEDKLSLEKQLCSLNE  1881
             LRS L+ KE+ F  EK+ +D TIS+LLEDK +LE++LCS N+
Sbjct  1816  LRSTLKSKEASFQSEKESMDRTISSLLEDKRNLEEKLCSAND  1857


 Score = 140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 118/341 (35%), Positives = 175/341 (51%), Gaps = 87/341 (26%)

Query  1771  LNKCEGLRFDLKEKDEANAGLRTQLISNEEALASLEESSIKNKLAMESANNKCL-EME--  1827
             L   + LR  L E+ +    L+ +L+  E+A  SLE+    NK  +   + +   E+E  
Sbjct  1673  LRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKEVELG  1732

Query  1828  -QRIDDLSKECEQLRSDLQFKESCFL---KEKDQLDGTISNLLEDKLSLEKQLCSLNEKL  1883
               RI +L+K+CE+L SDL+  +   L   + K+QL  T    LE+ L  ++++    +++
Sbjct  1733  RNRIGELTKKCEELCSDLENSDQIRLDLQETKEQLKKT----LENNLGWQQKV----DEV  1784

Query  1884  TMKCEKLRKTLKSNLKTYKHQFEEKLSILKEKDEDNARLKMQLTSLHESSSEHELAMKAA  1943
             T +CEKLR  ++S                                               
Sbjct  1785  TRECEKLRFDMQS-----------------------------------------------  1797

Query  1944  NNKSLELEHKIVELTKESEMLRSTLKSRESNFRTEKERMDGTIRSLLEDKRNLEEKLCSL  2003
               K ++ E K+ EL  E E LRSTLKS+E++F++EKE MD TI SLLEDKRNLEEKLCS 
Sbjct  1798  --KEVQNESKVQELISECEELRSTLKSKEASFQSEKESMDRTISSLLEDKRNLEEKLCSA  1855

Query  2004  SEIMSKLELELAAFQPPKSCGSCESNITNGNTTAKKTLDRNATPSVAMKPSMLIESTERK  2063
             ++I++KLE E+AA +P                  +K+LDRN  P    + S+  ES  RK
Sbjct  1856  NDIVAKLETEIAALRP------------------RKSLDRNPVP----RKSITFESEIRK  1893

Query  2064  NRRITAYDERRRQSNWNDFQDCANTTNSSESNCDCTEPNCK  2104
             NRRI+ +DE RRQS WND ++    T+  ++NC+C E N K
Sbjct  1894  NRRISVHDE-RRQSYWNDVREFGIMTDPVDNNCNCAELNSK  1933


>Q9VKI0_DROME unnamed protein product
Length=2189

 Score = 1860 bits (4818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1075/2019 (53%), Positives = 1376/2019 (68%), Gaps = 245/2019 (12%)

Query  1     MSAKNASSIQVCIKVRPCELGLTSLWQVKEGRSIQLADSHAEPCVFDYVFGEGASNQEVF  60
             MSAKNASSIQVCIKVRPCE GLTSLWQVKE RSI LADSHAEP VFDYVF EGASNQEVF
Sbjct  1     MSAKNASSIQVCIKVRPCEPGLTSLWQVKERRSIHLADSHAEPYVFDYVFDEGASNQEVF  60

Query  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTHTMMGDDQNPGVMVLAAKEIFQQISTETDR  120
             DRMAKHIVHACMQGFNGTIFAYGQTSSGKT+TMMGD+QNPGVMVLAAKEIFQQIS+ET+R
Sbjct  61    DRMAKHIVHACMQGFNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER  120

Query  121   DFLLRVGYIEIYNERIYDLLNKKNQDLKIHESGNGMVNVNCEECIITGEEDLLRLLCTGN  180
             DFLLRVGYIEIYNE+IYDLLNKKNQDLKIHESGNG+VNVNCEECIIT E DLLRLLC GN
Sbjct  121   DFLLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCEECIITSEVDLLRLLCLGN  180

Query  181   KERTVGET------SHSHAIFRIIIESRKSDRSDGDVVIQSVLNLVDLAGSERANHSAGR  234
             KERTVGET      S SHAIF+IIIESRKSD SD D VIQSVLNLVDLAGSERA+ +  R
Sbjct  181   KERTVGETNMNERSSRSHAIFKIIIESRKSDHSDDDAVIQSVLNLVDLAGSERADQTGAR  240

Query  235   GC---------QSLLFLSNVIKSLSENAD-KFVSFRSSKLTRILQASLGGKAFTSIICTI  284
             G          +SLLFLSNVIKSLSENAD +F ++R SKLTRILQASLGG AFTSIICTI
Sbjct  241   GARLKEGGHINKSLLFLSNVIKSLSENADNRFTNYRDSKLTRILQASLGGNAFTSIICTI  300

Query  285   NPSSVEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRIEREIKMNRDKLAEEERRNES  344
              PS +EESQSTLSFATRAKKIRIKPQVNEMVSDATMMKR+EREIK+ +DKLAEEER+NE+
Sbjct  301   KPSIMEESQSTLSFATRAKKIRIKPQVNEMVSDATMMKRLEREIKVLKDKLAEEERKNEN  360

Query  345   QLKVQELERRIKRDMLKIISSSSLTDQRLQKRRCTWISPASGPEAETATTATIATLPALS  404
             Q KV+ LER+IK DM KII   SL+D+  QKRR TW   ASG   E A T T        
Sbjct  361   QQKVEHLERQIKHDMHKIICGHSLSDKGQQKRRRTWCPTASGSHLELAETGTT-------  413

Query  405   EESRLPRLSKASNLPKPMF--------RRDVAPKTVSI---------NPALKEEFVPVDI  447
              E R+ +  K S+LPKP+F        R D  PKT++I         + ++ EEF+P + 
Sbjct  414   -EDRIDQFPKVSHLPKPVFFHTSNAGKRWDNIPKTINILGSLDIGTESNSISEEFLPAEC  472

Query  448   MDFTSAVPKLLEKEAASSVRSV---------------IKKDQQSVQ-----------NCD  481
             +DF S  P +L  +   ++R +               IKK+ Q +Q            C+
Sbjct  473   IDFGSPRPDVL--KPMLTIRQLPDLPLTPKGPLTTDKIKKEIQDLQMFTSLEKHFEVECE  530

Query  482   ALQA-------------------------------EVSALTASNQLANETIEKYEEQVKK  510
              +Q                                EV++L A N+ AN  I + EE++  
Sbjct  531   EVQGLKEKLAEVTAQRDNLEQESLAEKERYDALEKEVTSLRADNEAANSKISELEEKLST  590

Query  511   LKETIERLEMENSEAAVNHELRFESHKTKSKQVENKLLSTLSEKESTIESLQQSLEKLSR  570
             LK+T+  +E+EN + AV  E  FE+HK  SK   + LLS L EKESTIESLQ+SL+ L+R
Sbjct  591   LKQTMRIMEVEN-QVAVGLEFEFEAHKKSSKLRVDDLLSALLEKESTIESLQKSLDNLTR  649

Query  571   DVLRNSKEEHMRTMCPDLES-SCERICNKCQELEHLLPATDASVIDSIACQCDQLRAEIA  629
             DVLRNSKE HM ++ P+ E  + + ICNKC+ELE L+   ++      +C+CDQLR EI 
Sbjct  650   DVLRNSKEGHMLSIAPEQEDIAGDSICNKCEELEKLIADLESK---KNSCECDQLRLEIV  706

Query  630   ATRTKLESVQSAFSQASCEVSQRTTDCERLSRQISSAQDDFGLLQARYDHLEKQGQAQQL  689
             + R KLESV+SAF+ AS E+ Q+ TDCERLS+++S++Q+ FG LQ RYD L++Q QAQQ 
Sbjct  707   SVRDKLESVESAFNLASSEIIQKATDCERLSKELSTSQNAFGQLQERYDALDQQWQAQQA  766

Query  690   AIESMQAEYHSIQRKYQKLQLEYDHLEQR----SEEQCQQLQADNAKLQAEIGTLKQRVE  745
              I ++  ++  +Q KYQKLQ EY+ LE R    S  + Q+LQ DN K QA+I +L +R+E
Sbjct  767   GITTLHEKHEHVQEKYQKLQEEYEQLESRARSASSAEFQRLQNDNTKFQADIASLNERLE  826

Query  746   EAQRQLLEAPNPESLAEEFKAQNRELKAQLSDLQANFAEIQSEYDCLSNQLMESVQENDA  805
             EAQ  L E  N ES  E+ + QN EL A++ +L+ NF E+Q EYDCLSNQLMESVQENDA
Sbjct  827   EAQNMLTEVQNSESTVEKLRIQNHELTAKIKELETNFEEMQREYDCLSNQLMESVQENDA  886

Query  806   LREELKQRPSSFEVDSMKSSGVGTECSEPEHELDPDSDLLQQFVQLSESIHQIELQHHSG  865
             LREE+KQRP+S   +SM+SSG+ ++  E +     D +LL QFVQLSES+ QIELQHHSG
Sbjct  887   LREEIKQRPTSHVEESMRSSGISSDFDEQKQ----DINLLHQFVQLSESVQQIELQHHSG  942

Query  866   CSRLFRAINLDRDLEEPGLKLCLESADCIESDSRQLDASDFISLKGSFKRHRFQIRRLTQ  925
              SRLFRA  +  D  EPGLKLCLESA+ IE D+RQ DA++ I LKG  KRHRFQI+RL+Q
Sbjct  943   ISRLFRANQMKLDQSEPGLKLCLESAEYIEEDNRQSDATEPICLKGFLKRHRFQIKRLSQ  1002

Query  926   EQVEFKEEERLRCVISQLEQEVKEKNTLIGDAEATINELREQIISLESAFVEKSSLENM-  984
             E V+  EE+RL  +ISQLEQE++EK+ L+   EATINE+REQ+ +LESA +EKS + N  
Sbjct  1003  EHVDMGEEKRLLDIISQLEQEIEEKSALMEATEATINEMREQMTNLESALLEKSVIINKV  1062

Query  985   --------ELEKQNA------RDQPDKVTTESSMSDSLLECPPDEETLTACHESPAQKDH  1030
                      LEKQNA       +  D+VT ESSMS+SLL  PPDE+TL  C  SP++++ 
Sbjct  1063  EDYQRQIESLEKQNAEMTMVYEELQDRVTRESSMSESLLRVPPDEDTLPGCPTSPSRRE-  1121

Query  1031  ESQEVVTLKESLAELKTKVCHLQAELESQLKQMQLKDSNIAKLQTDIEEMGERCLSMELK  1090
               QEV TLK S+ EL+++V  L+AELE+ L+Q+QLKD NIA+LQTD EEM ERCLSME++
Sbjct  1122  --QEVATLKTSITELQSQVSDLKAELENHLRQIQLKDGNIARLQTDFEEMSERCLSMEVR  1179

Query  1091  VAQLQEDAQQKQELLDRQAQKLSDDLSLIDQLQQRNANLAE------ESLKLERSKHEQT  1144
             +A+L ED +QKQELLDRQAQKLSDDL LIDQLQ++NA L E      ESL L  +K +Q 
Sbjct  1180  LAELDEDTKQKQELLDRQAQKLSDDLCLIDQLQKKNAQLVEQYHKATESLSLADAKPDQI  1239

Query  1145  IASSIYEKQVEELEESLKRAKENLCILEKQKTVEINAIQLEYMVKMETSEHENRAKFRSY  1204
             + SS Y+ Q+E+L + L  AK+ L  + + K  EI+A+++E+++++ET+E EN+AKF + 
Sbjct  1240  LLSSQYDSQIEKLNQLLNAAKDELHDVRRIKDDEISALRMEFLLQIETNEKENQAKFYA-  1298

Query  1205  SHELEASKERYESSVATLRDQLSQAGEELSSVTTRFQAELEGIRGTLQEKINHAEEERSK  1264
               EL+ +K+RYES+VA L+++L Q  E LSSVT R QAELE ++   +E I+ A EER+ 
Sbjct  1299  --ELQETKDRYESNVAELKEKLLQVEETLSSVTVRCQAELEALKSAHKENISQAVEERNN  1356

Query  1265  LNAQHQAELEKIREILKEKLAEAEAKEIRIEADHKAEISHVRLTLKEQLSQAEEEREKVS  1324
             L  QHQAE+E IRE LK KLAEA  ++ ++E   +AEI+ VR TL EQL+Q +E+R+K +
Sbjct  1357  LIVQHQAEMETIRETLKNKLAEASTQQSKMEDAFRAEINEVRATLMEQLNQTKEDRDKGA  1416

Query  1325  SKLEEMEITLEEMISQRRAMEDTIAELEKTKNDRELALDNLKTEKTKLQLLYDKSQEQLQ  1384
             SKLEE++ TLE+MI+  R M DTIAELEKTK +++LA++ L  +  +L+    K+QEQL 
Sbjct  1417  SKLEEVKKTLEQMINGGRVMSDTIAELEKTKAEQDLAVNKLTKDNIELEKQCSKTQEQL-  1475

Query  1385  RQLQLHTRDHNGTGDGEQGEQLD--------KINDIQ---DQQVVDLEKLGREKMTLQSE  1433
              Q++  TRD          ++L+        +I +++   DQQV++L+K   EK++L+SE
Sbjct  1476  -QMESLTRDQISFEIEAHIKKLELIVASSKKRIIELEEKCDQQVLELDKCRLEKLSLESE  1534

Query  1434  IQ-------IQKQKIQELESHTDVLV----LDKCDLMAKLETFTAKISDLEEALHGAKLK  1482
             IQ          +K+QEL++   VL      +KCD   KLETFT KI+DLEE L  A+ K
Sbjct  1535  IQKANSEHSCTMEKLQELQAEMKVLSNRNEKEKCDFETKLETFTFKITDLEEVLKEAQHK  1594

Query  1483  LLAQDDLVSQHDRLKICLSEANELSCNLQKKVERLHADLLASEEGISSRDVELDQLRTEL  1542
             ++  DDLVSQH+RLKICL+EANELS NLQKKV  LH +L+ S++GISSRDVE+++LR EL
Sbjct  1595  VILYDDLVSQHERLKICLAEANELSSNLQKKVMSLHTELIDSQKGISSRDVEINELREEL  1654

Query  1543  KSAVDAKTTACTEQLILVAQVKKVEERMSVQTEEFKREVAELKGSMNELQLKHKSLQETK  1602
             K+A+DAK TA  EQ+ LV Q+K VEERM+ Q E+F RE A LKGS+NEL LK  S+QETK
Sbjct  1655  KAAMDAKATASAEQMTLVTQLKDVEERMANQAEKFTREAANLKGSINELLLKLNSMQETK  1714

Query  1603  DNLEAGNEELKLKLSRSHDLQNMLAEEQALTASLRESLDKLEQSKACLAEEMQTMEAEFA  1662
             D LE+GNEELK +L  S +L+NML EE  +  SL+E L KLE +K  L ++++  ++E  
Sbjct  1715  DMLESGNEELKEQLRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIY  1774

Query  1663  QRSTELSRKLEMGRIATGELSKECENLRSDLETKTKNFQRENKNLESIIFGLQKDKQQLD  1722
             QR TEL++++E+GR   GEL+K+CE L SDLE           N + I   LQ+ K+QL 
Sbjct  1775  QRHTELTKEVELGRNRIGELTKKCEELCSDLE-----------NSDQIRLDLQETKEQLK  1823

Query  1723  EEMVILKEKEEAHKTALASLQEASSKHQLVMEMANNKNLEMAQKVNDLLNKCEGLRFDLK  1782
             + +                                  NL   QKV+++  +CE LRFD++
Sbjct  1824  KTL--------------------------------ENNLGWQQKVDEVTRECEKLRFDMQ  1851

Query  1783  EKDEANAGLRTQLISNEEALASLEESSIKNKLAMESANNKCLEMEQRIDDLSKECEQLRS  1842
              K+  N                                      E ++ +L  ECE+LRS
Sbjct  1852  SKEVQN--------------------------------------ESKVQELISECEELRS  1873

Query  1843  DLQFKESCFLKEKDQLDGTISNLLEDKLSLEKQLCSLNE  1881
              L+ KE+ F  EK+ +D TIS+LLEDK +LE++LCS N+
Sbjct  1874  TLKSKEASFQSEKESMDRTISSLLEDKRNLEEKLCSAND  1912


 Score = 140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 118/341 (35%), Positives = 175/341 (51%), Gaps = 87/341 (26%)

Query  1771  LNKCEGLRFDLKEKDEANAGLRTQLISNEEALASLEESSIKNKLAMESANNKCL-EME--  1827
             L   + LR  L E+ +    L+ +L+  E+A  SLE+    NK  +   + +   E+E  
Sbjct  1728  LRNSQNLRNMLDEESKMCISLKEKLVKLEDAKTSLEQQLRDNKSEIYQRHTELTKEVELG  1787

Query  1828  -QRIDDLSKECEQLRSDLQFKESCFL---KEKDQLDGTISNLLEDKLSLEKQLCSLNEKL  1883
               RI +L+K+CE+L SDL+  +   L   + K+QL  T    LE+ L  ++++    +++
Sbjct  1788  RNRIGELTKKCEELCSDLENSDQIRLDLQETKEQLKKT----LENNLGWQQKV----DEV  1839

Query  1884  TMKCEKLRKTLKSNLKTYKHQFEEKLSILKEKDEDNARLKMQLTSLHESSSEHELAMKAA  1943
             T +CEKLR  ++S                                               
Sbjct  1840  TRECEKLRFDMQS-----------------------------------------------  1852

Query  1944  NNKSLELEHKIVELTKESEMLRSTLKSRESNFRTEKERMDGTIRSLLEDKRNLEEKLCSL  2003
               K ++ E K+ EL  E E LRSTLKS+E++F++EKE MD TI SLLEDKRNLEEKLCS 
Sbjct  1853  --KEVQNESKVQELISECEELRSTLKSKEASFQSEKESMDRTISSLLEDKRNLEEKLCSA  1910

Query  2004  SEIMSKLELELAAFQPPKSCGSCESNITNGNTTAKKTLDRNATPSVAMKPSMLIESTERK  2063
             ++I++KLE E+AA +P                  +K+LDRN  P    + S+  ES  RK
Sbjct  1911  NDIVAKLETEIAALRP------------------RKSLDRNPVP----RKSITFESEIRK  1948

Query  2064  NRRITAYDERRRQSNWNDFQDCANTTNSSESNCDCTEPNCK  2104
             NRRI+ +DE RRQS WND ++    T+  ++NC+C E N K
Sbjct  1949  NRRISVHDE-RRQSYWNDVREFGIMTDPVDNNCNCAELNSK  1988



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110345.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


Query= XP_017110346.1 nuclear pore complex protein Nup160 homolog
[Drosophila elegans]

Length=1416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NU160_DROME  unnamed protein product                                  2557    0.0  
P91350_CAEEL  unnamed protein product                                 42.0    0.005
Q583X2_TRYB2  unnamed protein product                                 38.5    0.044


>NU160_DROME unnamed protein product
Length=1411

 Score = 2557 bits (6628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1221/1413 (86%), Positives = 1320/1413 (93%), Gaps = 3/1413 (0%)

Query  1     MPTSKLHANMSYREVIPKNLSPAEWIEVKINTGTQSTLQDLKTFETSGGYCYKSRTNVQT  60
             MPTSKL ANMSYREVIP+NLSPAEWIEVKINTGTQSTLQDLKTFETSGGYCYK+  NVQT
Sbjct  1     MPTSKLQANMSYREVIPRNLSPAEWIEVKINTGTQSTLQDLKTFETSGGYCYKNTKNVQT  60

Query  61    RNRFIYWRAYQDVLELAEVSLDISLQRNHLRLRFTDSAVLNVSLTEQTNSITLLVVTVSS  120
             RNRFIYWR YQDVLEL+EVSLDISLQRNHLRLRFTDSAVLNVSLTEQ  S+TLLVVTVSS
Sbjct  61    RNRFIYWRTYQDVLELSEVSLDISLQRNHLRLRFTDSAVLNVSLTEQGTSVTLLVVTVSS  120

Query  121   VHRYVFPLNIAGQDGSSTTFPEDLLSQSIFYDVSDKINDPSTFYVTDGFGTMPNVAVSYL  180
             VHRYVFPL +AGQ+G + + PEDLLSQSIFYDV+DKINDPST+YVTDGFGTMPN AVSYL
Sbjct  121   VHRYVFPLKVAGQEGGAAS-PEDLLSQSIFYDVNDKINDPSTYYVTDGFGTMPNAAVSYL  179

Query  181   SQNSQSAYFAVAYQSKLLLHIMNCVTGHTVTHEVKEPHLMPRFLSNLKGALTGRSETLEA  240
             +Q+SQSAYFAVAYQSKLLLH+M C TGHT+THE+KEP LMP FLSNLKGALTGRSETLEA
Sbjct  180   TQDSQSAYFAVAYQSKLLLHVMKCSTGHTITHEIKEPKLMPWFLSNLKGALTGRSETLEA  239

Query  241   ATSMAFSEIEGDLFILVLYRSNELRLWSVDSLQTVASINCSAGSGHGGSGAQGPQNNQLR  300
             ATSMAFSEI G++FILVLYR+NELRLWSVD+LQTVASINCS   G   S AQGPQN+QLR
Sbjct  240   ATSMAFSEIGGEIFILVLYRNNELRLWSVDNLQTVASINCSTELGQD-SAAQGPQNSQLR  298

Query  301   KISDQNFCLFISHDNLAEFICVSIKPDADEASGLNLVQNSVAAPQMNLVDFDATSTHIWA  360
             KISDQNFCLF+SH++ AEFICVSI PDAD+AS +NLVQN V APQ +LVDFDATS+HIWA
Sbjct  299   KISDQNFCLFLSHNSRAEFICVSIMPDADDASVINLVQNMVPAPQTDLVDFDATSSHIWA  358

Query  361   LWSNAEGDFHVSAIYLGSNNSIKWVSAALEPPPDRYCLTMEQGVDPRESYCSYIFHPGRF  420
             LWSNAEGDFHVSA Y  SNN+IKWVSAALEPPPDRYCLTMEQGVDPRE+YCSYIFHPGRF
Sbjct  359   LWSNAEGDFHVSAAYFASNNAIKWVSAALEPPPDRYCLTMEQGVDPRETYCSYIFHPGRF  418

Query  421   DRNVIAKALYMFRRVNLQFDVKQLSMSVLKEQVCQAVEDEIQNELKDFVVTDEEYLEIST  480
             DRNVIAKALYMFRRVNLQFDVKQLSMSVLKEQVCQAVEDEIQNELKDFVVTDEEYLEIST
Sbjct  419   DRNVIAKALYMFRRVNLQFDVKQLSMSVLKEQVCQAVEDEIQNELKDFVVTDEEYLEIST  478

Query  481   RLWDRFYSCCEQYHIKFSEPTGLAVLGGMDAVCLVRRQSFALLRPCEVLEHLLLIGEHND  540
             RLWDRFYSCCEQYHIK SEPTGLAVLGGMDAVCLVRRQSFALLRPCEVLEHLLLIGEHND
Sbjct  479   RLWDRFYSCCEQYHIKLSEPTGLAVLGGMDAVCLVRRQSFALLRPCEVLEHLLLIGEHND  538

Query  541   EVATYVAPLFRNDPEMAKGFVDLMNVVTLLDKLISEDIKMDLDKQLYQRESPMDVIAKLV  600
             EVATYVAPLFRNDPEMAKGFV+LMNVVTLLDKLISEDIK++LDKQLYQRESP++VI+KLV
Sbjct  539   EVATYVAPLFRNDPEMAKGFVELMNVVTLLDKLISEDIKIELDKQLYQRESPVEVISKLV  598

Query  601   ARITVGDDNGPMLPSSCLKQIHQEVQQIPNLKPAIEMLLDVLCMIDPDAPPHDYSLSTRF  660
             ARI++ DDNGP+LPS+C++QI Q++Q IPNL+PA+EMLLDVLCMIDPD PPHDYSLSTRF
Sbjct  599   ARISMIDDNGPILPSNCVRQIQQKLQNIPNLEPALEMLLDVLCMIDPDEPPHDYSLSTRF  658

Query  661   LQPSGALLGSEYGLSILSETVKQMATIRFSVCRNLLILQYLVYGQKGMDSENVLTNINYL  720
             LQ SGAL+GSEYGLSILSETVKQMA IRFSVCRNLL+LQY+ YGQ  M+SENVLTN+NYL
Sbjct  659   LQSSGALMGSEYGLSILSETVKQMAMIRFSVCRNLLVLQYMAYGQNEMESENVLTNLNYL  718

Query  721   NSYYTLVWIAETPISSSTPPGFEASMQRLSRAQLFSGYTRPYSSHLRNNGNDQTTLLSLF  780
             NSYYTLVWIAETPISSSTP GFEAS+QRLSRAQLFSGY RPYSSHL++NGNDQTTLL LF
Sbjct  719   NSYYTLVWIAETPISSSTPAGFEASIQRLSRAQLFSGYNRPYSSHLKHNGNDQTTLLRLF  778

Query  781   LQSKGLFSALSMLLKTDSVQLESEQLNLRQSLLELVGYINKMLWPESPIYVFPEWLFGTC  840
             L+SKGLFSAL+MLLK DS+ L+SEQLNLRQSLL+LVGYINKMLWP SPIYVFPEWLFGTC
Sbjct  779   LESKGLFSALTMLLKHDSLSLDSEQLNLRQSLLQLVGYINKMLWPGSPIYVFPEWLFGTC  838

Query  841   HHIIVQDYVRILSSWCSVKSHARCFMLAASLLDCGEAHKAVHLFHETATGVVDDDFLFEH  900
             HHIIVQDYVRILS+WCSV+ HAR FMLA SLLDCGEAHKAVHLFHE  +G+V+DDFLFEH
Sbjct  839   HHIIVQDYVRILSNWCSVQKHARRFMLAVSLLDCGEAHKAVHLFHEAESGIVEDDFLFEH  898

Query  901   VLKNTPLYCKLQESVNRGETISAEDRKLAIVHYYLKVIQLFEQHSALDYVIQLAEMAMSV  960
             VLKNTPLY KLQ SV+RG+TIS ED KLAIVHYYLKVIQLFEQHSALDY+IQLA+MA+ V
Sbjct  899   VLKNTPLYGKLQNSVSRGDTISPEDTKLAIVHYYLKVIQLFEQHSALDYIIQLADMAIRV  958

Query  961   LQQDDPQLPMFQSIVFNNHLQLGHYEEAYCALVYNADTSRRKDCLRQLVITLFQSKCLSL  1020
             LQ DDPQLPMFQSIVFNNHLQLGHY EAY ALV NAD SRRKDCLRQLVITLFQ+KCL L
Sbjct  959   LQPDDPQLPMFQSIVFNNHLQLGHYVEAYTALVNNADISRRKDCLRQLVITLFQNKCLPL  1018

Query  1021  LMQFPYIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNMRKAATVMYEQAMRFQ  1080
             LMQF YIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNMRKA+TVMYEQAMRFQ
Sbjct  1019  LMQFSYIGLQDEFESIVESRARSMSIDQNEVYNFLYAFHTNKGNMRKASTVMYEQAMRFQ  1078

Query  1081  VESDAPNALEKRCSSLLICLNSLHLVDSRYRWIAKPKIGDERVASSMDQNNDDGEPKDDD  1140
             V+SDAPNALEKRCSSLLICLN LHLVDSRYRWIAKP +GDE+V  ++DQ+NDDGEPK D+
Sbjct  1079  VDSDAPNALEKRCSSLLICLNCLHLVDSRYRWIAKPVLGDEQVI-TIDQDNDDGEPKCDE  1137

Query  1141  DKNRQEVIVLELADIRRELVHAEAVHELSHYCKDVAAYERSSPEELSYLLARCGLYTAAL  1200
             DK  QEV+VLELADIRRELVHAEA+ ELS Y KD AAYER++PEELSYLLA  GLYTAAL
Sbjct  1138  DKRGQEVVVLELADIRRELVHAEALRELSFYRKDTAAYERATPEELSYLLASSGLYTAAL  1197

Query  1201  KLSRGHSFSVLHIFESLTAACNAATEDKDVDAWNWLQNNDMADLPHRSNAADMAWTLLQK  1260
             KLSRGHSFSVL IFESLT+AC AATEDK  DAWNWLQNNDMADLPHRSNAADMAWTLLQK
Sbjct  1198  KLSRGHSFSVLPIFESLTSACVAATEDKSSDAWNWLQNNDMADLPHRSNAADMAWTLLQK  1257

Query  1261  LVEDNEAKDSTLIRKSVVQRLLVLNAFVPQWLINSYKLSHSRELLQLFVKHNRLLEAADL  1320
             LV DNEAKDSTLIRKSVVQRLL LNAF+PQWLINSYKLSHSRELL L VKHNRLLEAADL
Sbjct  1258  LVVDNEAKDSTLIRKSVVQRLLGLNAFLPQWLINSYKLSHSRELLHLLVKHNRLLEAADL  1317

Query  1321  GCEMIAGMLGAGSEYFDFKHSVNVTNPQLCFPINTIDLLLYALKINGKEDIEYEMAHVKL  1380
             GCE+IAGMLGAGSEYF+FKH+VN+ NPQLCFPI+TIDLLL+ LKINGK+D++YEMA+ KL
Sbjct  1318  GCEIIAGMLGAGSEYFEFKHAVNIANPQLCFPISTIDLLLHGLKINGKDDLDYEMAYFKL  1377

Query  1381  EEEVNRYIETIKRTTEDKISMAILQNREERQQQ  1413
             EEEV RYIETIKRTT+DK+SMA+LQ R + Q++
Sbjct  1378  EEEVQRYIETIKRTTDDKMSMAVLQMRTDLQEE  1410


>P91350_CAEEL unnamed protein product
Length=1562

 Score = 42.0 bits (97),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 45/188 (24%), Positives = 84/188 (45%), Gaps = 23/188 (12%)

Query  927   KLAIVHYYLKVIQLFEQHSALDYVIQLAEMAMSVLQQDDPQLPMFQSIVFNNHLQLGHYE  986
             +L    Y+L V++  ++H+  + V  +A  A+  L  ++  + +  + +FN+   L +  
Sbjct  997   ELTASEYFLTVVRFLQEHNHAEEVCSVAVKAIENLPIENESVQLISNTLFNH---LTNRR  1053

Query  987   EAYCALVYNADTSRRKDCLRQLVITLFQSKCLSLLM---QFPYIGLQD--EFESIVESRA  1041
             E + +L     T+ R +  R  +  L     LSL++   ++  I      E E +VE   
Sbjct  1054  EWFQSLKLILRTTLRSETRRASIREL-----LSLMLACGEWEAIATMKFGEHEQVVEDFL  1108

Query  1042  RSMSIDQN-----EVYNFLYAFHTNKGNMRKAATVMYEQAMRFQVESD---APNALEKRC  1093
             R  +  Q+       +  L+AF+  + + RK A  MYE A    +ES     P  L ++ 
Sbjct  1109  RDAACRQSPSEKKHYFELLFAFYVARKDFRKGACAMYEYAR--HIESTTCMTPELLRRKR  1166

Query  1094  SSLLICLN  1101
               L + LN
Sbjct  1167  DCLAVVLN  1174


 Score = 32.0 bits (71),  Expect = 4.8, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 37/75 (49%), Gaps = 2/75 (3%)

Query  62   NRFIYWRAYQDVLELAEVSLDISLQRNHLRLRFTDSAVL-NVSLTEQTNSITLLVV-TVS  119
            +R   WRA    L + E SL  S+    L + FT + ++   S+T     +  +VV T S
Sbjct  95   DRIFLWRAIGQKLFIEERSLLYSITDGSLCIDFTRTPIIPGTSITIFEEGVLCIVVPTAS  154

Query  120  SVHRYVFPLNIAGQD  134
            ++HR+   L+  G D
Sbjct  155  AIHRFYARLHSKGHD  169


>Q583X2_TRYB2 unnamed protein product
Length=958

 Score = 38.5 bits (88),  Expect = 0.044, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 46/101 (46%), Gaps = 19/101 (19%)

Query  116  VTVSSVH-------RYVFPLNI----AGQDGSSTTFPEDLLSQSIFYDVSDKINDPSTFY  164
             TV+S H       R +F L +    + Q G    F E+L   ++F D  D +NDP+ F 
Sbjct  213  ATVTSRHSSKCATQRTLFKLPVDPATSPQRGLQVAFKEELDGSALFNDARDTLNDPNRFQ  272

Query  165  VTDGFGTMPNVAVSYLSQNSQSAYFAVAYQSKLLLHIMNCV  205
            V       P + V + ++  Q+  F ++  S+  +H M  V
Sbjct  273  V-------PTIFVGFATREGQT-NFTISSSSRGKVHFMRGV  305



Lambda      K        H
   0.316    0.132    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 13930076694


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110347.1 replication factor C subunit 3 [Drosophila elegans]

Length=356
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KLW6_DROME  unnamed protein product                                 729     0.0   
Q9U9Q1_DROME  unnamed protein product                                 729     0.0   
Q18547_CAEEL  unnamed protein product                                 368     6e-127


>Q7KLW6_DROME unnamed protein product
Length=395

 Score = 729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/356 (97%), Positives = 353/356 (99%), Gaps = 0/356 (0%)

Query  1    MALWVDKYRPRELSKLDFHKEQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY  60
            MALWVDKYRPRELSKLDFHK+QAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY
Sbjct  40   MALWVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY  99

Query  61   GAGVERLRSETMTFTTPSNRKIEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ  120
            G+GVERLRSETMTFTTPSNRK+EVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ
Sbjct  100  GSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ  159

Query  121  IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL  180
            IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL
Sbjct  160  IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL  219

Query  181  GIRVAAPNETEIVSILQSTCKREGLTLPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF  240
            GIRVAAPNETEIVSILQ+TCKREGL LPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF
Sbjct  220  GIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF  279

Query  241  TANQEIPDLDWQVFLRETAAQIISEQTPGKLEKVRERLYELLTQGVPPNLIFRGLVEQLV  300
            TANQEIPDLDWQVFLRETA+QIISEQTP KLEK+RERLYELLTQGVPPNLIFRGLVEQLV
Sbjct  280  TANQEIPDLDWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLV  339

Query  301  NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELVMTDDF  356
            NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSEL MTDDF
Sbjct  340  NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELDMTDDF  395


>Q9U9Q1_DROME unnamed protein product
Length=356

 Score = 729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/356 (97%), Positives = 353/356 (99%), Gaps = 0/356 (0%)

Query  1    MALWVDKYRPRELSKLDFHKEQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY  60
            MALWVDKYRPRELSKLDFHK+QAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY
Sbjct  1    MALWVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMY  60

Query  61   GAGVERLRSETMTFTTPSNRKIEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ  120
            G+GVERLRSETMTFTTPSNRK+EVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ
Sbjct  61   GSGVERLRSETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQTHQ  120

Query  121  IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL  180
            IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL
Sbjct  121  IEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCL  180

Query  181  GIRVAAPNETEIVSILQSTCKREGLTLPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF  240
            GIRVAAPNETEIVSILQ+TCKREGL LPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF
Sbjct  181  GIRVAAPNETEIVSILQNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF  240

Query  241  TANQEIPDLDWQVFLRETAAQIISEQTPGKLEKVRERLYELLTQGVPPNLIFRGLVEQLV  300
            TANQEIPDLDWQVFLRETA+QIISEQTP KLEK+RERLYELLTQGVPPNLIFRGLVEQLV
Sbjct  241  TANQEIPDLDWQVFLRETASQIISEQTPAKLEKIRERLYELLTQGVPPNLIFRGLVEQLV  300

Query  301  NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELVMTDDF  356
            NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSEL MTDDF
Sbjct  301  NNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIYKKFLSELDMTDDF  356


>Q18547_CAEEL unnamed protein product
Length=354

 Score = 368 bits (945),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 245/347 (71%), Gaps = 5/347 (1%)

Query  1    MALWVDKYRPREL---SKLDFHKEQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLR  57
            MALWVDKYRP++L     +D+H EQA +L+ L      PHL+F GPSGAGKKTRI CLLR
Sbjct  1    MALWVDKYRPKDLLGKDGVDYHIEQANHLKFLSADC-MPHLLFCGPSGAGKKTRIKCLLR  59

Query  58   EMYGAGVERLRSETMTFTTPSNRKIEVMTVSSNYHLEVNPSDAGMYDRTVVIDLIKQVAQ  117
            E+YG GVE+ +    +FT+PSN+K+E+ TVSSNYH+E+ PSD G+YDR VV DL+K++AQ
Sbjct  60   ELYGVGVEKTQLIMKSFTSPSNKKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQ  119

Query  118  THQIEISGQREFKVIVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRS  177
            T QIE + QR FKV+V+ E D LT+DAQH LRRTMEKY   C+I++S  S SRII  ++S
Sbjct  120  TSQIESTSQRSFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQS  179

Query  178  RCLGIRVAAPNETEIVSILQSTCKREGLTLPVELAKRVVDKSERNLRRALLMLEAAKVAK  237
            RC+ I V AP + ++  +L+   +RE   LP  + +++V+KSE NLRRA+LM EA ++  
Sbjct  180  RCIIINVPAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMTEALRMEN  239

Query  238  APFTANQ-EIPDLDWQVFLRETAAQIISEQTPGKLEKVRERLYELLTQGVPPNLIFRGLV  296
                A    IP  +W+++++ETA  I+ +Q+   L KVRERLYELL++ +PP +IF+ L+
Sbjct  240  ESGVAESVVIPVPEWEIYIQETARLILQKQSSDMLLKVRERLYELLSRCIPPTVIFKKLL  299

Query  297  EQLVNNCDMSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQFMNIY  343
            E L+  C   I  + +  A ++EHR+  G K IFHLE FVA FM+IY
Sbjct  300  EHLLPKCPPQIAREVVSEAAKFEHRLVLGQKAIFHLEGFVAAFMDIY  346



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110348.2 LOW QUALITY PROTEIN: homeotic protein spalt-major
[Drosophila elegans]

Length=1309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5U0U1_DROME  unnamed protein product                                 2060    0.0  
Q9VKH3_DROME  unnamed protein product                                 2058    0.0  
Q5U0U8_DROME  unnamed protein product                                 2057    0.0  


>Q5U0U1_DROME unnamed protein product
Length=1267

 Score = 2060 bits (5336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1141/1324 (86%), Positives = 1185/1324 (90%), Gaps = 72/1324 (5%)

Query  1     MCSIFRNRINYRGTGSTRSGSGERERDRDRDRERERDRD----ALLAKELDADSNNNGTE  56
             MCSIFRNRINYRGTG TRSGSGERERDRDRDR+R+RDR+     LLAKELDADSNNNGTE
Sbjct  1     MCSIFRNRINYRGTGGTRSGSGERERDRDRDRDRDRDRERDRDTLLAKELDADSNNNGTE  60

Query  57    PQMEA--VPESHTEREMAEEHGNGDGDGEGEDQEPENSNEALDLSLISSSGLRGSLPGSG  114
             PQMEA  VPES TERE AEE         GE+QEPENSNEALDLSLISS G R SLPGSG
Sbjct  61    PQMEAEAVPESDTERETAEE--------RGEEQEPENSNEALDLSLISSGG-RESLPGSG  111

Query  115   HVSLEALQHTKVAVAQFAASAMAGGSGGHQSPDLAMVQSTIFNVQRQHLMQLQLIQHLQS  174
             HVSLEALQHTKVAVAQFAA+AMAG    HQS DLAMVQSTIFNVQRQHLMQLQLIQHLQS
Sbjct  112   HVSLEALQHTKVAVAQFAATAMAGN---HQSADLAMVQSTIFNVQRQHLMQLQLIQHLQS  168

Query  175   QLKRAEAAALGRQTHSDEEEDEPEPEPQPEQEPNKLPANGLKEE----EDEEPEQDQERR  230
             QLKRAEAAALGR +HSDEEE+EP    +PE EP K P NGLKEE    +  E EQDQE R
Sbjct  169   QLKRAEAAALGRHSHSDEEEEEP----EPEPEPKKQPTNGLKEELELEQGPESEQDQESR  224

Query  231   LEESSKTETERATEERKAEPEGYQSQPMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ  290
              EE+SKT+ +R TE+RKAEPEGYQS  MMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ
Sbjct  225   REENSKTD-KRGTEDRKAEPEGYQS--MMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ  281

Query  291   RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR  350
             RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR
Sbjct  282   RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR  341

Query  351   SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQGQGQAP  410
             SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQ QG   
Sbjct  342   SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQVQG---  398

Query  411   AEQYPLRLPFVPPVAP---DQLQPQVEEPEEVRQELPAQQAEDLSKPMVKEKEKVKEKEK  467
              EQYP+RLPF PPVAP   +Q Q QVEEPEE+RQE+P  QAEDLSKPMVKEKEK      
Sbjct  399   -EQYPIRLPFAPPVAPVGQEQHQNQVEEPEEIRQEIPVPQAEDLSKPMVKEKEK------  451

Query  468   SHSPVERVRTPKEVKPVVAALSSPEKPDKEVTKPLVTPSRRNGSVRKRQSSSAGSPPQED  527
             SHSPVERV+TPKEVK   AAL S EKP+KE++KP+VT SRRNGSVRKRQ+S A SPPQED
Sbjct  452   SHSPVERVKTPKEVK-TDAALPSSEKPEKEISKPVVTSSRRNGSVRKRQTS-AVSPPQED  509

Query  528   RERDLAEHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL  587
             RERDL EHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL
Sbjct  510   RERDLVEHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL  569

Query  588   VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS  647
             VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS
Sbjct  570   VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS  629

Query  648   IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQAGAGAGAGAGAPNPGEA  707
             IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQ       GA A NPGEA
Sbjct  630   IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQ-------GAPAANPGEA  682

Query  708   ERLGIEDQNSNKSMGTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA  767
             ERLGIEDQNSNKS+GTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA
Sbjct  683   ERLGIEDQNSNKSLGTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA  742

Query  768   ATATPHPLERERDRDRDREKERVRERERDRERERRMPNDGSDERSHSNPDLAGGRSESGE  827
             ATATPHPLERERDR+++RE+               +PND SDERSHSNPDL GGRSESGE
Sbjct  743   ATATPHPLERERDREKERERR--------------IPNDCSDERSHSNPDLTGGRSESGE  788

Query  828   MPAMDLSSPSSASGRIFGSGLPNGTACGGSAGGGLPMLGMPMPPNLLLMAAAREEMHALG  887
             MPAMDLSSPSS SGRIF +GL NG A GGS  GGLPMLGMPMPPNLLLMAAAREEMHALG
Sbjct  789   MPAMDLSSPSSNSGRIFATGLANGAAGGGSGNGGLPMLGMPMPPNLLLMAAAREEMHALG  848

Query  888   HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHAHRPN  947
             HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHA RP+
Sbjct  849   HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHAQRPH  908

Query  948   CTDAGSPYGAKLTLNPNLFAKKP--TSSSSSGDKMPESSSAQPFAPEXSPATSIKEDPDQ  1005
             C+DAGSPYGAKLTLNPNLFAKKP  +SSSSSG+K+PESS+  PF  E  PAT IKEDPDQ
Sbjct  909   CSDAGSPYGAKLTLNPNLFAKKPPSSSSSSSGEKLPESSNP-PFPAENPPATPIKEDPDQ  967

Query  1006  EPLSVEEAGSAGEGSGTGAGSNYTPEAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP  1065
             E L VEE  SAGEGSGTGA SNY  EAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP
Sbjct  968   EQLMVEEGASAGEGSGTGATSNYPQEAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP  1027

Query  1066  PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM  1125
             PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM
Sbjct  1028  PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM  1087

Query  1126  GTHMWTNPTSRRGRRMSLELPMRPGPNSGSGHPGSSAEQEFMQRRPELFFPYLPPFFNGL  1185
             GTHMWTNPTSRRGRRMSLELPMRPGPNSG GHPGSSAEQEFMQRRPELFFPYLPPFFNGL
Sbjct  1088  GTHMWTNPTSRRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGL  1147

Query  1186  TPKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYGMERRSSSKSPTPEPA  1245
              PKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYG+ERRSSSKSPTPEPA
Sbjct  1148  PPKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYGLERRSSSKSPTPEPA  1207

Query  1246  QSPSLREDEGSGNIWHPLSRIKVESNQSEGMGMGAFNDQEDQVEAEAEIPGGDNEESESR  1305
             QSP+LRE+EGSGNIWHPLSRIKVE+NQ+E   MG FN+QED  E +A   GGDN+ESESR
Sbjct  1208  QSPALREEEGSGNIWHPLSRIKVENNQNE--SMGGFNEQEDHAETDAT--GGDNDESESR  1263

Query  1306  DAEK  1309
             DAEK
Sbjct  1264  DAEK  1267


>Q9VKH3_DROME unnamed protein product
Length=1267

 Score = 2058 bits (5331),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1140/1324 (86%), Positives = 1183/1324 (89%), Gaps = 72/1324 (5%)

Query  1     MCSIFRNRINYRGTGSTRSGSGERERDRDRDRERERDRD----ALLAKELDADSNNNGTE  56
             MCSIFRNRINYRGTG TRSGSGERERDRDRDR+R+RDR+     LLAKELDADSNNNGTE
Sbjct  1     MCSIFRNRINYRGTGGTRSGSGERERDRDRDRDRDRDRERDRDTLLAKELDADSNNNGTE  60

Query  57    PQMEA--VPESHTEREMAEEHGNGDGDGEGEDQEPENSNEALDLSLISSSGLRGSLPGSG  114
             PQMEA  VPES TERE AEE         GE+QEPENSNEALDLSLISS G R SLPGSG
Sbjct  61    PQMEAEAVPESDTERETAEE--------RGEEQEPENSNEALDLSLISSGG-RESLPGSG  111

Query  115   HVSLEALQHTKVAVAQFAASAMAGGSGGHQSPDLAMVQSTIFNVQRQHLMQLQLIQHLQS  174
             HVSLEALQHTKVAVAQFAA+AMAG    HQS DLAMVQSTIFNVQRQHLMQLQLIQHLQS
Sbjct  112   HVSLEALQHTKVAVAQFAATAMAGN---HQSADLAMVQSTIFNVQRQHLMQLQLIQHLQS  168

Query  175   QLKRAEAAALGRQTHSDEEEDEPEPEPQPEQEPNKLPANGLKEE----EDEEPEQDQERR  230
             QLKRAEAAALGR +HSDEEE+EP    +PE EP K P NGLKEE    +  E EQDQE R
Sbjct  169   QLKRAEAAALGRHSHSDEEEEEP----EPEPEPKKQPTNGLKEELELEQGPESEQDQESR  224

Query  231   LEESSKTETERATEERKAEPEGYQSQPMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ  290
              EE+SKT+ +R TE+RKAEPEGYQS  MMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ
Sbjct  225   REENSKTD-KRGTEDRKAEPEGYQS--MMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ  281

Query  291   RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR  350
             RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR
Sbjct  282   RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR  341

Query  351   SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQGQGQAP  410
             SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQ QG   
Sbjct  342   SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQVQG---  398

Query  411   AEQYPLRLPFVPPVAP---DQLQPQVEEPEEVRQELPAQQAEDLSKPMVKEKEKVKEKEK  467
              EQYP+RLPF PPVAP   +Q Q QVEEPEE+RQE+P  QAEDLSKPMVKEKEK      
Sbjct  399   -EQYPIRLPFAPPVAPVGQEQHQNQVEEPEEIRQEIPVPQAEDLSKPMVKEKEK------  451

Query  468   SHSPVERVRTPKEVKPVVAALSSPEKPDKEVTKPLVTPSRRNGSVRKRQSSSAGSPPQED  527
             SHSPVERV+TPKEVK   AAL S EKP+KE++KP+VT SRRNGSVRKRQ+S A SPPQED
Sbjct  452   SHSPVERVKTPKEVK-TDAALPSSEKPEKEISKPVVTSSRRNGSVRKRQTS-AVSPPQED  509

Query  528   RERDLAEHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL  587
             RERDL EHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL
Sbjct  510   RERDLVEHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL  569

Query  588   VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS  647
             VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS
Sbjct  570   VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS  629

Query  648   IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQAGAGAGAGAGAPNPGEA  707
             IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQ       GA A NPGEA
Sbjct  630   IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQ-------GAPAANPGEA  682

Query  708   ERLGIEDQNSNKSMGTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA  767
             ERLGIEDQNSNKS+GTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA
Sbjct  683   ERLGIEDQNSNKSLGTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA  742

Query  768   ATATPHPLERERDRDRDREKERVRERERDRERERRMPNDGSDERSHSNPDLAGGRSESGE  827
             ATATPHPLERERDR+++RE+               +PND SDERSHSNPDL GGRSESGE
Sbjct  743   ATATPHPLERERDREKERERR--------------IPNDCSDERSHSNPDLTGGRSESGE  788

Query  828   MPAMDLSSPSSASGRIFGSGLPNGTACGGSAGGGLPMLGMPMPPNLLLMAAAREEMHALG  887
             MPAMDLSSPSS SGRIF +GL NG A GGS  GGLPMLGMPMPPNLLLMAAAREEMHALG
Sbjct  789   MPAMDLSSPSSNSGRIFATGLANGAAGGGSGNGGLPMLGMPMPPNLLLMAAAREEMHALG  848

Query  888   HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHAHRPN  947
             HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHA RP 
Sbjct  849   HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHAQRPQ  908

Query  948   CTDAGSPYGAKLTLNPNLFAKKP--TSSSSSGDKMPESSSAQPFAPEXSPATSIKEDPDQ  1005
             C+DAGSPYGAKLTLNPNLFAKKP  +SSSSSG+K+PESS+  PF  E  PAT IKEDPDQ
Sbjct  909   CSDAGSPYGAKLTLNPNLFAKKPPSSSSSSSGEKLPESSNP-PFPAENPPATPIKEDPDQ  967

Query  1006  EPLSVEEAGSAGEGSGTGAGSNYTPEAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP  1065
             E L VEE  SAGEGSGTGA SNY  EAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP
Sbjct  968   EQLMVEEGASAGEGSGTGATSNYPQEAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP  1027

Query  1066  PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM  1125
             PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM
Sbjct  1028  PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM  1087

Query  1126  GTHMWTNPTSRRGRRMSLELPMRPGPNSGSGHPGSSAEQEFMQRRPELFFPYLPPFFNGL  1185
             GTHMWTNPTSRRGRRMSLELPMRPGPNSG GHPGSSAEQEFMQRRPELFFPYLPPFFNGL
Sbjct  1088  GTHMWTNPTSRRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGL  1147

Query  1186  TPKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYGMERRSSSKSPTPEPA  1245
              PKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPY +ERRSSSKSPTPEPA
Sbjct  1148  PPKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYILERRSSSKSPTPEPA  1207

Query  1246  QSPSLREDEGSGNIWHPLSRIKVESNQSEGMGMGAFNDQEDQVEAEAEIPGGDNEESESR  1305
             QSP+LRE+EGSGNIWHPLSRIKVE+NQ+E   MG FN+QED  E +A   GGDN+ESESR
Sbjct  1208  QSPALREEEGSGNIWHPLSRIKVENNQNE--SMGGFNEQEDHAETDAT--GGDNDESESR  1263

Query  1306  DAEK  1309
             DAEK
Sbjct  1264  DAEK  1267


>Q5U0U8_DROME unnamed protein product
Length=1267

 Score = 2057 bits (5330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1140/1324 (86%), Positives = 1184/1324 (89%), Gaps = 72/1324 (5%)

Query  1     MCSIFRNRINYRGTGSTRSGSGERERDRDRDRERERDRD----ALLAKELDADSNNNGTE  56
             MCSIFRNRINYRGTG TRSGSGERERDRDRDR+R+RDR+     LLAKELDADSNNNGTE
Sbjct  1     MCSIFRNRINYRGTGGTRSGSGERERDRDRDRDRDRDRERDRDTLLAKELDADSNNNGTE  60

Query  57    PQMEA--VPESHTEREMAEEHGNGDGDGEGEDQEPENSNEALDLSLISSSGLRGSLPGSG  114
             PQMEA  VPES TERE AEE         GE+QEPENSNEALDLSLISS G R SLPGSG
Sbjct  61    PQMEAEAVPESDTERETAEE--------RGEEQEPENSNEALDLSLISSGG-RESLPGSG  111

Query  115   HVSLEALQHTKVAVAQFAASAMAGGSGGHQSPDLAMVQSTIFNVQRQHLMQLQLIQHLQS  174
             HVSLEALQHTKVAVAQFAA+AMAG    HQS DLAMVQSTIFNVQRQHLMQLQLIQHLQS
Sbjct  112   HVSLEALQHTKVAVAQFAATAMAGN---HQSADLAMVQSTIFNVQRQHLMQLQLIQHLQS  168

Query  175   QLKRAEAAALGRQTHSDEEEDEPEPEPQPEQEPNKLPANGLKEE----EDEEPEQDQERR  230
             QLKRAEAAALGR +HSDEEE+EP    +PE EP K P NGLKEE    +  E EQDQE R
Sbjct  169   QLKRAEAAALGRHSHSDEEEEEP----EPEPEPKKQPTNGLKEELELEQGPESEQDQESR  224

Query  231   LEESSKTETERATEERKAEPEGYQSQPMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ  290
              EE+SKT+ +R TE+RKAEPEGYQS  MMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ
Sbjct  225   REENSKTD-KRGTEDRKAEPEGYQS--MMCDISSSLASSIITNHDPPPAPNEPNCLEMLQ  281

Query  291   RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR  350
             RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR
Sbjct  282   RRTEEVLDSASQSLHAAQMQEEYSEYASKEAQSRGEIFKHRCKYCGKIFGSYSALQIHLR  341

Query  351   SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQGQGQAP  410
             SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQ QG   
Sbjct  342   SHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPMLLPPGVAPNVGHSGQGQVQG---  398

Query  411   AEQYPLRLPFVPPVA---PDQLQPQVEEPEEVRQELPAQQAEDLSKPMVKEKEKVKEKEK  467
              EQYP+RLPF PPVA    +Q Q QVEEPEE+RQE+P  QAEDLSKPMVKEKEK      
Sbjct  399   -EQYPIRLPFAPPVAHVGQEQHQNQVEEPEEIRQEIPVPQAEDLSKPMVKEKEK------  451

Query  468   SHSPVERVRTPKEVKPVVAALSSPEKPDKEVTKPLVTPSRRNGSVRKRQSSSAGSPPQED  527
             SHSPVERV+TPKEVK   AAL S EKP+KE++KP+VT SRRNGSVRKRQ+S A SPPQED
Sbjct  452   SHSPVERVKTPKEVK-TDAALPSSEKPEKEISKPVVTSSRRNGSVRKRQTS-AVSPPQED  509

Query  528   RERDLAEHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL  587
             RERDL EHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL
Sbjct  510   RERDLVEHLHIAKLVRRSSASRESQPAEYSLAQMERIIDKSWEDLIEIDKTSETSKLQQL  569

Query  588   VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS  647
             VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS
Sbjct  570   VDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMS  629

Query  648   IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQAGAGAGAGAGAPNPGEA  707
             IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQ       GA A NPGEA
Sbjct  630   IHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHTMDDGSGGQ-------GAPAANPGEA  682

Query  708   ERLGIEDQNSNKSMGTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA  767
             ERLGIEDQNSNKS+GTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA
Sbjct  683   ERLGIEDQNSNKSLGTSDTLDFSTTISDHSGQRSESSQGGDFDEFMTMDSTDDSRDNSSA  742

Query  768   ATATPHPLERERDRDRDREKERVRERERDRERERRMPNDGSDERSHSNPDLAGGRSESGE  827
             ATATPHPLERERDR+++RE+               +PND SDERSHSNPDL GGRSESGE
Sbjct  743   ATATPHPLERERDREKERERR--------------IPNDCSDERSHSNPDLTGGRSESGE  788

Query  828   MPAMDLSSPSSASGRIFGSGLPNGTACGGSAGGGLPMLGMPMPPNLLLMAAAREEMHALG  887
             MPAMDLSSPSS SGRIF +GL NG A GGS  GGLPMLGMPMPPNLLLMAAAREEMHALG
Sbjct  789   MPAMDLSSPSSNSGRIFATGLANGAAGGGSGNGGLPMLGMPMPPNLLLMAAAREEMHALG  848

Query  888   HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHAHRPN  947
             HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHA RP+
Sbjct  849   HAHAKFPLLPFGPLGFMGLHPPPNVCNLCFKMLPSLAALESHLQSEHAKEPATGHAQRPH  908

Query  948   CTDAGSPYGAKLTLNPNLFAKKP--TSSSSSGDKMPESSSAQPFAPEXSPATSIKEDPDQ  1005
             C+DAGSPYGAKLTLNPNLFAKKP  +SSSSSG+K+PESS+  PF  E  PAT IKEDPDQ
Sbjct  909   CSDAGSPYGAKLTLNPNLFAKKPPSSSSSSSGEKLPESSNP-PFPAENPPATPIKEDPDQ  967

Query  1006  EPLSVEEAGSAGEGSGTGAGSNYTPEAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP  1065
             E L VEE  SAGEGSGTGA SNY  EAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP
Sbjct  968   EQLMVEEGASAGEGSGTGATSNYPQEAGDAEQSLMKMQLHAHRFPASPLDFQQALMSAGP  1027

Query  1066  PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM  1125
             PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM
Sbjct  1028  PTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHM  1087

Query  1126  GTHMWTNPTSRRGRRMSLELPMRPGPNSGSGHPGSSAEQEFMQRRPELFFPYLPPFFNGL  1185
             GTHMWTNPTSRRGRRMSLELPMRPGPNSG GHPGSSAEQEFMQRRPELFFPYLPPFFNGL
Sbjct  1088  GTHMWTNPTSRRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGL  1147

Query  1186  TPKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYGMERRSSSKSPTPEPA  1245
              PKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYG+ERRSSSKSPTPEPA
Sbjct  1148  PPKPGELSPGAFPNIPPPPFANGGKYPYPPGLLGFPGFLAQHPYGLERRSSSKSPTPEPA  1207

Query  1246  QSPSLREDEGSGNIWHPLSRIKVESNQSEGMGMGAFNDQEDQVEAEAEIPGGDNEESESR  1305
             QSP+LRE+EGSGNIWHPLSRIKVE+NQ+E   MG FN+QED  E +A   GGDN+ESESR
Sbjct  1208  QSPALREEEGSGNIWHPLSRIKVENNQNE--SMGGFNEQEDHAETDAT--GGDNDESESR  1263

Query  1306  DAEK  1309
             DAEK
Sbjct  1264  DAEK  1267



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110349.1 homeotic protein spalt-major isoform X1 [Drosophila
elegans]

Length=1392
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SALM_DROME  unnamed protein product                                   1976    0.0  
Q5U0U1_DROME  unnamed protein product                                 188     4e-48
Q9VKH3_DROME  unnamed protein product                                 188     4e-48


>SALM_DROME unnamed protein product
Length=1365

 Score = 1976 bits (5120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1197/1416 (85%), Positives = 1253/1416 (88%), Gaps = 75/1416 (5%)

Query  1     MKNHLSNVLCAMRSDFKDNHQETINKMIQFGTVKYGIVKQLKDRARSADKDTGSDQEENG  60
             MKNHLSNVLCAMRSDFKDNHQETINKMIQFGTVKYGIVKQLKDRARSADKD GSDQEENG
Sbjct  1     MKNHLSNVLCAMRSDFKDNHQETINKMIQFGTVKYGIVKQLKDRARSADKDIGSDQEENG  60

Query  61    GCSPLTTATTTATPSRSP----------EPEEEQHEEQQHQFQEKKTEVKSEL--EIDSV  108
             GCSPLTTATTTA+PSRSP             E+   EQ     + + ++KSE   EI+ V
Sbjct  61    GCSPLTTATTTASPSRSPEPEEEQPEEQSTSEQSIPEQSTPDHQLENDIKSEAKSEIEPV  120

Query  109   EDNNNRVAMTKLSDEVEEEEREREREPNASGSMPSSPVAEASAEEAATERCSEKEKERDI  168
             EDNNNRVAMTK S E        EREPNASGSMPSSPVAEASAEEAATER  EKEKE+D+
Sbjct  121   EDNNNRVAMTKPSSE--------EREPNASGSMPSSPVAEASAEEAATERTPEKEKEKDV  172

Query  169   DVDVEMSEEPPSSTAAVPSTEVALPGAAAGAPVTLEAIQNMQMAIAQFAAKTIANGSSGA  228
             +VDVE  +E PSS  AVPSTEV LPG A GAPVTLEAIQNMQMAIAQFAAKTIANGS+GA
Sbjct  173   EVDVEKPDEAPSS--AVPSTEVTLPGGA-GAPVTLEAIQNMQMAIAQFAAKTIANGSNGA  229

Query  229   DNEAAMKQLAFLQQTLFNLQQQQLFQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQEQ  288
             DNEAAMKQLAFLQQTLFNLQQQQLFQIQLIQQLQSQLALNQAKQEED EE+ DQEQ+QEQ
Sbjct  230   DNEAAMKQLAFLQQTLFNLQQQQLFQIQLIQQLQSQLALNQAKQEEDTEEDADQEQDQEQ  289

Query  289   -TDTYEEEERIADMELRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREQDHD  347
              TDTYEEEERIADMELRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRRE DH+
Sbjct  290   ETDTYEEEERIADMELRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREHDHE  349

Query  348   GQPHRRASLEGAHKGDSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLPEPNSLDLL  407
              QP+RR SL+  HK D+A DALAKLKEMENTPLPFGS DLASSIIT+HDDLPEPNSLDLL
Sbjct  350   SQPNRRPSLDNTHKADTAQDALAKLKEMENTPLPFGS-DLASSIITNHDDLPEPNSLDLL  408

Query  408   QKRAQEVLDSASQGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQ  467
             QKRAQEVLDSASQGILANSMADDFAFGEK+GE GKGRNEPFFKHRCRYCGKVFGSDSALQ
Sbjct  409   QKRAQEVLDSASQGILANSMADDFAFGEKSGE-GKGRNEPFFKHRCRYCGKVFGSDSALQ  467

Query  468   IHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFPHVPMNATPIPEHMDKFHPPLL  527
             IHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFPHVPMNATPIPEHMDKFHPPLL
Sbjct  468   IHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFPHVPMNATPIPEHMDKFHPPLL  527

Query  528   DQMSPTDSSPTHSPAPPPLGAAPASHFAPAFPGLQNLYRPQMEILKSLSAAAPHQFYPED  587
             DQMSPTDSSP HSPAPPPLG+APAS F PAFPGLQNLYRP MEILKSL AAAPHQ++P++
Sbjct  528   DQMSPTDSSPNHSPAPPPLGSAPAS-FPPAFPGLQNLYRPPMEILKSLGAAAPHQYFPQE  586

Query  588   MPTDLRKPSPRLEEDKPVVKHEPLEEKDQRVEQEQEQERERDLEQEQDCSDPEPEPLPLE  647
             +PTDLRKPSP+L+ED+P VK+EP+EEKDQR E EQE           +CS+PEPEPLPLE
Sbjct  587   LPTDLRKPSPQLDEDEPQVKNEPVEEKDQREEHEQEM---------AECSEPEPEPLPLE  637

Query  648   VRIKEERVEAEAEVKEEDHRTEPRRTPSPLPQERSPHGHHLQQQQHHHHHQHQHHNRHGH  707
             VRIKEERVE + +VK+EDHR EPRRTPSP                     +H+  + H H
Sbjct  638   VRIKEERVEEQEQVKQEDHRIEPRRTPSP-------------------SSEHRSPHHHRH  678

Query  708   SHLSYPPVVQPIQPAALMHPQPSPGSSGSHLDHLPTPGQLPPREDFFAERFPLNFTTAKT  767
             SH+ YPPVVQPIQPAALMHPQ SPGS  SHLDHLPTPGQLPPREDFFAERFPLNFTTAK 
Sbjct  679   SHMGYPPVVQPIQPAALMHPQSSPGSQ-SHLDHLPTPGQLPPREDFFAERFPLNFTTAKM  737

Query  768   LSPEHHSPVRSPAGGALPPGMPPQHHHPHPHMARSPFAFNPIKHEMAALLPRPHSNDNSW  827
             LSPEHHSPVRSPAGGALPPG+PP  HH   HMARSPF FNPIKHEMAALLPRPHSNDNSW
Sbjct  738   LSPEHHSPVRSPAGGALPPGVPPPPHHHPHHMARSPF-FNPIKHEMAALLPRPHSNDNSW  796

Query  828   ENFIEVSNTCETMKLKELMKNKKISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI  887
             ENFIEVSNTCETMKLKELMKNKKISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI
Sbjct  797   ENFIEVSNTCETMKLKELMKNKKISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI  856

Query  888   CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGEPTDLTPE  947
             CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGEPTDLTPE
Sbjct  857   CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGEPTDLTPE  916

Query  948   QIQAAEIRDPPPSMMPGHFMNPFAAAAFHFGALPGGPGGPGGPPNHGGHNGALGSESSQG  1007
             QIQAAEIRDPPPSMMPGHFMNPFAAAAFHFGAL  G  G    PNHG HNGALGSESSQG
Sbjct  917   QIQAAEIRDPPPSMMPGHFMNPFAAAAFHFGAL-PGGPGGPPGPNHGAHNGALGSESSQG  975

Query  1008  DLDDNMDCGEDYDDDGVSSEHLSSSHLEQDGDRPRSGDDFKSLLFEQKLRIDATGVVNTN  1067
             D+DDNMDCGEDYDDD VSSEHLS+S+LEQ+GDR RSGDDFKSLLFEQKLRIDATGVVNTN
Sbjct  976   DMDDNMDCGEDYDDD-VSSEHLSNSNLEQEGDRSRSGDDFKSLLFEQKLRIDATGVVNTN  1034

Query  1068  PVRPKSSASSHGHSVGSTSAPTSPSVHHSAAQVPKPSPSPARSDVSQGALDLTPRAAPTS  1127
             PVRP+SSASSHGHSVGSTSAPTSPSV H+++QV K S SPARS+ SQGALDLTPRAAPTS
Sbjct  1035  PVRPRSSASSHGHSVGSTSAPTSPSV-HASSQVIKRSSSPARSEASQGALDLTPRAAPTS  1093

Query  1128  GSSSRSPLPPKEKPASPAR-----------SPSGGHAPLPPTVGIDCLPPGLQHHLQQQH  1176
              SSSRSPL PKEKP SP             S +   +PLPPTVGIDCLPPGLQHHLQQQH
Sbjct  1094  SSSSRSPL-PKEKPVSPPSLPRSPSGSSHASANILTSPLPPTVGIDCLPPGLQHHLQQQH  1152

Query  1177  QHLMQQQAAVAAAAAAQHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAAAA  1236
             QHLMQQQAAVAAAAAAQHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAA  
Sbjct  1153  QHLMQQQAAVAAAAAAQHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAAQ-  1211

Query  1237  GQRQSPPQNNQGRQEGGGGAGPPPNPMMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQ  1296
               RQ+PPQ    RQEGG GAGPPPNP+MGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQ
Sbjct  1212  --RQTPPQARDQRQEGGPGAGPPPNPLMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQ  1269

Query  1297  SVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTK  1356
             SVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKC+ICDRGFTTK
Sbjct  1270  SVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKCSICDRGFTTK  1329

Query  1357  GNLKQHMLTHKIRDMEQETFRNRAVKYMSEWNDDRE  1392
             GNLKQHMLTHKIRDMEQETFRNRAVKYMSEWN+DRE
Sbjct  1330  GNLKQHMLTHKIRDMEQETFRNRAVKYMSEWNEDRE  1365


>Q5U0U1_DROME unnamed protein product
Length=1267

 Score = 188 bits (478),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 2/117 (2%)

Query  824  DNSWENFIEVSNTCETMKLKELMKN--KKISDPNQCVVCDRVLSCKSALQMHYRTHTGER  881
            D SWE+ IE+  T ET KL++L+ N   K++DPNQC+ C +V+SC+S+LQMH RTHTGER
Sbjct  548  DKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGER  607

Query  882  PFKCRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHT  938
            PF+C+ICGRAF TKGNLK HM++HKI+PPMR+  +CPVCH+K+SN ++LQQHIR+HT
Sbjct  608  PFRCKICGRAFATKGNLKAHMSIHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 172 bits (435),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 179/327 (55%), Gaps = 67/327 (20%)

Query  191  ALPGAAAGAPVTLEAIQNMQMAIAQFAAKTIANGSSGADNEAAMKQLAFLQQTLFNLQQQ  250
            +LPG+     V+LEA+Q+ ++A+AQFAA  +A     AD       LA +Q T+FN+Q+Q
Sbjct  106  SLPGSGH---VSLEALQHTKVAVAQFAATAMAGNHQSAD-------LAMVQSTIFNVQRQ  155

Query  251  QL--------FQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQEQTDTYEEEERIADME  302
             L         Q QL +   + L  +    EE+ E E + E +++ T+  +EE     +E
Sbjct  156  HLMQLQLIQHLQSQLKRAEAAALGRHSHSDEEEEEPEPEPEPKKQPTNGLKEE-----LE  210

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREQDHDGQPHRRASLEGAHKG  362
            L Q  E+   +   R+                        + D  G   R+A  EG    
Sbjct  211  LEQGPESEQDQESRRE---------------------ENSKTDKRGTEDRKAEPEGYQ--  247

Query  363  DSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLP---EPNSLDLLQKRAQEVLDSAS  419
                           + +   SS LASSIIT+HD  P   EPN L++LQ+R +EVLDSAS
Sbjct  248  ---------------SMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQRRTEEVLDSAS  292

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERPF  479
            Q + A  M ++++  E A +  + R E  FKHRC+YCGK+FGS SALQIH+RSHTGERPF
Sbjct  293  QSLHAAQMQEEYS--EYASKEAQSRGE-IFKHRCKYCGKIFGSYSALQIHLRSHTGERPF  349

Query  480  KCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             CNVCGS+FTTKGNLKVH+QRH Q FP
Sbjct  350  VCNVCGSKFTTKGNLKVHYQRHTQIFP  376


 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)

Query  450   KHRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             KH C  C + F S SALQIH+R+HTG++PF+CNVC   FTTKGNLKVH   H    P
Sbjct  1039  KHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)

Query  851   ISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVHKIRPP  910
             +++ + C VC R  S  SALQ+H RTHTG++PF+C +C +AFTTKGNLK HM  H    P
Sbjct  1036  VNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTHKIR  1369
             C  C K   C S+L++H R+HT ERPF+C IC R F TKGNLK HM  HKI+
Sbjct  583   CIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIK  634


 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 1/57 (2%)

Query  856  QCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVH-KIRPPM  911
            +C  C ++    SALQ+H R+HTGERPF C +CG  FTTKGNLK H   H +I PPM
Sbjct  322  RCKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPM  378


 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)

Query  451  HRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
            ++C +C KV    S+LQ+HIR+HTGERPF+C +CG  F TKGNLK H   H  K P
Sbjct  581  NQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIKPP  636


 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 0/49 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTH  1366
             C  C K F  +SAL+IH RSHT ERPF CN+C   FTTKGNLK H   H
Sbjct  323   CKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRH  371


 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 114/267 (43%), Gaps = 30/267 (11%)

Query  248  QQQQLFQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQ-----EQTDTYEEEERIADME  302
            Q+Q   Q++  ++++ ++ + QA   EDL +   +E+E+     E+  T +E +  A + 
Sbjct  416  QEQHQNQVEEPEEIRQEIPVPQA---EDLSKPMVKEKEKSHSPVERVKTPKEVKTDAALP  472

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSG-SPAESLKRRR--EQDHDGQPHRRASLEGA  359
              +K E  +++        N  V  R++S  SP +  + R   E  H  +  RR+S   +
Sbjct  473  SSEKPEKEISKPVVTSSRRNGSVRKRQTSAVSPPQEDRERDLVEHLHIAKLVRRSS--AS  530

Query  360  HKGDSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLPEPNSLDLLQKRAQEVLDSAS  419
             +   A  +LA+++ +          D +   +   D   E + L  L    +  L   +
Sbjct  531  RESQPAEYSLAQMERI---------IDKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPN  581

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERP-  478
            Q I    +    +  +    +  G   PF   RC+ CG+ F +   L+ H+  H  + P 
Sbjct  582  QCIFCQKVMSCRSSLQMHIRTHTGE-RPF---RCKICGRAFATKGNLKAHMSIHKIKPPM  637

Query  479  ---FKCNVCGSRFTTKGNLKVHFQRHA  502
               FKC VC  +F+    L+ H + H 
Sbjct  638  RSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 39.3 bits (90),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  907   IRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
             + PP+ N H C VC + +S++  LQ H+R HTG+
Sbjct  1032  LDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGD  1065


 Score = 38.1 bits (87),  Expect = 0.059, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 46/124 (37%), Gaps = 20/124 (16%)

Query  885   CRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTG-EPTD  943
             C +C R F++   L+ HM  H    P     QC VC K ++    L+ H+  H    PT 
Sbjct  1042  CHVCRRNFSSSSALQIHMRTHTGDKPF----QCNVCQKAFTTKGNLKVHMGTHMWTNPTS  1097

Query  944   LTPEQIQAAEIRDPPPSMMPGH--------FMNPFAAAAF-----HFGALPGGPG--GPG  988
                 ++       P P+   GH        FM       F      F  LP  PG   PG
Sbjct  1098  RRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGLPPKPGELSPG  1157

Query  989   GPPN  992
               PN
Sbjct  1158  AFPN  1161


 Score = 37.7 bits (86),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 39/82 (48%), Gaps = 9/82 (11%)

Query  1262  PMMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQSVMPAAPFNPLALSGVRGS-TTCGI  1320
             PM+G      M PNL L   A  +   +A+   A +  P  PF PL   G+      C +
Sbjct  824   PMLG----MPMPPNLLLM--AAAREEMHALGH-AHAKFPLLPFGPLGFMGLHPPPNVCNL  876

Query  1321  CYKTFPCHSALEIHYRS-HTKE  1341
             C+K  P  +ALE H +S H KE
Sbjct  877   CFKMLPSLAALESHLQSEHAKE  898


 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  899  KTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
            K    V  I   + + +QC  C K  S    LQ HIR HTGE
Sbjct  565  KLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGE  606


 Score = 31.6 bits (70),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  915  HQCPVCHKKYSNALVLQQHIRLHTGE  940
            H+C  C K + +   LQ H+R HTGE
Sbjct  321  HRCKYCGKIFGSYSALQIHLRSHTGE  346


>Q9VKH3_DROME unnamed protein product
Length=1267

 Score = 188 bits (478),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 2/117 (2%)

Query  824  DNSWENFIEVSNTCETMKLKELMKN--KKISDPNQCVVCDRVLSCKSALQMHYRTHTGER  881
            D SWE+ IE+  T ET KL++L+ N   K++DPNQC+ C +V+SC+S+LQMH RTHTGER
Sbjct  548  DKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGER  607

Query  882  PFKCRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHT  938
            PF+C+ICGRAF TKGNLK HM++HKI+PPMR+  +CPVCH+K+SN ++LQQHIR+HT
Sbjct  608  PFRCKICGRAFATKGNLKAHMSIHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 172 bits (435),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 179/327 (55%), Gaps = 67/327 (20%)

Query  191  ALPGAAAGAPVTLEAIQNMQMAIAQFAAKTIANGSSGADNEAAMKQLAFLQQTLFNLQQQ  250
            +LPG+     V+LEA+Q+ ++A+AQFAA  +A     AD       LA +Q T+FN+Q+Q
Sbjct  106  SLPGSGH---VSLEALQHTKVAVAQFAATAMAGNHQSAD-------LAMVQSTIFNVQRQ  155

Query  251  QL--------FQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQEQTDTYEEEERIADME  302
             L         Q QL +   + L  +    EE+ E E + E +++ T+  +EE     +E
Sbjct  156  HLMQLQLIQHLQSQLKRAEAAALGRHSHSDEEEEEPEPEPEPKKQPTNGLKEE-----LE  210

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREQDHDGQPHRRASLEGAHKG  362
            L Q  E+   +   R+                        + D  G   R+A  EG    
Sbjct  211  LEQGPESEQDQESRRE---------------------ENSKTDKRGTEDRKAEPEGYQ--  247

Query  363  DSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLP---EPNSLDLLQKRAQEVLDSAS  419
                           + +   SS LASSIIT+HD  P   EPN L++LQ+R +EVLDSAS
Sbjct  248  ---------------SMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQRRTEEVLDSAS  292

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERPF  479
            Q + A  M ++++  E A +  + R E  FKHRC+YCGK+FGS SALQIH+RSHTGERPF
Sbjct  293  QSLHAAQMQEEYS--EYASKEAQSRGE-IFKHRCKYCGKIFGSYSALQIHLRSHTGERPF  349

Query  480  KCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             CNVCGS+FTTKGNLKVH+QRH Q FP
Sbjct  350  VCNVCGSKFTTKGNLKVHYQRHTQIFP  376


 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)

Query  450   KHRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             KH C  C + F S SALQIH+R+HTG++PF+CNVC   FTTKGNLKVH   H    P
Sbjct  1039  KHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)

Query  851   ISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVHKIRPP  910
             +++ + C VC R  S  SALQ+H RTHTG++PF+C +C +AFTTKGNLK HM  H    P
Sbjct  1036  VNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTHKIR  1369
             C  C K   C S+L++H R+HT ERPF+C IC R F TKGNLK HM  HKI+
Sbjct  583   CIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIK  634


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 1/57 (2%)

Query  856  QCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVH-KIRPPM  911
            +C  C ++    SALQ+H R+HTGERPF C +CG  FTTKGNLK H   H +I PPM
Sbjct  322  RCKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPM  378


 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)

Query  451  HRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
            ++C +C KV    S+LQ+HIR+HTGERPF+C +CG  F TKGNLK H   H  K P
Sbjct  581  NQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIKPP  636


 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)

Query  1296  QSVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTT  1355
             Q++M A P        V     C +C + F   SAL+IH R+HT ++PF+CN+C + FTT
Sbjct  1020  QALMSAGPPTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTT  1079

Query  1356  KGNLKQHMLTH  1366
             KGNLK HM TH
Sbjct  1080  KGNLKVHMGTH  1090


 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 0/49 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTH  1366
             C  C K F  +SAL+IH RSHT ERPF CN+C   FTTKGNLK H   H
Sbjct  323   CKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRH  371


 Score = 40.8 bits (94),  Expect = 0.009, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 114/267 (43%), Gaps = 30/267 (11%)

Query  248  QQQQLFQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQ-----EQTDTYEEEERIADME  302
            Q+Q   Q++  ++++ ++ + QA   EDL +   +E+E+     E+  T +E +  A + 
Sbjct  416  QEQHQNQVEEPEEIRQEIPVPQA---EDLSKPMVKEKEKSHSPVERVKTPKEVKTDAALP  472

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSG-SPAESLKRRR--EQDHDGQPHRRASLEGA  359
              +K E  +++        N  V  R++S  SP +  + R   E  H  +  RR+S   +
Sbjct  473  SSEKPEKEISKPVVTSSRRNGSVRKRQTSAVSPPQEDRERDLVEHLHIAKLVRRSS--AS  530

Query  360  HKGDSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLPEPNSLDLLQKRAQEVLDSAS  419
             +   A  +LA+++ +          D +   +   D   E + L  L    +  L   +
Sbjct  531  RESQPAEYSLAQMERI---------IDKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPN  581

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERP-  478
            Q I    +    +  +    +  G   PF   RC+ CG+ F +   L+ H+  H  + P 
Sbjct  582  QCIFCQKVMSCRSSLQMHIRTHTGE-RPF---RCKICGRAFATKGNLKAHMSIHKIKPPM  637

Query  479  ---FKCNVCGSRFTTKGNLKVHFQRHA  502
               FKC VC  +F+    L+ H + H 
Sbjct  638  RSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 39.3 bits (90),  Expect = 0.025, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  907   IRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
             + PP+ N H C VC + +S++  LQ H+R HTG+
Sbjct  1032  LDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGD  1065


 Score = 38.1 bits (87),  Expect = 0.061, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 46/124 (37%), Gaps = 20/124 (16%)

Query  885   CRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTG-EPTD  943
             C +C R F++   L+ HM  H    P     QC VC K ++    L+ H+  H    PT 
Sbjct  1042  CHVCRRNFSSSSALQIHMRTHTGDKPF----QCNVCQKAFTTKGNLKVHMGTHMWTNPTS  1097

Query  944   LTPEQIQAAEIRDPPPSMMPGH--------FMNPFAAAAF-----HFGALPGGPG--GPG  988
                 ++       P P+   GH        FM       F      F  LP  PG   PG
Sbjct  1098  RRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGLPPKPGELSPG  1157

Query  989   GPPN  992
               PN
Sbjct  1158  AFPN  1161


 Score = 37.7 bits (86),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 39/82 (48%), Gaps = 9/82 (11%)

Query  1262  PMMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQSVMPAAPFNPLALSGVRGS-TTCGI  1320
             PM+G      M PNL L   A  +   +A+   A +  P  PF PL   G+      C +
Sbjct  824   PMLG----MPMPPNLLLM--AAAREEMHALGH-AHAKFPLLPFGPLGFMGLHPPPNVCNL  876

Query  1321  CYKTFPCHSALEIHYRS-HTKE  1341
             C+K  P  +ALE H +S H KE
Sbjct  877   CFKMLPSLAALESHLQSEHAKE  898


 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  899  KTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
            K    V  I   + + +QC  C K  S    LQ HIR HTGE
Sbjct  565  KLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGE  606


 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  915  HQCPVCHKKYSNALVLQQHIRLHTGE  940
            H+C  C K + +   LQ H+R HTGE
Sbjct  321  HRCKYCGKIFGSYSALQIHLRSHTGE  346



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110350.1 homeotic protein spalt-major isoform X2 [Drosophila
elegans]

Length=1382
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SALM_DROME  unnamed protein product                                   1954    0.0  
Q5U0U8_DROME  unnamed protein product                                 188     4e-48
Q9VKH3_DROME  unnamed protein product                                 188     4e-48


>SALM_DROME unnamed protein product
Length=1365

 Score = 1954 bits (5061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1188/1406 (84%), Positives = 1243/1406 (88%), Gaps = 75/1406 (5%)

Query  1     MKNHLSNVLCAMRSDFKDNHQETINKMIQFGTVKYGIVKQLKDRARSADKDTGSDQEENG  60
             MKNHLSNVLCAMRSDFKDNHQETINKMIQFGTVKYGIVKQLKDRARSADKD GSDQEENG
Sbjct  1     MKNHLSNVLCAMRSDFKDNHQETINKMIQFGTVKYGIVKQLKDRARSADKDIGSDQEENG  60

Query  61    GCSPLTTATTTATPSRSP----------EPEEEQHEEQQHQFQEKKTEVKSEL--EIDSV  108
             GCSPLTTATTTA+PSRSP             E+   EQ     + + ++KSE   EI+ V
Sbjct  61    GCSPLTTATTTASPSRSPEPEEEQPEEQSTSEQSIPEQSTPDHQLENDIKSEAKSEIEPV  120

Query  109   EDNNNRVAMTKLSDEVEEEEREREREPNASGSMPSSPVAEASAEEAATERCSEKEKERDI  168
             EDNNNRVAMTK S E        EREPNASGSMPSSPVAEASAEEAATER  EKEKE+D+
Sbjct  121   EDNNNRVAMTKPSSE--------EREPNASGSMPSSPVAEASAEEAATERTPEKEKEKDV  172

Query  169   DVDVEMSEEPPSSTAAVPSTEVALPGAAAGAPVTLEAIQNMQMAIAQFAAKTIANGSSGA  228
             +VDVE  +E PSS  AVPSTEV LPG A GAPVTLEAIQNMQMAIAQFAAKTIANGS+GA
Sbjct  173   EVDVEKPDEAPSS--AVPSTEVTLPGGA-GAPVTLEAIQNMQMAIAQFAAKTIANGSNGA  229

Query  229   DNEAAMKQLAFLQQTLFNLQQQQLFQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQEQ  288
             DNEAAMKQLAFLQQTLFNLQQQQLFQIQLIQQLQSQLALNQAKQEED EE+ DQEQ+QEQ
Sbjct  230   DNEAAMKQLAFLQQTLFNLQQQQLFQIQLIQQLQSQLALNQAKQEEDTEEDADQEQDQEQ  289

Query  289   -TDTYEEEERIADMELRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREQDHD  347
              TDTYEEEERIADMELRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRRE DH+
Sbjct  290   ETDTYEEEERIADMELRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREHDHE  349

Query  348   GQPHRRASLEGAHKGDSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLPEPNSLDLL  407
              QP+RR SL+  HK D+A DALAKLKEMENTPLPFGS DLASSIIT+HDDLPEPNSLDLL
Sbjct  350   SQPNRRPSLDNTHKADTAQDALAKLKEMENTPLPFGS-DLASSIITNHDDLPEPNSLDLL  408

Query  408   QKRAQEVLDSASQGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQ  467
             QKRAQEVLDSASQGILANSMADDFAFGEK+GE GKGRNEPFFKHRCRYCGKVFGSDSALQ
Sbjct  409   QKRAQEVLDSASQGILANSMADDFAFGEKSGE-GKGRNEPFFKHRCRYCGKVFGSDSALQ  467

Query  468   IHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFPHVPMNATPIPEHMDKFHPPLL  527
             IHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFPHVPMNATPIPEHMDKFHPPLL
Sbjct  468   IHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFPHVPMNATPIPEHMDKFHPPLL  527

Query  528   DQMSPTDSSPTHSPAPPPLGAAPASHFAPAFPGLQNLYRPQMEILKSLSAAAPHQFYPED  587
             DQMSPTDSSP HSPAPPPLG+APAS F PAFPGLQNLYRP MEILKSL AAAPHQ++P++
Sbjct  528   DQMSPTDSSPNHSPAPPPLGSAPAS-FPPAFPGLQNLYRPPMEILKSLGAAAPHQYFPQE  586

Query  588   MPTDLRKPSPRLEEDKPVVKHEPLEEKDQRVEQEQEQERERDLEQEQDCSDPEPEPLPLE  647
             +PTDLRKPSP+L+ED+P VK+EP+EEKDQR E EQE           +CS+PEPEPLPLE
Sbjct  587   LPTDLRKPSPQLDEDEPQVKNEPVEEKDQREEHEQEM---------AECSEPEPEPLPLE  637

Query  648   VRIKEERVEAEAEVKEEDHRTEPRRTPSPLPQERSPHGHHLQQQQHHHHHQHQHHNRHGH  707
             VRIKEERVE + +VK+EDHR EPRRTPSP                     +H+  + H H
Sbjct  638   VRIKEERVEEQEQVKQEDHRIEPRRTPSP-------------------SSEHRSPHHHRH  678

Query  708   SHLSYPPVVQPIQPAALMHPQPSPGSSGSHLDHLPTPGQLPPREDFFAERFPLNFTTAKT  767
             SH+ YPPVVQPIQPAALMHPQ SPGS  SHLDHLPTPGQLPPREDFFAERFPLNFTTAK 
Sbjct  679   SHMGYPPVVQPIQPAALMHPQSSPGSQ-SHLDHLPTPGQLPPREDFFAERFPLNFTTAKM  737

Query  768   LSPEHHSPVRSPAGGALPPGMPPQHHHPHPHMARSPFAFNPIKHEMAALLPRPHSNDNSW  827
             LSPEHHSPVRSPAGGALPPG+PP  HH   HMARSPF FNPIKHEMAALLPRPHSNDNSW
Sbjct  738   LSPEHHSPVRSPAGGALPPGVPPPPHHHPHHMARSPF-FNPIKHEMAALLPRPHSNDNSW  796

Query  828   ENFIEVSNTCETMKLKELMKNKKISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI  887
             ENFIEVSNTCETMKLKELMKNKKISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI
Sbjct  797   ENFIEVSNTCETMKLKELMKNKKISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRI  856

Query  888   CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGEPTDLTPE  947
             CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGEPTDLTPE
Sbjct  857   CGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGEPTDLTPE  916

Query  948   QIQAAEIRDPPPSMMPGHFMNPFAAAAFHFGALPGGPGGPGGPPNHGGHNGALGSESSQG  1007
             QIQAAEIRDPPPSMMPGHFMNPFAAAAFHFGAL  G  G    PNHG HNGALGSESSQG
Sbjct  917   QIQAAEIRDPPPSMMPGHFMNPFAAAAFHFGAL-PGGPGGPPGPNHGAHNGALGSESSQG  975

Query  1008  DLDDNMDCGEDYDDDGVSSEHLSSSHLEQDGDRPRSGDDFKSLLFEQKLRIDATGVVNTN  1067
             D+DDNMDCGEDYDDD VSSEHLS+S+LEQ+GDR RSGDDFKSLLFEQKLRIDATGVVNTN
Sbjct  976   DMDDNMDCGEDYDDD-VSSEHLSNSNLEQEGDRSRSGDDFKSLLFEQKLRIDATGVVNTN  1034

Query  1068  PVRPKSSASSHGHSVGSTSAPTSPSVHHSAAQVPKPSPSPARSDVSQGALDLTPRAAPTS  1127
             PVRP+SSASSHGHSVGSTSAPTSPSV H+++QV K S SPARS+ SQGALDLTPRAAPTS
Sbjct  1035  PVRPRSSASSHGHSVGSTSAPTSPSV-HASSQVIKRSSSPARSEASQGALDLTPRAAPTS  1093

Query  1128  GSSSRSPLPPKEKPASPAR-----------SPSGGHAPLPPTVGIDCLPPGLQHHLQQQH  1176
              SSSRSPL PKEKP SP             S +   +PLPPTVGIDCLPPGLQHHLQQQH
Sbjct  1094  SSSSRSPL-PKEKPVSPPSLPRSPSGSSHASANILTSPLPPTVGIDCLPPGLQHHLQQQH  1152

Query  1177  QHLMQQQAAVAAAAAAQHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAAAA  1236
             QHLMQQQAAVAAAAAAQHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAA  
Sbjct  1153  QHLMQQQAAVAAAAAAQHHHHQQMAALHQHQEQLRREAAEAQQKAAAAAAAAAAAAAAQ-  1211

Query  1237  GQRQSPPQNNQGRQEGGGGAGPPPNPMMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQ  1296
               RQ+PPQ    RQEGG GAGPPPNP+MGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQ
Sbjct  1212  --RQTPPQARDQRQEGGPGAGPPPNPLMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQ  1269

Query  1297  SVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTK  1356
             SVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKC+ICDRGFTTK
Sbjct  1270  SVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKCSICDRGFTTK  1329

Query  1357  GNLKQHMLTHKIRDMEQETFRNRAVK  1382
             GNLKQHMLTHKIRDMEQETFRNRAVK
Sbjct  1330  GNLKQHMLTHKIRDMEQETFRNRAVK  1355


>Q5U0U8_DROME unnamed protein product
Length=1267

 Score = 188 bits (478),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 2/117 (2%)

Query  824  DNSWENFIEVSNTCETMKLKELMKN--KKISDPNQCVVCDRVLSCKSALQMHYRTHTGER  881
            D SWE+ IE+  T ET KL++L+ N   K++DPNQC+ C +V+SC+S+LQMH RTHTGER
Sbjct  548  DKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGER  607

Query  882  PFKCRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHT  938
            PF+C+ICGRAF TKGNLK HM++HKI+PPMR+  +CPVCH+K+SN ++LQQHIR+HT
Sbjct  608  PFRCKICGRAFATKGNLKAHMSIHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 172 bits (436),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 179/327 (55%), Gaps = 67/327 (20%)

Query  191  ALPGAAAGAPVTLEAIQNMQMAIAQFAAKTIANGSSGADNEAAMKQLAFLQQTLFNLQQQ  250
            +LPG+     V+LEA+Q+ ++A+AQFAA  +A     AD       LA +Q T+FN+Q+Q
Sbjct  106  SLPGSGH---VSLEALQHTKVAVAQFAATAMAGNHQSAD-------LAMVQSTIFNVQRQ  155

Query  251  QL--------FQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQEQTDTYEEEERIADME  302
             L         Q QL +   + L  +    EE+ E E + E +++ T+  +EE     +E
Sbjct  156  HLMQLQLIQHLQSQLKRAEAAALGRHSHSDEEEEEPEPEPEPKKQPTNGLKEE-----LE  210

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREQDHDGQPHRRASLEGAHKG  362
            L Q  E+   +   R+                        + D  G   R+A  EG    
Sbjct  211  LEQGPESEQDQESRRE---------------------ENSKTDKRGTEDRKAEPEGYQ--  247

Query  363  DSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLP---EPNSLDLLQKRAQEVLDSAS  419
                           + +   SS LASSIIT+HD  P   EPN L++LQ+R +EVLDSAS
Sbjct  248  ---------------SMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQRRTEEVLDSAS  292

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERPF  479
            Q + A  M ++++  E A +  + R E  FKHRC+YCGK+FGS SALQIH+RSHTGERPF
Sbjct  293  QSLHAAQMQEEYS--EYASKEAQSRGE-IFKHRCKYCGKIFGSYSALQIHLRSHTGERPF  349

Query  480  KCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             CNVCGS+FTTKGNLKVH+QRH Q FP
Sbjct  350  VCNVCGSKFTTKGNLKVHYQRHTQIFP  376


 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)

Query  450   KHRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             KH C  C + F S SALQIH+R+HTG++PF+CNVC   FTTKGNLKVH   H    P
Sbjct  1039  KHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)

Query  851   ISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVHKIRPP  910
             +++ + C VC R  S  SALQ+H RTHTG++PF+C +C +AFTTKGNLK HM  H    P
Sbjct  1036  VNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTHKIR  1369
             C  C K   C S+L++H R+HT ERPF+C IC R F TKGNLK HM  HKI+
Sbjct  583   CIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIK  634


 Score = 77.0 bits (188),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 1/57 (2%)

Query  856  QCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVH-KIRPPM  911
            +C  C ++    SALQ+H R+HTGERPF C +CG  FTTKGNLK H   H +I PPM
Sbjct  322  RCKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPM  378


 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)

Query  451  HRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
            ++C +C KV    S+LQ+HIR+HTGERPF+C +CG  F TKGNLK H   H  K P
Sbjct  581  NQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIKPP  636


 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 0/49 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTH  1366
             C  C K F  +SAL+IH RSHT ERPF CN+C   FTTKGNLK H   H
Sbjct  323   CKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRH  371


 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 114/267 (43%), Gaps = 30/267 (11%)

Query  248  QQQQLFQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQ-----EQTDTYEEEERIADME  302
            Q+Q   Q++  ++++ ++ + QA   EDL +   +E+E+     E+  T +E +  A + 
Sbjct  416  QEQHQNQVEEPEEIRQEIPVPQA---EDLSKPMVKEKEKSHSPVERVKTPKEVKTDAALP  472

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSG-SPAESLKRRR--EQDHDGQPHRRASLEGA  359
              +K E  +++        N  V  R++S  SP +  + R   E  H  +  RR+S   +
Sbjct  473  SSEKPEKEISKPVVTSSRRNGSVRKRQTSAVSPPQEDRERDLVEHLHIAKLVRRSS--AS  530

Query  360  HKGDSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLPEPNSLDLLQKRAQEVLDSAS  419
             +   A  +LA+++ +          D +   +   D   E + L  L    +  L   +
Sbjct  531  RESQPAEYSLAQMERI---------IDKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPN  581

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERP-  478
            Q I    +    +  +    +  G   PF   RC+ CG+ F +   L+ H+  H  + P 
Sbjct  582  QCIFCQKVMSCRSSLQMHIRTHTGE-RPF---RCKICGRAFATKGNLKAHMSIHKIKPPM  637

Query  479  ---FKCNVCGSRFTTKGNLKVHFQRHA  502
               FKC VC  +F+    L+ H + H 
Sbjct  638  RSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 39.3 bits (90),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  907   IRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
             + PP+ N H C VC + +S++  LQ H+R HTG+
Sbjct  1032  LDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGD  1065


 Score = 38.1 bits (87),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 46/124 (37%), Gaps = 20/124 (16%)

Query  885   CRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTG-EPTD  943
             C +C R F++   L+ HM  H    P     QC VC K ++    L+ H+  H    PT 
Sbjct  1042  CHVCRRNFSSSSALQIHMRTHTGDKPF----QCNVCQKAFTTKGNLKVHMGTHMWTNPTS  1097

Query  944   LTPEQIQAAEIRDPPPSMMPGH--------FMNPFAAAAF-----HFGALPGGPG--GPG  988
                 ++       P P+   GH        FM       F      F  LP  PG   PG
Sbjct  1098  RRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGLPPKPGELSPG  1157

Query  989   GPPN  992
               PN
Sbjct  1158  AFPN  1161


 Score = 37.7 bits (86),  Expect = 0.079, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 39/82 (48%), Gaps = 9/82 (11%)

Query  1262  PMMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQSVMPAAPFNPLALSGVRGS-TTCGI  1320
             PM+G      M PNL L   A  +   +A+   A +  P  PF PL   G+      C +
Sbjct  824   PMLG----MPMPPNLLLM--AAAREEMHALGH-AHAKFPLLPFGPLGFMGLHPPPNVCNL  876

Query  1321  CYKTFPCHSALEIHYRS-HTKE  1341
             C+K  P  +ALE H +S H KE
Sbjct  877   CFKMLPSLAALESHLQSEHAKE  898


 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  899  KTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
            K    V  I   + + +QC  C K  S    LQ HIR HTGE
Sbjct  565  KLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGE  606


 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  915  HQCPVCHKKYSNALVLQQHIRLHTGE  940
            H+C  C K + +   LQ H+R HTGE
Sbjct  321  HRCKYCGKIFGSYSALQIHLRSHTGE  346


>Q9VKH3_DROME unnamed protein product
Length=1267

 Score = 188 bits (478),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 99/117 (85%), Gaps = 2/117 (2%)

Query  824  DNSWENFIEVSNTCETMKLKELMKN--KKISDPNQCVVCDRVLSCKSALQMHYRTHTGER  881
            D SWE+ IE+  T ET KL++L+ N   K++DPNQC+ C +V+SC+S+LQMH RTHTGER
Sbjct  548  DKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGER  607

Query  882  PFKCRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHT  938
            PF+C+ICGRAF TKGNLK HM++HKI+PPMR+  +CPVCH+K+SN ++LQQHIR+HT
Sbjct  608  PFRCKICGRAFATKGNLKAHMSIHKIKPPMRSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 172 bits (436),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 131/327 (40%), Positives = 179/327 (55%), Gaps = 67/327 (20%)

Query  191  ALPGAAAGAPVTLEAIQNMQMAIAQFAAKTIANGSSGADNEAAMKQLAFLQQTLFNLQQQ  250
            +LPG+     V+LEA+Q+ ++A+AQFAA  +A     AD       LA +Q T+FN+Q+Q
Sbjct  106  SLPGSGH---VSLEALQHTKVAVAQFAATAMAGNHQSAD-------LAMVQSTIFNVQRQ  155

Query  251  QL--------FQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQEQTDTYEEEERIADME  302
             L         Q QL +   + L  +    EE+ E E + E +++ T+  +EE     +E
Sbjct  156  HLMQLQLIQHLQSQLKRAEAAALGRHSHSDEEEEEPEPEPEPKKQPTNGLKEE-----LE  210

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSGSPAESLKRRREQDHDGQPHRRASLEGAHKG  362
            L Q  E+   +   R+                        + D  G   R+A  EG    
Sbjct  211  LEQGPESEQDQESRRE---------------------ENSKTDKRGTEDRKAEPEGYQ--  247

Query  363  DSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLP---EPNSLDLLQKRAQEVLDSAS  419
                           + +   SS LASSIIT+HD  P   EPN L++LQ+R +EVLDSAS
Sbjct  248  ---------------SMMCDISSSLASSIITNHDPPPAPNEPNCLEMLQRRTEEVLDSAS  292

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERPF  479
            Q + A  M ++++  E A +  + R E  FKHRC+YCGK+FGS SALQIH+RSHTGERPF
Sbjct  293  QSLHAAQMQEEYS--EYASKEAQSRGE-IFKHRCKYCGKIFGSYSALQIHLRSHTGERPF  349

Query  480  KCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             CNVCGS+FTTKGNLKVH+QRH Q FP
Sbjct  350  VCNVCGSKFTTKGNLKVHYQRHTQIFP  376


 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 40/57 (70%), Gaps = 0/57 (0%)

Query  450   KHRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
             KH C  C + F S SALQIH+R+HTG++PF+CNVC   FTTKGNLKVH   H    P
Sbjct  1039  KHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 42/60 (70%), Gaps = 0/60 (0%)

Query  851   ISDPNQCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVHKIRPP  910
             +++ + C VC R  S  SALQ+H RTHTG++PF+C +C +AFTTKGNLK HM  H    P
Sbjct  1036  VNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTTKGNLKVHMGTHMWTNP  1095


 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTHKIR  1369
             C  C K   C S+L++H R+HT ERPF+C IC R F TKGNLK HM  HKI+
Sbjct  583   CIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIK  634


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 1/57 (2%)

Query  856  QCVVCDRVLSCKSALQMHYRTHTGERPFKCRICGRAFTTKGNLKTHMAVH-KIRPPM  911
            +C  C ++    SALQ+H R+HTGERPF C +CG  FTTKGNLK H   H +I PPM
Sbjct  322  RCKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRHTQIFPPM  378


 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 0/56 (0%)

Query  451  HRCRYCGKVFGSDSALQIHIRSHTGERPFKCNVCGSRFTTKGNLKVHFQRHAQKFP  506
            ++C +C KV    S+LQ+HIR+HTGERPF+C +CG  F TKGNLK H   H  K P
Sbjct  581  NQCIFCQKVMSCRSSLQMHIRTHTGERPFRCKICGRAFATKGNLKAHMSIHKIKPP  636


 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 0/71 (0%)

Query  1296  QSVMPAAPFNPLALSGVRGSTTCGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTT  1355
             Q++M A P        V     C +C + F   SAL+IH R+HT ++PF+CN+C + FTT
Sbjct  1020  QALMSAGPPTSSLDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGDKPFQCNVCQKAFTT  1079

Query  1356  KGNLKQHMLTH  1366
             KGNLK HM TH
Sbjct  1080  KGNLKVHMGTH  1090


 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 0/49 (0%)

Query  1318  CGICYKTFPCHSALEIHYRSHTKERPFKCNICDRGFTTKGNLKQHMLTH  1366
             C  C K F  +SAL+IH RSHT ERPF CN+C   FTTKGNLK H   H
Sbjct  323   CKYCGKIFGSYSALQIHLRSHTGERPFVCNVCGSKFTTKGNLKVHYQRH  371


 Score = 41.2 bits (95),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 60/267 (22%), Positives = 114/267 (43%), Gaps = 30/267 (11%)

Query  248  QQQQLFQIQLIQQLQSQLALNQAKQEEDLEEEQDQEQEQ-----EQTDTYEEEERIADME  302
            Q+Q   Q++  ++++ ++ + QA   EDL +   +E+E+     E+  T +E +  A + 
Sbjct  416  QEQHQNQVEEPEEIRQEIPVPQA---EDLSKPMVKEKEKSHSPVERVKTPKEVKTDAALP  472

Query  303  LRQKAEARMAEAKARQHLINAGVPLRESSG-SPAESLKRRR--EQDHDGQPHRRASLEGA  359
              +K E  +++        N  V  R++S  SP +  + R   E  H  +  RR+S   +
Sbjct  473  SSEKPEKEISKPVVTSSRRNGSVRKRQTSAVSPPQEDRERDLVEHLHIAKLVRRSS--AS  530

Query  360  HKGDSALDALAKLKEMENTPLPFGSSDLASSIITHHDDLPEPNSLDLLQKRAQEVLDSAS  419
             +   A  +LA+++ +          D +   +   D   E + L  L    +  L   +
Sbjct  531  RESQPAEYSLAQMERI---------IDKSWEDLIEIDKTSETSKLQQLVDNIENKLTDPN  581

Query  420  QGILANSMADDFAFGEKAGESGKGRNEPFFKHRCRYCGKVFGSDSALQIHIRSHTGERP-  478
            Q I    +    +  +    +  G   PF   RC+ CG+ F +   L+ H+  H  + P 
Sbjct  582  QCIFCQKVMSCRSSLQMHIRTHTGE-RPF---RCKICGRAFATKGNLKAHMSIHKIKPPM  637

Query  479  ---FKCNVCGSRFTTKGNLKVHFQRHA  502
               FKC VC  +F+    L+ H + H 
Sbjct  638  RSQFKCPVCHQKFSNGIILQQHIRIHT  664


 Score = 39.3 bits (90),  Expect = 0.026, Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (68%), Gaps = 0/34 (0%)

Query  907   IRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
             + PP+ N H C VC + +S++  LQ H+R HTG+
Sbjct  1032  LDPPVNNKHFCHVCRRNFSSSSALQIHMRTHTGD  1065


 Score = 38.1 bits (87),  Expect = 0.060, Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 46/124 (37%), Gaps = 20/124 (16%)

Query  885   CRICGRAFTTKGNLKTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTG-EPTD  943
             C +C R F++   L+ HM  H    P     QC VC K ++    L+ H+  H    PT 
Sbjct  1042  CHVCRRNFSSSSALQIHMRTHTGDKPF----QCNVCQKAFTTKGNLKVHMGTHMWTNPTS  1097

Query  944   LTPEQIQAAEIRDPPPSMMPGH--------FMNPFAAAAF-----HFGALPGGPG--GPG  988
                 ++       P P+   GH        FM       F      F  LP  PG   PG
Sbjct  1098  RRGRRMSLELPMRPGPNSGQGHPGSSAEQEFMQRRPELFFPYLPPFFNGLPPKPGELSPG  1157

Query  989   GPPN  992
               PN
Sbjct  1158  AFPN  1161


 Score = 37.7 bits (86),  Expect = 0.084, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 39/82 (48%), Gaps = 9/82 (11%)

Query  1262  PMMGARPPFGMFPNLPLFPPATTQNMCNAMNQIAQSVMPAAPFNPLALSGVRGS-TTCGI  1320
             PM+G      M PNL L   A  +   +A+   A +  P  PF PL   G+      C +
Sbjct  824   PMLG----MPMPPNLLLM--AAAREEMHALGH-AHAKFPLLPFGPLGFMGLHPPPNVCNL  876

Query  1321  CYKTFPCHSALEIHYRS-HTKE  1341
             C+K  P  +ALE H +S H KE
Sbjct  877   CFKMLPSLAALESHLQSEHAKE  898


 Score = 33.1 bits (74),  Expect = 2.3, Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (48%), Gaps = 0/42 (0%)

Query  899  KTHMAVHKIRPPMRNFHQCPVCHKKYSNALVLQQHIRLHTGE  940
            K    V  I   + + +QC  C K  S    LQ HIR HTGE
Sbjct  565  KLQQLVDNIENKLTDPNQCIFCQKVMSCRSSLQMHIRTHTGE  606


 Score = 31.6 bits (70),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (62%), Gaps = 0/26 (0%)

Query  915  HQCPVCHKKYSNALVLQQHIRLHTGE  940
            H+C  C K + +   LQ H+R HTGE
Sbjct  321  HRCKYCGKIFGSYSALQIHLRSHTGE  346



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110351.1 hemicentin-2 isoform X1 [Drosophila elegans]

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DZ4_DROME  unnamed protein product                                 687     0.0   
Q59E13_DROME  unnamed protein product                                 323     3e-106
Q8T603_DROME  unnamed protein product                                 238     3e-75 


>Q59DZ4_DROME unnamed protein product
Length=410

 Score = 687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/411 (85%), Positives = 369/411 (90%), Gaps = 14/411 (3%)

Query  1    MAMEGKCFGCIATPILVIVLSVSRACAMQQHHLGPASHSPQHPGIQSLSNIVDGNSNLLP  60
            MAMEGKCFGCIATPILVI++S+SRA  MQQ HL PA    QHP ++SLS++VDGN NLLP
Sbjct  1    MAMEGKCFGCIATPILVIMISISRAWTMQQQHLSPAIQ--QHPAVKSLSHLVDGNDNLLP  58

Query  61   IISAPSPIDNDYVYIASVNSKFPQFGNALDEEQETEEQQPEETTYPPPIFDFGMPRNITT  120
            ++SAPS IDNDYVYIASVN KFPQFGN++D+E+E EEQ PEETTYPPP+FDFGMPRNITT
Sbjct  59   MVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITT  118

Query  121  RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK  180
            RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK
Sbjct  119  RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK  178

Query  181  YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCLVK  240
            YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTC VK
Sbjct  179  YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVK  238

Query  241  QPTTSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL  300
            QP TSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL
Sbjct  239  QPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL  298

Query  301  DTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAMHSS---RSSGLVLVLVAMVASSVV  357
            DTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRA+ +S   RSS LVL L+AMVASSVV
Sbjct  299  DTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVL-LLAMVASSVV  357

Query  358  RWLIGGCHWDSKSCRDSCSNLHTLHINYSQLNAKSAPTSASASASHLEQHR  408
            RWLIGG    S SC DSCSNL TLHINY  L AK          SHL++HR
Sbjct  358  RWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAK--------ITSHLKEHR  400


>Q59E13_DROME unnamed protein product
Length=522

 Score = 323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 197/270 (73%), Gaps = 32/270 (12%)

Query  96   EEQQPEETTYPPPIFDFGMPRNITTRTGHTAAI-NCRVDNLGDKSVSWIRKRDLHILTAG  154
            EE Q  +T+   PIFDFGMPRNIT RTGHT AI  CRVD+L DKSVSWIRKRDLHILT G
Sbjct  224  EESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVG  283

Query  155  ILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPD  214
              TYTSD+RF+V  + DS++WTLHVK    +DSGIYECQVNTEPK+SMAF+LN+I   PD
Sbjct  284  TATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPD  343

Query  215  AKAIIAGPTDLYVKVGSSVTLTCLVKQPTTSAQDIGPIYWYRGPYILTPFVAH-------  267
            AKA+I+GP DL+ K GS++ L CLV+QP  S +DIGPIYWYRG +++TPF A        
Sbjct  344  AKAVISGPPDLHFKAGSAIILNCLVQQP--SVKDIGPIYWYRGEHMITPFDADDGQPEIP  401

Query  268  ---------------PND--AAIDLQ-----RISMESTLAEKLQSRLRIANAQLLDTGNY  305
                           PND  + +DLQ     RI+MES L + L+SRLRI+NAQ  DTGNY
Sbjct  402  AGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNY  461

Query  306  TCMPTTAEAASVVVNVINDESPAAMQKSRA  335
            TC PTTA +ASV+V+VINDE+PAAMQKS A
Sbjct  462  TCQPTTASSASVLVHVINDENPAAMQKSGA  491


>Q8T603_DROME unnamed protein product
Length=367

 Score = 238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 171/260 (66%), Gaps = 10/260 (4%)

Query  108  PIFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVV  167
            P FDF +PRN+T   G T  ++CRV+ LGDK VSWIRKRDLHILTAG  TYTSD+RF+V+
Sbjct  53   PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL  112

Query  168  RTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYV  227
            R   S +WTL +KY QPRDSG+YECQ+NTEPK+S+++  NV+    + KA I GP+DL V
Sbjct  113  RPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV----ELKAEIFGPSDLMV  168

Query  228  KVGSSVTLTCLVKQPTTSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEK  287
            K GS + LTC + Q      ++G I+WY+G  +L       N+    + RI +E    + 
Sbjct  169  KTGSDINLTCKIMQ---GPHELGNIFWYKGSEMLDG--KGENEIDSSMARIRVEDDWTDG  223

Query  288  LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAMHSSR-SSGLVL  346
            L SRL+I  A   DTGNYTC+PT A+ +SV V+VI  E PAAMQ + + +S+    G+  
Sbjct  224  LTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICC  283

Query  347  VLVAMVASSVVRWLIGGCHW  366
            +L+++V+  +  +   GC +
Sbjct  284  MLLSIVSCCLQHFYETGCGY  303



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110352.1 hemicentin-2 isoform X1 [Drosophila elegans]

Length=413
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DZ4_DROME  unnamed protein product                                 687     0.0   
Q59E13_DROME  unnamed protein product                                 323     3e-106
Q8T603_DROME  unnamed protein product                                 238     3e-75 


>Q59DZ4_DROME unnamed protein product
Length=410

 Score = 687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/411 (85%), Positives = 369/411 (90%), Gaps = 14/411 (3%)

Query  1    MAMEGKCFGCIATPILVIVLSVSRACAMQQHHLGPASHSPQHPGIQSLSNIVDGNSNLLP  60
            MAMEGKCFGCIATPILVI++S+SRA  MQQ HL PA    QHP ++SLS++VDGN NLLP
Sbjct  1    MAMEGKCFGCIATPILVIMISISRAWTMQQQHLSPAIQ--QHPAVKSLSHLVDGNDNLLP  58

Query  61   IISAPSPIDNDYVYIASVNSKFPQFGNALDEEQETEEQQPEETTYPPPIFDFGMPRNITT  120
            ++SAPS IDNDYVYIASVN KFPQFGN++D+E+E EEQ PEETTYPPP+FDFGMPRNITT
Sbjct  59   MVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITT  118

Query  121  RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK  180
            RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK
Sbjct  119  RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK  178

Query  181  YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCLVK  240
            YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTC VK
Sbjct  179  YAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYVKVGSSVTLTCHVK  238

Query  241  QPTTSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL  300
            QP TSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL
Sbjct  239  QPATSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEKLQSRLRIANAQLL  298

Query  301  DTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAMHSS---RSSGLVLVLVAMVASSVV  357
            DTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRA+ +S   RSS LVL L+AMVASSVV
Sbjct  299  DTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAIRTSGSMRSSRLVL-LLAMVASSVV  357

Query  358  RWLIGGCHWDSKSCRDSCSNLHTLHINYSQLNAKSAPTSASASASHLEQHR  408
            RWLIGG    S SC DSCSNL TLHINY  L AK          SHL++HR
Sbjct  358  RWLIGGQRIGSNSCHDSCSNLSTLHINYCNLRAK--------ITSHLKEHR  400


>Q59E13_DROME unnamed protein product
Length=522

 Score = 323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/270 (61%), Positives = 197/270 (73%), Gaps = 32/270 (12%)

Query  96   EEQQPEETTYPPPIFDFGMPRNITTRTGHTAAI-NCRVDNLGDKSVSWIRKRDLHILTAG  154
            EE Q  +T+   PIFDFGMPRNIT RTGHT AI  CRVD+L DKSVSWIRKRDLHILT G
Sbjct  224  EESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVG  283

Query  155  ILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPD  214
              TYTSD+RF+V  + DS++WTLHVK    +DSGIYECQVNTEPK+SMAF+LN+I   PD
Sbjct  284  TATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPD  343

Query  215  AKAIIAGPTDLYVKVGSSVTLTCLVKQPTTSAQDIGPIYWYRGPYILTPFVAH-------  267
            AKA+I+GP DL+ K GS++ L CLV+QP  S +DIGPIYWYRG +++TPF A        
Sbjct  344  AKAVISGPPDLHFKAGSAIILNCLVQQP--SVKDIGPIYWYRGEHMITPFDADDGQPEIP  401

Query  268  ---------------PND--AAIDLQ-----RISMESTLAEKLQSRLRIANAQLLDTGNY  305
                           PND  + +DLQ     RI+MES L + L+SRLRI+NAQ  DTGNY
Sbjct  402  AGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNY  461

Query  306  TCMPTTAEAASVVVNVINDESPAAMQKSRA  335
            TC PTTA +ASV+V+VINDE+PAAMQKS A
Sbjct  462  TCQPTTASSASVLVHVINDENPAAMQKSGA  491


>Q8T603_DROME unnamed protein product
Length=367

 Score = 238 bits (608),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/260 (47%), Positives = 171/260 (66%), Gaps = 10/260 (4%)

Query  108  PIFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVV  167
            P FDF +PRN+T   G T  ++CRV+ LGDK VSWIRKRDLHILTAG  TYTSD+RF+V+
Sbjct  53   PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL  112

Query  168  RTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIVTPPDAKAIIAGPTDLYV  227
            R   S +WTL +KY QPRDSG+YECQ+NTEPK+S+++  NV+    + KA I GP+DL V
Sbjct  113  RPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVV----ELKAEIFGPSDLMV  168

Query  228  KVGSSVTLTCLVKQPTTSAQDIGPIYWYRGPYILTPFVAHPNDAAIDLQRISMESTLAEK  287
            K GS + LTC + Q      ++G I+WY+G  +L       N+    + RI +E    + 
Sbjct  169  KTGSDINLTCKIMQ---GPHELGNIFWYKGSEMLDG--KGENEIDSSMARIRVEDDWTDG  223

Query  288  LQSRLRIANAQLLDTGNYTCMPTTAEAASVVVNVINDESPAAMQKSRAMHSSR-SSGLVL  346
            L SRL+I  A   DTGNYTC+PT A+ +SV V+VI  E PAAMQ + + +S+    G+  
Sbjct  224  LTSRLKIKRAMPGDTGNYTCVPTVAKTSSVYVHVIIGEHPAAMQHNSSSNSNSFYCGICC  283

Query  347  VLVAMVASSVVRWLIGGCHW  366
            +L+++V+  +  +   GC +
Sbjct  284  MLLSIVSCCLQHFYETGCGY  303



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110353.1 uncharacterized protein LOC108134523 isoform X2
[Drosophila elegans]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DZ4_DROME  unnamed protein product                                 365     2e-126
Q59E13_DROME  unnamed protein product                                 174     5e-51 
Q8T603_DROME  unnamed protein product                                 152     9e-44 


>Q59DZ4_DROME unnamed protein product
Length=410

 Score = 365 bits (936),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/209 (87%), Positives = 195/209 (93%), Gaps = 2/209 (1%)

Query  1    MAMEGKCFGCIATPILVIVLSVSRACAMQQHHLGPASHSPQHPGIQSLSNIVDGNSNLLP  60
            MAMEGKCFGCIATPILVI++S+SRA  MQQ HL PA    QHP ++SLS++VDGN NLLP
Sbjct  1    MAMEGKCFGCIATPILVIMISISRAWTMQQQHLSPAIQ--QHPAVKSLSHLVDGNDNLLP  58

Query  61   IISAPSPIDNDYVYIASVNSKFPQFGNALDEEQETEEQQPEETTYPPPIFDFGMPRNITT  120
            ++SAPS IDNDYVYIASVN KFPQFGN++D+E+E EEQ PEETTYPPP+FDFGMPRNITT
Sbjct  59   MVSAPSSIDNDYVYIASVNRKFPQFGNSIDDEREAEEQPPEETTYPPPVFDFGMPRNITT  118

Query  121  RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK  180
            RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK
Sbjct  119  RTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVRTADSKDWTLHVK  178

Query  181  YAQPRDSGIYECQVNTEPKISMAFRLNVI  209
            YAQPRDSGIYECQVNTEPKISMAFRLNVI
Sbjct  179  YAQPRDSGIYECQVNTEPKISMAFRLNVI  207


>Q59E13_DROME unnamed protein product
Length=522

 Score = 174 bits (441),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 96/118 (81%), Gaps = 1/118 (1%)

Query  96   EEQQPEETTYPPPIFDFGMPRNITTRTGHTAAI-NCRVDNLGDKSVSWIRKRDLHILTAG  154
            EE Q  +T+   PIFDFGMPRNIT RTGHT AI  CRVD+L DKSVSWIRKRDLHILT G
Sbjct  224  EESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVG  283

Query  155  ILTYTSDERFKVVRTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIDYA  212
              TYTSD+RF+V  + DS++WTLHVK    +DSGIYECQVNTEPK+SMAF+LN+I+ +
Sbjct  284  TATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEIS  341


>Q8T603_DROME unnamed protein product
Length=367

 Score = 152 bits (383),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 85/110 (77%), Gaps = 0/110 (0%)

Query  108  PIFDFGMPRNITTRTGHTAAINCRVDNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVV  167
            P FDF +PRN+T   G T  ++CRV+ LGDK VSWIRKRDLHILTAG  TYTSD+RF+V+
Sbjct  53   PYFDFDVPRNLTVTVGQTGFLHCRVERLGDKDVSWIRKRDLHILTAGGTTYTSDQRFQVL  112

Query  168  RTADSKDWTLHVKYAQPRDSGIYECQVNTEPKISMAFRLNVIDYASPMLS  217
            R   S +WTL +KY QPRDSG+YECQ+NTEPK+S+++  NV++  + +  
Sbjct  113  RPDGSANWTLQIKYPQPRDSGVYECQINTEPKMSLSYTFNVVELKAEIFG  162


 Score = 28.5 bits (62),  Expect = 5.5, Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 61/150 (41%), Gaps = 31/150 (21%)

Query  53   DGNSNLLPIISAPSPIDNDYVYIASVNSKFPQFGNALDEEQETEEQQPEETTYPPPIFDF  112
            DG++N    I  P P D+  VY   +N++ P+   +L       E + E       IF  
Sbjct  115  DGSANWTLQIKYPQPRDSG-VYECQINTE-PKM--SLSYTFNVVELKAE-------IFG-  162

Query  113  GMPRNITTRTGHTAAINCRV----DNLGDKSVSWIRKRDLHILTAGILTYTSDERFKVVR  168
              P ++  +TG    + C++      LG+  + W +  ++     G      D     +R
Sbjct  163  --PSDLMVKTGSDINLTCKIMQGPHELGN--IFWYKGSEM---LDGKGENEIDSSMARIR  215

Query  169  TADSKDWT------LHVKYAQPRDSGIYEC  192
              D  DWT      L +K A P D+G Y C
Sbjct  216  VED--DWTDGLTSRLKIKRAMPGDTGNYTC  243



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110354.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110355.1 uncharacterized protein LOC108134524 [Drosophila
elegans]

Length=120
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I5K4_PLAF7  unnamed protein product                                 28.1    1.9  
ELL_DROME  unnamed protein product                                    26.9    4.8  
CBP1_CAEEL  unnamed protein product                                   26.6    6.8  


>Q8I5K4_PLAF7 unnamed protein product
Length=266

 Score = 28.1 bits (61),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (47%), Gaps = 9/73 (12%)

Query  2   NCFAYAVE---FAHDENLLKSHANVSHLSEF------LALLTLETAKEDDEDFHIFQEKL  52
           N F Y V+   ++ DEN  +  +N+ HL+ F      L    L  A E + D  I +  +
Sbjct  21  NGFIYLVKWKGYSDDENTWEPESNLIHLTTFKKKMESLKTNFLSKANETNGDGKILKNHI  80

Query  53  LQLKREADRLDSK  65
           L   +E D + SK
Sbjct  81  LAPTQEDDSIKSK  93


>ELL_DROME unnamed protein product
Length=1059

 Score = 26.9 bits (58),  Expect = 4.8, Method: Composition-based stats.
 Identities = 19/90 (21%), Positives = 48/90 (53%), Gaps = 12/90 (13%)

Query  26   LSEFLALLTLETAK----EDDEDFHIFQEKLLQL-------KREADRLDSKLNSPDYYTQ  74
             S+++ + TLE  +    E + D+  +++ L ++       +  ++RL+S     + Y  
Sbjct  830  FSQYVPIQTLEVRRRYKTEFESDYDEYRKLLTRVEDVRNRFQDLSERLESARRCDNGYGD  889

Query  75   KEELIFKVVCEIKGIDHEKWL-RDEQGFDY  103
             + +  ++VCE + I++++ +  D++ FDY
Sbjct  890  YDHIKRQIVCEYERINNDRTIGEDKERFDY  919


>CBP1_CAEEL unnamed protein product
Length=2017

 Score = 26.6 bits (57),  Expect = 6.8, Method: Composition-based stats.
 Identities = 10/34 (29%), Positives = 24/34 (71%), Gaps = 1/34 (3%)

Query  35   LETAKEDDEDFHIFQEKLLQLKRE-ADRLDSKLN  67
             E+A + +E +H+  EK+ ++++E  ++ +S+LN
Sbjct  647  FESANDREEYYHLLAEKIYKIQKELQEKKNSRLN  680



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110356.1 transmembrane protein 214-A isoform X1 [Drosophila
elegans]

Length=680
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKM7_DROME  unnamed protein product                                 1189    0.0   
Q9VKM8_DROME  unnamed protein product                                 392     2e-133
SEH1_DROME  unnamed protein product                                   36.2    0.087 


>Q9VKM7_DROME unnamed protein product
Length=677

 Score = 1189 bits (3075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/680 (91%), Positives = 640/680 (94%), Gaps = 3/680 (0%)

Query  1    MSEQWEVVSKSRKQKNLDKKVIAHTEQKRIAAQLPKLEELLPAQRYRNLLGSSSNNNHKS  60
            MSEQWEVVSKSRKQKNLDKKV AH EQKRIAAQLPKLEELLP QRYRNL GSS+NNN KS
Sbjct  1    MSEQWEVVSKSRKQKNLDKKVSAHNEQKRIAAQLPKLEELLPTQRYRNLFGSSNNNNSKS  60

Query  61   HSPAKSSSSTSSSSKTNKSPAKKNPVKNAVGSTVPKKSTSSSVAKPKTLEQALRNITRDD  120
            HSPAKSSSS SSSSK NKSP KK+  KNA   +  K++TS++ +KPKTLE ALRNITRDD
Sbjct  61   HSPAKSSSSASSSSKANKSPVKKHTAKNA---STQKRTTSAAASKPKTLELALRNITRDD  117

Query  121  FAAQLEQVKLSCPGSELRWLSHIAQYFNGALSYECDPIFSGRSAQYPSNLASASLKYSIV  180
            FAAQLEQVKLSCPGSELRWLSHIA YFN ALSY+CDPIFSGRSAQYPSNLASASLKYSIV
Sbjct  118  FAAQLEQVKLSCPGSELRWLSHIALYFNEALSYDCDPIFSGRSAQYPSNLASASLKYSIV  177

Query  181  EFLGSVGEQNLEYFFYSLLDSMATDLNNNQTVAGYKLILQLIGQNWPSICSRNLAKTALL  240
            EFLGSVGEQNLEYFFYSLLDSM+TDLNNNQTVAGYKLILQLIGQNWP+ICSRNLAKTALL
Sbjct  178  EFLGSVGEQNLEYFFYSLLDSMSTDLNNNQTVAGYKLILQLIGQNWPNICSRNLAKTALL  237

Query  241  RNSYQNRSNICLSILWAIGQGGYQSLNEGVRVWQNLMLPNLELKQYTKFVVEYMERALTA  300
            RNSYQNRSNICLSILWAIGQGGYQSLNEGVRVWQNLMLPNLELKQYTKFVVEYMERAL+A
Sbjct  238  RNSYQNRSNICLSILWAIGQGGYQSLNEGVRVWQNLMLPNLELKQYTKFVVEYMERALSA  297

Query  301  AAARKQVDPLQLNQQEFFATYNALNAPYNNLPKEWQQSLKRSARLLLQNYINSPVKHANI  360
            AA RK  DPLQ+NQQEFFATYNALNAPYN+LPKEWQQSLKRSARLLLQ+YINSPV+HANI
Sbjct  298  AAVRKTADPLQINQQEFFATYNALNAPYNHLPKEWQQSLKRSARLLLQHYINSPVRHANI  357

Query  361  FLTLFREISANSKQNNEIEGCISCLLSSGRDDCLRVWRMNYKKQQLPSLLLLKAIDDNWT  420
            FLTLFREISA SKQ NEIEGCISCLLSSGRDDCLRVWRMNYKKQQLPSLLLLKAI+DNWT
Sbjct  358  FLTLFREISAGSKQTNEIEGCISCLLSSGRDDCLRVWRMNYKKQQLPSLLLLKAINDNWT  417

Query  421  TSTHELATSPVYHSFLQDVENLNVELQASKRKESSLEGLKEVLLSVQEKSSAQQKKNKQN  480
            TSTHELATS VYHSFLQDV NLN ELQ SKR E  L+ LKEVLLSVQEKSSAQQKKNKQ 
Sbjct  418  TSTHELATSTVYHSFLQDVANLNEELQGSKRNEGHLDDLKEVLLSVQEKSSAQQKKNKQK  477

Query  481  AAAQKKKCGCCKWTLGSVFIIALIAGALYTDTEINGKGVFEKSATGKVLKNAGVLPHVQK  540
            AAA+KKKCGCCKWTLGS+FIIALIAGALY DTE+NGKGVFEKSATGKVLKNAGVLPHVQK
Sbjct  478  AAAEKKKCGCCKWTLGSIFIIALIAGALYYDTEVNGKGVFEKSATGKVLKNAGVLPHVQK  537

Query  541  SWYTVMGAGARGYKWAEVNVPPYAEPAIKTTGDLWKLARNAACNVYQNGKGYFGAKWPVV  600
            SWYTVMGAGARGYKWAEVNVPPYAEP IKTT DLWKLARNAACN YQNGKGYFGAKWPVV
Sbjct  538  SWYTVMGAGARGYKWAEVNVPPYAEPVIKTTCDLWKLARNAACNAYQNGKGYFGAKWPVV  597

Query  601  AKFIDQYVPNLSGKIEAFAAGVSDFAVSSYDKSAALIKEKVLVGRLSPENINQALNQTRN  660
            AKFIDQYVPN SGKIEAFAAGVSD A SSY+K+AALIKEKVLVGRLSPENINQALNQTRN
Sbjct  598  AKFIDQYVPNSSGKIEAFAAGVSDLAASSYEKAAALIKEKVLVGRLSPENINQALNQTRN  657

Query  661  AALEYYNQFHKKVDAYAKLK  680
            AALEYYNQFHKKVDAYAKLK
Sbjct  658  AALEYYNQFHKKVDAYAKLK  677


>Q9VKM8_DROME unnamed protein product
Length=237

 Score = 392 bits (1007),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 208/216 (96%), Gaps = 0/216 (0%)

Query  465  SVQEKSSAQQKKNKQNAAAQKKKCGCCKWTLGSVFIIALIAGALYTDTEINGKGVFEKSA  524
            SVQEKSSAQQKKNKQ AAA+KKKCGCCKWTLGS+FIIALIAGALY DTE+NGKGVFEKSA
Sbjct  22   SVQEKSSAQQKKNKQKAAAEKKKCGCCKWTLGSIFIIALIAGALYYDTEVNGKGVFEKSA  81

Query  525  TGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPYAEPAIKTTGDLWKLARNAACN  584
            TGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPYAEP IKTT DLWKLARNAACN
Sbjct  82   TGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPYAEPVIKTTCDLWKLARNAACN  141

Query  585  VYQNGKGYFGAKWPVVAKFIDQYVPNLSGKIEAFAAGVSDFAVSSYDKSAALIKEKVLVG  644
             YQNGKGYFGAKWPVVAKFIDQYVPN SGKIEAFAAGVSD A SSY+K+AALIKEKVLVG
Sbjct  142  AYQNGKGYFGAKWPVVAKFIDQYVPNSSGKIEAFAAGVSDLAASSYEKAAALIKEKVLVG  201

Query  645  RLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK  680
            RLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK
Sbjct  202  RLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK  237


>SEH1_DROME unnamed protein product
Length=354

 Score = 36.2 bits (82),  Expect = 0.087, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 17/20 (85%), Gaps = 0/20 (0%)

Query  385  LLSSGRDDCLRVWRMNYKKQ  404
            L+S+G D C+R+WRMNY +Q
Sbjct  287  LISTGDDGCVRLWRMNYNRQ  306



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110357.1 uncharacterized protein LOC108134525 isoform X2
[Drosophila elegans]

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKM8_DROME  unnamed protein product                                 424     1e-152
Q9VKM7_DROME  unnamed protein product                                 392     4e-134
Q9W3N9_DROME  unnamed protein product                                 30.4    1.1   


>Q9VKM8_DROME unnamed protein product
Length=237

 Score = 424 bits (1089),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/237 (94%), Positives = 227/237 (96%), Gaps = 0/237 (0%)

Query  1    MAQVKPKSNKQGGKPAPAAKKSVQEKSSAQQKKNKQNAAAQKKKCGCCKWTLGSVFIIAL  60
            MAQVKPKSNKQ GKP PAAKKSVQEKSSAQQKKNKQ AAA+KKKCGCCKWTLGS+FIIAL
Sbjct  1    MAQVKPKSNKQSGKPVPAAKKSVQEKSSAQQKKNKQKAAAEKKKCGCCKWTLGSIFIIAL  60

Query  61   IAGALYTDTEINGKGVFEKSATGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPY  120
            IAGALY DTE+NGKGVFEKSATGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPY
Sbjct  61   IAGALYYDTEVNGKGVFEKSATGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPY  120

Query  121  AEPAIKTTGDLWKLARNAACNVYQNGKGYFGAKWPVVAKFIDQYVPNLSGKIEAFAAGVS  180
            AEP IKTT DLWKLARNAACN YQNGKGYFGAKWPVVAKFIDQYVPN SGKIEAFAAGVS
Sbjct  121  AEPVIKTTCDLWKLARNAACNAYQNGKGYFGAKWPVVAKFIDQYVPNSSGKIEAFAAGVS  180

Query  181  DFAVSSYDKSAALIKEKVLVGRLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK  237
            D A SSY+K+AALIKEKVLVGRLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK
Sbjct  181  DLAASSYEKAAALIKEKVLVGRLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK  237


>Q9VKM7_DROME unnamed protein product
Length=677

 Score = 392 bits (1008),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 203/216 (94%), Positives = 208/216 (96%), Gaps = 0/216 (0%)

Query  22   SVQEKSSAQQKKNKQNAAAQKKKCGCCKWTLGSVFIIALIAGALYTDTEINGKGVFEKSA  81
            SVQEKSSAQQKKNKQ AAA+KKKCGCCKWTLGS+FIIALIAGALY DTE+NGKGVFEKSA
Sbjct  462  SVQEKSSAQQKKNKQKAAAEKKKCGCCKWTLGSIFIIALIAGALYYDTEVNGKGVFEKSA  521

Query  82   TGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPYAEPAIKTTGDLWKLARNAACN  141
            TGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPYAEP IKTT DLWKLARNAACN
Sbjct  522  TGKVLKNAGVLPHVQKSWYTVMGAGARGYKWAEVNVPPYAEPVIKTTCDLWKLARNAACN  581

Query  142  VYQNGKGYFGAKWPVVAKFIDQYVPNLSGKIEAFAAGVSDFAVSSYDKSAALIKEKVLVG  201
             YQNGKGYFGAKWPVVAKFIDQYVPN SGKIEAFAAGVSD A SSY+K+AALIKEKVLVG
Sbjct  582  AYQNGKGYFGAKWPVVAKFIDQYVPNSSGKIEAFAAGVSDLAASSYEKAAALIKEKVLVG  641

Query  202  RLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK  237
            RLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK
Sbjct  642  RLSPENINQALNQTRNAALEYYNQFHKKVDAYAKLK  677


>Q9W3N9_DROME unnamed protein product
Length=410

 Score = 30.4 bits (67),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 28/62 (45%), Gaps = 1/62 (2%)

Query  150  FGAKWPVVAKF-IDQYVPNLSGKIEAFAAGVSDFAVSSYDKSAALIKEKVLVGRLSPENI  208
            F   W V  KF +     N + K+E       DFA+ SY +SAA    KV    ++P  I
Sbjct  164  FDGLWDVYNKFHMGNCAENTAKKLEITRQQQDDFAIESYKRSAAAWANKVFQDEIAPVKI  223

Query  209  NQ  210
             Q
Sbjct  224  QQ  225



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110358.1 SET domain-containing protein SmydA-8 isoform X1
[Drosophila elegans]

Length=507
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZ41_DROME  unnamed protein product                                 259     3e-80
M9PHK0_DROME  unnamed protein product                                 213     2e-64
Q7K561_DROME  unnamed protein product                                 177     2e-49


>Q9VZ41_DROME unnamed protein product
Length=532

 Score = 259 bits (663),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 157/489 (32%), Positives = 253/489 (52%), Gaps = 16/489 (3%)

Query  14   IQWSPVCGRYLVAKGATLGHDLLIEELPFAVGPKCNGPVVCLGCYE-LDPDPEEELCGEC  72
            ++ S + GRYLVA       + LI E P A+GP  +G  VCLGCY  +    ++  C  C
Sbjct  51   VEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQYRCPGC  110

Query  73   GWPLC-AECSPNEDNH-HFQLECRLLRDARA---RFFPLPRGSSHCPQL-DCIMPLRVLL  126
             WPLC + C+  +  H H + EC+L  + RA          G +    L + +M +R+LL
Sbjct  111  AWPLCGSTCAGLKHRHGHTETECQLYAERRAVAGELLTERAGPAEVRDLYELVMIVRILL  170

Query  127  AKEANPGRWDSEVAPMEHHEEERKKDSDVWHADRVNIAQYLRGPCKLASRFSEELIMQVV  186
             ++ +P ++ + +A ME H EER++++ +W      + Q LR   +L      E + +V 
Sbjct  171  LRQHDPEQF-ALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLED-LEAEQVHEVC  228

Query  187  GVLEVNAFEARSPKGYPLRCLFPYTGILAHSCVPNTCRSIYPSEGYKIRLRAMVDLEEGQ  246
            G+L+VN FE     G   R L+P   +LAH C PNT  +  PS  ++I LR    + E +
Sbjct  229  GILDVNCFEI-GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPS-SFEILLRTSRRVRERE  286

Query  247  PLHHSYTYTLDGTAQRQRHLKQGKFFDCKCDRCLDPTELGTHFSSLKCGQCAEGNQVPRQ  306
             L  SY YTL GT +R+  + +GK F C C RC DP ELGT  S+L C  C  G+     
Sbjct  287  ALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGSVRAVD  346

Query  307  PTDPDSSWNCGSCGSVTSSSEGQTMLQSLQTEVNAVQALAMGAKRLEEVERLLRKYKSLI  366
            P      W C  C     ++E +  L  +  ++  +    +       +E  L +Y+ ++
Sbjct  347  PLQQTGDWACDRCAHKMGATEVERQLDRINNDLEDIDVHDIPG-----LENFLLRYRDVL  401

Query  367  HPMHFIATGLRQLLIEMYGRVPGYEMVQLPDHQLERKAELCRQVLRVLNTFEPGLSRTRA  426
             P H++    +  L ++YGR  GY + Q+    + RK   CR+ L +++  +PGL+R R 
Sbjct  402  RPNHYLLLSAKYSLCQIYGRTEGYLLPQMSPEDIARKESYCREFLEIVDVLDPGLTRLRG  461

Query  427  MNLYELHVPLVLLAKSGFIAGRLKGGELRGRLVDAIDLLKECVEILEFEDKSSQEGVLCV  486
            + +YELH P+++LA+S F +G++   E + RL + + LL+   +IL  E + S E  +  
Sbjct  462  LIMYELHAPVMVLAQSAFQSGQISRQEFQRRLKEVVKLLQVSRDILLMEPEGSTENAMGQ  521

Query  487  VAKQALEQL  495
             A  AL ++
Sbjct  522  AAADALSKM  530


>M9PHK0_DROME unnamed protein product
Length=369

 Score = 213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/376 (32%), Positives = 198/376 (53%), Gaps = 9/376 (2%)

Query  120  MPLRVLLAKEANPGRWDSEVAPMEHHEEERKKDSDVWHADRVNIAQYLRGPCKLASRFSE  179
            M +R+LL ++ +P ++ + +A ME H EER++++ +W      + Q LR   +L      
Sbjct  1    MIVRILLLRQHDPEQF-ALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLED-LEA  58

Query  180  ELIMQVVGVLEVNAFEARSPKGYPLRCLFPYTGILAHSCVPNTCRSIYPSEGYKIRLRAM  239
            E + +V G+L+VN FE     G   R L+P   +LAH C PNT  +  PS  ++I LR  
Sbjct  59   EQVHEVCGILDVNCFEI-GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPS-SFEILLRTS  116

Query  240  VDLEEGQPLHHSYTYTLDGTAQRQRHLKQGKFFDCKCDRCLDPTELGTHFSSLKCGQCAE  299
              + E + L  SY YTL GT +R+  + +GK F C C RC DP ELGT  S+L C  C  
Sbjct  117  RRVREREALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRT  176

Query  300  GNQVPRQPTDPDSSWNCGSCGSVTSSSEGQTMLQSLQTEVNAVQALAMGAKRLEEVERLL  359
            G+     P      W C  C     ++E +  L  +  ++  +    +       +E  L
Sbjct  177  GSVRAVDPLQQTGDWACDRCAHKMGATEVERQLDRINNDLEDIDVHDIPG-----LENFL  231

Query  360  RKYKSLIHPMHFIATGLRQLLIEMYGRVPGYEMVQLPDHQLERKAELCRQVLRVLNTFEP  419
             +Y+ ++ P H++    +  L ++YGR  GY + Q+    + RK   CR+ L +++  +P
Sbjct  232  LRYRDVLRPNHYLLLSAKYSLCQIYGRTEGYLLPQMSPEDIARKESYCREFLEIVDVLDP  291

Query  420  GLSRTRAMNLYELHVPLVLLAKSGFIAGRLKGGELRGRLVDAIDLLKECVEILEFEDKSS  479
            GL+R R + +YELH P+++LA+S F +G++   E + RL + + LL+   +IL  E + S
Sbjct  292  GLTRLRGLIMYELHAPVMVLAQSAFQSGQISRQEFQRRLKEVVKLLQVSRDILLMEPEGS  351

Query  480  QEGVLCVVAKQALEQL  495
             E  +   A  AL ++
Sbjct  352  TENAMGQAAADALSKM  367


>Q7K561_DROME unnamed protein product
Length=513

 Score = 177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 136/472 (29%), Positives = 227/472 (48%), Gaps = 24/472 (5%)

Query  21   GRYLVAKGATLGHDLLIEELPFAVGPKCNGPVVCLGCYELDPDPEEELCGECGWPLCAEC  80
            GR+LVA      ++++++E P   GP      VCLGC       +   C +CGWPLC   
Sbjct  52   GRHLVATRTIKPYEIVLKEAPLVRGPAQISAPVCLGCLNGIEAEDHIECEQCGWPLCGPE  111

Query  81   SPNEDNHHFQLECRLLRDARARFFPLPRGSSHCPQLDCIMPLRVLLAKEANPGRWDSEVA  140
              + D H  + EC L +D   +      G  H P   C+  +R LL  E +  +  S+  
Sbjct  112  CKSLDEH--KAECGLTKDRGQKVNVQEFGGPH-PLYTCLSTVRCLLIGETSTEK-ASKFQ  167

Query  141  PMEHHEEERKKDSDVWHADRVNIAQYLRGPCKLASRFSEELIMQVVGVLEVNAFEARSPK  200
             +E  E  R+  S+ W AD V+I Q++    K   +F+EE IM+ VG L++N  E   P 
Sbjct  168  DLESLESTRR-GSNQWKADLVSIGQFIPKFFK-TQKFTEEEIMKAVGALQINGHEV--PT  223

Query  201  GYPLRCLFPYTGILA-HSCVPNTCRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTLDGT  259
              P      YT     +SC+PN  +S +   G+ I L A  ++++   L   Y+  + GT
Sbjct  224  TDPSHVAVFYTASFTENSCLPNLAKS-FNKNGHCI-LWAPREIKKNAHLSICYSDAMWGT  281

Query  260  AQRQRHLKQGKFFDCKCDRCLDPTELGTHFSSLKCG--QCAEGNQVPRQPTDPDSSWNCG  317
            A RQRHL Q K F C C+RC+D TEL T++S++KC   QC  G  +P +  + + SW C 
Sbjct  282  ADRQRHLMQTKLFKCACERCVDVTELDTNYSAIKCEDRQCG-GLMLPTKADEWNGSWRCR  340

Query  318  SCGSVTSSSEGQTMLQSLQTEVNAVQALAMGAKRLEEVERLLRKYKSLIHPMHFIATGLR  377
             C         + +L+    ++ +++ +A      E   + L+ Y+  + P HF  + ++
Sbjct  341  ECHKQVQKHYVERILERAGKDIQSMEKIA------ENGLKYLKHYEKWLPPQHFHMSEIK  394

Query  378  QLLIEMYGRVPGYEMVQLPDHQLERKAELCRQVLRVLNTFEPGLSRTRAMNLYELHVPLV  437
             LL+++  +    E++ +PD +L  K    R+++ +     P   RT     +ELH  + 
Sbjct  395  ILLVQLLAK-DQKELMVIPDDRLLLKLNFARELVELYEKLTPCEVRTLGTLCFELHSAIA  453

Query  438  LLAKSGFIAGRLKGGELRGRLVDAIDLLKECVEILEFEDKSSQEGVLCVVAK  489
               +   +   L     + RL +++  + +CV  L++E     EG +   AK
Sbjct  454  EQTRRVALETSLSP---KDRLEESLFYVDKCVNYLKYESDIFIEGHVLKQAK  502



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110359.1 SET domain-containing protein SmydA-8 isoform X2
[Drosophila elegans]

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VZ41_DROME  unnamed protein product                                 259     5e-80
M9PHK0_DROME  unnamed protein product                                 212     5e-64
Q7K561_DROME  unnamed protein product                                 182     3e-51


>Q9VZ41_DROME unnamed protein product
Length=532

 Score = 259 bits (661),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 252/499 (51%), Gaps = 24/499 (5%)

Query  2    LKARLEEDGVLGRCLATASSVERGELVLEELPFARGPKRDSGIVCLGCYQFLQFGEDGES  61
            L  R+E   + GR L     +E GE ++ E P A GP      VCLGCY  +    D   
Sbjct  47   LPYRVEHSDIYGRYLVANRQLEAGETLIREEPLAIGPCVSGDPVCLGCYHPVSLKADQY-  105

Query  62   LDRCELCDWPLCGS-CADEGDATDHG---GECQVFSAARVTFAGNVSDDGVCPQ-----L  112
              RC  C WPLCGS CA  G    HG    ECQ++ A R   AG +  +   P       
Sbjct  106  --RCPGCAWPLCGSTCA--GLKHRHGHTETECQLY-AERRAVAGELLTERAGPAEVRDLY  160

Query  113  DCITPLRVLLAKEANPGRWDSEVAPMEHHEEERKKDSDVWHADRVNIAQYLRGPCKLASR  172
            + +  +R+LL ++ +P ++ + +A ME H EER++++ +W      + Q LR   +L   
Sbjct  161  ELVMIVRILLLRQHDPEQF-ALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLED-  218

Query  173  FSEELIMQVVGVLEVNAFEARSPKGYPLRCLFPYTGILAHSCVPNTCRSIYPSEGYKIRL  232
               E + +V G+L+VN FE     G   R L+P   +LAH C PNT  +  PS  ++I L
Sbjct  219  LEAEQVHEVCGILDVNCFEI-GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPS-SFEILL  276

Query  233  RAMVDLEEGQPLHHSYTYTLDGTAQRQRHLKQGKFFDCKCDRCLDPTELGTHFSSLKCGQ  292
            R    + E + L  SY YTL GT +R+  + +GK F C C RC DP ELGT  S+L C  
Sbjct  277  RTSRRVREREALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCAT  336

Query  293  CAEGNQVPRQPTDPDSSWNCGSCGSVTSSSEGQTMLQSLQTEVNAVQALAMGAKRLEEVE  352
            C  G+     P      W C  C     ++E +  L  +  ++  +    +       +E
Sbjct  337  CRTGSVRAVDPLQQTGDWACDRCAHKMGATEVERQLDRINNDLEDIDVHDIPG-----LE  391

Query  353  RLLRKYKSLIHPMHFIATGLRQLLIEMYGRVPGYEMVQLPDHQLERKAELCRQVLRVLNT  412
              L +Y+ ++ P H++    +  L ++YGR  GY + Q+    + RK   CR+ L +++ 
Sbjct  392  NFLLRYRDVLRPNHYLLLSAKYSLCQIYGRTEGYLLPQMSPEDIARKESYCREFLEIVDV  451

Query  413  FEPGLSRTRAMNLYELHVPLVLLAKSGFIAGRLKGGELRGRLVDAIDLLKECVEILEFED  472
             +PGL+R R + +YELH P+++LA+S F +G++   E + RL + + LL+   +IL  E 
Sbjct  452  LDPGLTRLRGLIMYELHAPVMVLAQSAFQSGQISRQEFQRRLKEVVKLLQVSRDILLMEP  511

Query  473  KSSQEGVLCVVAKQALEQL  491
            + S E  +   A  AL ++
Sbjct  512  EGSTENAMGQAAADALSKM  530


>M9PHK0_DROME unnamed protein product
Length=369

 Score = 212 bits (540),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 119/374 (32%), Positives = 197/374 (53%), Gaps = 9/374 (2%)

Query  118  LRVLLAKEANPGRWDSEVAPMEHHEEERKKDSDVWHADRVNIAQYLRGPCKLASRFSEEL  177
            +R+LL ++ +P ++ + +A ME H EER++++ +W      + Q LR   +L      E 
Sbjct  3    VRILLLRQHDPEQF-ALIARMESHTEERRQNAVLWRHYEEKVVQRLRVTWQLED-LEAEQ  60

Query  178  IMQVVGVLEVNAFEARSPKGYPLRCLFPYTGILAHSCVPNTCRSIYPSEGYKIRLRAMVD  237
            + +V G+L+VN FE     G   R L+P   +LAH C PNT  +  PS  ++I LR    
Sbjct  61   VHEVCGILDVNCFEI-GQNGAKARTLYPSAFLLAHDCTPNTAHTDDPS-SFEILLRTSRR  118

Query  238  LEEGQPLHHSYTYTLDGTAQRQRHLKQGKFFDCKCDRCLDPTELGTHFSSLKCGQCAEGN  297
            + E + L  SY YTL GT +R+  + +GK F C C RC DP ELGT  S+L C  C  G+
Sbjct  119  VREREALTLSYAYTLQGTLKRRAFMHEGKLFWCCCRRCSDPRELGTDCSALVCATCRTGS  178

Query  298  QVPRQPTDPDSSWNCGSCGSVTSSSEGQTMLQSLQTEVNAVQALAMGAKRLEEVERLLRK  357
                 P      W C  C     ++E +  L  +  ++  +    +       +E  L +
Sbjct  179  VRAVDPLQQTGDWACDRCAHKMGATEVERQLDRINNDLEDIDVHDIPG-----LENFLLR  233

Query  358  YKSLIHPMHFIATGLRQLLIEMYGRVPGYEMVQLPDHQLERKAELCRQVLRVLNTFEPGL  417
            Y+ ++ P H++    +  L ++YGR  GY + Q+    + RK   CR+ L +++  +PGL
Sbjct  234  YRDVLRPNHYLLLSAKYSLCQIYGRTEGYLLPQMSPEDIARKESYCREFLEIVDVLDPGL  293

Query  418  SRTRAMNLYELHVPLVLLAKSGFIAGRLKGGELRGRLVDAIDLLKECVEILEFEDKSSQE  477
            +R R + +YELH P+++LA+S F +G++   E + RL + + LL+   +IL  E + S E
Sbjct  294  TRLRGLIMYELHAPVMVLAQSAFQSGQISRQEFQRRLKEVVKLLQVSRDILLMEPEGSTE  353

Query  478  GVLCVVAKQALEQL  491
              +   A  AL ++
Sbjct  354  NAMGQAAADALSKM  367


>Q7K561_DROME unnamed protein product
Length=513

 Score = 182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 141/484 (29%), Positives = 233/484 (48%), Gaps = 28/484 (6%)

Query  5    RLEEDGVLGRCLATASSVERGELVLEELPFARGPKRDSGIVCLGCYQFLQFGEDGESLDR  64
            ++  +  LGR L    +++  E+VL+E P  RGP + S  VCLGC      G + E    
Sbjct  44   KIAHNEQLGRHLVATRTIKPYEIVLKEAPLVRGPAQISAPVCLGCLN----GIEAEDHIE  99

Query  65   CELCDWPLCGSCADEGDATDHGGECQVFSAARVTFAGNVSDDGVCPQLDCITPLRVLLAK  124
            CE C WPLCG      D  +H  EC + +  R          G  P   C++ +R LL  
Sbjct  100  CEQCGWPLCGPECKSLD--EHKAECGL-TKDRGQKVNVQEFGGPHPLYTCLSTVRCLLIG  156

Query  125  EANPGRWDSEVAPMEHHEEERKKDSDVWHADRVNIAQYLRGPCKLASRFSEELIMQVVGV  184
            E +  +  S+   +E  E  R+  S+ W AD V+I Q++    K   +F+EE IM+ VG 
Sbjct  157  ETSTEK-ASKFQDLESLESTRR-GSNQWKADLVSIGQFIPKFFK-TQKFTEEEIMKAVGA  213

Query  185  LEVNAFEARSPKGYPLRCLFPYTGILA-HSCVPNTCRSIYPSEGYKIRLRAMVDLEEGQP  243
            L++N  E   P   P      YT     +SC+PN  +S +   G+ I L A  ++++   
Sbjct  214  LQINGHEV--PTTDPSHVAVFYTASFTENSCLPNLAKS-FNKNGHCI-LWAPREIKKNAH  269

Query  244  LHHSYTYTLDGTAQRQRHLKQGKFFDCKCDRCLDPTELGTHFSSLKCG--QCAEGNQVPR  301
            L   Y+  + GTA RQRHL Q K F C C+RC+D TEL T++S++KC   QC  G  +P 
Sbjct  270  LSICYSDAMWGTADRQRHLMQTKLFKCACERCVDVTELDTNYSAIKCEDRQCG-GLMLPT  328

Query  302  QPTDPDSSWNCGSCGSVTSSSEGQTMLQSLQTEVNAVQALAMGAKRLEEVERLLRKYKSL  361
            +  + + SW C  C         + +L+    ++ +++ +A      E   + L+ Y+  
Sbjct  329  KADEWNGSWRCRECHKQVQKHYVERILERAGKDIQSMEKIA------ENGLKYLKHYEKW  382

Query  362  IHPMHFIATGLRQLLIEMYGRVPGYEMVQLPDHQLERKAELCRQVLRVLNTFEPGLSRTR  421
            + P HF  + ++ LL+++  +    E++ +PD +L  K    R+++ +     P   RT 
Sbjct  383  LPPQHFHMSEIKILLVQLLAK-DQKELMVIPDDRLLLKLNFARELVELYEKLTPCEVRTL  441

Query  422  AMNLYELHVPLVLLAKSGFIAGRLKGGELRGRLVDAIDLLKECVEILEFEDKSSQEGVLC  481
                +ELH  +    +   +   L     + RL +++  + +CV  L++E     EG + 
Sbjct  442  GTLCFELHSAIAEQTRRVALETSLSP---KDRLEESLFYVDKCVNYLKYESDIFIEGHVL  498

Query  482  VVAK  485
              AK
Sbjct  499  KQAK  502



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110360.1 palmitoyltransferase ZDHHC3 [Drosophila elegans]

Length=276
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKN8_DROME  unnamed protein product                                 563     0.0   
Q9XTL3_DROME  unnamed protein product                                 391     2e-138
Q7K3T4_DROME  unnamed protein product                                 164     4e-49 


>Q9VKN8_DROME unnamed protein product
Length=276

 Score = 563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/276 (97%), Positives = 273/276 (99%), Gaps = 0/276 (0%)

Query  1    MVFIRDPCGVACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLGMSH  60
            MVFIRDPCG+ACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLL MSH
Sbjct  1    MVFIRDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSH  60

Query  61   SKAVFSDPGTVPLPVNRLDFSDLHTTSKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRI  120
            SKAVFSDPGTVPLP NRLDFSDLHTT+KNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRI
Sbjct  61   SKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRI  120

Query  121  CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECNQNV  180
            CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEEC+QNV
Sbjct  121  CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNV  180

Query  181  IETQLRMIHSVILLLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQL  240
            IETQLRMIHSVIL+LVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQL
Sbjct  181  IETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQL  240

Query  241  LADVFGRGHPGLWLLPCTSLNHSSRYHDTPLLSHEV  276
            LADVFGRGHP LWLLPCTSLNH+SRYHDTPLLSHEV
Sbjct  241  LADVFGRGHPALWLLPCTSLNHASRYHDTPLLSHEV  276


>Q9XTL3_DROME unnamed protein product
Length=277

 Score = 391 bits (1004),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 185/190 (97%), Positives = 188/190 (99%), Gaps = 0/190 (0%)

Query  1    MVFIRDPCGVACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLGMSH  60
            MVFIRDPCG+ACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLL MSH
Sbjct  1    MVFIRDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSH  60

Query  61   SKAVFSDPGTVPLPVNRLDFSDLHTTSKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRI  120
            SKAVFSDPGTVPLP NRLDFSDLHTT+KNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRI
Sbjct  61   SKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRI  120

Query  121  CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECNQNV  180
            CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEEC+QNV
Sbjct  121  CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNV  180

Query  181  IETQLRMIHS  190
            IETQLRMIHS
Sbjct  181  IETQLRMIHS  190


>Q7K3T4_DROME unnamed protein product
Length=293

 Score = 164 bits (415),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 151/271 (56%), Gaps = 21/271 (8%)

Query  4    IRDPCGVACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLGMSHSKA  63
            ++D CG+ C+++T+  +L+A++VV+R I+L +   +++ + ++++F  + FL   SH + 
Sbjct  33   VKDICGIVCVIMTWLLILFAEFVVMRLILLPS-NYTVFSTINMIIFQALAFLAFASHIRT  91

Query  64   VFSDPGTVPLPVNRLDFSDLHTTSKNNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKR  123
            + SDPG VP           + T +     G      +  C +C + +P RAHHC +C+R
Sbjct  92   MLSDPGAVPRG---------NATKEMIEQMGYREGQMFYKCPKCCSIKPERAHHCSVCQR  142

Query  124  CIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECNQNVIET  183
            CIR+MDHHCPW+NNCVGE NQKYF+ F  Y+A +S++++ L++  +     EC +N   T
Sbjct  143  CIRKMDHHCPWVNNCVGENNQKYFVLFTFYIASISVHTLFLVLTQFA----ECVKNDWRT  198

Query  184  ------QLRMIHSVILLLVSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRK  237
                     +   + L     +FG+F   ++  QL AIL D+T +E ++++      + +
Sbjct  199  CSPYSPPATIFLLLFLTFEGLMFGIFTIIMLATQLTAILNDQTGIEQLKKEEARWAKKSR  258

Query  238  YQLLADVFGRGHPGLWLLPCTSLNHSSRYHD  268
             + +  VFGR     W  P T  +  +R++ 
Sbjct  259  LKSIQSVFGRFSLA-WFSPFTEPSCRTRFNS  288



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110361.1 signal transducing adapter molecule 1 [Drosophila
elegans]

Length=691
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XTL2_DROME  unnamed protein product                                 1048    0.0  
STAM1_CAEEL  unnamed protein product                                  208     1e-59
Q17796_CAEEL  unnamed protein product                                 82.0    6e-16


>Q9XTL2_DROME unnamed protein product
Length=689

 Score = 1048 bits (2710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/709 (87%), Positives = 631/709 (89%), Gaps = 38/709 (5%)

Query  1    MGIFGQSSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRQAKDCLKAVMRRMGHTDP  60
            MGIFGQSSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPR AKDCLKAVMRRMGHTDP
Sbjct  1    MGIFGQSSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRLAKDCLKAVMRRMGHTDP  60

Query  61   HVVMQAITLLDALSNNCGKPLHLEVASRDFETEFRRLLAKAQPKVSLKMRQVLKNWADND  120
            HVVMQAITLLDALSNNCGKPLHLEVASRDFETEFRRLLAKAQPKVSLKMRQVLKNWA+ND
Sbjct  61   HVVMQAITLLDALSNNCGKPLHLEVASRDFETEFRRLLAKAQPKVSLKMRQVLKNWAEND  120

Query  121  YKNDRELDLIPALYAQLRQEGYDFKNLGDKATKTVAEKAAALPKDPNVVSSQQEEDDIAK  180
            YKNDRELDLIPALYA+LRQEGYDFKNLGDK +KTVAEKAAALPKDPNVVSSQQEEDDIAK
Sbjct  121  YKNDRELDLIPALYAKLRQEGYDFKNLGDKTSKTVAEKAAALPKDPNVVSSQQEEDDIAK  180

Query  181  AIELSLKENKGSSPKTGSGASAGTASAYPSLYPSFGGATTSSAISSEANATSAPEPRKVR  240
            AIELSLKENKG SPKTGS AS GTASAYPSLYPSF G T SSA S+EA++  APEPRKVR
Sbjct  181  AIELSLKENKG-SPKTGSVASTGTASAYPSLYPSFAG-TGSSAPSAEASSAPAPEPRKVR  238

Query  241  ALYDFEAAEENELTFFSGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLD  300
            ALYDFEAAEENELTFF+GEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLD
Sbjct  239  ALYDFEAAEENELTFFAGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLD  298

Query  301  INQQHKTAAAAAAGQRELDSAAALQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPE  360
            INQQHK+  AAAAGQRELDSAAALQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPE
Sbjct  299  INQQHKS--AAAAGQRELDSAAALQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPE  356

Query  361  DPSQDSDEMLQLEQEVHQMGPLIDAELERVDRKHAQLTQLSSDLVDAINLYHTLMRDDRV  420
            DPSQDSDEMLQLEQEVHQMGPLIDAELERVDRKHAQLTQLSSDLVDAINLYHTLMRDDR 
Sbjct  357  DPSQDSDEMLQLEQEVHQMGPLIDAELERVDRKHAQLTQLSSDLVDAINLYHTLMRDDRA  416

Query  421  AAGQFAAAAGGFMPGLAGFPGAALYGSPGYPAAGGFPPAQNYPHGMHSLPYGPGPVSNPP  480
            AAG FAAAAGGFMPGLAGFPGAALYG+PGYPAAGGFPPAQNYP GMHS+PYGP P  NPP
Sbjct  417  AAGHFAAAAGGFMPGLAGFPGAALYGAPGYPAAGGFPPAQNYP-GMHSMPYGPVP--NPP  473

Query  481  TGAPSQAPG--GGYLGQPQGPVPLPYQNGHAAQMNSLPPHLTQPAVAAPVPQPIY-----  533
            T APSQAPG  GGYLGQPQG VPLPYQNGHAAQMNSLP HLTQP   AP+PQPIY     
Sbjct  474  TSAPSQAPGAPGGYLGQPQGQVPLPYQNGHAAQMNSLPAHLTQPTGTAPMPQPIYTQPTP  533

Query  534  ----------TAQPIPVTNQHPQQPPQHPQNNYHIDQQSQYAQVPPAVPQIQQPQPQQQQ  583
                         P     Q  QQPPQHPQN+YHID QSQYAQVPPAV QIQ    Q QQ
Sbjct  534  VTTQQQQQPLPQHPQQPPQQQGQQPPQHPQNSYHIDPQSQYAQVPPAVTQIQ----QPQQ  589

Query  584  PSAPHAYMSPQHQQPPPPQGYQPGPNLYAPNGSPA-VNPQSFMSPQQHQQQQTQHQQQQQ  642
            P APHAYMSPQHQQ PPPQGYQPGPNLY PNGSPA VNPQS+MSPQQ QQQ         
Sbjct  590  PPAPHAYMSPQHQQAPPPQGYQPGPNLYGPNGSPAVVNPQSYMSPQQQQQQHPPPH----  645

Query  643  QLPHLDQFSQLHQQMAAMSMAGGPPVGAPGYHMQNDAVKNNIPIYQQQR  691
                 DQFSQLHQQMAAMSMAGGPPVGAPGYHMQNDAVKNNIPIYQQQR
Sbjct  646  -----DQFSQLHQQMAAMSMAGGPPVGAPGYHMQNDAVKNNIPIYQQQR  689


>STAM1_CAEEL unnamed protein product
Length=457

 Score = 208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 148/418 (35%), Positives = 217/418 (52%), Gaps = 51/418 (12%)

Query  8    SPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRQAKDCLKAVMRRMGHTDPHVVMQAI  67
            S ++  + K T+ T T +NW  IL  CD +  +   +K  +K++ +R+ + DPHVV+ AI
Sbjct  10   SAYEDLLGKITAPTITVENWEGILAFCDMINNDFEGSKTGIKSLRKRLNNRDPHVVLLAI  69

Query  68   TLLDALSNNCGKPLHLEVASRDFETEFRRLLAKAQPKVSLKMRQVLKNWADNDYKNDREL  127
            ++LD+   NC +    EV+S  F  E + L   +Q +V+ KMR  ++ W D + K ++ L
Sbjct  70   SVLDSCWANCEERFRKEVSSAQFINELKALCTSSQRQVAEKMRLTVQKWVDTECKTEQSL  129

Query  128  DLIPALYAQLRQEGYDFKNLGDKATKTVAEKAAALPKDPNVVSSQQEEDDIAKAIELSLK  187
             LI  L+  L  +GY F  + D  +KT A   A    DPN V S QEE+ IAKAI  SL 
Sbjct  130  SLIVTLHKNLVADGYSFV-VDDPKSKTKAID-AKFANDPNYVGSAQEEEAIAKAIAASLA  187

Query  188  ENKGSSPKTGSGASAGTASAYPSLYPSFGGATTSSAISSEANATSAPEPRKVRALYDFEA  247
            +      +    A   T++ YPS   S     T+S I         PE + VRALYDFEA
Sbjct  188  D-----AEKQEKAKKSTSTMYPSAKASSPAVQTNSNI---------PE-KNVRALYDFEA  232

Query  248  AEENELTFFSGEIIHVLDDSDPNWWKGYNQRGEGLFPSNFVTADLSVDPERLDINQQHKT  307
            AE NEL+F +G+II + D+S+P+WW G     +GLFPS+FVT  L       D+      
Sbjct  233  AESNELSFVAGDIITITDESNPHWWTGRIGTQQGLFPSSFVTNQLD------DLK-----  281

Query  308  AAAAAAGQRELDSAAALQQKTEAAAAAAAAQPVEIDESKIDRLLHLLHEANPEDPSQDSD  367
                    +E DS+   Q+  E  A+        I+E+ + R L +LHE +P    QD +
Sbjct  282  -------SKETDSS---QKAPEVVAS--------INEAILVRCLQVLHECDPTGERQDPE  323

Query  368  EMLQLEQEVHQMGPLIDAELERVDRKHAQLTQLSSDLVDAINLYHTLMRDDRVAAGQF  425
            ++ QLE   +  G LIDA L  +DR+   L Q+   + D + LY     DD +  G F
Sbjct  324  DLAQLEAASYAQGNLIDAHLASIDRQSNSLAQIDVAIRDVLALY-----DDAIQKGGF  376


>Q17796_CAEEL unnamed protein product
Length=729

 Score = 82.0 bits (201),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 79/144 (55%), Gaps = 2/144 (1%)

Query  7    SSPFDADVEKATSETNTNDNWSLILDVCDKVTTNPRQAKDCLKAVMRRMGHTDPHVVMQA  66
            ++ F   +++AT  T    NW  I+   D + +    AK  L+A+ +RM H +PHVV   
Sbjct  2    ATKFQRVLDQATDSTLVEPNWEGIILCTDMIRSGEVPAKPSLQAIRKRMQHENPHVVNHT  61

Query  67   ITLLDALSNNCGKPLHLEVASRDFETEFRRLLAKAQ-PKVSLKMRQVLKNWADNDYKNDR  125
            + +LDA   NCG  +H EVA+R+F  +F+ L+ + +  +V  K  ++L+ WA   + N  
Sbjct  62   LLVLDACVKNCGHKVHAEVATREFMEDFKNLVTENKYDEVKNKSLEMLQCWA-TAFANKP  120

Query  126  ELDLIPALYAQLRQEGYDFKNLGD  149
            E  ++   +  ++  G+DF +L +
Sbjct  121  EYKMVVDTHNLMKLAGFDFPSLKE  144



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


Query= XP_017110362.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.321    0.134    0.380 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3693403802


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110364.1 guanylate cyclase 32E [Drosophila elegans]

Length=1187
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9NFA6_DROME  unnamed protein product                                 781     0.0  
C7LAF5_DROME  unnamed protein product                                 781     0.0  
Q8IQK2_DROME  unnamed protein product                                 776     0.0  


>M9NFA6_DROME unnamed protein product
Length=1235

 Score = 781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/1112 (41%), Positives = 654/1112 (59%), Gaps = 91/1112 (8%)

Query  10    AFSSILVLLGCQWSSGNPLASMRRLSDTINIGFLAEYSQMRVTL-GGLPLAIEDVNKNPN  68
             AFS+     G  ++ G   AS RR  +        +Y++  +T+ G + LA+E+VN    
Sbjct  29    AFSNFRPTHGEVFTLGYLTASQRRPGNL-------DYNRPGLTISGAISLAVEEVNAGRL  81

Query  69    LLPGKKLAFKPVDIGHKMSAYRVKPLRAMTQMRESGVTAFIGPDESCTTEALLASAWNTP  128
                G  L F    +  +     V  +R    +    V A+IGP E+C  E  +A+A+N P
Sbjct  82    RDRGHSLQF----VVAETYGEEVVSIRQTAALWTQQVAAYIGPQETCVHEGRMAAAFNLP  137

Query  129   MLSFKCSDSIVSNKSTFHTFARTLAPASKVSKSVISLLNAFHWNKFSIVVSSKPIWGSDV  188
             M+S+ C+    SNK+ F TFART  P +++SKSV++LL AF+W + S       ++  D 
Sbjct  138   MISYYCTHRDPSNKADFPTFARTRPPDTQISKSVVALLLAFNWTQVSF------LYLDDA  191

Query  189   ARAIQELAEARNFTISHFKYISDYIPTTKTL-------SQIDKIIAETYSTTRIYVFIGE  241
             +   Q +AE    T++        I T  T+       +  + ++ +TY+ TRIY+ +G 
Sbjct  192   SGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHGFMDNPFEALVEQTYANTRIYLILGH  251

Query  242   HIAMVDFVRGLQNRRLLESGDYIVVSVDDEIYDSNRRVNIMERNYLDPYIRK---EKSKS  298
             +   V  +  LQ R +L  GDY VV +D E YD  +          + Y+R    E  + 
Sbjct  252   YYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKP---------EKYLRGLLLEDVEP  302

Query  299   LDKISFRSVVKISMTYPQNPHIRDICSKIKDYARKTPFLVPYHQRVFDNI-SVPIYGLHL  357
             L   +F+S + I  T   +       +++  Y  + PF  P     F  +  +     +L
Sbjct  303   LAVQAFQSYLGIVPT--ASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYL  360

Query  358   YDSVMIYVRAITEVLKLGGDIYDGNLVMSHIFNRSYHSIQGFDVYIDANGDAEGNYTVIT  417
             YD+V +Y +A+ EVL  GG   +G+ +++ I    Y S  G+ VYID NGDA GNYTV+ 
Sbjct  361   YDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLA  420

Query  418   LQNDVGSGTSGGSLAKMSMQPVGFFAYDKNSL------IPEFRYIKSDRPIQWLNGRPPL  471
                  GS  +G +   + ++PVG F +  +SL      +P  +      PI W+ G  P 
Sbjct  421   R----GSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFS---PIDWVGGTRPA  473

Query  472   AEPLCGFHGELCPRKKLDWRYLLTGPLCALVVVVAMALLI-------KHYRYEQTLAGLL  524
             A P CGF GE C           TG + A +   A+ LL        +++RYEQ L  LL
Sbjct  474   AAPRCGFGGEKCVN--------YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLL  525

Query  525   WKVDMKEVTVINLGEYNNPSNKN------IFQICRQSILVVGEPNKRS---FTNIALFRG  575
             WK+D +EV  I+  E    S K       + +  + S+    + + R    FT I L++G
Sbjct  526   WKIDFREVQ-IHENEREQQSQKQTRSTHPLIRTSQVSLSSNPDADFRYTTIFTPIGLYKG  584

Query  576   NIVAMKKIHKKSVDITRSIRKELKLMREVRHENIINFIGASTDHGSVVIFTTYCARGSLE  635
              + A+KK+ KKSVDITR ++KELKL+R+ RH+NI  FIGA TD  ++ I + YC RGSL+
Sbjct  585   QLYAIKKVRKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLK  644

Query  636   DVLANEDLHLDHIFISSLVSDILKGMIYLHDSEIISHGQLRSSNCLIDSRWVCQISDFGL  695
             D+L NED+ LD++FI+S+V+DI++G+IYLHDS I  HG L +SNCL+DSRWV +++DFGL
Sbjct  645   DILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGL  704

Query  696   HELKAGQEEPNKSELELKRALCM-----APELLRDVYRPAR---GSQKGDVYSFGILLYE  747
                K G E+ + ++++   A C+     APELLR    P+    G+Q+GD YSFGILLYE
Sbjct  705   FAFKQGIED-SSTDMQHMSAKCLKLLYRAPELLRQ--GPSSLVMGTQRGDAYSFGILLYE  761

Query  748   TIGRKGPWGDTTYSKEEIIEFVKCPELLQHGVFRPALTHTHLDIPDYIRKCLCQCWDEDP  807
                R+GP+G+T  +  + ++ V  P+   +  +RP+L        D + +CL +CW E P
Sbjct  762   MHVRRGPFGETGLTPMQCLQKVLQPQDYLN-PYRPSLQPLETAF-DCVSECLRECWAERP  819

Query  808   EVRPDIRLVRMHLKELQAGLKPNIFDNMLSIMEKYAYNLEGLVQERTNLLYEEKKKTDML  867
             E RPD + +R  L+ L+ G++PNIFDNM+++MEKYA NLE LV +RT+ L EEKKKTD L
Sbjct  820   EDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDAL  879

Query  868   LYQMLPRPVAELLKRGDPVEAECFDCVTILFSDIVGFTELCTTSTPFEVVEMLNDWYTCC  927
             L++MLPR VA+ LK+G  V+ E ++ V+I FSDIVGFT +    TP +VV+ LND YTC 
Sbjct  880   LHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCF  939

Query  928   DSIISNYDVYKVETIGDAYMVVSGLPLQNGNRHAGEIASLALHLLETVGNLKIRHKPTET  987
             DSII +YDVYKVETIGDAYMVVSGLPL+NG+ HA EIA+++LHLL  V   KIRH+PT  
Sbjct  940   DSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNR  999

Query  988   VQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGESMKIHISEATYQLLQLIG  1047
             + LRIG+HSGP  AGVVG KMPRYCLFGDTVNTASRMES+G  +KIH S    QLL  +G
Sbjct  1000  LLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLG  1059

Query  1048  SYVCIERGLTNIKGKGDMRTYWLTNRHQSELT  1079
              Y   ERG+ ++KGKGD RTYWL    +   T
Sbjct  1060  GYHFAERGVISMKGKGDQRTYWLLGEDEEART  1091


>C7LAF5_DROME unnamed protein product
Length=1237

 Score = 781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/1112 (42%), Positives = 656/1112 (59%), Gaps = 89/1112 (8%)

Query  10    AFSSILVLLGCQWSSGNPLASMRRLSDTINIGFLAEYSQMRVTL-GGLPLAIEDVNKNPN  68
             AFS+     G  ++ G   AS RR  +        +Y++  +T+ G + LA+E+VN    
Sbjct  29    AFSNFRPTHGEVFTLGYLTASQRRPGNL-------DYNRPGLTISGAISLAVEEVNAGRL  81

Query  69    LLPGKKLAFKPVDIGHKMSAYRVKPLRAMTQMRESGVTAFIGPDESCTTEALLASAWNTP  128
                G  L F    +  +     V  +R    +    V A+IGP E+C  E  +A+A+N P
Sbjct  82    RDRGHSLQF----VVAETYGEEVVSIRQTAALWTQQVAAYIGPQETCVHEGRMAAAFNLP  137

Query  129   MLSFKCSDSIVSNKSTFHTFARTLAPASKVSKSVISLLNAFHWNKFSIVVSSKPIWGSDV  188
             M+S+ C+    SNK+ F TFART  P +++SKSV++LL AF+W + S       ++  D 
Sbjct  138   MISYYCTHRDPSNKADFPTFARTRPPDTQISKSVVALLLAFNWTQVSF------LYLDDA  191

Query  189   ARAIQELAEARNFTISHFKYISDYIPTTKTL-------SQIDKIIAETYSTTRIYVFIGE  241
             +   Q +AE    T++        I T  T+       +  + ++ +TY+ TRIY+ +G 
Sbjct  192   SGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHGFMDNPFEALVEQTYANTRIYLILGH  251

Query  242   HIAMVDFVRGLQNRRLLESGDYIVVSVDDEIYDSNRRVNIMERNYLDPYIRK---EKSKS  298
             +   V  +  LQ R +L  GDY VV +D E YD  +          + Y+R    E  + 
Sbjct  252   YYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKP---------EKYLRGLLLEDVEP  302

Query  299   LDKISFRSVVKISMTYPQNPHIRDICSKIKDYARKTPFLVPYHQRVFDNI-SVPIYGLHL  357
             L   +F+S + I  T   +       +++  Y  + PF  P     F  +  +     +L
Sbjct  303   LAVQAFQSYLGIVPT--ASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYL  360

Query  358   YDSVMIYVRAITEVLKLGGDIYDGNLVMSHIFNRSYHSIQGFDVYIDANGDAEGNYTVIT  417
             YD+V +Y +A+ EVL  GG   +G+ +++ I    Y S  G+ VYID NGDA GNYTV+ 
Sbjct  361   YDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLA  420

Query  418   LQNDVGSGTSGGSLAKMSMQPVGFFAYDKNSL------IPEFRYIKSDRPIQWLNGRPPL  471
                  GS  +G +   + ++PVG F +  +SL      +P  + +K   PI W+ G  P 
Sbjct  421   R----GSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPH-QNLKLFSPIDWVGGTRPA  475

Query  472   AEPLCGFHGELCPRKKLDWRYLLTGPLCALVVVVAMALLI-------KHYRYEQTLAGLL  524
             A P CGF GE C           TG + A +   A+ LL        +++RYEQ L  LL
Sbjct  476   AAPRCGFGGEKCVN--------YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLL  527

Query  525   WKVDMKEVTVINLGEYNNPSNKN------IFQICRQSILVVGEPNKRS---FTNIALFRG  575
             WK+D +EV  I+  E    S K       + +  + S+    + + R    FT I L++G
Sbjct  528   WKIDFREVQ-IHENEREQQSQKQTRSTHPLIRTSQVSLSSNPDADFRYTTIFTPIGLYKG  586

Query  576   NIVAMKKIHKKSVDITRSIRKELKLMREVRHENIINFIGASTDHGSVVIFTTYCARGSLE  635
              + A+KK+ KKSVDITR ++KELKL+R+ RH+NI  FIGA TD  ++ I + YC RGSL+
Sbjct  587   QLYAIKKVRKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNICIISEYCTRGSLK  646

Query  636   DVLANEDLHLDHIFISSLVSDILKGMIYLHDSEIISHGQLRSSNCLIDSRWVCQISDFGL  695
             D+L NED+ LD++FI+S+V+DI++G+IYLHDS I  HG L +SNCL+DSRWV +++DFGL
Sbjct  647   DILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLVDSRWVVKLTDFGL  706

Query  696   HELKAGQEEPNKSELELKRALCM-----APELLRDVYRPAR---GSQKGDVYSFGILLYE  747
                K G E+ + ++++   A C+     APELLR    P+    G+Q+GD YSFGILLYE
Sbjct  707   FAFKQGIED-SSTDMQHMSAKCLKLLYRAPELLRQ--GPSSLVMGTQRGDAYSFGILLYE  763

Query  748   TIGRKGPWGDTTYSKEEIIEFVKCPELLQHGVFRPALTHTHLDIPDYIRKCLCQCWDEDP  807
                R+GP+G+T  +  + ++ V  P+   +  +RP+L        D + +CL +CW E P
Sbjct  764   MHVRRGPFGETGLTPMQCLQKVLQPQDYLN-PYRPSLQPLETAF-DCVSECLRECWAERP  821

Query  808   EVRPDIRLVRMHLKELQAGLKPNIFDNMLSIMEKYAYNLEGLVQERTNLLYEEKKKTDML  867
             E RPD + +R  L+ L+ G++PNIFDNM+++MEKYA NLE LV +RT+ L EEKKKTD L
Sbjct  822   EDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDAL  881

Query  868   LYQMLPRPVAELLKRGDPVEAECFDCVTILFSDIVGFTELCTTSTPFEVVEMLNDWYTCC  927
             L++MLPR VA+ LK+G  V+ E ++ V+I FSDIVGFT +    TP +VV+ LND YTC 
Sbjct  882   LHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCF  941

Query  928   DSIISNYDVYKVETIGDAYMVVSGLPLQNGNRHAGEIASLALHLLETVGNLKIRHKPTET  987
             DSII +YDVYKVETIGDAYMVVSGLPL+NG+ HA EIA+++LHLL  V   KIRH+PT  
Sbjct  942   DSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSAVSEFKIRHRPTNR  1001

Query  988   VQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGESMKIHISEATYQLLQLIG  1047
             + LRIG+HSGP  AGVVG KMPRYCLFGDTVNTASRMES+G  +KIH S    QLL  +G
Sbjct  1002  LLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLG  1061

Query  1048  SYVCIERGLTNIKGKGDMRTYWLTNRHQSELT  1079
              Y   ERG+ ++KGKGD RTYWL    +   T
Sbjct  1062  GYHFAERGVISMKGKGDQRTYWLLGEDEEART  1093


>Q8IQK2_DROME unnamed protein product
Length=1248

 Score = 776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/1125 (41%), Positives = 651/1125 (58%), Gaps = 104/1125 (9%)

Query  10    AFSSILVLLGCQWSSGNPLASMRRLSDTINIGFLAEYSQMRVTL-GGLPLAIEDVNKNPN  68
             AFS+     G  ++ G   AS RR  +        +Y++  +T+ G + LA+E+VN    
Sbjct  29    AFSNFRPTHGEVFTLGYLTASQRRPGNL-------DYNRPGLTISGAISLAVEEVNAGRL  81

Query  69    LLPGKKLAFKPVDIGHKMSAYRVKPLRAMTQMRESGVTAFIGPDESCTTEALLASAWNTP  128
                G  L F    +  +     V  +R    +    V A+IGP E+C  E  +A+A+N P
Sbjct  82    RDRGHSLQF----VVAETYGEEVVSIRQTAALWTQQVAAYIGPQETCVHEGRMAAAFNLP  137

Query  129   MLSFKCSDSIVSNKSTFHTFARTLAPASKVSKSVISLLNAFHWNKFSIVVSSKPIWGSDV  188
             M+S+ C+    SNK+ F TFART  P +++SKSV++LL AF+W + S       ++  D 
Sbjct  138   MISYYCTHRDPSNKADFPTFARTRPPDTQISKSVVALLLAFNWTQVSF------LYLDDA  191

Query  189   ARAIQELAEARNFTISHFKYISDYIPTTKTL-------SQIDKIIAETYSTTRIYVFIGE  241
             +   Q +AE    T++        I T  T+       +  + ++ +TY+ TRIY+ +G 
Sbjct  192   SGQYQPVAETILSTLTDAGVSIRDIRTWNTIYHHGFMDNPFEALVEQTYANTRIYLILGH  251

Query  242   HIAMVDFVRGLQNRRLLESGDYIVVSVDDEIYDSNRRVNIMERNYLDPYIRK---EKSKS  298
             +   V  +  LQ R +L  GDY VV +D E YD  +          + Y+R    E  + 
Sbjct  252   YYEHVGLMVSLQRRGILSKGDYFVVGIDIEQYDPAKP---------EKYLRGLLLEDVEP  302

Query  299   LDKISFRSVVKISMTYPQNPHIRDICSKIKDYARKTPFLVPYHQRVFDNI-SVPIYGLHL  357
             L   +F+S + I  T   +       +++  Y  + PF  P     F  +  +     +L
Sbjct  303   LAVQAFQSYLGIVPT--ASVSFATFANEVNKYMERPPFNFPNPLGPFGGVKQISAEAAYL  360

Query  358   YDSVMIYVRAITEVLKLGGDIYDGNLVMSHIFNRSYHSIQGFDVYIDANGDAEGNYTVIT  417
             YD+V +Y +A+ EVL  GG   +G+ +++ I    Y S  G+ VYID NGDA GNYTV+ 
Sbjct  361   YDAVHLYAKALMEVLDSGGRPRNGSAIVAAIKGSRYRSAMGYHVYIDENGDAAGNYTVLA  420

Query  418   LQNDVGSGTSGGSLAKMSMQPVGFFAYDKNSL------IPEFRYIKSDRPIQWLNGRPPL  471
                  GS  +G +   + ++PVG F +  +SL      +P  +      PI W+ G  P 
Sbjct  421   R----GSVRNGRNQTVLGLRPVGTFIHRNSSLSSISKALPNLKLFS---PIDWVGGTRPA  473

Query  472   AEPLCGFHGELCPRKKLDWRYLLTGPLCALVVVVAMALLI-------KHYRYEQTLAGLL  524
             A P CGF GE C           TG + A +   A+ LL        +++RYEQ L  LL
Sbjct  474   AAPRCGFGGEKCVN--------YTGEISAAIAGGALLLLSLVSLVLYRNWRYEQELDSLL  525

Query  525   WKVDMKEVTVINLGEYNNPSNKNIFQICRQ-----------------SILVVGEPNK---  564
             WK+D +EV  I+  E    S K    +                     + +   P+    
Sbjct  526   WKIDFREVQ-IHENEREQQSQKQTRHLLNHLPRRLPPQSTHPLIRTSQVSLSSNPDADFR  584

Query  565   --RSFTNIALFRGNIVAMKKIHKKSVDITRSIRKELKLMREVRHENIINFIGASTDHGSV  622
                 FT I L++G + A+KK+ KKSVDITR ++KELKL+R+ RH+NI  FIGA TD  ++
Sbjct  585   YTTIFTPIGLYKGQLYAIKKVRKKSVDITREMKKELKLLRDARHDNICAFIGACTDPPNI  644

Query  623   VIFTTYCARGSLEDVLANEDLHLDHIFISSLVSDILKGMIYLHDSEIISHGQLRSSNCLI  682
              I + YC RGSL+D+L NED+ LD++FI+S+V+DI++G+IYLHDS I  HG L +SNCL+
Sbjct  645   CIISEYCTRGSLKDILENEDVKLDNMFIASMVADIIRGVIYLHDSPIRFHGALCTSNCLV  704

Query  683   DSRWVCQISDFGLHELKAGQEEPNKSELELKRALCM-----APELLRDVYRPAR---GSQ  734
             DSRWV +++DFGL   K G E+ + ++++   A C+     APELLR    P+    G+Q
Sbjct  705   DSRWVVKLTDFGLFAFKQGIED-SSTDMQHMSAKCLKLLYRAPELLRQ--GPSSLVMGTQ  761

Query  735   KGDVYSFGILLYETIGRKGPWGDTTYSKEEIIEFVKCPELLQHGVFRPALTHTHLDIPDY  794
             +GD YSFGILLYE   R+GP+G+T  +  + ++ V  P+   +  +RP+L        D 
Sbjct  762   RGDAYSFGILLYEMHVRRGPFGETGLTPMQCLQKVLQPQDYLN-PYRPSLQPLETAF-DC  819

Query  795   IRKCLCQCWDEDPEVRPDIRLVRMHLKELQAGLKPNIFDNMLSIMEKYAYNLEGLVQERT  854
             + +CL +CW E PE RPD + +R  L+ L+ G++PNIFDNM+++MEKYA NLE LV +RT
Sbjct  820   VSECLRECWAERPEDRPDFKTIRTKLRPLRKGMRPNIFDNMMAMMEKYANNLEALVDDRT  879

Query  855   NLLYEEKKKTDMLLYQMLPRPVAELLKRGDPVEAECFDCVTILFSDIVGFTELCTTSTPF  914
             + L EEKKKTD LL++MLPR VA+ LK+G  V+ E ++ V+I FSDIVGFT +    TP 
Sbjct  880   DQLQEEKKKTDALLHEMLPRCVADQLKKGHKVDPEHYEQVSIYFSDIVGFTAMSAECTPL  939

Query  915   EVVEMLNDWYTCCDSIISNYDVYKVETIGDAYMVVSGLPLQNGNRHAGEIASLALHLLET  974
             +VV+ LND YTC DSII +YDVYKVETIGDAYMVVSGLPL+NG+ HA EIA+++LHLL  
Sbjct  940   QVVDFLNDLYTCFDSIIGHYDVYKVETIGDAYMVVSGLPLRNGDLHAAEIATMSLHLLSA  999

Query  975   VGNLKIRHKPTETVQLRIGVHSGPCAAGVVGQKMPRYCLFGDTVNTASRMESTGESMKIH  1034
             V   KIRH+PT  + LRIG+HSGP  AGVVG KMPRYCLFGDTVNTASRMES+G  +KIH
Sbjct  1000  VSEFKIRHRPTNRLLLRIGIHSGPVCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIH  1059

Query  1035  ISEATYQLLQLIGSYVCIERGLTNIKGKGDMRTYWLTNRHQSELT  1079
              S    QLL  +G Y   ERG+ ++KGKGD RTYWL    +   T
Sbjct  1060  CSWQCRQLLDRLGGYHFAERGVISMKGKGDQRTYWLLGEDEEART  1104



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110365.1 homogentisate 1,2-dioxygenase [Drosophila elegans]

Length=439
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HGD_CAEEL  unnamed protein product                                    597     0.0  
UGPA2_DICDI  unnamed protein product                                  32.3    0.78 
Q8IP22_DROME  unnamed protein product                                 31.6    1.7  


>HGD_CAEEL unnamed protein product
Length=437

 Score = 597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/433 (66%), Positives = 341/433 (79%), Gaps = 6/433 (1%)

Query  3    QYKYLSGFGSHFSSEDERYPNSLPVGQNSPQVCPYKLYAEQLSGSAFTAPRTENVRTWLY  62
            + KYL+GFG+  ++ D R P++LPVGQNSPQ C + LYAEQLSG+AFTAPR++N R+WLY
Sbjct  6    ELKYLTGFGNEHATSDPRVPDALPVGQNSPQKCSHGLYAEQLSGTAFTAPRSQNQRSWLY  65

Query  63   RKLPSAVHLPFKPF-EGAKYFRQNWDEQPPNPNQLRWKPFDLPAEQGKRIDFVEGLHTVC  121
            R  PS +H PF+   E  +++  N+   PPNPNQ RW PF LP ++G  + FV+ L+TVC
Sbjct  66   RIRPSVIHRPFEAMKENDQHWTNNFSSIPPNPNQYRWNPFPLPTKEG--VTFVDNLYTVC  123

Query  122  GAGDPRSRHGLAIHIYSCNASMDSSAFYNSDGDFLIVPQQGVLDITTELGRMTVAPNEIC  181
            G GD  SR GLAIH +SCNASM+ +A YNSDGDFLIVPQQG L+ITTE GR+ V P EI 
Sbjct  124  GGGDVISRTGLAIHQFSCNASMEHTAMYNSDGDFLIVPQQGALEITTEFGRLLVNPQEIA  183

Query  182  VIPQGIRFAINVDSPSRGYILEVYDGHFVLPDLGPIGANGLANPRDFETPVAWFDDQNGK  241
            VIPQGIRF++ V  PSRGYILEVY  HF LPDLGPIGANGLANPRDFE PVAWF+D +  
Sbjct  184  VIPQGIRFSVAVRGPSRGYILEVYGTHFQLPDLGPIGANGLANPRDFEAPVAWFEDLD-V  242

Query  242  DFQVISKFQGSLFVAQQNHTVFDVVAWHGNYVPFKYDLSKFMVINSVSFDHCDPSIFTVL  301
            +F +I+K+QGS F A+Q H+ FDVV WHGNYVP+KYDL KFMVIN+VSFDHCDPSIFTVL
Sbjct  243  EFTIINKYQGSWFQAKQGHSPFDVVGWHGNYVPYKYDLKKFMVINTVSFDHCDPSIFTVL  302

Query  302  TCPSLRAGTAIADFVIFPPRWSVQEHTFRPPYYHRNCMSEFMGLILGKYEAKEDGFAAGG  361
            T PS++ GTAIADFVIFPPRW   ++TFRPPYYHRNCMSE+MGLI G YEAKE GF  GG
Sbjct  303  TAPSVKHGTAIADFVIFPPRWGCADNTFRPPYYHRNCMSEYMGLITGCYEAKEGGFKPGG  362

Query  362  ATLHSIMTPHGPDVKCFDGASKAKLVPERVAEGTQAFMFESSLSLAVTKWGEETCQKLDA  421
             +LHS+MTPHGPD  CF+ AS A L P+RVAEGT +FMFESSL++A+T W     Q +D 
Sbjct  363  GSLHSMMTPHGPDFNCFEMASNADLKPQRVAEGTMSFMFESSLNMAITNWA--VYQNVDK  420

Query  422  AYYECWQALRNNF  434
             YY+ WQ L+ +F
Sbjct  421  DYYKDWQPLKKHF  433


>UGPA2_DICDI unnamed protein product
Length=502

 Score = 32.3 bits (72),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 32/130 (25%), Positives = 50/130 (38%), Gaps = 15/130 (12%)

Query  28   GQNSPQVCPYKLYAEQLSGSAFTAPRTENVRTWLYRKLPSAVHLPFKPFEGAKYFRQNWD  87
            G  S  +    L+ ++L   + TAP       +L +++PS   L F  F   +    +WD
Sbjct  20   GSRSSDLATEDLFLKKLEAISQTAPNETVKNEFLNKEIPSINKL-FTRFLKNRKKVIDWD  78

Query  88   EQPPNPNQLRWKPFDLPAEQGKR----------IDFVEGLHTVCGAGDPRSRHGLAIHIY  137
            +  P P  +     DLPA   +R          +    GL T  G   P+S     I + 
Sbjct  79   KINPPPADMVLNYKDLPAITEQRTSELASKLAVLKLNGGLGTTMGCTGPKS----VIEVR  134

Query  138  SCNASMDSSA  147
            S    +D S 
Sbjct  135  SEKTFLDLSV  144


>Q8IP22_DROME unnamed protein product
Length=1215

 Score = 31.6 bits (70),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query  199  GYILEVYDGHFVL--PDLGPIGANGLANPR----DFETPVAWFDDQNGKD  242
            GY   V +  +VL  PDL PIG NG  NP     DF      F+DQ+ ++
Sbjct  561  GYSFVVSNNGYVLLHPDLRPIGTNGKMNPNYNSIDFTEVEHLFEDQSPRE  610



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110366.1 uncharacterized protein LOC108134531 [Drosophila
elegans]

Length=208
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KFV9_DROME  unnamed protein product                             28.1    5.7  
Q6NR39_DROME  unnamed protein product                                 28.1    6.1  


>A0A0B4KFV9_DROME unnamed protein product
Length=514

 Score = 28.1 bits (61),  Expect = 5.7, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query  26   MLSMLEIKIQIDQSPELQRPLTRVYLVVKLSELACSPLLSG  66
            +LS + +K++   +PE  R L R   + K    ACSPL +G
Sbjct  414  LLSQIRLKLE---NPEKSRDLFRKRSIRKSKRRACSPLNAG  451


>Q6NR39_DROME unnamed protein product
Length=498

 Score = 28.1 bits (61),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query  26   MLSMLEIKIQIDQSPELQRPLTRVYLVVKLSELACSPLLSG  66
            +LS + +K++   +PE  R L R   + K    ACSPL +G
Sbjct  398  LLSQIRLKLE---NPEKSRDLFRKRSIRKSKRRACSPLNAG  435



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110367.1 DET1 homolog [Drosophila elegans]

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VKM4_DROME  unnamed protein product                                 847     0.0  
Q95W10_DROME  unnamed protein product                                 679     0.0  
Q8MR99_DROME  unnamed protein product                                 514     0.0  


>Q9VKM4_DROME unnamed protein product
Length=539

 Score = 847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/540 (77%), Positives = 473/540 (88%), Gaps = 4/540 (1%)

Query  1    MAYERRLRSQNLVHLLQNRESGYTCAGNQLGRMPRLFYERPFYKCITPCLTIDTVTIPPV  60
            MAY++RL+SQNLVHLLQNRESGYT  G Q GRMP L YER FYKCITPCLTID++TIPP+
Sbjct  1    MAYKKRLQSQNLVHLLQNRESGYTNVGQQPGRMPLLAYERLFYKCITPCLTIDSITIPPI  60

Query  61   YLRKFTPDGSKLLAFSQDQRSLHIYRYRG--CASVGELIRRADVGTGECFSSPGSTLKST  118
            YLRKFTPDG KLLAFSQDQRSL IY Y G  CA+VGELIR+ADVG+GECFSS  + LKS 
Sbjct  61   YLRKFTPDGRKLLAFSQDQRSLLIYSYGGSSCAAVGELIRQADVGSGECFSSQDTILKSR  120

Query  119  IFERLFATKEALTLRLCQGDYSLYYLHREFSIFLEEGRYVLLAAMSVLRGALPIDDYVRY  178
            IFERLF TKE  TL LCQGD+ LYYLHREFS+FLEEGRY +LAAM+V+RGALP+DDYVRY
Sbjct  121  IFERLFPTKE--TLNLCQGDFGLYYLHREFSVFLEEGRYAMLAAMTVVRGALPVDDYVRY  178

Query  179  PDLFDKLEVFSYVFFVVDLKLGVVSDSLFLPHDSIVIAHNHGISVFGSTVAIMSRLHQCI  238
            PDLFDK++ FSYVFF+VDLKLGVV+D L LP+DSIVIAHNHGISVFGSTV +MSRLHQC+
Sbjct  179  PDLFDKVDAFSYVFFLVDLKLGVVTDRLILPNDSIVIAHNHGISVFGSTVMMMSRLHQCV  238

Query  239  YVYGVTEGKLHVQETVGPRPRDFIEKARSDFDNLDATTVLPITHIKQRVLSFLYRQIDPE  298
            YVY V +GK H QET+GPRPRDFIEKA +DFDNLDATTVLPITHIKQRVLSFLYR+I+ +
Sbjct  239  YVYWVNDGKFHQQETIGPRPRDFIEKATTDFDNLDATTVLPITHIKQRVLSFLYRKINDK  298

Query  299  SPAVQEKRREFYKNFEFVEHMIMERMQLVNKELLLLRYEERPKDSETMPMTGTPRRLYVF  358
            S    E ++ FYKNFE++EHMIMERM LVN ELL+LRYEERP  ++TMPM  +PRRLYVF
Sbjct  299  SGNPTESQKSFYKNFEYIEHMIMERMHLVNNELLMLRYEERPNGTDTMPMATSPRRLYVF  358

Query  359  YTISGEEVVGVYPDYSVDLLQIILQFYDEMSNVRSLQTGDAPSLPLHFILKQNFVDANES  418
            YTI+GEEVVGVYP+YSV+LLQI+LQF D MSN RSLQ GDAPSLP+HF L+  F D+NES
Sbjct  359  YTITGEEVVGVYPEYSVNLLQILLQFNDYMSNDRSLQFGDAPSLPMHFFLRHTFADSNES  418

Query  419  IPFVRHAALRFNPSVPVSSQSLSPSPYLRFNEFSFDDRHVSPLERPNPCSAEPIVFRDRA  478
            +   RH ALRFNPSVP+SSQSLS SPYL+FNEF +D R+VSPLE+P+ C  +PIVF DRA
Sbjct  419  VSVDRHTALRFNPSVPLSSQSLSSSPYLKFNEFRYDSRYVSPLEQPHRCCNDPIVFLDRA  478

Query  479  TQSIKFRLHATARRHNNPLAPRELCAFIWHPYEPLLLSIQKCMNSYAYHVHLYSHSTVVD  538
            T SIKFRLHATARRH NPLAPRELCAFIWHP++PL+LSIQKCMNSY YHVHLY+HST+V+
Sbjct  479  TDSIKFRLHATARRHLNPLAPRELCAFIWHPFDPLVLSIQKCMNSYVYHVHLYNHSTIVE  538


>Q95W10_DROME unnamed protein product
Length=509

 Score = 679 bits (1752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/478 (72%), Positives = 397/478 (83%), Gaps = 4/478 (1%)

Query  1    MAYERRLRSQNLVHLLQNRESGYTCAGNQLGRMPRLFYERPFYKCITPCLTIDTVTIPPV  60
            MAY++RL+SQNLVHLLQNRESGYT  G Q GR+    YER FYKCITPCLTID++TIPP+
Sbjct  1    MAYKKRLQSQNLVHLLQNRESGYTNVGQQPGRIGCSRYERLFYKCITPCLTIDSITIPPI  60

Query  61   YLRKFTPDGSKLLAFSQDQRSLHIYRYRG--CASVGELIRRADVGTGECFSSPGSTLKST  118
            YLRKFTPD  KLLAFSQDQRSL IY Y G  CA+VGELIR+ADVG+GECFSS  + LKS 
Sbjct  61   YLRKFTPDRRKLLAFSQDQRSLLIYSYGGSSCAAVGELIRQADVGSGECFSSQDTILKSR  120

Query  119  IFERLFATKEALTLRLCQGDYSLYYLHREFSIFLEEGRYVLLAAMSVLRGALPIDDYVRY  178
            IFERLF TKE  TL LCQGD+ LYYLHREFS+FLEEGRY +LAAM+V+RGALP+DDYVRY
Sbjct  121  IFERLFPTKE--TLNLCQGDFGLYYLHREFSVFLEEGRYAMLAAMTVVRGALPVDDYVRY  178

Query  179  PDLFDKLEVFSYVFFVVDLKLGVVSDSLFLPHDSIVIAHNHGISVFGSTVAIMSRLHQCI  238
            PDLFDK++ FSYVFF+VDLKLGVV+D L LP+DSIVIAHNHGISVFGSTV +MSRLHQC+
Sbjct  179  PDLFDKVDAFSYVFFLVDLKLGVVTDRLILPNDSIVIAHNHGISVFGSTVMMMSRLHQCV  238

Query  239  YVYGVTEGKLHVQETVGPRPRDFIEKARSDFDNLDATTVLPITHIKQRVLSFLYRQIDPE  298
            YVY V +GK H QET+GP       +       LDATTVLPITHIKQRVLSFLYR+I+ +
Sbjct  239  YVYWVNDGKFHQQETIGPGRGTLSRRLPQTLTILDATTVLPITHIKQRVLSFLYRKINDK  298

Query  299  SPAVQEKRREFYKNFEFVEHMIMERMQLVNKELLLLRYEERPKDSETMPMTGTPRRLYVF  358
            S    E ++ FYKNFE++EHMIMERM LVN ELL+LRYEERP  ++TMPM  +PRRLYVF
Sbjct  299  SGNPTESQKSFYKNFEYIEHMIMERMHLVNNELLMLRYEERPNGTDTMPMATSPRRLYVF  358

Query  359  YTISGEEVVGVYPDYSVDLLQIILQFYDEMSNVRSLQTGDAPSLPLHFILKQNFVDANES  418
            YTI+GEEVVGVYP+YSV+LLQI+LQF D MSN RSLQ GDAPSLP+HF L+  F D+NES
Sbjct  359  YTITGEEVVGVYPEYSVNLLQILLQFNDYMSNDRSLQFGDAPSLPMHFFLRHTFADSNES  418

Query  419  IPFVRHAALRFNPSVPVSSQSLSPSPYLRFNEFSFDDRHVSPLERPNPCSAEPIVFRD  476
            +   RH ALRFNPSVP+SSQSLS SPYL+FNEF +D R+V PLE+P+ C  +PIVF D
Sbjct  419  VSVDRHTALRFNPSVPLSSQSLSSSPYLKFNEFRYDSRYVFPLEQPHRCCNDPIVFLD  476


>Q8MR99_DROME unnamed protein product
Length=314

 Score = 514 bits (1324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/316 (78%), Positives = 278/316 (88%), Gaps = 4/316 (1%)

Query  1    MAYERRLRSQNLVHLLQNRESGYTCAGNQLGRMPRLFYERPFYKCITPCLTIDTVTIPPV  60
            MAY++RL+SQNLVHLLQNRESGYT  G Q GRMP L YER FYKCITPCLTID++TIPP+
Sbjct  1    MAYKKRLQSQNLVHLLQNRESGYTNVGQQPGRMPLLAYERLFYKCITPCLTIDSITIPPI  60

Query  61   YLRKFTPDGSKLLAFSQDQRSLHIYRYRG--CASVGELIRRADVGTGECFSSPGSTLKST  118
            YLRKFTPDG KLLAFSQDQRSL IY Y G  CA+VGELIR+ADVG+GECFSS  +TLKS 
Sbjct  61   YLRKFTPDGRKLLAFSQDQRSLLIYSYGGSSCAAVGELIRQADVGSGECFSSQDTTLKSR  120

Query  119  IFERLFATKEALTLRLCQGDYSLYYLHREFSIFLEEGRYVLLAAMSVLRGALPIDDYVRY  178
            IFERLF TKE  TL LCQGD+ LYYLHREFS+FLEEGRY +LAAM+V+RGALP+DDYVRY
Sbjct  121  IFERLFPTKE--TLNLCQGDFGLYYLHREFSVFLEEGRYAMLAAMTVVRGALPVDDYVRY  178

Query  179  PDLFDKLEVFSYVFFVVDLKLGVVSDSLFLPHDSIVIAHNHGISVFGSTVAIMSRLHQCI  238
            PDLFDK++ FSYVFF+VDLKLGVV+D L LP+DSIVIAHNHGISVFGSTV +MSRLHQC+
Sbjct  179  PDLFDKVDAFSYVFFLVDLKLGVVTDRLILPNDSIVIAHNHGISVFGSTVMMMSRLHQCV  238

Query  239  YVYGVTEGKLHVQETVGPRPRDFIEKARSDFDNLDATTVLPITHIKQRVLSFLYRQIDPE  298
            YVY V +GK H QET+GPRPRDFIEKA +DFDNLDATTVLPITHIKQRVLSFLYR+I+ +
Sbjct  239  YVYWVNDGKFHQQETIGPRPRDFIEKATTDFDNLDATTVLPITHIKQRVLSFLYRKINDK  298

Query  299  SPAVQEKRREFYKNFE  314
            S    E ++ FYKNFE
Sbjct  299  SGNPTESQKSFYKNFE  314



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110368.1 extensin-2 [Drosophila elegans]

Length=171
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALXA_CAEEL  unnamed protein product                                   32.3    0.18 


>ALXA_CAEEL unnamed protein product
Length=882

 Score = 32.3 bits (72),  Expect = 0.18, Method: Composition-based stats.
 Identities = 23/57 (40%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query  67   GYNQMP-PYPYPQPIPMPDYYSPYRNARPPPPPPLMYPAYQA-AYPPQTGGGWNANP  121
            GY Q P PY  PQP+  P Y   +  A P P  P  +P+YQ      Q  GG+  NP
Sbjct  809  GYYQQPMPYGQPQPMFQPQYQPTF--AAPYPTFPGAFPSYQQQWPQQQQQGGFPPNP  863



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110369.1 protein aubergine [Drosophila elegans]

Length=870
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

AUB_DROME  unnamed protein product                                    1397    0.0  
PIWI_DROME  unnamed protein product                                   753     0.0  
SIWI_BOMMO  unnamed protein product                                   728     0.0  


>AUB_DROME unnamed protein product
Length=866

 Score = 1397 bits (3617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/872 (75%), Positives = 758/872 (87%), Gaps = 8/872 (1%)

Query  1    MNLPPNTGTARGRGRGTKRNE-DANRGLAPQLGQSPHSSQSGRNEASGGQGSTSDAPASN  59
            MNLPPN   ARGRGRG K N  +ANRG AP LGQ    S S  N+ASGG G   DA    
Sbjct  1    MNLPPNPVIARGRGRGRKPNNVEANRGFAPSLGQKSDPSHSEGNQASGGNGGGGDAQVGP  60

Query  60   LQRSERSLDTKS-SEAEIQSSESDPRGSVRGRRLITDVIHSRPQGLVTKNGVSGTKITVQ  118
                  S++  S S  ++  SE DPRGSVRGRRLITD+++SRP G+ +K GV GT ITVQ
Sbjct  61   ------SIEKSSLSAVQMHKSEGDPRGSVRGRRLITDLVYSRPPGMTSKKGVVGTHITVQ  114

Query  119  TNYFKLLKRPNWSIYQYRVDFVPDVDNTRLRRGLVSEHRSILGGYIFDGTVLFCTNQFKP  178
             NYFK+LKRPNW+IYQYRVDF PDV+ TRLRR  + EH+ ILGGYIFDGT +FC NQFK 
Sbjct  115  ANYFKVLKRPNWTIYQYRVDFTPDVEATRLRRSFLYEHKGILGGYIFDGTNMFCINQFKA  174

Query  179  VQNSPYVLELLTKSRAGENFEIKIKAVGSVEAADNQQFQVLNLILRRAMEGLDLQLVSRN  238
            VQ+SPYVLEL+TKSRAGEN EIKIKAVGSV++ D +QFQVLNLILRRAMEGLDL+LVSR 
Sbjct  175  VQDSPYVLELVTKSRAGENIEIKIKAVGSVQSTDAEQFQVLNLILRRAMEGLDLKLVSRY  234

Query  239  FFDPKAKINLENYRMELWPGYQTSIRQHESDILLCAEIAHKVMRTDTLYNILAEAIRDND  298
            ++DP+AKINLEN+RM+LWPGYQTSIRQHE+DILLC+EI HKVMRT+TLYNIL++AIRD+D
Sbjct  235  YYDPQAKINLENFRMQLWPGYQTSIRQHENDILLCSEICHKVMRTETLYNILSDAIRDSD  294

Query  299  DYQTAFKREVMGMVVLTDYNNKTYRVDDVDFDSSPLSKFNTKEGDISYVEYYKKRYNITI  358
            DYQ+ FKR VMGMV+LTDYNNKTYR+DDVDF S+PL KF T +G+ISYV+YYKKRYNI I
Sbjct  295  DYQSTFKRAVMGMVILTDYNNKTYRIDDVDFQSTPLCKFKTNDGEISYVDYYKKRYNIII  354

Query  359  RDFKQPLVVSRPTEKNIRGGVDRLIMLVPELARATGMTDAMRANFRLMKAMSEHTRLTPD  418
            RD KQPLV+SRPT+KNIRGG D+ IM++PELARATGMTDAMRA+FR ++AMSEHTRL PD
Sbjct  355  RDLKQPLVMSRPTDKNIRGGNDQAIMIIPELARATGMTDAMRADFRTLRAMSEHTRLNPD  414

Query  419  RRIERLRVFNQRLKSAKESIETLKSWHIEIDSALVEIPARVLPPEKIVFGLNKRYLCDSR  478
            RRIERLR+FN+RLKS K+S+ETLKSW+IE+DSALVEIPARVLPPEKI+FG  K ++CD+R
Sbjct  415  RRIERLRMFNKRLKSCKQSVETLKSWNIELDSALVEIPARVLPPEKILFGNQKIFVCDAR  474

Query  479  ADWTNEFRNSSMFSHVEIKRWFVITPNRNLRETQEFVKMCIRVANGMKMHISEPRYDEIK  538
            ADWTNEFR  SMF +V I RW+VITP+RNLRETQEFV+MCIR A+ MKM+I  P Y+EI 
Sbjct  475  ADWTNEFRTCSMFKNVHINRWYVITPSRNLRETQEFVQMCIRTASSMKMNICNPIYEEIP  534

Query  539  DDRNGTYSQSIDNVVAKDPQIVMIVIKSSNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPR  598
            DDRNGTYSQ+IDN  A DPQIVM+V++S NEEKYSCIKKRTCVDRPVPSQVVTLKVIAPR
Sbjct  535  DDRNGTYSQAIDNAAANDPQIVMVVMRSPNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPR  594

Query  599  AEKSAGLMSIATKVVIQMNAKLMGAPWTIELPVRGLMTVGFDVCHSAKNKNKSFGALVAT  658
             +K  GLMSIATKVVIQMNAKLMGAPW + +P+ GLMTVGFDVCHS KNKNKS+GA VAT
Sbjct  595  QQKPTGLMSIATKVVIQMNAKLMGAPWQVVIPLHGLMTVGFDVCHSPKNKNKSYGAFVAT  654

Query  659  MDMKTSCRFYSSVNEHMKGQELSDQLSLNMTCALKAYREHHGTLPERILFFRDGVGDGQL  718
            MD K S R++S+VNEH+KGQELS+Q+S+NM CAL++Y+E H +LPERILFFRDGVGDGQL
Sbjct  655  MDQKESFRYFSTVNEHIKGQELSEQMSVNMACALRSYQEQHRSLPERILFFRDGVGDGQL  714

Query  719  YQVVNTEVKFLRAKLDEIYKSAGKVEGCRMAFIVVSKRINSRYFVNKRNPLPGTVVDDVI  778
            YQVVN+EV  L+ +LDEIYKSAGK EGCRM FI+VSKRINSRYF   RNP+PGTVVDDVI
Sbjct  715  YQVVNSEVNTLKDRLDEIYKSAGKQEGCRMTFIIVSKRINSRYFTGHRNPVPGTVVDDVI  774

Query  779  TLPERYDFFLVSQSVRQGTVSPTSYNIISDNMGLSADRLQILAYKMTHMYYNFSGTVRVP  838
            TLPERYDFFLVSQ+VR GTVSPTSYN+ISDNMGL+AD+LQ+L+YKMTHMYYN+SGT+RVP
Sbjct  775  TLPERYDFFLVSQAVRIGTVSPTSYNVISDNMGLNADKLQMLSYKMTHMYYNYSGTIRVP  834

Query  839  AVCQYAHKLAFLVAESINRCPSAGLENQLYFL  870
            AVC YAHKLAFLVAESINR PSAGL+NQLYFL
Sbjct  835  AVCHYAHKLAFLVAESINRAPSAGLQNQLYFL  866


>PIWI_DROME unnamed protein product
Length=843

 Score = 753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/872 (44%), Positives = 556/872 (64%), Gaps = 45/872 (5%)

Query  11   RGRGRGTKRNEDANRGLAPQLGQSPHSSQSGRNEASGGQ-----GSTSDAPASN----LQ  61
            +GRGR    NED               S + R    G +     GS+S  P ++      
Sbjct  5    QGRGRRRPLNED--------------DSSTSRGSGDGPRVKVFRGSSSGDPRADPRIEAS  50

Query  62   RSERSLDTKSSEAEIQSSESDPRGSVRGRRLITDVIHSRPQGLVTKNGVSGTKITVQTNY  121
            R  R+L+ ++   E   +E  P G         D +++RP  LV+K G  G  + +QTN+
Sbjct  51   RERRALE-EAPRREGGPTERKPWGDQ------YDYLNTRPAELVSKKGTDGVPVMLQTNF  103

Query  122  FKLLKRPNWSIYQYRVDFVPDVDNTRLRRGLVSEHRSILG-GYIFDGTVLFCTNQFKPVQ  180
            F+L  +P W I  Y V+F P ++N R+R G++S H ++LG GY+FDG  LF T +F+   
Sbjct  104  FRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSNHANLLGSGYLFDGLQLFTTRKFEQ--  161

Query  181  NSPYVLELLTKSRAGENFEIKIKAVGSVEAADNQQFQVLNLILRRAMEGLDLQLVSRNFF  240
                +  L  KS+    ++I IK VG +  A+ +  QVLNLILRR+M+GL+L+LV RN F
Sbjct  162  ---EITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF  218

Query  241  DPKAKINLENYRMELWPGYQTSIRQHESDILLCAEIAHKVMRTDTLYNILAEAIRDNDDY  300
            DP+AKI +  ++MELWPGY+TSIRQHE DILL  EI HKVMRT+T+Y+I+     +   +
Sbjct  219  DPRAKIEIREFKMELWPGYETSIRQHEKDILLGTEITHKVMRTETIYDIMRRCSHNPARH  278

Query  301  QTAFKREVMGMVVLTDYNNKTYRVDDVDFDSSPLSKFNTKEGDISYVEYYKKRYNITIRD  360
            Q   +  V+ ++VLTDYNN+TYR++DVDF  +P S F+ K  DIS+VEYY  +YNI IRD
Sbjct  279  QDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRD  338

Query  361  FKQPLVVSRPTEKNIRGGVDRLIMLVPELARATGMTDAMRANFRLMKAMSEHTRLTPDRR  420
              QPL++S+  +K ++     L++L+PEL R TG+   MR+NF+LM+AMS +TR+ P +R
Sbjct  339  HNQPLLISKNRDKALKTNASELVVLIPELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQR  398

Query  421  IERLRVFNQRLKSAKESIETLKSWHIEIDSALVEIPARVLPPEKIVFGLNKRYLCDSRAD  480
             +RLR FN RL++  ES++ L+ W++E+D  + E+  R++  + IVF  N +      AD
Sbjct  399  TDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFH-NGKVPAGENAD  457

Query  481  WTNEFRNSSMFSHVE--IKRWFVITPNRNLRETQEFVKMCIRVANGMKMHISEPRYDEIK  538
            W   FR+  M +     + RW VI P RN  E +  +    R A+GM + I  P+   I 
Sbjct  458  WQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIY  517

Query  539  DDRNGTYSQSIDNVVAKDPQIVMIVIKSSNEEKYSCIKKRTCVDRPVPSQVVTLKVIAPR  598
            DDR GTY +++D+ V  DP++++ ++ + N E+YS IKKR  VDR VP+QVVTLK     
Sbjct  518  DDRTGTYVRAMDDCVRSDPKLILCLVPNDNAERYSSIKKRGYVDRAVPTQVVTLKTT---  574

Query  599  AEKSAGLMSIATKVVIQMNAKLMGAPWTIELPVRGLMTVGFDVCHSAKNKNKSFGALVAT  658
              K+  LMSIATK+ IQ+N KL   PW IELP+ GLMT+GFD+  S +++ +++GAL+A+
Sbjct  575  --KNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIAS  632

Query  659  MDMKTSCRFYSSVNEHMKGQELSDQLSLNMTCALKAYREHHGTLPERILFFRDGVGDGQL  718
            MD++ +  ++S+V E      L++ L   +  AL+ Y+  H  LP RI+F+RDGV  G L
Sbjct  633  MDLQQNSTYFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSL  692

Query  719  YQVVNTEVKFLRAKLDEIYKSAGKVEGCRMAFIVVSKRINSRYFVNKRNPLPGTVVDDVI  778
             Q+   EVK +  KL   Y    ++   ++A+IVV++ +N+R+F+N +NP PGT+VDDVI
Sbjct  693  KQLFEFEVKDIIEKLKTEYARV-QLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVI  751

Query  779  TLPERYDFFLVSQSVRQGTVSPTSYNIISDNMGLSADRLQILAYKMTHMYYNFSGTVRVP  838
            TLPERYDF+LVSQ VRQGTVSPTSYN++  +MGLS +++Q L YKM H+YYN+SGT RVP
Sbjct  752  TLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGLSPEKMQKLTYKMCHLYYNWSGTTRVP  811

Query  839  AVCQYAHKLAFLVAESINRCPSAGLENQLYFL  870
            AVCQYA KLA LV  +++  P   LE + Y+L
Sbjct  812  AVCQYAKKLATLVGTNLHSIPQNALEKKFYYL  843


>SIWI_BOMMO unnamed protein product
Length=899

 Score = 728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/783 (46%), Positives = 514/783 (66%), Gaps = 23/783 (3%)

Query  96   VIHSRPQGLVTKNGVSGTKITVQTNYFKLLKRPNWSIYQYRVDFVPDVDNTRLRRGLVSE  155
            ++ +RP+ + +K G SGT + +  NYF +   P W +YQY VD  P+ D+T +R+ L+  
Sbjct  132  ILRTRPEAVTSKKGTSGTPLDLLANYFTVETTPKWGLYQYHVDISPEEDSTGVRKALMRV  191

Query  156  HRSILGGYIFDGTVLFCTNQFKPVQNSPYVLELLTKSRA-GENFEIKIKAVGSVEAADNQ  214
            H   LGGY+FDGTVL+  N+  P    P  +EL +  +   E   I IK    V   D  
Sbjct  192  HSKTLGGYLFDGTVLYTVNRLHP---DP--MELYSDRKTDNERMRILIKLTCEVSPGDYH  246

Query  215  QFQVLNLILRRAMEGLDLQLVSRNFFDPKAKINLENYRMELWPGYQTSIRQHESDILLCA  274
              Q+ N+I+R+    L LQL+ R++FDP+AKI++  +++++WPGY+T+I Q+E  +LL  
Sbjct  247  YIQIFNIIIRKCFNLLKLQLMGRDYFDPEAKIDIPEFKLQIWPGYKTTINQYEDRLLLVT  306

Query  275  EIAHKVMRTDTLYNILAE-AIRDNDDYQTAFKREVMGMVVLTDYNNKTYRVDDVDFDSSP  333
            EIAHKV+R DT+  +L+E A    ++Y+  F  +V+G +V+TDYN +TYRVDDV ++ SP
Sbjct  307  EIAHKVLRMDTVLQMLSEYAATKGNNYKKIFLEDVVGKIVMTDYNKRTYRVDDVAWNVSP  366

Query  334  LSKFNTKEGDISYVEYYKKRYNITIRDFKQPLVVSRPTEKNIRGGVDRLIMLVPELARAT  393
             S F  ++ +I+Y+EYY K+YN+ I+D  QPL++SR   + IR G+  LI LVPEL R T
Sbjct  367  KSTFKMRDENITYIEYYYKKYNLRIQDPGQPLLISRSKPREIRAGLPELIYLVPELCRQT  426

Query  394  GMTDAMRANFRLMKAMSEHTRLTPDRRIERLRVFNQRLKSAKESIETLKSWHIEIDSALV  453
            G++D MRANF+LM+++  HT++ PD+RIE+L  FN+R  S  E +E L +W +++   LV
Sbjct  427  GLSDEMRANFKLMRSLDVHTKIGPDKRIEKLNNFNRRFTSTPEVVEELATWSLKLSKELV  486

Query  454  EIPARVLPPEKIVFGLNKRYLC-DSRADWTNEFRNSSMFSHVEIKRWFVITPNRNLRETQ  512
            +I  R LPPE I+   N +Y   D+   WT + R+  + +  ++  W VITP R  R+T+
Sbjct  487  KIKGRQLPPENIIQANNVKYPAGDTTEGWTRDMRSKHLLAIAQLNSWVVITPERQRRDTE  546

Query  513  EFVKMCIRVANGMKMHISEPRYDEIKDDRNGTYSQSIDNVVA-KDPQIVMIVIKSSNEEK  571
             F+ + I+   G+   +  P    I+ D    Y+   + V+A K+P +++ V+  +  ++
Sbjct  547  SFIDLIIKTGGGVGFRMRSPDLVVIRHDGPIEYANMCEEVIARKNPALILCVLARNYADR  606

Query  572  YSCIKKRTCVDRPVPSQVVTLKVIAPRAEKSAGLMSIATKVVIQMNAKLMGAPWTIELPV  631
            Y  IKK+  VDR VP+QVV       R   S   MSIATKV IQ+N KL G+PWT+++P+
Sbjct  607  YEAIKKKCTVDRAVPTQVV-----CARNMSSKSAMSIATKVAIQINCKLGGSPWTVDIPL  661

Query  632  RGLMTVGFDVCHSAKNKNKSFGALVATMDMKTSCRFYSSVNEHMKGQELSDQLSLNMTCA  691
              LM VG+DVCH  ++K KSFGA VAT+D K   ++YS VN H  G+ELS  +  N+  A
Sbjct  662  PSLMVVGYDVCHDTRSKEKSFGAFVATLD-KQMTQYYSIVNAHTSGEELSSHMGFNIASA  720

Query  692  LKAYREHHGTLPERILFFRDGVGDGQLYQVVNTEVKFLRAKLDEIYKSAGKVEGCRMAFI  751
            +K +RE +GT P RI  +RDGVGDGQ+  V + EV  ++ KL EIY  AG VE  ++AFI
Sbjct  721  VKKFREKNGTYPARIFIYRDGVGDGQIPYVHSHEVAEIKKKLAEIY--AG-VE-IKLAFI  776

Query  752  VVSKRINSRYFVNK----RNPLPGTVVDDVITLPERYDFFLVSQSVRQGTVSPTSYNIIS  807
            +VSKRIN+R FV +     NP PGTV+DDV+TLPERYDF+LVSQ+VR+GT++PTSYN+I 
Sbjct  777  IVSKRINTRIFVQRGRSGENPRPGTVIDDVVTLPERYDFYLVSQNVREGTIAPTSYNVIE  836

Query  808  DNMGLSADRLQILAYKMTHMYYNFSGTVRVPAVCQYAHKLAFLVAESINRCPSAGLENQL  867
            D  GL+ DR+Q L YK+TH+Y+N S  VRVP+VCQYAHKLAFL A S++  P   L   L
Sbjct  837  DTTGLNPDRIQRLTYKLTHLYFNCSSQVRVPSVCQYAHKLAFLAANSLHNQPHYSLNETL  896

Query  868  YFL  870
            YFL
Sbjct  897  YFL  899



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110370.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110371.1 60S ribosomal protein L9 [Drosophila elegans]

Length=190
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RL9_DROME  unnamed protein product                                    389     1e-140
RL9_CAEEL  unnamed protein product                                    246     4e-84 
RL9_DICDI  unnamed protein product                                    199     2e-65 


>RL9_DROME unnamed protein product
Length=190

 Score = 389 bits (1000),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/190 (99%), Positives = 189/190 (99%), Gaps = 0/190 (0%)

Query  1    MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG  60
            MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG
Sbjct  1    MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG  60

Query  61   TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY  120
            TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY
Sbjct  61   TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY  120

Query  121  IRRVEMAAGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVS  180
            IRRVEMA GVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVS
Sbjct  121  IRRVEMAPGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVS  180

Query  181  EKTTVVKLES  190
            EKTTVVKLES
Sbjct  181  EKTTVVKLES  190


>RL9_CAEEL unnamed protein product
Length=189

 Score = 246 bits (629),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 144/186 (77%), Gaps = 0/186 (0%)

Query  1    MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG  60
            M+ I SN  V  P+ +  +VK R+V +TG RGT+++ F+HL ++M    K TL+V KWFG
Sbjct  1    MKLIESNDTVVFPEGVTFTVKNRIVHVTGPRGTIRKDFRHLHMEMERIGKSTLRVRKWFG  60

Query  61   TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY  120
             +KELAA+RTVCSHI+NMIKGVT GF+YKMR+VYAHFPIN    + N  +EIRNFLGEK 
Sbjct  61   VRKELAAIRTVCSHIKNMIKGVTVGFRYKMRSVYAHFPINVTLQDGNRTVEIRNFLGEKI  120

Query  121  IRRVEMAAGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVS  180
            +RRV +  GV    STAQKDE++VEGND++ VS +AA IQQST VK KDIRKFLDG+YVS
Sbjct  121  VRRVPLPEGVIATISTAQKDEIVVEGNDVQFVSQAAARIQQSTAVKEKDIRKFLDGIYVS  180

Query  181  EKTTVV  186
            EKTT+V
Sbjct  181  EKTTIV  186


>RL9_DICDI unnamed protein product
Length=188

 Score = 199 bits (506),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 132/185 (71%), Gaps = 0/185 (0%)

Query  1    MRTINSNQCVKIPKDIKASVKARVVTITGTRGTLKRSFKHLALDMYMPDKRTLKVEKWFG  60
            M+ INS++ V+IP+++   VK R V +TG RGTL +SF H ++D+ +  K+ L V+ WFG
Sbjct  1    MKVINSSRKVQIPENVTVDVKGRSVKVTGPRGTLSKSFDHASVDINLVGKKELTVDLWFG  60

Query  61   TKKELAAVRTVCSHIENMIKGVTFGFQYKMRAVYAHFPINCVTSENNTVIEIRNFLGEKY  120
             +K++A ++T+ S IENMI GVT G++YKMR VYAHFPIN   ++   V+EIRNF GEK 
Sbjct  61   NRKQIACIKTITSIIENMITGVTKGYEYKMRFVYAHFPINVAVTDGGRVVEIRNFFGEKI  120

Query  121  IRRVEMAAGVTVVNSTAQKDELIVEGNDIESVSGSAALIQQSTTVKNKDIRKFLDGLYVS  180
            +RR+E+  G+T   +   KDE+++ GN +E +S S A IQ  + +K KD+RKFLDG+YVS
Sbjct  121  VRRIELLDGITCYRNEKAKDEIVLTGNSLELLSQSCATIQLRSAIKYKDVRKFLDGIYVS  180

Query  181  EKTTV  185
            E+  +
Sbjct  181  ERNVL  185



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110372.1 double-strand break repair protein MRE11 [Drosophila
elegans]

Length=611
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XYZ4_DROME  unnamed protein product                                 1012    0.0   
MRE11_CAEEL  unnamed protein product                                  333     6e-105
Q8T8P1_TRYBB  unnamed protein product                                 295     5e-90 


>Q9XYZ4_DROME unnamed protein product
Length=620

 Score = 1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/621 (84%), Positives = 563/621 (91%), Gaps = 11/621 (2%)

Query  1    MEDTTGAEQDADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLG  60
            M  TT AEQDADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLG
Sbjct  1    MNGTTTAEQDADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLG  60

Query  61   GDLFHDAVPSQNSMHKCIELLRRYTFGDRPVSLEILSDQAQSFHNAVNQSVNYEDPNLNI  120
            GDLFHDAVPSQN++HKCIELLRRYTFGDRPVSLEILSDQ Q FHNAVNQSVNYEDPNLNI
Sbjct  61   GDLFHDAVPSQNALHKCIELLRRYTFGDRPVSLEILSDQGQCFHNAVNQSVNYEDPNLNI  120

Query  121  AIPVFSIHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLSQVEISPILLRKGESQLAL  180
            AIPVFSIHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDL+QVEISP+L+RKGESQLAL
Sbjct  121  AIPVFSIHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLTQVEISPVLMRKGESQLAL  180

Query  181  YGLSHIHDARLARLIKDFKVKFNCPDSAKDSD--------EEWFHLLVVHQNRADRGPKN  232
            YGLSHIHD RLARLIKDFKVKFNCP++  + +        E+WFHLLVVHQNRADRGPKN
Sbjct  181  YGLSHIHDGRLARLIKDFKVKFNCPENVANGEDGNESKEEEDWFHLLVVHQNRADRGPKN  240

Query  233  YLPEELLPDFLHLVIWGHEHDCRIEPEMNARKGFYVSQPGSSVPTSLSEGEAKKKHVGLL  292
            YLPE+LLP FLHLVIWGHEHDCRIEPE NA+K FYVSQPGSSVPTSLSEGEAKKKHVGLL
Sbjct  241  YLPEDLLPSFLHLVIWGHEHDCRIEPEENAKKRFYVSQPGSSVPTSLSEGEAKKKHVGLL  300

Query  293  EIYKGKFKLKELPLQTVRPFVFESVSLPDRAEELGLDEGDASTKVFKFAKERVEAMLEKA  352
            EIYKGKFKLK LPL+TVRPFV+ESV L D A+ELGL EGDASTKVFKFA+ERVEAM+E+A
Sbjct  301  EIYKGKFKLKPLPLETVRPFVYESVVLADHADELGLVEGDASTKVFKFAQERVEAMIERA  360

Query  353  AAQQTGHPKQPTLPLIRLRLSYSDESCMFNAIRFGQMFSTQVANVQDVVQFSKLIKRTKT  412
             AQ TGHPKQPTLPLIRLRL Y+DESCMFNAIRFG+M ST+VANVQDVVQFSK++KRTKT
Sbjct  361  VAQHTGHPKQPTLPLIRLRLLYTDESCMFNAIRFGEMLSTRVANVQDVVQFSKVVKRTKT  420

Query  413  ETIHLDKEAMRRALEADNATRVEELVDRYFDGA--NKPLRLFHSKALAEMTYRLVERADA  470
            E ++LDKEA+RRALEADNATRVEELVDRYF+ A  NKPL+LFHSKALAEMTYRL+E+ DA
Sbjct  421  EAVNLDKEALRRALEADNATRVEELVDRYFEEAKSNKPLKLFHSKALAEMTYRLLEQRDA  480

Query  471  DAAENIVKFYKEKAVDHLMETMPNEESIDNELMSFRTRHNHESLLKMLDSQGLKVKREER  530
            DAAENIVKFYKEKAVDHLME MPN+E+ID EL  FR  H H  LLKMLD+QGLKVK+EE+
Sbjct  481  DAAENIVKFYKEKAVDHLMEAMPNDENIDEELERFRALHKHGDLLKMLDTQGLKVKKEEK  540

Query  531  SSTSVLGSEANGTTAPTTGRGRGRGRATGRGRAAASGATRGKAQLEVTVNSSRTSSRQQT  590
             S SVLGSE N +TAP TGRG  RGR T R RA A+ ATRGK QL+VTV+S+RTS RQQT
Sbjct  541  -SMSVLGSEVNVSTAPATGRGAARGRGTARTRAGATAATRGKGQLDVTVSSTRTSGRQQT  599

Query  591  LLSSLKGTRNTASYVISDDSD  611
            LLSSL G+RNTASYVISDDSD
Sbjct  600  LLSSLMGSRNTASYVISDDSD  620


>MRE11_CAEEL unnamed protein product
Length=728

 Score = 333 bits (854),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 193/466 (41%), Positives = 279/466 (60%), Gaps = 32/466 (7%)

Query  7    AEQDADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELAVSEDVDMILLGGDLFHD  66
            A  +++++I+ILVATD H GYGE  A    D+   FEE+L++A  + VDMILLGGDLFH+
Sbjct  58   AHDESEDIIKILVATDIHCGYGENKANIHMDAVNTFEEVLQIATEQKVDMILLGGDLFHE  117

Query  67   AVPSQNSMHKCIELLRRYTFGDRPVSLEILSDQAQSFHNAVNQSVNYEDPNLNIAIPVFS  126
              PS+   H+  +LLR+Y     P++LE LSD + +F+ +V   VNY D NLN+ +P+F+
Sbjct  118  NNPSREVQHRVTQLLRQYCLNGNPIALEFLSDASVNFNQSVFGHVNYYDQNLNVGLPIFT  177

Query  127  IHGNHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLSQVEISPILLRKGESQLALYGLSHI  186
            IHGNHDD SG G L++LDLL  SGLVN FG+ +++ +  +SPILLRKGE++LALYG+   
Sbjct  178  IHGNHDDLSGKG-LTALDLLHESGLVNLFGKHSNIQEFIVSPILLRKGETRLALYGIGSQ  236

Query  187  HDARLARLIKDFKVKFNCPDSAKDSDEEWFHLLVVHQNRADRG----PKNYLPEELLPDF  242
             D RL R  K+  + F  P++     E+WF+L V+HQNR  R       N+LPE L+P F
Sbjct  237  RDDRLVRAFKNNSISFLRPNAGA---EDWFNLFVLHQNRPRRAMHRSTGNFLPESLIPQF  293

Query  243  LHLVIWGHEHDCRIEPEMNARK-----GFYVSQPGSSVPTSLSEGEAKKKHVGLLEIYKG  297
              L+IWGHEH+C+ +P+  A       GFY+ QPGS+V TSL+  EA +K+  L++I   
Sbjct  294  FDLLIWGHEHECKPDPQYVASSEAVGDGFYILQPGSTVATSLTPEEALQKNAFLIKIKGR  353

Query  298  KFKLKELPLQTVRPFVFESVSL----PDRAEELGLDEGDASTKVF--KFAKE-RVEAMLE  350
            KF  K +PLQTVRP V + + L    P     L  D    +   +  + A E ++  M+ 
Sbjct  354  KFASKPIPLQTVRPMVCDELLLDKIPPGSRPILKTDRPKHTDGRYIDEIAIEAKINEMIT  413

Query  351  KAAAQQTGHPKQPTLPLIRLRLSYSDESCMF---NAIRFGQMFSTQVANVQDVVQFSKLI  407
             A A++   P+QP LPLIRL++ Y  +       NA R G  +   VAN  D+V F K  
Sbjct  414  TAKAKR--RPRQPELPLIRLKVIYDGDWLNITPANAKRIGLRYENVVANAVDMV-FIKKN  470

Query  408  KRTKTETIHLDKEA----MRRALEADNATRVEELVDRYFDGANKPL  449
             + K   +  + E     M   +   +AT ++ +++ YF   N+PL
Sbjct  471  NKPKEGKLQTENEKNITEMADEMGQVSATNLQTIINDYF--INQPL  514


>Q8T8P1_TRYBB unnamed protein product
Length=763

 Score = 295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 209/599 (35%), Positives = 313/599 (52%), Gaps = 51/599 (9%)

Query  11   ADNVIRILVATDNHLGYGEKDAVRGEDSFTAFEEILELA-VSEDVDMILLGGDLFHDAVP  69
            A +  + LV +DNHLGY E+D+ RG+DSFT FEE L  A V  +VD ILL GD FHD  P
Sbjct  34   AASTFKFLVTSDNHLGYQERDSRRGDDSFTTFEECLRAARVEHEVDAILLAGDFFHDNKP  93

Query  70   SQNSMHKCIELLRRYTFGDRPVSLEILSDQAQSFHNAVNQSVNYEDPNLNIAIPVFSIHG  129
            S   + +   LLR Y  GD+P+S  +LSD  ++F        N++DPN+N+A+P+F IHG
Sbjct  94   SLGCLARTSSLLRSYVLGDKPISFTLLSDPKRNFPTHPVPLANFQDPNINVALPIFMIHG  153

Query  130  NHDDPSGFGRLSSLDLLSTSGLVNYFGRWTDLSQVEISPILLRKGESQLALYGLSHIHDA  189
            NHDDP   G  SS+D+LST+GLVNYFG  + L  + + P+LL+KG++ +ALYGL ++ D 
Sbjct  154  NHDDP--VGGTSSIDILSTAGLVNYFGHTSSLDDIVVEPVLLKKGDTYIALYGLGNVRDD  211

Query  190  RLARLIKDFKVKFNCPDSAKDSDEEWFHLLVVHQNRADRGPKNY---LPEELLPDF-LHL  245
            RL R  +  K+ F  P +    D  WF +L+ HQNR  R   N    + E +L    + L
Sbjct  212  RLHRCFRMKKLHFVQPKTEPGKD--WFKILLFHQNRGVRSGGNMKCGIYETMLAGHGMDL  269

Query  246  VIWGHEHDCRIEPEMNARKGFYVSQPGSSVPTSLSEGEAKKKHVGLLEIYKGKFKLKELP  305
            VIWG+EH+ ++EP  +  +GF + QPGS++ TSLSE E   K  G+LE+  G +++   P
Sbjct  270  VIWGNEHEQQMEP--SPSEGFDIIQPGSTILTSLSEHECNPKKYGVLEVRGGSYRVTGFP  327

Query  306  LQTVRPFVFESVSLPDRAEELGLDEGDASTKVFKFAKERVEAMLEKAAAQQTGHPK----  361
            L+++RP V  +V L    +  G    DA   V  F +  VE M+E+A  Q +  P     
Sbjct  328  LRSIRPVVRRTVEL--WRDNPGCRTLDA---VEDFLRSVVEQMIEEAEEQVSRIPDDVLK  382

Query  362  -QPTL--PLIRLRLSYSD-ESCMF---NAIRFGQMFSTQVANVQDVVQF--SKLIKRTKT  412
              P +  P++RL + ++D +S  F   N  RFGQ +   V N  ++++    K + R  +
Sbjct  383  FHPNIKFPIMRLAVDFTDPDSTTFPQPNINRFGQQYMDIVVNPSELLRPIKPKQVPRVAS  442

Query  413  ETIHLDKEAMRRALEADNATRVEELVDRYFDG-ANKPLRLFHSKALAEMTYRLVERADAD  471
                   EA    +   N + +   V   F+  A     L     ++   Y   E+ + D
Sbjct  443  SASATGGEAPVVPVPRLNTSDIRTKVAEVFNANARDACSLLSESEVSAAVYAFAEKGERD  502

Query  472  AA-ENIVKFYK--EKAVDHLM-----ETMPNEESIDNELMSFRTRHN--HESLLKMLD--  519
            A  E I +     +K+V   M     E++   ESI  E++  +   N  +E L +  +  
Sbjct  503  AIDERICELLSKCQKSVWVSMRRGESESILKPESIYEEVVRHKKEANKRYEELSRAAEEA  562

Query  520  ----SQGLKVKREERSSTSVLGSEANGTTAPTTGR---GRGRG--RATGRGRAAASGAT  569
                +QG ++    R+ T +  S  +G  +   G    G   G   AT   RA  SGAT
Sbjct  563  LQRSTQGNELTERLRADTELAASMDSGNFSRVGGELADGAALGLLSATAPRRAGGSGAT  621



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110373.2 uncharacterized protein LOC108134537 [Drosophila
elegans]

Length=393
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PLBL_DROME  unnamed protein product                                   31.2    1.7  
Q8SYD5_DROME  unnamed protein product                                 29.3    6.3  
Q9U6P7_DROME  unnamed protein product                                 29.3    6.4  


>PLBL_DROME unnamed protein product
Length=658

 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 19/28 (68%), Gaps = 0/28 (0%)

Query  240  LSKVDKLMRTHTLKIDMDGGQESVGRGH  267
            L+ VDK +RTH  + D+ G QES+  G+
Sbjct  504  LASVDKYLRTHGFRGDLLGSQESIAYGN  531


>Q8SYD5_DROME unnamed protein product
Length=474

 Score = 29.3 bits (64),  Expect = 6.3, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (6%)

Query  28  CTCRSKIRLR---PIEHASSFRLSASPSPIAIYKSSGRPAISLQLHPQIAG  75
           C C  ++RLR     +H +SF    +  P A+   SG+P   L+  P   G
Sbjct  33  CICARQMRLRNKKQSQHDASFPFQPTRRPTAVRSPSGQPPHYLKKSPSPTG  83


>Q9U6P7_DROME unnamed protein product
Length=474

 Score = 29.3 bits (64),  Expect = 6.4, Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 3/51 (6%)

Query  28  CTCRSKIRLR---PIEHASSFRLSASPSPIAIYKSSGRPAISLQLHPQIAG  75
           C C  ++RLR     +H +SF    +  P A+   SG+P   L+  P   G
Sbjct  33  CICARQMRLRNKKQSQHDASFPFQPTRRPTAVRSPSGQPPHYLKKSPSPTG  83



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110374.1 uncharacterized protein LOC108134538 [Drosophila
elegans]

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9Q1_DROME  unnamed protein product                                 355     3e-113
Q9VIP6_DROME  unnamed protein product                                 280     2e-84 
Q8MS96_DROME  unnamed protein product                                 273     2e-83 


>Q9V9Q1_DROME unnamed protein product
Length=631

 Score = 355 bits (911),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 225/623 (36%), Positives = 333/623 (53%), Gaps = 33/623 (5%)

Query  89   LEDHYGGNLTTAYFVDTAGCRMPHFEVTDDTIAQFMFKP--RPY-SCNRALVRTSDSVPG  145
             E+H+   L   Y VDT GCRM    V ++    F+++   R + + N  L   S+    
Sbjct  33   FEEHH---LVEKYSVDTKGCRMLTM-VPNEYDVMFLWRGLRRDFCASNLNLTSFSNCTYN  88

Query  146  QLLLNLDAGELLAYYNISDLSSVSCNFTEVKRKSDSANTYSPAVSFKL--DKVVQLPLDS  203
             L   ++     A + +  L S  C +  ++R +D  N Y  +  F+L  D    +   +
Sbjct  89   YLRTEVNMELAKARFGVETLESFKCMYYAMERHTDFDNRYLYSREFELLTDGNNTIEPHA  148

Query  204  EFICMWCYDSLDRLFYKDCHFFA--VDKPRVRASIKPGTERVSFNKSKDAHERLSVMLLG  261
            + I   C+ +   + Y   HF+    D+    A   P  +  S   S      LSV+++G
Sbjct  149  DIIRAECFINATSI-YNGVHFYVHPTDEWLRTAQGLPPLKLASDVGS------LSVLIVG  201

Query  262  MDSLSHLNFLRQMRQTADYIRKHLSHVELWGYNKVGDNTFPNIVPLLSGLDDQELNLACT  321
            +DS+S ++F R M +TA+++   L HVEL G+N++G++ F +++PLLSGL  QEL    +
Sbjct  202  LDSISQMHFHRSMARTANFLLS-LPHVELKGFNRLGEDGFDSLMPLLSGLSGQELKDVSS  260

Query  322  PKTLRSYDRCSFIWKRYQQAGYRTAFAEDVALLSSFNYNQNGFRKQPTDYYLRPMIMEME  381
               L S D C FIWK +Q+AGY T   ED    S F     GFRK PTD+YLRP ++EM 
Sbjct  261  --NLSSLDSCPFIWKVFQKAGYETGLGEDNIDKSLF---VKGFRKPPTDFYLRPALLEMW  315

Query  382  RNVAFKKDLNMHLCMGSRRTADVLLEYMRKLVPRMSGQLFFSFFWTVALTHDYFNFPSLL  441
                       H C      A VL E++ K++P  +   FF+F W        FN+   L
Sbjct  316  LKTRTDGLFGTH-CNEKDNYAMVLREFLFKMLPHHTSHRFFTFLWWTQGIDHLFNYGRKL  374

Query  442  DKAMLTQLTQLQESGVLNRTVVMLLSDHGLRWGSFRRTYQGMMEERQPLMIMLYPPWMNE  501
            D+  L     +  SG+L  TV++++S+HGL  G F +T QG +EE QPL I+ YP W+ E
Sbjct  375  DQPFLKMFKAIGRSGLLKNTVLLVVSNHGLNKGRFYKTVQGKVEESQPLAILCYPRWLEE  434

Query  502  RYPEAIANLRLNARRLTTPFDVHATMVQLLNLRDLEADQLLRRSAELEEPDSTLPRGISL  561
            RYP+AI NL+ N RRL T FD+HAT+  L NL  LE +QL +R  +L      +PRGISL
Sbjct  435  RYPQAIGNLKSNNRRLVTAFDLHATLQNLPNLTSLEDEQLQQRRVDLWAMGKDIPRGISL  494

Query  562  FVPIPAARTCEQAGIAAHWCTCHQRQELPTNDQRVQRAARYLVRLINNRLKDST-QCRTL  620
            F+PIP  R C  A I    C C Q + + T+D  VQRAAR ++R +N  +   T  C+TL
Sbjct  495  FLPIPDHRDCFLAAIPTANCLCQQPRNVSTSDGYVQRAARLIIRNLNKMIHTHTPPCKTL  554

Query  621  YLNSILQALIAAPHSKIVKNISTDYAVDITLRLQTKPGLGVFESTVRMTGYTTVLTGTIS  680
            YL+ +L A          + I+ ++  +  +RL   PG G FE  VR TGY   + G IS
Sbjct  555  YLDRVLTA-------DKWRRIADEHQSEFRVRLIATPGEGQFEGIVRYTGYKLAVDGHIS  607

Query  681  RLNLYGSQSYCLKDPALKMFCYC  703
            R+N Y + S C+++  ++M+C+C
Sbjct  608  RVNDYRNGSQCIRNYLIEMYCFC  630


>Q9VIP6_DROME unnamed protein product
Length=644

 Score = 280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 188/625 (30%), Positives = 299/625 (48%), Gaps = 41/625 (7%)

Query  101  YFVDTAGCRMPHFE-VTDDTIAQFMFKPRPYSCNRALVRTSDSVPGQLLLNLDAGELLA-  158
            Y+V +  C+MP     T DT++ F  K   +  N + + TS+         L   E LA 
Sbjct  31   YYVYSPVCQMPAVNPFTWDTMSNFHRKTLRHCHNDSDMVTSEFDFETHQYRLHVHEHLAK  90

Query  159  -YYNISDLSSVSCNFTEVKRKSDSA---NTYSPAVSFKLDKVVQLPLDSEFICMWCY---  211
               N    +++ C + E+ R +      N Y+      +++   +P +++++   CY   
Sbjct  91   PIMNRKGNATLECEYQEISRDNSDQKPDNAYNQLRRRPIEQHQFVPNNTDYMITSCYVRD  150

Query  212  -DSLDRLFYKDCHFFAVDKPRVRASIKPGTERVSFNKSKDAHERLSVMLLGMDSLSHLNF  270
                  L  +D   F  D+        P  +   F K +    + SV+++G+DS S +N 
Sbjct  151  VTKHRELLQQDAISFIEDR-------LPKEKVKDFVKDESEVHKPSVLIMGLDSTSRINL  203

Query  271  LRQMRQTADYIRKHLSHVELWGYNKVGDNTFPNIVPLLSGLDDQELNLACTPKTLRSYDR  330
             R M     ++R+     E+ GYNKVGDNTFPN++  L+G  ++ +   C        D 
Sbjct  204  RRAMPSVYKFVRQP-GWFEMQGYNKVGDNTFPNLLAALTGDSEKGVGDYCDVTKPGCLDS  262

Query  331  CSFIWKRYQQAGYRTAFAEDVALLSSFNYNQNGFRKQPTDYYLRPMIMEMERNVAFKKDL  390
             +FIWKR+++A Y TAFAED + +S+FNY + GF KQPTDYYLRP++  +E+      D 
Sbjct  263  LNFIWKRFKKANYTTAFAEDCSSISTFNYLKPGFVKQPTDYYLRPLLFAIEKQFKVTNDF  322

Query  391  NMHLCMGSRRTADVLLEYMRKLVPRMSGQL-FFSFFWTVALTHDYFNFPSLLDKAMLTQL  449
                C+G   +   + ++ ++ + R  G+   F F W+ + THDY+   + LD  +   L
Sbjct  323  GFAYCVGRHLSFSYVWDFGQQFIDRFLGRSPMFGFLWSNSFTHDYYEGATALDNLLWKYL  382

Query  450  TQLQESGVLNRTVVMLLSDHGLRWGSFRRTYQGMMEERQPLMIMLYPPWMNERYPEAIAN  509
               +ES +  +++V+L+SDHG R+ + RR   G  EER P+M +  PPW   +YP   +N
Sbjct  383  KSFEESNLFQKSIVILMSDHGHRYNTLRRASTGYFEERMPMMFIYLPPWFRRKYPHLASN  442

Query  510  LRLNARRLTTPFDVHATMVQLLNLRDLEADQLLRRSAELEEPDSTLPRGI----SLFVPI  565
            L  N  RL++ +DV+ T+  LL L     D+          PD+   R      SLF  +
Sbjct  443  LGKNQNRLSSNYDVYMTLQHLLQLDSKSVDEF---------PDNLRARQCKSCQSLFFEL  493

Query  566  PAARTCEQAGIAAHWCTCHQRQELPTNDQRVQRAARYLVRLINNRLKD---STQCRTLYL  622
            P  RTC+ AGI   WC C Q  E  TN   V   A  +V+ +N  L     S  C    L
Sbjct  494  PFNRTCQMAGIEEKWCCC-QPTETITNSPHVSTIAEAIVQRMNEHLISHNLSDLCHNFTL  552

Query  623  NSILQALIAAPHSKIVKNISTDYAVDITLRLQTKPGLGVFESTVRMTGYTTVL----TGT  678
            + + +A      S  ++    +  V I +  +T P   +FE+TVR    T  L       
Sbjct  553  DYVEKADRKTILSNGLRPADKNEQVYIIV-FETVPKNPIFEATVRWNSRTQRLLHFDVEE  611

Query  679  ISRLNLYGSQSYCLKDPALKMFCYC  703
            +SRL  Y + + C+     K +C C
Sbjct  612  LSRLTSYKNDANCINRKNAKKYCIC  636


>Q8MS96_DROME unnamed protein product
Length=503

 Score = 273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/478 (33%), Positives = 242/478 (51%), Gaps = 24/478 (5%)

Query  238  PGTERVSFNKSKDAHERLSVMLLGMDSLSHLNFLRQMRQTADYIRKHLSHVELWGYNKVG  297
            P  +   F K +    + SV+++G+DS S +N  R M     ++R+     E+ GYNKVG
Sbjct  30   PKEKVKDFVKDESEVHKPSVLIMGLDSTSRINLRRAMPSVYKFVRQP-GWFEMQGYNKVG  88

Query  298  DNTFPNIVPLLSGLDDQELNLACTPKTLRSYDRCSFIWKRYQQAGYRTAFAEDVALLSSF  357
            DNTFPN++  L+G  ++ +   C        D  +FIWKR+++A Y TAFAED + +S+F
Sbjct  89   DNTFPNLLAALTGDSEKGVGDYCDVTKPGCLDSLNFIWKRFKKANYTTAFAEDCSSISTF  148

Query  358  NYNQNGFRKQPTDYYLRPMIMEMERNVAFKKDLNMHLCMGSRRTADVLLEYMRKLVPRMS  417
            NY + GF KQPTDYYLRP++  +E+      D     C+G   +   + ++ ++ + R  
Sbjct  149  NYLKPGFVKQPTDYYLRPLLFAIEKQFKVTNDFGFAYCVGRHLSFSYVWDFGQQFIDRFL  208

Query  418  GQL-FFSFFWTVALTHDYFNFPSLLDKAMLTQLTQLQESGVLNRTVVMLLSDHGLRWGSF  476
            G+   F F W+ + THDY+   + LD  +   L   +ES +  +++V+L+SDHG R+ + 
Sbjct  209  GRSPMFGFLWSNSFTHDYYEGATALDNLLWKYLKSFEESNLFQKSIVILMSDHGHRYNTL  268

Query  477  RRTYQGMMEERQPLMIMLYPPWMNERYPEAIANLRLNARRLTTPFDVHATMVQLLNLRDL  536
            RR   G  EER P+M +  PPW   +YP   +NL  N  RL++ +DV+ T+  LL L   
Sbjct  269  RRASTGYFEERMPMMFIYLPPWFRRKYPHLASNLGKNQNRLSSNYDVYMTLQHLLQLDSK  328

Query  537  EADQLLRRSAELEEPDSTLPRGI----SLFVPIPAARTCEQAGIAAHWCTCHQRQELPTN  592
              D+          PD+   R      SLF  +P  RTC+ AGI   WC C Q  E  TN
Sbjct  329  SVDEF---------PDNLRARQCKSCQSLFFELPFNRTCQMAGIEEKWCCC-QPTETITN  378

Query  593  DQRVQRAARYLVRLINNRLKD---STQCRTLYLNSILQALIAAPHSKIVKNISTDYAVDI  649
               V   A  +V+ +N  L     S  C    L+ + +A      S  ++    +  V I
Sbjct  379  SPHVSTIAEAIVQRMNEHLISHNLSDLCHNFTLDYVEKADRKTILSNGLRPADKNEQVYI  438

Query  650  TLRLQTKPGLGVFESTVRMTGYTTVL----TGTISRLNLYGSQSYCLKDPALKMFCYC  703
             +  +T P   +FE+TVR    T  L       +SRL  Y + + C+     K +C C
Sbjct  439  IV-FETVPKNPIFEATVRWNSRTQRLLHFDVEELSRLTSYKNDANCINRKNAKKYCIC  495



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110375.1 transcription factor btd isoform X1 [Drosophila
elegans]

Length=329
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIRA_DROME  unnamed protein product                                   36.2    0.036


>HIRA_DROME unnamed protein product
Length=1047

 Score = 36.2 bits (82),  Expect = 0.036, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 9/65 (14%)

Query  229   PVVVPAVSTVLSPTVVIADDVVSTTSTPP---------ATASGAGAGAGGATAAAAAGGA  279
             P + P + T+ SPTV I D+++S +S+ P         + AS +G  A  + AA+ AG A
Sbjct  978   PSLSPEIQTLDSPTVCIDDEILSASSSLPPLDTSPVEVSPASTSGGAASTSPAASVAGSA  1037

Query  280   PAGSA  284
             P  S+
Sbjct  1038  PVSSS  1042



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110376.1 transcription factor btd isoform X2 [Drosophila
elegans]

Length=298
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIRA_DROME  unnamed protein product                                   36.2    0.032


>HIRA_DROME unnamed protein product
Length=1047

 Score = 36.2 bits (82),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 9/65 (14%)

Query  198   PVVVPAVSTVLSPTVVIADDVVSTTSTPP---------ATASGAGAGAGGATAAAAAGGA  248
             P + P + T+ SPTV I D+++S +S+ P         + AS +G  A  + AA+ AG A
Sbjct  978   PSLSPEIQTLDSPTVCIDDEILSASSSLPPLDTSPVEVSPASTSGGAASTSPAASVAGSA  1037

Query  249   PAGSA  253
             P  S+
Sbjct  1038  PVSSS  1042



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110377.1 transcription factor btd isoform X3 [Drosophila
elegans]

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HIRA_DROME  unnamed protein product                                   35.8    0.039


>HIRA_DROME unnamed protein product
Length=1047

 Score = 35.8 bits (81),  Expect = 0.039, Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 9/65 (14%)

Query  196   PVVVPAVSTVLSPTVVIADDVVSTTSTPP---------ATASGAGAGAGGATAAAAAGGA  246
             P + P + T+ SPTV I D+++S +S+ P         + AS +G  A  + AA+ AG A
Sbjct  978   PSLSPEIQTLDSPTVCIDDEILSASSSLPPLDTSPVEVSPASTSGGAASTSPAASVAGSA  1037

Query  247   PAGSA  251
             P  S+
Sbjct  1038  PVSSS  1042



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110378.1 D-3-phosphoglycerate dehydrogenase [Drosophila
elegans]

Length=334
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SERA_DICDI  unnamed protein product                                   140     2e-38
CTBP1_CAEEL  unnamed protein product                                  139     2e-36
CTBP_DROME  unnamed protein product                                   122     4e-31


>SERA_DICDI unnamed protein product
Length=407

 Score = 140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 98/311 (32%), Positives = 160/311 (51%), Gaps = 17/311 (5%)

Query  9    KVLVCDAVDKSCVELLEQHGINV-TYKLKLPMAELCDEVKNYDAAIVRSDTKITAEVLAA  67
            K+L+ + +  + ++  E+ G  V +    LP  ++ +++K+     +RS TK+T ++L+ 
Sbjct  13   KILLLENIHIAAIKQFEEQGFQVESISSSLPEDKIIEKIKDVHVLGLRSKTKVTEKILSE  72

Query  68   GAGSLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGSLARPVVPAG  127
             A  L  +G    G D +D+  A    V V N+P  NS S  EL    I +L+R +    
Sbjct  73   -AKRLLAIGCFCIGTDQVDLIEAEKRGVPVFNSPFCNSRSVAELIICEIITLSRKLGDRS  131

Query  128  QSMKEGRWDRKLYAGTELYGKTLAVLGLGRIGREVAVRMKTWGMRIIGYDPITTEAEAKA  187
              M    W ++     E+ GKTL ++G G IG +++V  +  GM ++ YD     A    
Sbjct  132  TEMHNKIWRKESANCHEIRGKTLGIIGYGHIGSQLSVLAEAMGMSVLYYDI----ARRLP  187

Query  188  AGIEKMT--LEEIWPLADYITVHTPLIPATRNLISTETLAKCKQGVKVVNVARGGIIDEQ  245
             G  KM   ++ +   ++++T+H P    T  LI  E +   K+G  ++N +RG ++   
Sbjct  188  LGNSKMCPDMKTLLENSNFVTLHVPDTKETVGLIGEEEINTMKKGSYLLNASRGKVVQIP  247

Query  246  AVLDGLESGKVAGAAFDVYPEEPPKSAVTK----ALIGHPKVVATPHLGASTSEAQVRVA  301
             + + L SG +AGAA DVYPEEP  SA  K     L   P  + TPH+G ST EAQ  + 
Sbjct  248  HLANALRSGHLAGAAVDVYPEEP--SANCKDWECELQKCPNTILTPHIGGSTEEAQEAIG  305

Query  302  VEVAE---QFI  309
            +EV++   QFI
Sbjct  306  LEVSDLIVQFI  316


>CTBP1_CAEEL unnamed protein product
Length=727

 Score = 139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 142/271 (52%), Gaps = 17/271 (6%)

Query  72   LKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSMK  131
            LKVV R G G+DNIDV AAT   + V + PG       + T  LI  L R      +S  
Sbjct  243  LKVVFRIGYGIDNIDVKAATELGIAVCHAPGDYVEDVADSTLSLILDLFRRTYWHAKSYS  302

Query  132  EGRWD------RKLYAGTE-LYGKTLAVLGLGRIGREVAVRMKTWGMRIIGYDPITTEAE  184
            E R        R+   G++ + G  L +LG GR+G  V +R + +G+ II YDP   E  
Sbjct  303  ETRKTIGADQVRENAVGSKKVRGSVLGILGCGRVGTAVGLRARAFGLHIIFYDPFVREGH  362

Query  185  AKAAGIEKM-TLEEIWPLADYITVHTPLIPATRNLISTETLAKCKQGVKVVNVARGGIID  243
             KA G E++ T++E    +D I++H  L   TR +I+ ++L +CK GV +VN +  G+I+
Sbjct  363  DKALGFERVYTMDEFMSRSDCISLHCNLGDETRGIINADSLRQCKSGVYIVNTSHAGLIN  422

Query  244  EQAVLDGLESGKVAGAAFDVYPEEPPKSAVTKALIGHPKVVATPHLG----ASTSEAQVR  299
            E  +   L++G V GAA DV+            L+G P ++ TPH      AS  + ++ 
Sbjct  423  ENDLAAALKNGHVKGAALDVHDSVRFDPNCLNPLVGCPNIINTPHSAWMTEASCKDLRIN  482

Query  300  VAVEVAEQFIALNGTSPKYTSYAGVINKDAL  330
             A E+ +   A+NG  P+  ++   INK+A+
Sbjct  483  AAKEIRK---AINGRCPQDLTH--CINKEAV  508


>CTBP_DROME unnamed protein product
Length=476

 Score = 122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 131/255 (51%), Gaps = 21/255 (8%)

Query  71   SLKVVGRAGAGVDNIDVPAATAHNVVVLNTPGGNSISACELTCILIGSLARPVVPAGQSM  130
            +L+++ R G+G DNIDV AA    + V N PG       + T  LI +L R        +
Sbjct  91   ALRIIVRIGSGTDNIDVKAAGELGIAVCNVPGYGVEEVADTTMCLILNLYRRTYWLANMV  150

Query  131  KEGRWDRKLYAGTE-----------LYGKTLAVLGLGRIGREVAVRMKTWGMRIIGYDPI  179
            +EG    K + G E           + G TL ++GLGRIG  VA+R K +G  +I YDP 
Sbjct  151  REG----KKFTGPEQVREAAHGCARIRGDTLGLVGLGRIGSAVALRAKAFGFNVIFYDPY  206

Query  180  TTEAEAKAAGIEKM-TLEEIWPLADYITVHTPLIPATRNLISTETLAKCKQGVKVVNVAR  238
              +   K+ G+ ++ TL+++   +D +++H  L     +LI+  T+ + + G  +VN AR
Sbjct  207  LPDGIDKSLGLTRVYTLQDLLFQSDCVSLHCTLNEHNHHLINEFTIKQMRPGAFLVNTAR  266

Query  239  GGIIDEQAVLDGLESGKVAGAAFDVYPEEPPKSAVTKALIGHPKVVATPHLG----ASTS  294
            GG++D++ +   L+ G++  AA DV+ E  P +    AL   P ++ TPH      AS +
Sbjct  267  GGLVDDETLALALKQGRIRAAALDVH-ENEPYNVFQGALKDAPNLICTPHAAFFSDASAT  325

Query  295  EAQVRVAVEVAEQFI  309
            E +   A E+    +
Sbjct  326  ELREMAATEIRRAIV  340



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110379.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110387.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


Query= XP_017110395.1 soluble guanylate cyclase 88E isoform X1 [Drosophila
elegans]

Length=1108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1992    0.0   
GCY31_CAEEL  unnamed protein product                                  521     2e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1992 bits (5160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1007/1115 (90%), Positives = 1037/1115 (93%), Gaps = 25/1115 (2%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKLRKITFSNSSSMDATTTT  900
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL+KITFSNSSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  901   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  957
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  958   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1017
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1018  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1073
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1074  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1108
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 521 bits (1341),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.321    0.137    0.411 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 15366306386


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110399.1 uncharacterized protein LOC108134558 [Drosophila
elegans]

Length=140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7JQI1_DROME  unnamed protein product                                 28.1    2.6  
Q8MPY1_CAEEL  unnamed protein product                                 26.9    8.1  


>Q7JQI1_DROME unnamed protein product
Length=852

 Score = 28.1 bits (61),  Expect = 2.6, Method: Composition-based stats.
 Identities = 14/51 (27%), Positives = 27/51 (53%), Gaps = 14/51 (27%)

Query  23   KGRKEEGKILVLDQLALQ--------------QQISANFIFHAISNYKKTP  59
            KG +++GK+ +LD++A+               +Q +A  +FH +S   +TP
Sbjct  215  KGLRDQGKMALLDEIAMDNIEKLFHVMIFPALRQKAAPVVFHMLSTINQTP  265


>Q8MPY1_CAEEL unnamed protein product
Length=725

 Score = 26.9 bits (58),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 18/48 (38%), Positives = 21/48 (44%), Gaps = 11/48 (23%)

Query  92   GHKDAHWLEHAYFQQELFELVHEKYSAARGCLSRDKRNLLLTGGQPLL  139
            G KD+  L+ A   Q LFEL   K+               LT GQPLL
Sbjct  518  GPKDSRMLQAASRSQSLFELSGSKHFMGS-----------LTSGQPLL  554



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110400.1 histone H1-like [Drosophila elegans]

Length=249
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H1_DROME  unnamed protein product                                     291     7e-100
H11_CAEEL  unnamed protein product                                    53.5    2e-08 
H1_DICDI  unnamed protein product                                     52.4    3e-08 


>H1_DROME unnamed protein product
Length=256

 Score = 291 bits (746),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 217/256 (85%), Positives = 228/256 (89%), Gaps = 7/256 (3%)

Query  1    MSDSAVATSASPVAAPPAPVEKKVAAKKATGSAATKAKKPTAPPSHPPTQQMVDASIKNL  60
            MSDSAVATSASPVAAPPA VEKKV  KKA+GSA TKAKK +A PSHPPTQQMVDASIKNL
Sbjct  1    MSDSAVATSASPVAAPPATVEKKVVQKKASGSAGTKAKKASATPSHPPTQQMVDASIKNL  60

Query  61   KERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSAS  120
            KERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSAS
Sbjct  61   KERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKLIQTKGKGASGSFKLSAS  120

Query  121  AKKDPKP----KVASVDKKVKSKKVAVKKTGVTAKK-AAGAADKKPKAKKAVATKKTAEK  175
            AKK+  P    KV S +KKV+SKKVA KK GV++KK A GAADKKPKAKKAVATKKTAE 
Sbjct  121  AKKEKDPKAKSKVLSAEKKVQSKKVASKKIGVSSKKTAVGAADKKPKAKKAVATKKTAEN  180

Query  176  KKTEKAKAKDAKKTGTVKAKPAATKAKTTAAKPK--VAKAPKAKPAASAKPKKVIKKAAA  233
            KKTEKAKAKDAKKTG +K+KPAATKAK TAAKPK  VAKA KAKPA SAKPKK +KKA+ 
Sbjct  181  KKTEKAKAKDAKKTGIIKSKPAATKAKVTAAKPKAVVAKASKAKPAVSAKPKKTVKKASV  240

Query  234  PATAKKPKAKTTAAKK  249
             ATAKKPKAKTTAAKK
Sbjct  241  SATAKKPKAKTTAAKK  256


>H11_CAEEL unnamed protein product
Length=208

 Score = 53.5 bits (127),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 46/77 (60%), Gaps = 2/77 (3%)

Query  43   PPSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKC--DAQKLAPFIKKYLKSAVVN  100
            P +HPP   M+  +IK LK+R G+S  AI K+I+  YK   +  ++   +++ LK  V +
Sbjct  35   PVAHPPYINMIKEAIKQLKDRKGASKQAILKFISQNYKLGDNVIQINAHLRQALKRGVTS  94

Query  101  GKLIQTKGKGASGSFKL  117
              L+Q  G GA+G F++
Sbjct  95   KALVQAAGSGANGRFRV  111


>H1_DICDI unnamed protein product
Length=180

 Score = 52.4 bits (124),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 44/92 (48%), Gaps = 5/92 (5%)

Query  44   PSHPPTQQMVDASIKNLKERGGSSLLAIKKYITATYKCDAQKLAPFIKKYLKSAVVNGKL  103
            P+HP  Q M+  +I + K+R GSS  AI KYI A Y          +K  LK  V  G L
Sbjct  22   PNHPTYQVMISTAIAHYKDRTGSSQPAIIKYIEANYNVAPDTFKTQLKLALKRLVAKGTL  81

Query  104  IQTKGKGASGSFKLSASAKKDPKPKVASVDKK  135
               K      S+KLS   KK+ +  +  V KK
Sbjct  82   TMVK-----ASYKLSEEGKKEHQATLGPVAKK  108



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110401.1 soluble guanylate cyclase 88E isoform X2 [Drosophila
elegans]

Length=1101
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GCY8E_DROME  unnamed protein product                                  1972    0.0   
GCY31_CAEEL  unnamed protein product                                  520     3e-171
GCYDB_DROME  unnamed protein product                                  364     2e-112


>GCY8E_DROME unnamed protein product
Length=1097

 Score = 1972 bits (5110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1001/1115 (90%), Positives = 1030/1115 (92%), Gaps = 32/1115 (3%)

Query  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
             MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQ VLGV
Sbjct  1     MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQQVLGV  60

Query  61    SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
             SER+FMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI
Sbjct  61    SERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120

Query  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
             CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL
Sbjct  121   CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180

Query  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240
             TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG
Sbjct  181   TFDNRAFTLASLAMTREEKHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILPELLG  240

Query  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDSQNEDLLQHEDGSEPEKS  300
             KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFD QNEDLLQHEDGSEPEKS
Sbjct  241   KKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKS  300

Query  301   LRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360
             LRLKGQMVYMENWRMIMFLGTPVMPDL SLITTGLYINDLSMHDFSRDLMLAGTQQSVEL
Sbjct  301   LRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVEL  360

Query  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420
             KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV
Sbjct  361   KLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRGENPIDTCEMFDSV  420

Query  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480
             SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD
Sbjct  421   SILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPD  480

Query  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540
             KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD
Sbjct  481   KDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGD  540

Query  541   TVNTASRMESTSIAMKVHISESTKILIGPNYKILERGEIEVKGKGTMGTYWLEERENRLP  600
             TVNTASRMESTSIAMKVHISESTK+LIGPNYKI+ERGEI+VKGKGTMGTYWLEERENRLP
Sbjct  541   TVNTASRMESTSIAMKVHISESTKVLIGPNYKIIERGEIDVKGKGTMGTYWLEERENRLP  600

Query  601   LQLTATLQVHPVSPASSTGTSKPKAIMPPVTKALTPLVPVSVSLEVSIPATTIPTVDVVA  660
             LQLTA LQVHP+SP   T T K KAIMPPV+K LTP++PVSVSL  S+P + +P VDV+A
Sbjct  601   LQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTPMMPVSVSLAASMPTSNVPAVDVMA  660

Query  661   PSSSISGLVLTAAAAAHMSLHHQAVVAAGLSGDSGPTVAGGVGDSASSGGGDAAAAAAGG  720
              SSSISGL LTAAAAAHMSLHHQAVVA  L+G S       V            A+ A G
Sbjct  661   SSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPSV------------ASGATG  708

Query  721   GGAAAGVPADDRNSRIYSPVTFKDVARRSVANSPVRGSAGFPCSDQEKRRESRSNSTGHV  780
               A  G P+DDRNSRIYSPVTFKDVARRSVANSPVR  A     DQE+RRESRSNSTGHV
Sbjct  709   AAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQ---PDQERRRESRSNSTGHV  765

Query  781   FMRSPSDIFGSLILDTEEFLEDLQISRSSLANNNNNPPPCGFSPTPPFRIGSAPSKPRPS  840
             FMR+PS+IFGSLILDTEEFLEDLQISRSSLANNNNN  PCGFSPTPPFRIGSAP KPRPS
Sbjct  766   FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPCGFSPTPPFRIGSAPPKPRPS  825

Query  841   NPDKFTPEELAAMDQMTPPSTAPARETASCSSASLDRDKAAKL-------SSSMDATTTT  893
             NPDKFTPEELAAMDQ+TPPSTAPARETASCSSASLDRDKA KL       SSS+DA TT 
Sbjct  826   NPDKFTPEELAAMDQLTPPSTAPARETASCSSASLDRDKATKLKKITFSNSSSLDA-TTP  884

Query  894   TAVAAVVCPMRSKTPPMAQQPV---VQASTSKGDPKRPGSKDSVSSISLHSPPPHRSNSA  950
             TA+AAVVCPMR+K+PPMA  PV   VQASTSKGD +RPGSKDSVSSISLHSPPPHRSNSA
Sbjct  885   TALAAVVCPMRTKSPPMAVAPVMHMVQASTSKGDGQRPGSKDSVSSISLHSPPPHRSNSA  944

Query  951   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVHEVESQSATKAANMRLALFGHDRGGG  1010
             PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEV EVESQS  KAANMRLAL+GHD GG 
Sbjct  945   PARPHSMSKAARKAFLAAKQTKAMEKLDKMIEEVQEVESQSVAKAANMRLALYGHDGGGD  1004

Query  1011  GDLAAGGCPLFLPPPPQQQQR----LMPSSISDSGLCSHGHSHAPSCHHLEPKMSNSQSF  1066
                AAGGCPLFLPPPPQQQQ+    LMPSSISDSGLCSHGHSHAPSCHH++PKM+NSQSF
Sbjct  1005  L--AAGGCPLFLPPPPQQQQQQQQSLMPSSISDSGLCSHGHSHAPSCHHMDPKMTNSQSF  1062

Query  1067  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1101
             QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL
Sbjct  1063  QHSPRGGITHQCCSGFGHGNGRHSHRMHSNACRIL  1097


>GCY31_CAEEL unnamed protein product
Length=702

 Score = 520 bits (1339),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 278/622 (45%), Positives = 399/622 (64%), Gaps = 23/622 (4%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYGL++++++ YIK  YGE  W +++  +G+   +F + + + E L  KL      V G 
Sbjct  1    MYGLIIDHIATYIKEKYGESTWSEVKFVSGVTDDTFQMDKKFSEGLSHKLIWACHDVTGD  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
               E M  +G  F  F+ ++ +++VL VLGR    FLNGLDNLHEYL+F++P+++ PSF 
Sbjct  61   PVDELMTNIGTSFYKFLTKFEFNKVLRVLGRTFPQFLNGLDNLHEYLRFTFPKLKPPSFY  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQL  180
            CE+E++ GLTLHYRSKRRGF++Y  GQIR +++  +  E+ IEL+  E   +  HV  +L
Sbjct  121  CEHESRTGLTLHYRSKRRGFLHYVQGQIRNISQELFQTEVVIELLDIEHDLNLEHVIMRL  180

Query  181  TFDNRAFTLASLAMTREE----KHLPISAHVLFEIFPFCMVFGADMVVRSIGNSLMVILP  236
             F+N  F     A         + + I++ + F+IFPF +VF   M +R+IG  L+ ++ 
Sbjct  181  HFNNLDFNRQGTAYRNLNDSILEKVKITSDIFFDIFPFIIVFNRGMRIRNIGIGLLRVMA  240

Query  237  ELLGKKITAWFDLVRPLIAFKFQTILNRTNNIFELVTVDPVTER-----------FDSQN  285
             ++GKKI   F L+RP I F+++ I+  +NNIFEL++ DP+ E             D   
Sbjct  241  GIVGKKINQTFLLMRPFIRFRWEEIMLHSNNIFELISSDPIQEDEDGILVYKTTDVDQMT  300

Query  286  EDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            E+  +  DG E EK L LKGQM YME W  I F+G PVM  L  +  +GL+IND ++HD 
Sbjct  301  EERHRMGDG-EREKFLSLKGQMFYMEEWESICFVGIPVMSHLPQMYKSGLFINDFALHDS  359

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SRDL+LA TQQS ELKL L QE QKS+ + E+M  L +E RRTD+LLYQM+PK VA++LR
Sbjct  360  SRDLVLASTQQSAELKLLLHQEAQKSRNMRENMNRLKKERRRTDKLLYQMLPKSVANQLR  419

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKV  465
             GE+ +  CE FDSV+ILF+DIV FT++CS +TP+EV+  L  +Y+ FDK+ + + VYKV
Sbjct  420  HGESAVACCERFDSVTILFTDIVEFTKMCSSLTPLEVIEFLKVIYTNFDKIIDTHGVYKV  479

Query  466  ETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQH-LRIRVGVHSGAVV  524
            ETIGDAYMVV+GAP K  + AE + D A   +     + + +   H + IR GVHSG+VV
Sbjct  480  ETIGDAYMVVSGAPTKTEHDAEFILDCASQFLVEAGKMVNMNNKIHKIDIRAGVHSGSVV  539

Query  525  AGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGPN----YKILERGEIE  580
            AG+VGL MPRYCLFG+TV  A++ME  S  MK+ +SE+T   I  +    Y+   R EIE
Sbjct  540  AGVVGLSMPRYCLFGETVYVANKMEQNSSPMKILVSETTHNKIEESDPGLYQFERREEIE  599

Query  581  VKGKGTMGTYWLEERE--NRLP  600
            +K   T+ T+++  R   +R+P
Sbjct  600  IKDDQTIQTFFVVSRHGPHRVP  621


>GCYDB_DROME unnamed protein product
Length=669

 Score = 364 bits (935),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 229/672 (34%), Positives = 349/672 (52%), Gaps = 84/672 (13%)

Query  1    MYGLLLENLSEYIKSVYGEEKWEDIRRQAGIDSPSFSVHQVYPENLLQKLAKKAQAVLGV  60
            MYG+L E++  YI+  YG E W  + +       SF  HQ+YP+ L+   A    A  G 
Sbjct  1    MYGMLYESVQHYIQQEYGMETWRKVCQIVDCKHQSFKTHQIYPDKLMPDFAAALSASTGE  60

Query  61   SEREFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFI  120
            S    M+  G  FV F   +GYD+++   GR+  DFL  +DN+H  ++F+YP+M++PS  
Sbjct  61   SFDFCMNFFGRCFVRFFSNFGYDKMIRSTGRYFCDFLQSIDNIHVQMRFTYPKMKSPSMQ  120

Query  121  CENETKQGLTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREE----------IL  170
              N    G  + YRS R G   Y +GQ+ EVA+ FY  +M   ++  +          I 
Sbjct  121  LTNMDDDGAVILYRSGRTGMSKYLIGQMTEVAKEFYGLDMTAYVLESQNDICGGTAGPIK  180

Query  171  FD----TVHVTFQLTFDNRAFT---LASLAMTREEKHLPISAHVLFEIFPFCMVFGADMV  223
                  TV V ++L FDNR +    +  +A   + K   +  +V  E+FPF +V   DM 
Sbjct  181  LTEGPLTVIVKYRLDFDNRDYMAKRVNVIAHPSQLKMPSVDLNVFLELFPFTIVLDHDMK  240

Query  224  VRSIGNSLM--VIL-------PELLGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVT  273
            +   G  ++   IL          +G  I   F   RP     +++TIL     +FE   
Sbjct  241  ITLAGEKIVETWILHNPGVNPKTFIGSHILERFKCRRPKDTQIQWETILQMRTVLFEFEL  300

Query  274  VDPVTER--------FDSQNED------------------------------LLQHEDGS  295
            +     R        FD +N D                                  +D  
Sbjct  301  IRTGHNRAAYDAALNFDFENFDEASSLNEAQAMALASAKEFSAENAKEEAAAAATSKDEI  360

Query  296  EPE----------KSLRLKGQMVYMENWRMIMFLGTPVMPDLNSLITTGLYINDLSMHDF  345
            +P           +S+ LKGQM Y+++   ++FL +P++ +L+ L   GLY+NDL+ H  
Sbjct  361  DPATGQRRHSVGLRSILLKGQMFYIKDVDSLIFLCSPLIENLDELHGIGLYLNDLNPHGL  420

Query  346  SRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLR  405
            SR+L++AG Q   +L++  ++E+Q+S +LE+S+ L D   R+ DELLY MIP+ +A+R+R
Sbjct  421  SRELVMAGWQHCSKLEIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAERMR  480

Query  406  RGENPIDTCEMFDSVSILFSDIVTFTEICSRIT--PMEVVSMLNAMYSIFDKLTERNSVY  463
            + E  +  C+ F+ VS++F +++   +  S      M+ V+ LN ++S  D+      VY
Sbjct  481  KSEEHV--CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVY  538

Query  464  KVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDPSTGQHLRIRVGVHSGAV  523
            KVET+G  YM V+GAPD +  HAE  CD+AL ++  +     P       IRVG++SG V
Sbjct  539  KVETVGMVYMAVSGAPDVNPLHAEHACDLALRVMKKVKAHALPGVA----IRVGINSGPV  594

Query  524  VAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKILIGP-NYKILERGEIEVK  582
            VAG+VG+K+PRYCLFGDTVNTASRMES+S    + +S  T + +    YK+  RG ++VK
Sbjct  595  VAGVVGMKVPRYCLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVK  654

Query  583  GKGTMGTYWLEE  594
            GKG M TYWL E
Sbjct  655  GKGEMETYWLLE  666



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110402.1 protein Turandot E-like [Drosophila elegans]

Length=159
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TOTM_DROME  unnamed protein product                                   91.3    4e-24
TOTF_DROME  unnamed protein product                                   89.0    2e-23
TOTE_DROME  unnamed protein product                                   86.7    3e-22


>TOTM_DROME unnamed protein product
Length=131

 Score = 91.3 bits (225),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 70/131 (53%), Gaps = 0/131 (0%)

Query  1    MSFIVHVGCFLVVLGCISGTGHAENNAEFTAKAREMLELYANPSADKSAQSRKIPELAEF  60
            M+  +++ C +V    + G  +AEN  EF  + + +  +Y + S D++ + R I  L  F
Sbjct  1    MNPTIYLSCLMVFSVFLLGKVNAENEDEFVTEKQRLFSVYGDSSVDEATKYRNIDSLVTF  60

Query  61   YEKYKDLIDLTDQERQRANDLLTRYKAEKAKQVYVDGVPQQGGFFTALGVGLLVSASTEI  120
            Y+KY   + L      RA+DLL RYK E A+ V VDG P QGGF+  L   L+V    EI
Sbjct  61   YDKYFTRLQLKPDLNTRAHDLLRRYKEENARVVLVDGTPAQGGFWLPLVKLLIVQLGVEI  120

Query  121  GVEVYKRATSS  131
              E  KRA  S
Sbjct  121  ASEGVKRAIES  131


>TOTF_DROME unnamed protein product
Length=125

 Score = 89.0 bits (219),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 2/82 (2%)

Query  22   HAENNAEFTAKAREMLELYANPSADKSAQSRKIPELAEFYEKYKDLIDLTDQERQRANDL  81
            HA+++ EFTAKAR+ML ++ N   D+  +SR +P L EFYEKY   + LT Q+R  AN++
Sbjct  21   HAQSDPEFTAKARQMLAVFGNSEVDRYTKSRNLPALIEFYEKYSSRLPLTVQDRTYANNV  80

Query  82   LTRYKAEKAKQVYVDGVPQQGG  103
            + RY+A   +Q  VDGVP QGG
Sbjct  81   IRRYRAHNNQQ--VDGVPAQGG  100


>TOTE_DROME unnamed protein product
Length=134

 Score = 86.7 bits (213),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 66/102 (65%), Gaps = 5/102 (5%)

Query  18   SGTGHAENNAEFTAKAREMLELYANPSADKSAQSRKIPELAEFYEKYKDLIDLTDQERQR  77
             G+GH ++ AEF AK+RE+ +++ NPS DK  ++R +P L  FYEKY   + LT QER  
Sbjct  33   LGSGHCQSEAEFAAKSREIAQVFGNPSVDKYTKARNLPTLIAFYEKYSSRLRLTPQERIS  92

Query  78   ANDLLTRYKAEKAKQVYVDGVPQQGGFFTAL---GVGLLVSA  116
             N+ + +YKA++ +Q  VDGV  QGG+ + +    + ++V A
Sbjct  93   INNAMRQYKAQRNQQ--VDGVSAQGGWLSDIIKTAISIIVKA  132



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110403.1 venom allergen 5.01 [Drosophila elegans]

Length=375
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VIN6_DROME  unnamed protein product                                 412     1e-144
Q2PDZ4_DROME  unnamed protein product                                 111     2e-27 
Q8T499_DROME  unnamed protein product                                 97.1    7e-23 


>Q9VIN6_DROME unnamed protein product
Length=316

 Score = 412 bits (1060),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 234/306 (76%), Gaps = 10/306 (3%)

Query  1    MIKWNRLLSIILLIHQAKSSNKWCRKNLCNGQHVLCTDNGKIQSTCPRDATAMVKMSQDM  60
            MIK   LL   L I    +S+KWC+ +LC GQHVLC DNG  +STCP+ A AMVKMS DM
Sbjct  1    MIKCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDM  60

Query  61   KNLIVDQHNEYRNKFAGGLDGHPKAARMTTMEWDSQLAKVADALVRRCQPIRDECGKTLK  120
              LIVD+HNEYRNKFAGG+D +PKAARMTT+EWD +LAKVAD LVRRC+PIRD+C  T  
Sbjct  61   IALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPN  120

Query  121  YHQGEASYSLEKYYCMTTKKNALKKQLNYWFDPNSTDHTKRLFFSLKEQDQEFSKNYFQV  180
            Y   E SYSLEKY+CMTTKK AL+KQL++WFDPNS D  ++LFFS  +  QE SKNYFQV
Sbjct  121  YGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQV  180

Query  181  LRDRSNRVGCAIIEYIHPSLVHQLLKCVYNCGVSLCEDNHNPVYEQTDSEPTSECRKGAN  240
            LRDR+NRVGCAI+EY+ P+LVHQLLKCVYNCGVSLCE+  NPVYE TD E  SEC KG+N
Sbjct  181  LRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSN  240

Query  241  QRYKNLCHKDELVKSCDGGNLFV-----LNGHEEEDV-----LKFTKYPLPHYSNDPSLP  290
            ++YKNLCHKDELVK+C+GG+LFV      N  +EE++      + T + LP Y  +  LP
Sbjct  241  KQYKNLCHKDELVKTCNGGSLFVEPENDYNDGQEENMENDYEFETTVFTLPTYDPNDVLP  300

Query  291  EIPDNP  296
             +PDNP
Sbjct  301  TLPDNP  306


>Q2PDZ4_DROME unnamed protein product
Length=350

 Score = 111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 111/233 (48%), Gaps = 11/233 (5%)

Query  33   HVLCTDNGKIQSTCPRDATAMVKMSQDMKNLIVDQHNEYRNKFAGG-LDGHPKAARMTTM  91
            H+ C ++G     C +D   ++ + + +K LI++ HN YR+  AGG +   P AARM  +
Sbjct  42   HIGCNNSGSWSPKCGKDP-KIIDVPKHIKKLILNHHNTYRDIVAGGQMHRLPIAARMLKL  100

Query  92   EWDSQLAKVADALVRRC--QPIRDECGKTLKYHQGEASYSLEKYYCMTTKKNALKKQLNY  149
            +WD +LA +A  LV+RC  QP  D C  T ++          K+         ++ QLN 
Sbjct  101  KWDHELALLATILVKRCDLQPT-DHCISTEEFSSPSYHAVYNKFKAKEDTFRIVRSQLNA  159

Query  150  WFDPNSTDHTKRLFFSLKEQDQEFSKNYFQVLRDRSNRVGCAIIEYIHPSLVHQLLKCVY  209
            W+D      +  L   L    +E   ++ +++   SNR+GCAI         HQ L C+Y
Sbjct  160  WYDQYKHVSSSSLIDGLSTAKKEIG-HFLRMIVGPSNRLGCAIASIEKGGWTHQWLACLY  218

Query  210  NCGVSLCEDNHNPVYEQTDSEPTSECRKGANQRYKNLCHKDELVKSCDGGNLF  262
            +C         N +  +   +P   C  G N +++NLC+  E VK C    LF
Sbjct  219  SC-----SPQKNSLLYEYSGKPGVYCTTGINGKFQNLCNDTEPVKDCMHSELF  266


>Q8T499_DROME unnamed protein product
Length=278

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 78/289 (27%), Positives = 127/289 (44%), Gaps = 49/289 (17%)

Query  12   LLIHQAKSSNKWCRKNLCNG--QHVLCTDNGKIQSTCPRDATAMVKMSQDMKNLIVDQHN  69
            +L+ Q   +  +C   LC G  +H+ C + G +   C  DA  +V+++   + +I+++ N
Sbjct  1    MLLGQQLQAFDYCDPTLCPGPERHIACNNFGALADICSPDA-HIVRITTARRTMILNELN  59

Query  70   EYRNKFA-GGLDGHPKAARMTTMEWDSQLAKVADALVRRCQPIRDECGKTLKYH------  122
            EYR++ A G L G   A RM T++WD +LA  A+  V+RC  + D C  + ++       
Sbjct  60   EYRDRIARGDLMGFSPATRMATLQWDQELASFAELNVKRCALVNDHCRNSEQFRNVAQVV  119

Query  123  -----QG--------------EASYSLEKYYCMTTKKNALKKQLNYWFDPNSTDHTKRLF  163
                 QG              EA   +E +    T+   +K  L   F     + + R  
Sbjct  120  AEGGWQGDPLPPSSPSDPPNPEAPIPVEYH----TEDEVIKATLEQMF-AEYKECSMRDI  174

Query  164  FSLKEQDQEFSKNYF-QVLRDRSNRVGCAIIEYI---------HPSLVHQLLKCVYNCGV  213
             +    +      YF Q++RD +  VGC I+              S VHQ + C +    
Sbjct  175  IAFSPPNNSKCIAYFTQLVRDSTTHVGCGILRQTKNTTNEAGQSLSSVHQYMTCNF----  230

Query  214  SLCEDNHNPVYEQTDSEPTSECRKGANQRYKNLCHKDELVKSCDGGNLF  262
                D + PVY+  D  P +ECR G N  + NLC  +E+  S +   LF
Sbjct  231  VRTNDVNAPVYQSGD-RPATECRSGRNSVFINLCSVNEIYDSSNLAGLF  278



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110404.1 uncharacterized protein LOC108134562 [Drosophila
elegans]

Length=115
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O96229_PLAF7  unnamed protein product                                 32.7    0.044
Q9VQB6_DROME  unnamed protein product                                 30.0    0.38 


>O96229_PLAF7 unnamed protein product
Length=950

 Score = 32.7 bits (73),  Expect = 0.044, Method: Composition-based stats.
 Identities = 17/38 (45%), Positives = 26/38 (68%), Gaps = 0/38 (0%)

Query  78   EEELREEPPPPEAQEAQEEKEKDKDKEKEKTKKEEKKK  115
            E+E  ++    ++++  +EKEKDKD EKEK+K  EK K
Sbjct  378  EKEKDKDIEKEKSKDTAKEKEKDKDIEKEKSKDMEKLK  415


 Score = 30.4 bits (67),  Expect = 0.31, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)

Query  94   QEEKEKDKDKEKEKTKKEEKKK  115
            ++EKEKDKD EKEK+K   K+K
Sbjct  376  EKEKEKDKDIEKEKSKDTAKEK  397


 Score = 26.9 bits (58),  Expect = 4.5, Method: Composition-based stats.
 Identities = 12/24 (50%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  92   EAQEEKEKDKDKEKEKTKKEEKKK  115
            E ++EK+KD +KEK K   +EK+K
Sbjct  376  EKEKEKDKDIEKEKSKDTAKEKEK  399


>Q9VQB6_DROME unnamed protein product
Length=971

 Score = 30.0 bits (66),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 22/29 (76%), Gaps = 0/29 (0%)

Query  82   REEPPPPEAQEAQEEKEKDKDKEKEKTKK  110
            +EE PPP++++  E+  KDK+++KE+  K
Sbjct  830  KEEKPPPDSEDGGEQPTKDKERDKEEDNK  858



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110405.1 uncharacterized protein LOC108134563 [Drosophila
elegans]

Length=211
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01820_CAEEL  unnamed protein product                                 30.8    0.96 
Q25442_MUSDO  unnamed protein product                                 29.6    1.9  
Q38B92_TRYB2  unnamed protein product                                 28.9    2.4  


>O01820_CAEEL unnamed protein product
Length=739

 Score = 30.8 bits (68),  Expect = 0.96, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 29/53 (55%), Gaps = 1/53 (2%)

Query  107  MKRGNIRSAKAKALKTEPLE-APPVQQRLKKSKKKKCKSWMRRSCRPFFLHNE  158
            +K    RS +A A+   P E A PV+  +K+  +K  K+ MRRS +    +NE
Sbjct  341  VKAAKKRSTRAPAVPITPTEPASPVESPVKEQPQKAPKAQMRRSSKRTTKNNE  393


>Q25442_MUSDO unnamed protein product
Length=612

 Score = 29.6 bits (65),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 38/92 (41%), Gaps = 7/92 (8%)

Query  126  EAPPVQQRLKKSKKKKCKSWMRRSCRPFFLHNES---QIKQYRARTEKELAVHT---ERT  179
            E   V    KK   +KC  W+ R CRPF   + S    + ++  +   E   H    E  
Sbjct  82   ELKTVSADCKKEAIEKCAQWVVRDCRPFSAVSGSGFIDMIKFFIKVGAEYGEHVNVEELL  141

Query  180  QQKIAMWRRARERDAQKKSDKIHRSIDKALRK  211
               I + R+    DA++K   I R I  A+ K
Sbjct  142  PSPITLSRKVTS-DAKEKKALISREIKSAVEK  172


>Q38B92_TRYB2 unnamed protein product
Length=185

 Score = 28.9 bits (63),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 13/29 (45%), Positives = 17/29 (59%), Gaps = 2/29 (7%)

Query  84   LGRMVGVFLAFAAIFLLFILLCGMKRGNI  112
            +GR  GV   F  IF+LF+LLC     N+
Sbjct  1    MGRRHGVIRGF--IFVLFLLLCATAAANV  27



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110407.2 trypsin [Drosophila elegans]

Length=258
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TRYDT_DROME  unnamed protein product                                  232     1e-76
Q9VQ97_DROME  unnamed protein product                                 162     3e-49
Q52V24_ASTLP  unnamed protein product                                 137     9e-40


>TRYDT_DROME unnamed protein product
Length=253

 Score = 232 bits (592),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/249 (52%), Positives = 173/249 (69%), Gaps = 6/249 (2%)

Query  4    LLLSVVALVALTAMCQGH-PDMDFPFGRIVNGESSDIESHPYQVSIQTTKGSHFCGGSLI  62
            +LLS VA      + +G  P +D   GRIV G ++ I S P+Q+S+Q + GSH CGGS+ 
Sbjct  6    ILLSAVACALGGTVPEGLLPQLD---GRIVGGSATTISSFPWQISLQRS-GSHSCGGSIY  61

Query  63   SSDTILTAAHCMQSYAADELQVRLGSTSRSSGGEVVTVRAFKSHEGYNSKLMVNDVAIMK  122
            SS+ I+TAAHC+QS +A  LQ+R GS+  SSGG   +V +FK+HEGYN+  MVND+AI+K
Sbjct  62   SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIK  121

Query  123  LSTPVRQTNKIRAVELADSEPVSGTSAVVTGWGTTCFLFCSSPDSLLEVEVDLLHYKDCA  182
            ++  +  ++ I+A+ LA S P +G +A V+GWGT  +   S P  L  V V+++    CA
Sbjct  122  INGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCA  181

Query  183  SDTYSYGSESILPTMVCATGEKKDACQGDSGGPLVANGKQVGVVSWGSGCAWTGYPGVYA  242
            S TY YGS+ I  TM+CA    KDACQGDSGGPLV+ G  VGVVSWG GCA++ YPGVYA
Sbjct  182  SSTYGYGSQ-IRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA  240

Query  243  DVAALKSWI  251
            DVAAL+SW+
Sbjct  241  DVAALRSWV  249


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 162 bits (411),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/223 (40%), Positives = 131/223 (59%), Gaps = 8/223 (4%)

Query  30   RIVNGESSDIESHPYQVSIQTTKGSHFCGGSLISSDTILTAAHCMQSYAADELQVRLGST  89
            RIV G    I   P+Q ++  ++  + CG  + S   I+TAAHC++        VR+GS 
Sbjct  23   RIVGGHPVLISEVPWQAALMYSE-KYICGAVIYSDKIIITAAHCVERPFDTLYSVRVGSV  81

Query  90   SRSSGGEVVTVRAFKSHEGY-NSKLMVNDVAIMKLSTPVRQTNKIRAVELADSEPVSGTS  148
             ++ GG+   V   + HE Y +S ++ ND+A+++L   +    ++R ++LADS P +GT 
Sbjct  82   WKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEVRPIQLADSAPAAGTE  141

Query  149  AVVTGWGTTCFLFCSSPDSLLEVEVDLLHYKDCASDTYSYGSESILPTMVCATGEKKDAC  208
            A V+GWG    L+   P SLL+  V +L    C   +Y Y    I  TM+CA    KD+C
Sbjct  142  ASVSGWGEIGILWLQ-PTSLLKTSVKILDPNVC-KRSYQY----ITKTMICAAALLKDSC  195

Query  209  QGDSGGPLVANGKQVGVVSWGSGCAWTGYPGVYADVAALKSWI  251
             GDSGGPLV+ G+ VG+VS+G GCA   +PGVYA+VA LK WI
Sbjct  196  HGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI  238


>Q52V24_ASTLP unnamed protein product
Length=237

 Score = 137 bits (346),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 132/239 (55%), Gaps = 23/239 (10%)

Query  31   IVNGESSDIESHPYQVSIQTTK---GSHFCGGSLISSDTILTAAHCMQSYAADE-----L  82
            IV G  + +   PYQ+S Q T      HFCG S+ + +  +TA HC  +Y  D      L
Sbjct  1    IVGGTDATLGEFPYQLSFQETFIGFSFHFCGASIYNENYAITAGHC--AYGDDYENPSGL  58

Query  83   QVRLG--STSRSSGGE-VVTVRAFKSHEGYNSKLMVNDVAIMKLSTPVRQTNKIRAVELA  139
            Q+  G    S + G E ++TV     HE ++  L+ ND++++KLS  +   + +  + L 
Sbjct  59   QIVAGELDMSVNEGSEQIITVSKIILHENFDYNLLDNDISLLKLSGSLTFNDNVAPIALP  118

Query  140  DSEPVSGTSAVVTGWGTTCFLFCSSPDSLLEVEVDLLHYKDCASDTYSYGSESILPTMVC  199
            +    +    +VTGWGTT     ++PD L +V V L+  +DC +D   YG++ IL +M+C
Sbjct  119  EQGHTATGDVIVTGWGTTS-EGGNTPDVLQKVTVPLVSDEDCRAD---YGADEILDSMIC  174

Query  200  ATGEK--KDACQGDSGGPLVANGKQ----VGVVSWGSGCAWTGYPGVYADVAALKSWIE  252
            A   +  KD+CQGDSGGPL A+        G+VSWG GCA  GYPGVY +V+    WI+
Sbjct  175  AGVPEGGKDSCQGDSGGPLAASDTGSTYLAGIVSWGYGCARPGYPGVYTEVSYHVDWIK  233



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110409.1 uncharacterized protein LOC108134568 [Drosophila
elegans]

Length=362
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RBP2B_PLAF7  unnamed protein product                                  33.5    0.31 


>RBP2B_PLAF7 unnamed protein product
Length=3179

 Score = 33.5 bits (75),  Expect = 0.31, Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 31/48 (65%), Gaps = 1/48 (2%)

Query  289   QKLRLAEQRRMELRSAERRRQQEKLLRRQQAEQAFQRWMSNVAQRPKP  336
             ++L+  EQ R+E R  + + Q+E+ LR+++ E+  QR +  + ++ KP
Sbjct  2675  EELKRQEQERLE-REKQEQLQKEEELRKKEQEKQQQRNIQELEEQKKP  2721



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110410.1 coiled-coil domain-containing protein 34 [Drosophila
elegans]

Length=316


***** No hits found *****



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110412.1 glucose-6-phosphate 1-dehydrogenase isoform X1
[Drosophila elegans]

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G6PD_DROME  unnamed protein product                                   1033    0.0   
G6PD_DICDI  unnamed protein product                                   514     1e-179
Q4Q3K1_LEIMA  unnamed protein product                                 462     3e-158


>G6PD_DROME unnamed protein product
Length=524

 Score = 1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/524 (93%), Positives = 507/524 (97%), Gaps = 0/524 (0%)

Query  1    MATQKEDHTALDLIIKSLKSPTMIYEGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLY  60
            MATQKEDHTALDLIIKSLKSPTM+ EGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLY
Sbjct  1    MATQKEDHTALDLIIKSLKSPTMVCEGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLY  60

Query  61   RDDLLPKPTKFCGYARSKLTITSLKTQCLPYMKVQSHEQKKYEEFWTLNEYVSGSYGGRT  120
            RDDLLPKPTKFCGYARS LT+ S+K QCLPYMKVQ HEQKKYEEFW LNEYVSG Y GRT
Sbjct  61   RDDLLPKPTKFCGYARSMLTVDSIKEQCLPYMKVQPHEQKKYEEFWALNEYVSGRYDGRT  120

Query  121  GFELLNQQLELMENKNKANRIFYLALPPSVFEEVTVNIKQICMSLCGWNRVIVEKPFGRD  180
            GFELLNQQLE+MENKNKANRIFYLALPPSVFEEVTVNIKQICMS+CGWNRVI+EKPFGRD
Sbjct  121  GFELLNQQLEIMENKNKANRIFYLALPPSVFEEVTVNIKQICMSVCGWNRVIIEKPFGRD  180

Query  181  DVSSQALSDHLAGLFQEDQLYRIDHYLGKEMVQNLMTIRFGNKILSSTWNRENIASVLIT  240
            D SSQALSDHLAGLFQEDQLYRIDHYLGKEMVQNLMTIRFGNKILSSTWNRENIASVLIT
Sbjct  181  DASSQALSDHLAGLFQEDQLYRIDHYLGKEMVQNLMTIRFGNKILSSTWNRENIASVLIT  240

Query  241  FKEPFGTQGRGGYFDEFGIIRDVMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIG  300
            FKEPFGTQGRGGYFDEFGIIRDVMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSI 
Sbjct  241  FKEPFGTQGRGGYFDEFGIIRDVMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIE  300

Query  301  ALTLDDMVLGQYLGDPKGATEDARTGYLDDPTVSKDSNTPTYALGVLKINNERWQGVPFI  360
            ALTLDDMVLGQYLG+P+G  +DARTGY++DPTVS DSNTPTYALGVLKINNERWQGVPFI
Sbjct  301  ALTLDDMVLGQYLGNPQGTNDDARTGYVEDPTVSNDSNTPTYALGVLKINNERWQGVPFI  360

Query  361  LRCGKALNERKAEVRIQYQDVPGDIFEGSTKRNELVIRVQPGEALYFKMMTKSPGITFDI  420
            LRCGKALNERKAEVRIQYQDV GDIFEG+TKRNELVIRVQPGEALYFKMMTKSPGITFDI
Sbjct  361  LRCGKALNERKAEVRIQYQDVLGDIFEGNTKRNELVIRVQPGEALYFKMMTKSPGITFDI  420

Query  421  EETELDLTYEHRYKDSYLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIERE  480
            EETELDLTYEHRYKDSYLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIE+E
Sbjct  421  EETELDLTYEHRYKDSYLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIEKE  480

Query  481  RVQPITYQYGSRGPKQADRKCEENNFKYSGSYKWHGGKPAPSSN  524
             ++PITYQYGSRGPK+ADRKCEENNFKYSGSYKWHGGK A S++
Sbjct  481  HIRPITYQYGSRGPKEADRKCEENNFKYSGSYKWHGGKAATSNH  524


>G6PD_DICDI unnamed protein product
Length=497

 Score = 514 bits (1324),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 262/492 (53%), Positives = 337/492 (68%), Gaps = 14/492 (3%)

Query  37   TFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARSKLTITSLKTQCLPYMKVQS  96
            T +I GASGDLAKKK YP L+ LY  DLLP  T   GYARS + I   K +    +K   
Sbjct  12   TVIILGASGDLAKKKTYPALFGLYLRDLLPSNTIIYGYARSHIEIGDFKARISKGLK---  68

Query  97   HEQKKYEEFWTLNEYVSGSYGGRTGFELLNQQLELMENK-----NKANRIFYLALPPSVF  151
             +++K ++F  L  Y SG Y  +  ++   ++L L E K     +K NR+FY+A+PPS+F
Sbjct  69   GDEEKKKQFLNLLHYHSGKYDEKASYDEF-EKLILAEEKKQQGVDKFNRLFYMAIPPSIF  127

Query  152  EEVTVNIKQICMSLCGWNRVIVEKPFGRDDVSSQALSDHLAGLFQEDQLYRIDHYLGKEM  211
             EV++ I    +S  GW+RVIVEKPFGRD  SS+ L   L  LF+E  L+RIDHYLGKEM
Sbjct  128  IEVSIGIHGSLISKNGWSRVIVEKPFGRDLASSRELVSELGKLFKEKDLFRIDHYLGKEM  187

Query  212  VQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRDVMQNHLLQI  271
            VQNLM +RF N +    W++ +I+S+ ITFKE  GT+GRGGYFD+FGIIRDVMQNHLLQ+
Sbjct  188  VQNLMVLRFANAVFEPLWSKSHISSITITFKEDIGTEGRGGYFDQFGIIRDVMQNHLLQV  247

Query  272  LSLVAMEKPVSCHPDDIRDEKVKVLKSIGALTLDDMVLGQYLGDPKGATEDARTGYLDDP  331
            LSLVAME PVS + DDI +EKVK+L+ I  + + ++VLGQY  DP+G        YLDD 
Sbjct  248  LSLVAMEPPVSLNADDITNEKVKLLRCIQPIKMSEVVLGQYTSDPEGKI----PAYLDDE  303

Query  332  TVSKDSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDVPGDIF-EGST  390
             V KDS TPTYA  V  INN RW+G+PFIL+CGKAL+ERK EVRIQ++     +F +   
Sbjct  304  GVPKDSTTPTYAAAVFHINNPRWRGMPFILKCGKALDERKTEVRIQFKRPDNFLFSDDDI  363

Query  391  KRNELVIRVQPGEALYFKMMTKSPGITFDIEETELDLTYEHRYKDSYLPDAYERLILDVF  450
             RNELV+R+QPGEA+Y K+++K PG+   IE+TELDL+Y HR+++  LPDAYERLILD  
Sbjct  364  SRNELVMRIQPGEAVYLKLLSKKPGLENKIEQTELDLSYRHRFENLDLPDAYERLILDSI  423

Query  451  CGSQMHFVRSDELREAWRIFTPILHQIERERVQPITYQYGSRGPKQADRKCEENNFKYSG  510
             G    FVR DEL  AW+IFTP+L QIE+E+++P  Y +GSRGPK AD   ++  F  S 
Sbjct  424  KGDHNLFVRDDELDVAWQIFTPLLDQIEKEKIKPEPYSFGSRGPKSADELSKKFGFIRSL  483

Query  511  SYKWHGGKPAPS  522
             Y W G  P  S
Sbjct  484  GYNWPGNSPQGS  495


>Q4Q3K1_LEIMA unnamed protein product
Length=562

 Score = 462 bits (1189),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 251/490 (51%), Positives = 310/490 (63%), Gaps = 18/490 (4%)

Query  37   TFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARSKLTITSL--KTQCLPYMKV  94
            T ++FGASGDLAKKK +P L+ LY   LLP      GYAR+K+       +   + Y   
Sbjct  73   TIIVFGASGDLAKKKTFPALFDLYCGGLLPPEVNVIGYARTKVDDAERWKRETLMTYFSN  132

Query  95   QSHEQKKYEEFWTLNEYVSGSYGGRTGFELLNQQLELMENKNKA-----NRIFYLALPPS  149
                    E+F     Y  GSY     F+ L+  +   EN  K      NR+FYLALPPS
Sbjct  133  VPERACHAEDFLKHISYFCGSYDKVDDFKRLDAVIREKENAFKGPEKGGNRLFYLALPPS  192

Query  150  VFEEVTVNIKQICM--SLCGWNRVIVEKPFGRDDVSSQALSDHLAGLFQEDQLYRIDHYL  207
            VF  V  +I +  M   + GW RVI+EKPFGRD  SS  LS  L   F E QLYRIDHYL
Sbjct  193  VFASVCESIHKGAMPQEVGGWARVIIEKPFGRDTKSSAELSRALEPFFDESQLYRIDHYL  252

Query  208  GKEMVQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRDVMQNH  267
            GKEMVQN++T RF N+I S+ WN  NIA V ITFKE  GT+GRGGYFD  GIIRDVMQNH
Sbjct  253  GKEMVQNIITTRFANRIFSAVWNSNNIACVQITFKETIGTEGRGGYFDGIGIIRDVMQNH  312

Query  268  LLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIGALTLDDMVLGQYLGDPKGATEDARTGY  327
            L QIL+L+AMEKP S   + IRDEKV VLK I  +T ++ VLGQY     G+      GY
Sbjct  313  LTQILALLAMEKPRSLDAECIRDEKVSVLKCIEPITKENCVLGQYTASADGSI----PGY  368

Query  328  LDDPTVSKDSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDVPGDIFE  387
             +D TV + S  PT+A+  L INN+RW GVPFIL+ GKA+ ++   +RIQ++D      E
Sbjct  369  QEDVTVPEGSTCPTFAVMRLNINNDRWAGVPFILKAGKAVEQKYVAIRIQFKDEVHPYGE  428

Query  388  GSTKRNELVIRVQPGEALYFKMMTKSPGITFDI---EETELDLTYEHRYKDSYLPDAYER  444
             +T+RNELVIR QP EA+Y K+ TK PG++ D+    +TELDLTY  RY D  LPDAYE 
Sbjct  429  -ATQRNELVIRAQPSEAMYVKITTKVPGLSGDLRQTHQTELDLTYHTRY-DVRLPDAYES  486

Query  445  LILDVFCGSQMHFVRSDELREAWRIFTPILHQIERERVQPITYQYGSRGPKQADRKCEEN  504
            LI D   G+  +FVR DEL  AWRIFTP+LHQI+   ++PI YQ G+RGPK+AD     N
Sbjct  487  LINDALLGNSTNFVRKDELDVAWRIFTPLLHQIDCGEIKPIPYQAGTRGPKEADEFITNN  546

Query  505  NFKYSGSYKW  514
             FK+   Y+W
Sbjct  547  GFKHQKGYQW  556



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110413.1 glucose-6-phosphate 1-dehydrogenase isoform X2
[Drosophila elegans]

Length=503
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G6PD_DROME  unnamed protein product                                   989     0.0   
G6PD_DICDI  unnamed protein product                                   514     8e-180
Q4Q3K1_LEIMA  unnamed protein product                                 461     3e-158


>G6PD_DROME unnamed protein product
Length=524

 Score = 989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/502 (93%), Positives = 485/502 (97%), Gaps = 0/502 (0%)

Query  1    MIYEGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARSKLTIT  60
            M+ EGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARS LT+ 
Sbjct  23   MVCEGTHFDGKIPHTFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARSMLTVD  82

Query  61   SLKTQCLPYMKVQSHEQKKYEEFWTLNEYVSGSYGGRTGFELLNQQLELMENKNKANRIF  120
            S+K QCLPYMKVQ HEQKKYEEFW LNEYVSG Y GRTGFELLNQQLE+MENKNKANRIF
Sbjct  83   SIKEQCLPYMKVQPHEQKKYEEFWALNEYVSGRYDGRTGFELLNQQLEIMENKNKANRIF  142

Query  121  YLALPPSVFEEVTVNIKQICMSLCGWNRVIVEKPFGRDDVSSQALSDHLAGLFQEDQLYR  180
            YLALPPSVFEEVTVNIKQICMS+CGWNRVI+EKPFGRDD SSQALSDHLAGLFQEDQLYR
Sbjct  143  YLALPPSVFEEVTVNIKQICMSVCGWNRVIIEKPFGRDDASSQALSDHLAGLFQEDQLYR  202

Query  181  IDHYLGKEMVQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRD  240
            IDHYLGKEMVQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRD
Sbjct  203  IDHYLGKEMVQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRD  262

Query  241  VMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIGALTLDDMVLGQYLGDPKGATED  300
            VMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSI ALTLDDMVLGQYLG+P+G  +D
Sbjct  263  VMQNHLLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIEALTLDDMVLGQYLGNPQGTNDD  322

Query  301  ARTGYLDDPTVSKDSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDVP  360
            ARTGY++DPTVS DSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDV 
Sbjct  323  ARTGYVEDPTVSNDSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDVL  382

Query  361  GDIFEGSTKRNELVIRVQPGEALYFKMMTKSPGITFDIEETELDLTYEHRYKDSYLPDAY  420
            GDIFEG+TKRNELVIRVQPGEALYFKMMTKSPGITFDIEETELDLTYEHRYKDSYLPDAY
Sbjct  383  GDIFEGNTKRNELVIRVQPGEALYFKMMTKSPGITFDIEETELDLTYEHRYKDSYLPDAY  442

Query  421  ERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIERERVQPITYQYGSRGPKQADRKCE  480
            ERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIE+E ++PITYQYGSRGPK+ADRKCE
Sbjct  443  ERLILDVFCGSQMHFVRSDELREAWRIFTPILHQIEKEHIRPITYQYGSRGPKEADRKCE  502

Query  481  ENNFKYSGSYKWHGGKPAPSSN  502
            ENNFKYSGSYKWHGGK A S++
Sbjct  503  ENNFKYSGSYKWHGGKAATSNH  524


>G6PD_DICDI unnamed protein product
Length=497

 Score = 514 bits (1323),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 262/492 (53%), Positives = 337/492 (68%), Gaps = 14/492 (3%)

Query  15   TFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARSKLTITSLKTQCLPYMKVQS  74
            T +I GASGDLAKKK YP L+ LY  DLLP  T   GYARS + I   K +    +K   
Sbjct  12   TVIILGASGDLAKKKTYPALFGLYLRDLLPSNTIIYGYARSHIEIGDFKARISKGLK---  68

Query  75   HEQKKYEEFWTLNEYVSGSYGGRTGFELLNQQLELMENK-----NKANRIFYLALPPSVF  129
             +++K ++F  L  Y SG Y  +  ++   ++L L E K     +K NR+FY+A+PPS+F
Sbjct  69   GDEEKKKQFLNLLHYHSGKYDEKASYDEF-EKLILAEEKKQQGVDKFNRLFYMAIPPSIF  127

Query  130  EEVTVNIKQICMSLCGWNRVIVEKPFGRDDVSSQALSDHLAGLFQEDQLYRIDHYLGKEM  189
             EV++ I    +S  GW+RVIVEKPFGRD  SS+ L   L  LF+E  L+RIDHYLGKEM
Sbjct  128  IEVSIGIHGSLISKNGWSRVIVEKPFGRDLASSRELVSELGKLFKEKDLFRIDHYLGKEM  187

Query  190  VQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRDVMQNHLLQI  249
            VQNLM +RF N +    W++ +I+S+ ITFKE  GT+GRGGYFD+FGIIRDVMQNHLLQ+
Sbjct  188  VQNLMVLRFANAVFEPLWSKSHISSITITFKEDIGTEGRGGYFDQFGIIRDVMQNHLLQV  247

Query  250  LSLVAMEKPVSCHPDDIRDEKVKVLKSIGALTLDDMVLGQYLGDPKGATEDARTGYLDDP  309
            LSLVAME PVS + DDI +EKVK+L+ I  + + ++VLGQY  DP+G        YLDD 
Sbjct  248  LSLVAMEPPVSLNADDITNEKVKLLRCIQPIKMSEVVLGQYTSDPEGKI----PAYLDDE  303

Query  310  TVSKDSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDVPGDIF-EGST  368
             V KDS TPTYA  V  INN RW+G+PFIL+CGKAL+ERK EVRIQ++     +F +   
Sbjct  304  GVPKDSTTPTYAAAVFHINNPRWRGMPFILKCGKALDERKTEVRIQFKRPDNFLFSDDDI  363

Query  369  KRNELVIRVQPGEALYFKMMTKSPGITFDIEETELDLTYEHRYKDSYLPDAYERLILDVF  428
             RNELV+R+QPGEA+Y K+++K PG+   IE+TELDL+Y HR+++  LPDAYERLILD  
Sbjct  364  SRNELVMRIQPGEAVYLKLLSKKPGLENKIEQTELDLSYRHRFENLDLPDAYERLILDSI  423

Query  429  CGSQMHFVRSDELREAWRIFTPILHQIERERVQPITYQYGSRGPKQADRKCEENNFKYSG  488
             G    FVR DEL  AW+IFTP+L QIE+E+++P  Y +GSRGPK AD   ++  F  S 
Sbjct  424  KGDHNLFVRDDELDVAWQIFTPLLDQIEKEKIKPEPYSFGSRGPKSADELSKKFGFIRSL  483

Query  489  SYKWHGGKPAPS  500
             Y W G  P  S
Sbjct  484  GYNWPGNSPQGS  495


>Q4Q3K1_LEIMA unnamed protein product
Length=562

 Score = 461 bits (1187),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 251/490 (51%), Positives = 310/490 (63%), Gaps = 18/490 (4%)

Query  15   TFVIFGASGDLAKKKIYPTLWWLYRDDLLPKPTKFCGYARSKLTITSL--KTQCLPYMKV  72
            T ++FGASGDLAKKK +P L+ LY   LLP      GYAR+K+       +   + Y   
Sbjct  73   TIIVFGASGDLAKKKTFPALFDLYCGGLLPPEVNVIGYARTKVDDAERWKRETLMTYFSN  132

Query  73   QSHEQKKYEEFWTLNEYVSGSYGGRTGFELLNQQLELMENKNKA-----NRIFYLALPPS  127
                    E+F     Y  GSY     F+ L+  +   EN  K      NR+FYLALPPS
Sbjct  133  VPERACHAEDFLKHISYFCGSYDKVDDFKRLDAVIREKENAFKGPEKGGNRLFYLALPPS  192

Query  128  VFEEVTVNIKQICM--SLCGWNRVIVEKPFGRDDVSSQALSDHLAGLFQEDQLYRIDHYL  185
            VF  V  +I +  M   + GW RVI+EKPFGRD  SS  LS  L   F E QLYRIDHYL
Sbjct  193  VFASVCESIHKGAMPQEVGGWARVIIEKPFGRDTKSSAELSRALEPFFDESQLYRIDHYL  252

Query  186  GKEMVQNLMTIRFGNKILSSTWNRENIASVLITFKEPFGTQGRGGYFDEFGIIRDVMQNH  245
            GKEMVQN++T RF N+I S+ WN  NIA V ITFKE  GT+GRGGYFD  GIIRDVMQNH
Sbjct  253  GKEMVQNIITTRFANRIFSAVWNSNNIACVQITFKETIGTEGRGGYFDGIGIIRDVMQNH  312

Query  246  LLQILSLVAMEKPVSCHPDDIRDEKVKVLKSIGALTLDDMVLGQYLGDPKGATEDARTGY  305
            L QIL+L+AMEKP S   + IRDEKV VLK I  +T ++ VLGQY     G+      GY
Sbjct  313  LTQILALLAMEKPRSLDAECIRDEKVSVLKCIEPITKENCVLGQYTASADGSI----PGY  368

Query  306  LDDPTVSKDSNTPTYALGVLKINNERWQGVPFILRCGKALNERKAEVRIQYQDVPGDIFE  365
             +D TV + S  PT+A+  L INN+RW GVPFIL+ GKA+ ++   +RIQ++D      E
Sbjct  369  QEDVTVPEGSTCPTFAVMRLNINNDRWAGVPFILKAGKAVEQKYVAIRIQFKDEVHPYGE  428

Query  366  GSTKRNELVIRVQPGEALYFKMMTKSPGITFDI---EETELDLTYEHRYKDSYLPDAYER  422
             +T+RNELVIR QP EA+Y K+ TK PG++ D+    +TELDLTY  RY D  LPDAYE 
Sbjct  429  -ATQRNELVIRAQPSEAMYVKITTKVPGLSGDLRQTHQTELDLTYHTRY-DVRLPDAYES  486

Query  423  LILDVFCGSQMHFVRSDELREAWRIFTPILHQIERERVQPITYQYGSRGPKQADRKCEEN  482
            LI D   G+  +FVR DEL  AWRIFTP+LHQI+   ++PI YQ G+RGPK+AD     N
Sbjct  487  LINDALLGNSTNFVRKDELDVAWRIFTPLLHQIDCGEIKPIPYQAGTRGPKEADEFITNN  546

Query  483  NFKYSGSYKW  492
             FK+   Y+W
Sbjct  547  GFKHQKGYQW  556



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110414.1 RNA polymerase II subunit A C-terminal domain
phosphatase SSU72 [Drosophila elegans]

Length=195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VWE4_DROME  unnamed protein product                                 387     2e-139
M9PHZ3_DROME  unnamed protein product                                 379     4e-136
Q27GU1_CAEEL  unnamed protein product                                 30.8    0.70  


>Q9VWE4_DROME unnamed protein product
Length=195

 Score = 387 bits (994),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 184/195 (94%), Positives = 193/195 (99%), Gaps = 0/195 (0%)

Query  1    MTDPSKLSVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGVAFDKPNVYEFGT  60
            MTDPSKL+VAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPG+AFDKPNVYEFGT
Sbjct  1    MTDPSKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGT  60

Query  61   SYEDIYRDLEAKDKEFYTQNGLLHMLDRNRRIKKCPERFQETKEQFDIIVTVEERVYDLV  120
             YEDIYRDLE+KDKEFYTQNGLLHMLDRNRRIKKCPERFQ+TKEQFDIIVTVEERVYDLV
Sbjct  61   KYEDIYRDLESKDKEFYTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLV  120

Query  121  VLHMESMDSVDNRPVHVLNVDVVDNAEDALMGAFLITDMINLMAKSTDLDNDIDEMIQEF  180
            V+HMESM+SVDNRPVHVLNVDVVDNAEDALMGAF+ITDMIN+MAKSTDLDNDIDE+IQEF
Sbjct  121  VMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEF  180

Query  181  EERRNRVILHSVLFY  195
            EERR RVILHSVLFY
Sbjct  181  EERRKRVILHSVLFY  195


>M9PHZ3_DROME unnamed protein product
Length=194

 Score = 379 bits (972),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 192/195 (98%), Gaps = 1/195 (1%)

Query  1    MTDPSKLSVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGVAFDKPNVYEFGT  60
            MTDPSKL+VAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPG+AFDKPNVYEFGT
Sbjct  1    MTDPSKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSYGTGERVKLPGMAFDKPNVYEFGT  60

Query  61   SYEDIYRDLEAKDKEFYTQNGLLHMLDRNRRIKKCPERFQETKEQFDIIVTVEERVYDLV  120
             YEDIYRDLE+KDK+ YTQNGLLHMLDRNRRIKKCPERFQ+TKEQFDIIVTVEERVYDLV
Sbjct  61   KYEDIYRDLESKDKD-YTQNGLLHMLDRNRRIKKCPERFQDTKEQFDIIVTVEERVYDLV  119

Query  121  VLHMESMDSVDNRPVHVLNVDVVDNAEDALMGAFLITDMINLMAKSTDLDNDIDEMIQEF  180
            V+HMESM+SVDNRPVHVLNVDVVDNAEDALMGAF+ITDMIN+MAKSTDLDNDIDE+IQEF
Sbjct  120  VMHMESMESVDNRPVHVLNVDVVDNAEDALMGAFVITDMINMMAKSTDLDNDIDELIQEF  179

Query  181  EERRNRVILHSVLFY  195
            EERR RVILHSVLFY
Sbjct  180  EERRKRVILHSVLFY  194


>Q27GU1_CAEEL unnamed protein product
Length=867

 Score = 30.8 bits (68),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (51%), Gaps = 6/55 (11%)

Query  32   FNVRSYGTGERVKLPGVAFDKPNVYEFGTSYEDIYRDLEAKDKEFYTQNGLLHML  86
            FN  S   GERV  P VA+  P         +D  RD +A+DK+F T   + H++
Sbjct  389  FNNVSEIDGERVLAPSVAYADP------VHVDDEKRDWKAQDKKFVTPATIDHLM  437



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110416.1 uncharacterized protein LOC108134576 [Drosophila
elegans]

Length=645


***** No hits found *****



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110417.1 uncharacterized protein LOC108134576 [Drosophila
elegans]

Length=645


***** No hits found *****



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110418.1 uncharacterized protein LOC108134567 isoform X1
[Drosophila elegans]

Length=364
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q70VI1_DROME  unnamed protein product                                 715     0.0  
Q9VFC7_DROME  unnamed protein product                                 706     0.0  
Q95U15_DROME  unnamed protein product                                 595     0.0  


>Q70VI1_DROME unnamed protein product
Length=364

 Score = 715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/364 (99%), Positives = 362/364 (99%), Gaps = 0/364 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS  240
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS  240

Query  241  APNDAPSRSLGVFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP  300
            AP DAPSR LG+FERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP
Sbjct  241  APADAPSRPLGIFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP  300

Query  301  NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH  360
            NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH
Sbjct  301  NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH  360

Query  361  RSIL  364
            RSIL
Sbjct  361  RSIL  364


>Q9VFC7_DROME unnamed protein product
Length=365

 Score = 706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/364 (98%), Positives = 358/364 (98%), Gaps = 0/364 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS  240
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS  240

Query  241  APNDAPSRSLGVFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP  300
            AP DAPSR LG+FERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP
Sbjct  241  APADAPSRPLGIFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP  300

Query  301  NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH  360
            NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTP 
Sbjct  301  NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPE  360

Query  361  RSIL  364
               L
Sbjct  361  EEDL  364


>Q95U15_DROME unnamed protein product
Length=312

 Score = 595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/364 (85%), Positives = 312/364 (86%), Gaps = 52/364 (14%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADS  240
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFER          
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFER----------  230

Query  241  APNDAPSRSLGVFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP  300
                                                      LPIFHPRNRFRDLLSPSP
Sbjct  231  ------------------------------------------LPIFHPRNRFRDLLSPSP  248

Query  301  NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH  360
            NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH
Sbjct  249  NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKHPARPLTPH  308

Query  361  RSIL  364
            RSIL
Sbjct  309  RSIL  312



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110419.1 uncharacterized protein LOC108134576 [Drosophila
elegans]

Length=645


***** No hits found *****



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110420.1 trypsin alpha-like [Drosophila elegans]

Length=256
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VQ97_DROME  unnamed protein product                                 162     4e-49
TRYDT_DROME  unnamed protein product                                  152     4e-45
Q9VQA3_DROME  unnamed protein product                                 128     6e-36


>Q9VQ97_DROME unnamed protein product
Length=245

 Score = 162 bits (410),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 102/257 (40%), Positives = 137/257 (53%), Gaps = 19/257 (7%)

Query  1    MFIQSFLLLLAIGFLSAGRVPRPEERIIGGQNIDIEQAPWQVSLQVKGQHYCGGSIYSKD  60
            M +   +L+ ++  +SAG  P   ERI+GG  + I + PWQ +L    ++ CG  IYS  
Sbjct  1    MLLHWLVLVASVTLISAGSSP---ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDK  57

Query  61   IIITAAHCRFDDRDRALEAKDFLIRVGSSLKNSGGTLVKVAAIRSHENFENRN-LINDIA  119
            IIITAAHC     D       + +RVGS  KN GG   +VA IR HE++ +   L NDIA
Sbjct  58   IIITAAHCVERPFDTL-----YSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIA  112

Query  120  VMRLSEPLKFTRKVQSIPLAKRNPAPRTVATVSGWGATLEFPNYGNPVMTNPIHLQGVYN  179
            V+RL + L F  +V+ I LA   PA  T A+VSGWG           +   P  L     
Sbjct  113  VIRLVDTLIFNAEVRPIQLADSAPAAGTEASVSGWGEI-------GILWLQPTSLLKTSV  165

Query  180  YIENRKSCSRLLA-MTESNICAGTYGQSACSGDSGGPLVVNQKLVGVVSKGFEFCDGF--  236
             I +   C R    +T++ ICA    + +C GDSGGPLV   +LVG+VS G    + F  
Sbjct  166  KILDPNVCKRSYQYITKTMICAAALLKDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFP  225

Query  237  TVYESVPFFRPWILNAI  253
             VY +V   +PWILNAI
Sbjct  226  GVYANVAELKPWILNAI  242


>TRYDT_DROME unnamed protein product
Length=253

 Score = 152 bits (383),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 98/259 (38%), Positives = 145/259 (56%), Gaps = 24/259 (9%)

Query  6    FLLLLAI------GFLSAGRVPRPEERIIGGQNIDIEQAPWQVSLQVKGQHYCGGSIYSK  59
            F++LL+       G +  G +P+ + RI+GG    I   PWQ+SLQ  G H CGGSIYS 
Sbjct  4    FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSS  63

Query  60   DIIITAAHCRFDDRDRALEAKDFLIRVGSSLKNSGGTLVKVAAIRSHENFENRNLINDIA  119
            ++I+TAAHC      +++ A    IR GSS  +SGG    V++ ++HE +    ++NDIA
Sbjct  64   NVIVTAAHCL-----QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIA  118

Query  120  VMRLSEPLKFTRKVQSIPLAKRNPAPRTVATVSGWGATLEFPNYGNPVMTNPIHLQGVYN  179
            +++++  L F+  +++I LA  NPA    A+VSGWG TL    YG+  +  P  LQ V  
Sbjct  119  IIKINGALTFSSTIKAIGLASSNPANGAAASVSGWG-TLS---YGSSSI--PSQLQYVNV  172

Query  180  YIENRKSCSRLL-----AMTESNICAGTYGQSACSGDSGGPLVVNQKLVGVVSKGF--EF  232
             I ++  C+         +  + ICA   G+ AC GDSGGPLV    LVGVVS G+   +
Sbjct  173  NIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAY  232

Query  233  CDGFTVYESVPFFRPWILN  251
             +   VY  V   R W+++
Sbjct  233  SNYPGVYADVAALRSWVIS  251


>Q9VQA3_DROME unnamed protein product
Length=245

 Score = 128 bits (321),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/253 (34%), Positives = 134/253 (53%), Gaps = 25/253 (10%)

Query  1    MFIQSFLLLLAIGFLSAGRVPRPEERIIGGQNIDIEQAPWQVSLQVKGQHYCGGSIYSKD  60
            M ++  LLL++I  ++A             ++I IEQAPWQ S+Q+  +H+CGG IYS+D
Sbjct  1    MLLKGILLLVSIAQIAADF-----------KSIGIEQAPWQASVQINDKHHCGGVIYSED  49

Query  61   IIITAAHCRFDDRDRALEAKDFLIRVGSSLKNSGGTLVKVAAIRSHENFENRNLINDIAV  120
            II+T A C    R   +      +RVGS+ +N+GGT++KV  +R  +    R   +D+A+
Sbjct  50   IILTIAECVRKARLEFIS-----VRVGSAQENAGGTVLKVEKMR-LQVLGLRP--SDVAI  101

Query  121  MRLSEPLKFTRKVQSIPLAKRNPAPRTVATVSGWGATLEFPNYGNPVMTNPIHLQGVYNY  180
            ++L  PL     +++IPLA     P T A+VSGWG           ++   + +Q     
Sbjct  102  LQLRSPLYLDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSSEVLLRVDVKIQDQLMC  161

Query  181  IENRKSCSRLLAMTESNICAGTYGQ--SACSGDSGGPLVVNQKLVGVVS--KGFEFCDGF  236
              N     RL+++ E  ICA   G+   AC G  GGPLV N +L G++S     +  +  
Sbjct  162  ATNLALKGRLMSVGE--ICAAPAGEIPYACQGFVGGPLVANNRLYGILSWQSACDVLNKS  219

Query  237  TVYESVPFFRPWI  249
            +VY ++  F+ WI
Sbjct  220  SVYANIAMFKVWI  232



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110422.1 uncharacterized protein LOC108134579 [Drosophila
elegans]

Length=118
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VP33B_CAEEL  unnamed protein product                                  28.5    1.6  
Q584H3_TRYB2  unnamed protein product                                 28.1    1.8  
Q383T8_TRYB2  unnamed protein product                                 27.7    2.1  


>VP33B_CAEEL unnamed protein product
Length=617

 Score = 28.5 bits (62),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 29/52 (56%), Gaps = 1/52 (2%)

Query  10   MYECESSFIADESLEGDAFLSQGLENESLDGSSVFSQAACSSSSKRRRPNKP  61
            ++   + F+A ++L G      GL +ES +  ++   A CSS+  R RP++P
Sbjct  165  LFSVANMFVALQNLYGVIPTVYGLGSESKNLWNL-VHALCSSNELRARPDQP  215


>Q584H3_TRYB2 unnamed protein product
Length=1000

 Score = 28.1 bits (61),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 3/42 (7%)

Query  64   TPFEAA---MVEATNRCTDELVNMSQNLIELGDRRLQVMERI  102
            +P EAA   +V A++ C+D++V++ Q   +L +R   V ERI
Sbjct  746  SPGEAAPSAIVTASDSCSDDVVDLQQRYQQLEERVRNVNERI  787


>Q383T8_TRYB2 unnamed protein product
Length=366

 Score = 27.7 bits (60),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 17/57 (30%), Positives = 28/57 (49%), Gaps = 3/57 (5%)

Query  13   CESSFIADESLEGDAFLSQGLENESLDGSSVFSQAACSSSSKRRRPNKPEMTPFEAA  69
            C +S IA   + GDAFL    ++ +LD    + +  CS S+       P  T ++A+
Sbjct  139  CRASKIAQRDIRGDAFLLSNHDDPALDE---WGRVDCSLSTYNELLANPPTTKYDAS  192



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110423.1 UDP-glucosyltransferase 2 [Drosophila elegans]

Length=537
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V9X9_DROME  unnamed protein product                                 206     6e-60
Q9VGT3_DROME  unnamed protein product                                 200     2e-57
Q93242_CAEEL  unnamed protein product                                 130     2e-32


>Q9V9X9_DROME unnamed protein product
Length=521

 Score = 206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 150/522 (29%), Positives = 251/522 (48%), Gaps = 28/522 (5%)

Query  21   GADILCLFTSLSPSHLVIQMSMARILAERGHNVTVVTVLEPPFLHKDITHILVPLEKDDL  80
            GA IL +F   S SH    +   + LA  GH +T V+        ++I  I VP   +  
Sbjct  17   GARILAVFPLPSSSHYFFALPYLKSLASLGHEITSVSPYPQREPFRNIHDIPVP---EVF  73

Query  81   QAFNSVVSGLTKTDNTNAYASMFRSVRQMSEAFTKMGSVMKHQTVRNLYEHPDN-RFDLL  139
            + FN V+  +  T  +   +S F  + +     TK  +V+ ++ VR     P    FDL+
Sbjct  74   ENFNEVLR-IASTPRSTWQSSDF--INEYVLNLTK--TVLNNEGVRRDILGPQKPHFDLV  128

Query  140  IVGYFMNSFQLALGYKLKVPIV-VALSNPPSLLGDVLGNPWEVSYVSAMHLTTDHGSPMG  198
            I+  +       L      PI+ +A       + +++GN   +SY+ +   ++       
Sbjct  129  IMDLWRMDVLSGLAAYFDAPIIGMASYGTDWKIDELMGNVSPISYLQSP--SSRFYDLEA  186

Query  199  FGKRFLNLLGNLGQRLFMFL-IEYGNARTYREIYGDDPTLPSYGD------LNKNISLVF  251
            +G+R L+L+    +R F ++  ++ + R    +Y      PS  +      +++N  LV 
Sbjct  187  YGERLLHLM----ERTFSYMNYKWRHVRKQETLYSQ--FFPSVAERKPLSEISRNFDLVL  240

Query  252  FASHGISEGPIRPNVPAVIEVGGIQVKDRPDPLPRNMAEFLLEA-PHGAILLSLGSNLRK  310
               H  + GP RP VP +I+VGG+ V    + L   +  F+  A   G I  SLG+N++ 
Sbjct  241  VNQH-FTLGPPRPYVPNMIQVGGLHVDHSTEALSAELDHFIQGAGESGVIYFSLGTNVKS  299

Query  311  THLKPDTVQKMFNVVSGLRQKVIWKWDDLENTPGSSENILYSKWLPQDDILAHPNITLFI  370
              L  D  + +    + L Q+++WK++D E  PG   N+  SKW PQ  ILAHPN+ LFI
Sbjct  300  KSLSEDRRKVLLETFASLPQRIVWKFED-ELLPGKPPNVFISKWFPQQAILAHPNVKLFI  358

Query  371  THAGKGGVTEAQFHGKPMLALPVFGDQPSNADIMQKQGFGLKQSLLTLEEDSFRNGIREV  430
            TH G     E+  HGKPML LP   DQ  N D +++ G GL  ++  +  + FR+ I  +
Sbjct  359  THGGLLSTIESIHHGKPMLGLPCLFDQFRNMDHVRQVGLGLVLNIKQMTSEEFRSTIIRL  418

Query  431  LENPKYARAVRSFSNLYRDRPMSAQQTFIYWVEYVIRHRGAQHLQSPVVHMSYIAVNNFD  490
            L N  +    R  +  YRD+PM   +T I+W EYV+ H+GA H+Q     + ++  ++ D
Sbjct  419  LTNKSFEETARITAARYRDQPMKPMETAIWWTEYVLSHKGAAHMQVAGKDLGFVRYHSLD  478

Query  491  VYALFLVAIAATCFVIKLFIGVLFKKSKGNLKQTQLNNKHKL  532
            V+  FLV       ++   + +  +K    +K+ +     K+
Sbjct  479  VFGTFLVGALVILGIVTYLLVMTLRKCLFLIKRGKCEAIKKI  520


>Q9VGT3_DROME unnamed protein product
Length=528

 Score = 200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 143/508 (28%), Positives = 250/508 (49%), Gaps = 29/508 (6%)

Query  17   AGVHGADILCLFTSLSPSHLVIQMSMARILAERGHNVTVVTVLEPPFLHKDITHILVPLE  76
            + V   + L +  + + SH  +  ++A+ LA  GH VT+++  E   L K I +I     
Sbjct  20   SCVSAYNYLVVLHTAARSHYHVGSALAKGLAAAGHQVTIISPFE---LKKPIKNIKDVPA  76

Query  77   KDDLQAFNSVVSGLTKTDNTNAYASMFRSVRQMSEAFTKMGSVMKHQTVRNLYEHPDNRF  136
            K  L +    ++ L ++        +  +  +M    T++  ++K  +V  L +  +  F
Sbjct  77   KSILTSMQGRIANLLQSSKEPIIKQII-NFHEMGIEITEL--LLKEPSVIELMK-SNQTF  132

Query  137  DLLIVGYFMNSFQLALGYKLKVPIVVALSNPPSLLGDVLGNPWEVSYVSAMHLTTDHGSP  196
            D +I   F+N          K P++         LG      W    V +    +   S 
Sbjct  133  DAVISEVFLNEAHFGFAEHFKAPLIG--------LGTFGAISWNTDLVGSPSPPSYVPSA  184

Query  197  M-GFGKRFLNLLGNLGQRLFM-----FLIEYGNART---YREIYGDDPTLPSYGDLNKNI  247
            +  F  R ++L+  +G + F+     FL  +   R    YR+ + ++     + D+ KN 
Sbjct  185  LLKFSDR-MSLVERVGNQAFLTYEYIFLNYFYLPRQEVLYRKYFPNNKQ--DFYDMRKNT  241

Query  248  SLVFFASHGISEGPIRPNVPAVIEVGGIQVKDRPDPLPRNMAEFLLEAPHGAILLSLGSN  307
            +LV    H +S    RP  P +IEVGG+ +  +  PLP+++ EF+  A HG I  S+GSN
Sbjct  242  ALVLLNQH-VSLSFPRPYSPNMIEVGGMHINRKRQPLPKDILEFIEGAEHGVIYFSMGSN  300

Query  308  LRKTHLKPDTVQKMFNVVSGLRQKVIWKWDDLENTPGSSENILYSKWLPQDDILAHPNIT  367
            L+   L  +  Q + +  + L+Q+V+WK++D  + PG   N+  S W PQDDILAH N+ 
Sbjct  301  LKSKTLPLEKRQALIDTFAQLKQRVLWKFED-TDLPGKPANVFISDWFPQDDILAHDNVL  359

Query  368  LFITHAGKGGVTEAQFHGKPMLALPVFGDQPSNADIMQKQGFGLKQSLLTLEEDSFRNGI  427
             FITH G    TE+ +H KP + +P+FGDQ  N    ++ G+G+      L        I
Sbjct  360  AFITHGGLLSTTESIYHRKPFVGIPIFGDQFLNMARAEQNGYGVTVHYEELSSAKLLAAI  419

Query  428  REVLENPKYARAVRSFSNLYRDRPMSAQQTFIYWVEYVIRHRGAQHLQSPVVHMSYIAVN  487
            ++++ NP+  + VR  S+ YRD+  +  +  +YWVE+V RH+GA++L+S    +++I  +
Sbjct  420  QKIINNPEATQRVRDMSDRYRDQQQTPLERAVYWVEHVSRHKGAKYLRSASQDLNFIQYH  479

Query  488  NFDVYALFLVAIAATCFVIKLFIGVLFK  515
            N D   +    I    + I L I ++++
Sbjct  480  NLDAMLILYGGIIFVLYCIFLLIRLVWR  507


>Q93242_CAEEL unnamed protein product
Length=530

 Score = 130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 130/519 (25%), Positives = 241/519 (46%), Gaps = 53/519 (10%)

Query  34   SHLVIQMSMARILAERGHNVTVVT-VLEPPFLHKDITHILVPLEKDDLQAFNSVVSGLTK  92
            SH+    S+   L + GH+VTVV  V++     K+ T I    ++  + A   VV   ++
Sbjct  31   SHIKFVGSVVDTLVDAGHDVTVVLPVIDST--QKNRTSIKSGAKQIIIDADEEVVEIFSQ  88

Query  93   TDN--TNAYAS-------MFRSVRQMSEAFTKMGS-VMKHQTVRNLYEHPDNRFDLLIVG  142
            T+   +N +         M+ + R +++ F K  + VMK   +  L +    +FDL I  
Sbjct  89   TEKFLSNMWTMEMSNPLMMWMNPRILTQLFGKQCTKVMKLSEL--LDQLKSEKFDLAITE  146

Query  143  YFMNSFQLALGYKLKVPIVVALSNPPSL--LGDVLGNPWEVSYVSAMHLTTDHGSPMGFG  200
             F +S    +   L++P  V++ +   +  + DVLG P   SYV      + +   M   
Sbjct  147  AF-DSCGYGIFEYLQIPAHVSILSCARMDHVSDVLGQPIAPSYVPGTQ--SLYSDRMTMT  203

Query  201  KRFLNLLGNL-GQRLFMFLIEYGNA---------RTYREIYGDDPTLPSYGDLNKNISLV  250
            +RFLN L  L G  +F  + +Y +A         R++REI  +   L     L  +I ++
Sbjct  204  QRFLNYLQFLNGNSMFSDIGDYESANAKKLLGVERSWREILPESSFL-----LTNHIPVL  258

Query  251  FFASHGISEGPIRPNVPAVIEVGGIQVKDRPDPLP-RNMAEFLLEAPHGAILLSLGSNLR  309
             F +         P    ++ +GGI V    + L   +  + ++      +++S GSN++
Sbjct  259  EFPA---------PTFDKIVPIGGISVNKNKETLKLEHYFDTMVSMRKKNVIISFGSNIK  309

Query  310  KTHLKPDTVQKMFNVVSGLRQKV--IWKWDDLENTPGSS--ENILYSKWLPQDDILAHPN  365
               + PD  +K    +  L   V  IWK+++L +   +    NI   +W+PQ ++LA   
Sbjct  310  SMDM-PDEYKKSLAELFQLMPDVTFIWKYENLADKKYTCGIMNINRVEWIPQTELLADSR  368

Query  366  ITLFITHAGKGGVTEAQFHGKPMLALPVFGDQPSNADIMQKQGFG--LKQSLLTLEEDSF  423
            +  FITH G G VTE    GKP + +P+F DQ  NA+++++ G    L ++ L   E + 
Sbjct  369  VDAFITHGGLGSVTELATMGKPAVVIPIFADQTRNAEMLKRHGGAEVLHKTDLANPE-TL  427

Query  424  RNGIREVLENPKYARAVRSFSNLYRDRPMSAQQTFIYWVEYVIRHRGAQHLQSPVVHMSY  483
            R  +R+V+++P Y +  +  + +  ++P + ++T +  VE+  R      +     H + 
Sbjct  428  RKTLRKVMDDPSYRQNAQRLAEMLNNQPTNPKETLVKHVEFAARFGKLPSMDPYGRHQNI  487

Query  484  IAVNNFDVYALFLVAIAATCFVIKLFIGVLFKKSKGNLK  522
            I   N D+ A+  + +    ++    +GV+ +   G  K
Sbjct  488  IEYYNLDILAIATILLTLVVYLKIFAVGVVVRCCCGKKK  526



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110425.1 rap guanine nucleotide exchange factor 2 isoform X1
[Drosophila elegans]

Length=1571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z025_DROME  unnamed protein product                                 2653    0.0  
Q9VMF3_DROME  unnamed protein product                                 2616    0.0  
Q95V18_DROME  unnamed protein product                                 2605    0.0  


>B7Z025_DROME unnamed protein product
Length=1569

 Score = 2653 bits (6876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1445/1574 (92%), Positives = 1485/1574 (94%), Gaps = 8/1574 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMHVGPPNFMD  1557
               R+Q  Q  Q QQQSL MPPPPPPPYNVPPL S+YSH QG  GSR LNHMH GPPNFMD
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPPYNVPPLGSIYSHHQGTAGSRHLNHMHGGPPNFMD  1555

Query  1558  STKCTICPMTSINQ  1571
             STKCTICPM  +NQ
Sbjct  1556  STKCTICPMPPMNQ  1569


>Q9VMF3_DROME unnamed protein product
Length=1573

 Score = 2616 bits (6780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1427/1552 (92%), Positives = 1466/1552 (94%), Gaps = 8/1552 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMH  1549
               R+Q  Q  Q QQQSL MPPPPPPPYNVPPL S+YSH QG  GSR LNHMH
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPPYNVPPLGSIYSHHQGTAGSRHLNHMH  1547


>Q95V18_DROME unnamed protein product
Length=1573

 Score = 2605 bits (6751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1422/1552 (92%), Positives = 1461/1552 (94%), Gaps = 8/1552 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGVGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEV MLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVAMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDF  FRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFGTFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISH NTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHVNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMH  1549
               R+Q  Q  Q QQQSL MPPPPPP YNVPPL S+YSH QG  GSR LNHMH
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPRYNVPPLGSIYSHHQGTAGSRHLNHMH  1547



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


Query= XP_017110426.1 rap guanine nucleotide exchange factor 2 isoform X1
[Drosophila elegans]

Length=1571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z025_DROME  unnamed protein product                                 2653    0.0  
Q9VMF3_DROME  unnamed protein product                                 2616    0.0  
Q95V18_DROME  unnamed protein product                                 2605    0.0  


>B7Z025_DROME unnamed protein product
Length=1569

 Score = 2653 bits (6876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1445/1574 (92%), Positives = 1485/1574 (94%), Gaps = 8/1574 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMHVGPPNFMD  1557
               R+Q  Q  Q QQQSL MPPPPPPPYNVPPL S+YSH QG  GSR LNHMH GPPNFMD
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPPYNVPPLGSIYSHHQGTAGSRHLNHMHGGPPNFMD  1555

Query  1558  STKCTICPMTSINQ  1571
             STKCTICPM  +NQ
Sbjct  1556  STKCTICPMPPMNQ  1569


>Q9VMF3_DROME unnamed protein product
Length=1573

 Score = 2616 bits (6780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1427/1552 (92%), Positives = 1466/1552 (94%), Gaps = 8/1552 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMH  1549
               R+Q  Q  Q QQQSL MPPPPPPPYNVPPL S+YSH QG  GSR LNHMH
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPPYNVPPLGSIYSHHQGTAGSRHLNHMH  1547


>Q95V18_DROME unnamed protein product
Length=1573

 Score = 2605 bits (6751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1422/1552 (92%), Positives = 1461/1552 (94%), Gaps = 8/1552 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGVGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEV MLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVAMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDF  FRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFGTFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISH NTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHVNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMH  1549
               R+Q  Q  Q QQQSL MPPPPPP YNVPPL S+YSH QG  GSR LNHMH
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPRYNVPPLGSIYSHHQGTAGSRHLNHMH  1547



Lambda      K        H
   0.323    0.138    0.420 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 714047328


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110427.1 rap guanine nucleotide exchange factor 2 isoform X1
[Drosophila elegans]

Length=1571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z025_DROME  unnamed protein product                                 2653    0.0  
Q9VMF3_DROME  unnamed protein product                                 2616    0.0  
Q95V18_DROME  unnamed protein product                                 2605    0.0  


>B7Z025_DROME unnamed protein product
Length=1569

 Score = 2653 bits (6876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1445/1574 (92%), Positives = 1485/1574 (94%), Gaps = 8/1574 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMHVGPPNFMD  1557
               R+Q  Q  Q QQQSL MPPPPPPPYNVPPL S+YSH QG  GSR LNHMH GPPNFMD
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPPYNVPPLGSIYSHHQGTAGSRHLNHMHGGPPNFMD  1555

Query  1558  STKCTICPMTSINQ  1571
             STKCTICPM  +NQ
Sbjct  1556  STKCTICPMPPMNQ  1569


>Q9VMF3_DROME unnamed protein product
Length=1573

 Score = 2616 bits (6780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1427/1552 (92%), Positives = 1466/1552 (94%), Gaps = 8/1552 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMH  1549
               R+Q  Q  Q QQQSL MPPPPPPPYNVPPL S+YSH QG  GSR LNHMH
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPPYNVPPLGSIYSHHQGTAGSRHLNHMH  1547


>Q95V18_DROME unnamed protein product
Length=1573

 Score = 2605 bits (6751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1422/1552 (92%), Positives = 1461/1552 (94%), Gaps = 8/1552 (1%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGVGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEV MLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVAMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDF  FRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFGTFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISH NTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHVNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV--HQQQHHHLHYRQQQSSTQHELSP  1437
             VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYV   Q  H     +QQQ+S+QHE SP
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGSISSCDSGYVHQQQHYHLQYQQQQQQNSSQHEPSP  1436

Query  1438  PVYTAADCRLLQQISNNAVTRNLNSLCQSTNTSSSTPIPPPTQPTATIQLSAPPTAAAYM  1497
             PVYTAADCRLLQQISNNAVTRNLNS CQSTNT  STP PPP QPTATIQLSAPPTAAAYM
Sbjct  1437  PVYTAADCRLLQQISNNAVTRNLNSPCQSTNTPPSTPTPPPNQPTATIQLSAPPTAAAYM  1496

Query  1498  QIRNQQNQQLQHQQQSLVMPPPPPPPYNVPPLASLYSHQQGNPGSRPLNHMH  1549
               R+Q  Q  Q QQQSL MPPPPPP YNVPPL S+YSH QG  GSR LNHMH
Sbjct  1497  HARSQHQQLQQ-QQQSLAMPPPPPPRYNVPPLGSIYSHHQGTAGSRHLNHMH  1547



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110428.1 rap guanine nucleotide exchange factor 2 isoform X2
[Drosophila elegans]

Length=1425
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B7Z026_DROME  unnamed protein product                                 2543    0.0  
Q9VMF3_DROME  unnamed protein product                                 2501    0.0  
B7Z025_DROME  unnamed protein product                                 2498    0.0  


>B7Z026_DROME unnamed protein product
Length=1422

 Score = 2543 bits (6592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1331/1426 (93%), Positives = 1366/1426 (96%), Gaps = 5/1426 (0%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTSVGPPNFMDSTKCTICPMTSINQ  1425
             VDLSLESSSVTTFRDLPLRKSVTS GPPNFMDSTKCTICPM  +NQ
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTSGGPPNFMDSTKCTICPMPPMNQ  1422


>Q9VMF3_DROME unnamed protein product
Length=1573

 Score = 2501 bits (6481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1313/1404 (94%), Positives = 1347/1404 (96%), Gaps = 5/1404 (0%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTS  1403
             VDLSLESSSVTTFRDLPLRKSVTS
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTS  1400


>B7Z025_DROME unnamed protein product
Length=1569

 Score = 2498 bits (6473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1313/1404 (94%), Positives = 1347/1404 (96%), Gaps = 5/1404 (0%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTS  1403
             VDLSLESSSVTTFRDLPLRKSVTS
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTS  1400


 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/21 (86%), Positives = 19/21 (90%), Gaps = 0/21 (0%)

Query  1405  GPPNFMDSTKCTICPMTSINQ  1425
             GPPNFMDSTKCTICPM  +NQ
Sbjct  1549  GPPNFMDSTKCTICPMPPMNQ  1569



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110430.1 rap guanine nucleotide exchange factor 2 isoform X3
[Drosophila elegans]

Length=1406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VMF3_DROME  unnamed protein product                                 2501    0.0  
B7Z026_DROME  unnamed protein product                                 2501    0.0  
B7Z025_DROME  unnamed protein product                                 2500    0.0  


>Q9VMF3_DROME unnamed protein product
Length=1573

 Score = 2501 bits (6483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1313/1404 (94%), Positives = 1347/1404 (96%), Gaps = 5/1404 (0%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTS  1403
             VDLSLESSSVTTFRDLPLRKSVTS
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTS  1400


>B7Z026_DROME unnamed protein product
Length=1422

 Score = 2501 bits (6483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1313/1404 (94%), Positives = 1347/1404 (96%), Gaps = 5/1404 (0%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTS  1403
             VDLSLESSSVTTFRDLPLRKSVTS
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTS  1400


>B7Z025_DROME unnamed protein product
Length=1569

 Score = 2500 bits (6480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1313/1404 (94%), Positives = 1347/1404 (96%), Gaps = 5/1404 (0%)

Query  1     MDPYHHIKHHYPPTSIASTGAAVGSFPAINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60
             MDPYHHI+HHYPPTSIA TG  VGS   INRPELHQKCNRGSHSSDTSSAYSGSDTMASN
Sbjct  1     MDPYHHIRHHYPPTSIAGTGVVVGSSTTINRPELHQKCNRGSHSSDTSSAYSGSDTMASN  60

Query  61    YASSMEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120
             YASS+EAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL
Sbjct  61    YASSLEAEEIDLSGLVESVVDSDEEDLAESMDSLTVRDAVRDCLEKDPAERSEEDVEVLL  120

Query  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180
             EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN
Sbjct  121   EFTQGLKAFTNITLAVRRALCSVMVFAVVDKAGTVVMSDGEELDSWSVLINGAVEIEHAN  180

Query  181   GSREELQMGDCFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240
             GSREELQMGD FGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED
Sbjct  181   GSREELQMGDSFGILPTMDKLYHRGVMRTKCDDCQFVCITQTDYYRIQHQGEENTRRHED  240

Query  241   ENGSVVMVTELRSIGGGSADCPGGGGSSTNALASLNMKRGHVVIRGTPERLLQQLVEENS  300
             ENG VVMVTELRSIGG   D  G GGS+T A ASLNMKRGHVVIRGTPERLLQQLVEENS
Sbjct  241   ENGFVVMVTELRSIGGAGTDSAGSGGSATGASASLNMKRGHVVIRGTPERLLQQLVEENS  300

Query  301   MTDPTYVEDFLLTHRIFIHNPKEVTSKLLHWFDLEQMDAHKTQELRDRVTRVVLLWVNNH  360
             MTDPTYVEDFLLTHRIFI NP+EVTSKLLHWFDLEQ+DAHKTQELRDRVTRVVLLWVNNH
Sbjct  301   MTDPTYVEDFLLTHRIFIQNPQEVTSKLLHWFDLEQVDAHKTQELRDRVTRVVLLWVNNH  360

Query  361   FTDFEADHEMMEFLEVFEALLEKKKLLSQLRLLHIACAAKARMRSSTLTRSSRDEPLKFS  420
             FTDFEAD+EMMEFLEVFEALLE+KKLLSQLRLLHIACAAKARMRS TLTRSSRDEPL F 
Sbjct  361   FTDFEADYEMMEFLEVFEALLERKKLLSQLRLLHIACAAKARMRSCTLTRSSRDEPLNFR  420

Query  421   IVGGYELRGVAVATGNAAVGIYISHVEPDSKAQEVGLKRGDQIHEVNGQSLDHVTSKRAI  480
             IVGGYELRGVA+ATGNAAVGIYISHVEP SKAQ+VGLKRGDQIHEVNGQSLDHVTSKRA+
Sbjct  421   IVGGYELRGVAIATGNAAVGIYISHVEPGSKAQDVGLKRGDQIHEVNGQSLDHVTSKRAL  480

Query  481   EILTGTTHLSISVKSNLLGFKEILQALEHGGGSAGSGSISAGNVTFKCLRSPRRICANDI  540
             EILTGTTHLSISVKSNLLGFKEI+QALEHGGG+AGSGSISAG+ +FK +RSPRRICANDI
Sbjct  481   EILTGTTHLSISVKSNLLGFKEIMQALEHGGGTAGSGSISAGSGSFKSVRSPRRICANDI  540

Query  541   AKLHGRSDSTTDELSTVNASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600
             AKLHGRSDSTTDELS+V+ASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ
Sbjct  541   AKLHGRSDSTTDELSSVSASNRAHMVRLSSVDMLLDQPDCAPPQTPPVSGSGNMASNFMQ  600

Query  601   QLLQSVNNSSAKKSSWSNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKHHHGSSLND  660
             QLLQSVNNSSAKKS   NSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNK +HGSSLND
Sbjct  601   QLLQSVNNSSAKKSG-GNSNSDQQDTKGGFMTLAPKRRLQKALAKMNLLNKQNHGSSLND  659

Query  661   SSDTLLNEPKSKLSTVTSCSSSTQSSINGCTVSGSGRLYQSQSNPDLTSLNYEGGSEAGG  720
             SSDTLLN+PKSKLS V+SCSSSTQSSINGCTVSG GRLYQSQSNPDLTSLNY+GGS+AGG
Sbjct  660   SSDTLLNDPKSKLSAVSSCSSSTQSSINGCTVSGGGRLYQSQSNPDLTSLNYDGGSDAGG  719

Query  721   SGDGRLQANFLGAHVHRPSAASTLTTNSMQSH-LPDYPDHVLKVYKADQTYKYVLIYKET  779
             +G GRLQ N+L AH+HRPSAASTLTTNS QSH LPDYPDHVLKVYKADQT KYVLIYKET
Sbjct  720   NGGGRLQVNYLNAHIHRPSAASTLTTNSTQSHLLPDYPDHVLKVYKADQTCKYVLIYKET  779

Query  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839
             TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK
Sbjct  780   TAHEVVMLTLQEFGIHDPSSNFSLCEVSVGDGGMVKQRRLPDQLQNLAERISFAARYYLK  839

Query  840   LNDSTEPLVPDELALELVRESSVHFLQLNAYELAIQLTLQDFANFRQIESTEYVDELFEI  899
             LNDSTEPLVPDELALELVRES+VHFL LNAYELAIQLTLQDFANFRQIESTEYVDELFE+
Sbjct  840   LNDSTEPLVPDELALELVRESNVHFLHLNAYELAIQLTLQDFANFRQIESTEYVDELFEL  899

Query  900   HSRYGVPMLSKFAELVNREMFWVVGEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959
              SRYGVPMLSKFAELVNREMFWVV EICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF
Sbjct  900   RSRYGVPMLSKFAELVNREMFWVVSEICAEHNIVRRMKIVKQFIKIARHCKECRNFNSMF  959

Query  960   AIISGLGHGAVSRLRLTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019
             AI+SGLGHGAVSRLR TWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII
Sbjct  960   AIVSGLGHGAVSRLRQTWEKLPSKYQRLFNDLQDLMDPSRNMSKYRQLVSAELLAQHPII  1019

Query  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079
             PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS
Sbjct  1020  PFYPIVKKDLTFIHLGNDTRVDGLINFEKLRMLAKEVRLLTHMCSSPYDLLSILELKGQS  1079

Query  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSAAAPNPKKMFEEAQMVRRVKA  1139
             PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKS AAPNPKKMFEEAQMVRRVKA
Sbjct  1080  PSNALFSLNQMSASQSNAAAGTVIAANAGQATIKRRKKSTAAPNPKKMFEEAQMVRRVKA  1139

Query  1140  YLNSLKILSDEDLLHKFSLECEPAQGSTYSGSISHGNTSHRSGGGGSISGGGGGSSSGGG  1199
             YLNSLKILSDEDLLHKFSLECEPA GSTYSGSISHGNTSHRSGGGGSISGG GGSS GGG
Sbjct  1140  YLNSLKILSDEDLLHKFSLECEPAHGSTYSGSISHGNTSHRSGGGGSISGGAGGSSGGGG  1199

Query  1200  AGSSSLNAGDQLSIYSHTSSSSAPNSSLSCRKRHPSSPTLSTTSSTSSTSDYQRRQVHNN  1259
              GSSSLNAGDQLSIYSHTSSSSAPNSSLS RKRHPSSPTLSTTSSTSSTSD+QRRQ+HNN
Sbjct  1200  GGSSSLNAGDQLSIYSHTSSSSAPNSSLSLRKRHPSSPTLSTTSSTSSTSDHQRRQMHNN  1259

Query  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVTRHGSAVPGVIPPLHHMHAAHGFSTPSAG  1319
             GPKFGTASPQAVKKMLSLSESSKIRPHQPFV RHGS + GVIPPLHHMHAAHGFSTPS G
Sbjct  1260  GPKFGTASPQAVKKMLSLSESSKIRPHQPFVPRHGSTMAGVIPPLHHMHAAHGFSTPSPG  1319

Query  1320  GALGQATSPAAGVVPNVQCTPSPSPCSHRRLASGGNIMPTRAIHERSHSDTPAPPPPLPS  1379
             G +   TSPA   V NVQCTPSPSPCSHRRLASGGNI+P+RAIHERSHSDTPAPPPPLPS
Sbjct  1320  GVV---TSPATSAVANVQCTPSPSPCSHRRLASGGNIIPSRAIHERSHSDTPAPPPPLPS  1376

Query  1380  VDLSLESSSVTTFRDLPLRKSVTS  1403
             VDLSLESSSVTTFRDLPLRKSVTS
Sbjct  1377  VDLSLESSSVTTFRDLPLRKSVTS  1400



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110431.1 C-type lectin 37Da-like isoform X1 [Drosophila
elegans]

Length=181
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B4ZJ93_DROME  unnamed protein product                                 134     3e-40
LEDL2_DROME  unnamed protein product                                  112     3e-31
Q9VIX1_DROME  unnamed protein product                                 102     1e-27


>B4ZJ93_DROME unnamed protein product
Length=175

 Score = 134 bits (338),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 104/177 (59%), Gaps = 10/177 (6%)

Query  1    MFLKFTGLCAIWGMIALSAAYEITPNVIDGVPGFLNITTAPFVKIGAGYYFVESANKKNW  60
            M +K TG      ++AL   +E++ NV   +   L  T   FV+IG  YY +E   +KNW
Sbjct  1    MIVKLTGSTTF--LVAL-FLFEVSRNVAGALEA-LQTTNDTFVRIGNSYYLIERKLQKNW  56

Query  61   FDAYESCRRMEADLITFDSLVEMNQITEYLIDTIVAQNLSLFWSSGTDFAEQDKHVWFSN  120
            F AYE CR+ +A+LI+ ++  E+  ++EYL+   + +    +W+SGTD   + KHVWFSN
Sbjct  57   FGAYEICRQQQAELISLETFDELRLVSEYLLANNIFER---YWTSGTDLGTKGKHVWFSN  113

Query  121  GQLISSELWLPGEPNNLHNEEHCDNLKIN---NGLGGLNDDRCEELHYSICEAPQPK  174
            GQ +S++LW  GEPNN +NEEHCD L  +       G+ND  C      ICE  QPK
Sbjct  114  GQPLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFICEEVQPK  170


>LEDL2_DROME unnamed protein product
Length=186

 Score = 112 bits (279),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 90/167 (54%), Gaps = 11/167 (7%)

Query  22   EITPNVIDGVPGFLNITTAPFVKIGAGYYFVESANKKNWFDAYESCRRMEADLITFDSLV  81
            + T ++ +G P  L +   PF+KI   YY V    K NW+ AYE+CRR++++L+TF++  
Sbjct  23   KYTTHIQNGNPYNLTVDMTPFIKINESYY-VFGQTKVNWYVAYENCRRLQSELVTFETAE  81

Query  82   EMNQITEYLIDTIVAQNLSLFWSSGTDFAEQDKHVWFSNGQLISSELWLPGEPNNLHNEE  141
            E + I  +L       + S  W+SG D  +   H WFSN QL++ + W P +P+N    E
Sbjct  82   EFDAIAAFLN---ARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTIKRWAPKQPDNAGGRE  138

Query  142  HCDNLKINNGLGG---LNDDRCE----ELHYSICEAPQPKTASFIIW  181
            HC +L    G      LND  C      L   ICEAP+ +T S ++W
Sbjct  139  HCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPKQETVSIVVW  185


>Q9VIX1_DROME unnamed protein product
Length=186

 Score = 102 bits (254),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 84/152 (55%), Gaps = 11/152 (7%)

Query  37   ITTAPFVKIGAGYYFVESANKKNWFDAYESCRRMEADLITFDSLVEMNQITEYLIDTIVA  96
            +   PF KI  GYYF       NW++AYE CR + ++L+TF++  E + +T +L  T   
Sbjct  38   VKAEPFTKINDGYYFF-GTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFL--TANG  94

Query  97   QNLSLFWSSGTDFAEQDKHVWFSNGQLISSELWLPGEPNNLHNEEHCDNLKI---NNGLG  153
              L+ +W+SG D A+   H WF+N Q ISS  W   +P+N   +EHC +L     ++   
Sbjct  95   SRLT-YWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKF  153

Query  154  GLNDDRCEE----LHYSICEAPQPKTASFIIW  181
             LND  C +    L   ICEAP+ +T S ++W
Sbjct  154  ELNDRPCSQDPNSLFKYICEAPEMETISIVVW  185



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110432.1 C-type lectin 37Da-like [Drosophila elegans]

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B4ZJ93_DROME  unnamed protein product                                 149     5e-46
LEDL2_DROME  unnamed protein product                                  138     1e-41
Q9VIX1_DROME  unnamed protein product                                 131     4e-39


>B4ZJ93_DROME unnamed protein product
Length=175

 Score = 149 bits (375),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 108/174 (62%), Gaps = 8/174 (5%)

Query  1    MFLKFTLLGAFLGVISLSASYKITPNVIDGVPGFLNITTAPFVKIGSGYYIFESK-AVNW  59
            M +K T    FL  + L   ++++ NV   +   L  T   FV+IG+ YY+ E K   NW
Sbjct  1    MIVKLTGSTTFLVALFL---FEVSRNVAGALEA-LQTTNDTFVRIGNSYYLIERKLQKNW  56

Query  60   YSAFESCRQMEADLIAFESPEELNLISEYITEVSKVVSYWTSGTDLTEQGKHIWFSNGQP  119
            + A+E CRQ +A+LI+ E+ +EL L+SEY+   +    YWTSGTDL  +GKH+WFSNGQP
Sbjct  57   FGAYEICRQQQAELISLETFDELRLVSEYLLANNIFERYWTSGTDLGTKGKHVWFSNGQP  116

Query  120  VSSDLWLPGEPSNSGNVERCVEFGIR---SKVTGLNDRNCIRLNGYICKAPQPK  170
            +S+DLW  GEP+N  N E C E G     +K  G+NDRNC   + +IC+  QPK
Sbjct  117  LSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFICEEVQPK  170


>LEDL2_DROME unnamed protein product
Length=186

 Score = 138 bits (347),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 101/182 (55%), Gaps = 10/182 (5%)

Query  6    TLLGAFLGVISLSASY---KITPNVIDGVPGFLNITTAPFVKIGSGYYIFESKAVNWYSA  62
            TL+  FL V   +  +   K T ++ +G P  L +   PF+KI   YY+F    VNWY A
Sbjct  4    TLVQLFLVVAGFAPGFGYDKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWYVA  63

Query  63   FESCRQMEADLIAFESPEELNLISEYITEVSKVVSYWTSGTDLTEQGKHIWFSNGQPVSS  122
            +E+CR+++++L+ FE+ EE + I+ ++        +WTSG DL + G H WFSN Q V+ 
Sbjct  64   YENCRRLQSELVTFETAEEFDAIAAFLNARGDRSEHWTSGNDLGKTGTHYWFSNAQLVTI  123

Query  123  DLWLPGEPSNSGNVERCVEFGI---RSKVTGLNDRNCIR----LNGYICKAPQPKTASFV  175
              W P +P N+G  E C+  G     S    LNDR C      L  YIC+AP+ +T S V
Sbjct  124  KRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPKQETVSIV  183

Query  176  IW  177
            +W
Sbjct  184  VW  185


>Q9VIX1_DROME unnamed protein product
Length=186

 Score = 131 bits (330),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 90/148 (61%), Gaps = 7/148 (5%)

Query  37   ITTAPFVKIGSGYYIFESKAVNWYSAFESCRQMEADLIAFESPEELNLISEYITEVSKVV  96
            +   PF KI  GYY F ++++NWY A+E CR++ ++L+ FE+ +E + ++ ++T     +
Sbjct  38   VKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRL  97

Query  97   SYWTSGTDLTEQGKHIWFSNGQPVSSDLWLPGEPSNSGNVERCVEFGI---RSKVTGLND  153
            +YWTSG DL + G H WF+N Q +SS  W   +P N+G  E C+  G     S+   LND
Sbjct  98   TYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELND  157

Query  154  RNCIR----LNGYICKAPQPKTASFVIW  177
            R C +    L  YIC+AP+ +T S V+W
Sbjct  158  RPCSQDPNSLFKYICEAPEMETISIVVW  185



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110434.1 uncharacterized protein LOC108134587 [Drosophila
elegans]

Length=108
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9U1X7_CAEEL  unnamed protein product                                 28.9    0.80 
M9PFL7_DROME  unnamed protein product                                 26.9    4.0  
Q8I943_DROME  unnamed protein product                                 26.9    4.1  


>Q9U1X7_CAEEL unnamed protein product
Length=258

 Score = 28.9 bits (63),  Expect = 0.80, Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 19/32 (59%), Gaps = 0/32 (0%)

Query  40   VGSSTVLLKMGQAFRLTSLPCTTIFCTGDGYG  71
            V +++ LL+M +AFR   +PC   +  G+  G
Sbjct  181  VRATSTLLEMSRAFRTNGVPCLQFYSNGNLIG  212


>M9PFL7_DROME unnamed protein product
Length=567

 Score = 26.9 bits (58),  Expect = 4.0, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  77   DKKEPPEDCRYTEYLNWDDDYPDC  100
            D +  P     + YL +DDD PDC
Sbjct  113  DHRNRPTQQNGSHYLEYDDDGPDC  136


>Q8I943_DROME unnamed protein product
Length=547

 Score = 26.9 bits (58),  Expect = 4.1, Method: Composition-based stats.
 Identities = 10/24 (42%), Positives = 13/24 (54%), Gaps = 0/24 (0%)

Query  77   DKKEPPEDCRYTEYLNWDDDYPDC  100
            D +  P     + YL +DDD PDC
Sbjct  111  DHRNRPTQQNGSHYLEYDDDGPDC  134



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110435.1 uncharacterized protein LOC108134588 [Drosophila
elegans]

Length=107
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38B64_TRYB2  unnamed protein product                                 28.1    1.7  
Q387G1_TRYB2  unnamed protein product                                 28.1    1.7  


>Q38B64_TRYB2 unnamed protein product
Length=1366

 Score = 28.1 bits (61),  Expect = 1.7, Method: Composition-based stats.
 Identities = 13/31 (42%), Positives = 18/31 (58%), Gaps = 6/31 (19%)

Query  4   FHLLVSVALLGVLLRAGHTAEWEGNYNDPRH  34
           FHLL+SV      +  G   EWEG+ +D +H
Sbjct  11  FHLLLSV------VPPGRGVEWEGSSDDQKH  35


>Q387G1_TRYB2 unnamed protein product
Length=1222

 Score = 28.1 bits (61),  Expect = 1.7, Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 22/47 (47%), Gaps = 8/47 (17%)

Query  58    ECRRIVCGHSGLALFQ-------SCGVSILSPPCRYGGYINTDLPYP  97
             E R++VCG S L  FQ       +C +        YG Y+ T +P P
Sbjct  991   EHRQVVCGES-LVRFQVERSALVTCAIQHAQSLTLYGNYVATSMPSP  1036



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110436.1 C-type lectin 37Da-like [Drosophila elegans]

Length=179
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

B4ZJ93_DROME  unnamed protein product                                 147     2e-45
Q9VIX1_DROME  unnamed protein product                                 98.6    5e-26
LEDL2_DROME  unnamed protein product                                  98.2    7e-26


>B4ZJ93_DROME unnamed protein product
Length=175

 Score = 147 bits (372),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 110/175 (63%), Gaps = 8/175 (5%)

Query  1    MFLKLTGLCAFLGILSISFAHKITPNVFEGVPDILNITTVPFRKIGSSYYNIASK-TVSW  59
            M +KLTG   FL  L   F  +++ NV  G  + L  T   F +IG+SYY I  K   +W
Sbjct  1    MIVKLTGSTTFLVAL---FLFEVSRNV-AGALEALQTTNDTFVRIGNSYYLIERKLQKNW  56

Query  60   YTAFASCRQMRADLIAFESLEELNLISQYLIDENIVIKSYWTSGTNLAEQDNHVWFSNGQ  119
            + A+  CRQ +A+LI+ E+ +EL L+S+YL+  NI  + YWTSGT+L  +  HVWFSNGQ
Sbjct  57   FGAYEICRQQQAELISLETFDELRLVSEYLLANNI-FERYWTSGTDLGTKGKHVWFSNGQ  115

Query  120  AVSSDLWISGGPINENKVEQCDEL--IIEPGRRVGLNDKKCSYLTSFICKVRQPK  172
             +S+DLW  G P N+N  E CDEL     P +  G+ND+ C++ +SFIC+  QPK
Sbjct  116  PLSTDLWYGGEPNNKNNEEHCDELGSDFRPTKSPGMNDRNCNFESSFICEEVQPK  170


>Q9VIX1_DROME unnamed protein product
Length=186

 Score = 98.6 bits (244),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 83/148 (56%), Gaps = 7/148 (5%)

Query  37   ITTVPFRKIGSSYYNIASKTVSWYTAFASCRQMRADLIAFESLEELNLISQYLIDENIVI  96
            +   PF KI   YY   +++++WY A+  CR++ ++L+ FE+ +E + ++ +L      +
Sbjct  38   VKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRL  97

Query  97   KSYWTSGTNLAEQDNHVWFSNGQAVSSDLWISGGPINENKVEQCDEL--IIEPGRRVGLN  154
             +YWTSG +LA+  +H WF+N Q +SS  W    P N  + E C  L  I +  R+  LN
Sbjct  98   -TYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELN  156

Query  155  DKKCSY----LTSFICKVRQPKTASFLI  178
            D+ CS     L  +IC+  + +T S ++
Sbjct  157  DRPCSQDPNSLFKYICEAPEMETISIVV  184


>LEDL2_DROME unnamed protein product
Length=186

 Score = 98.2 bits (243),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 88/184 (48%), Gaps = 13/184 (7%)

Query  1    MFLKLTGLCAFLGILSISFAHKITPNVFEGVPDILNITTVPFRKIGSSYYNIASKTVSWY  60
            +FL + G     G        K T ++  G P  L +   PF KI  SYY      V+WY
Sbjct  8    LFLVVAGFAPGFGY------DKYTTHIQNGNPYNLTVDMTPFIKINESYYVFGQTKVNWY  61

Query  61   TAFASCRQMRADLIAFESLEELNLISQYLIDENIVIKSYWTSGTNLAEQDNHVWFSNGQA  120
             A+ +CR+++++L+ FE+ EE + I+ +L +       +WTSG +L +   H WFSN Q 
Sbjct  62   VAYENCRRLQSELVTFETAEEFDAIAAFL-NARGDRSEHWTSGNDLGKTGTHYWFSNAQL  120

Query  121  VSSDLWISGGPINENKVEQCDEL--IIEPGRRVGLNDKKC----SYLTSFICKVRQPKTA  174
            V+   W    P N    E C  L  I        LND+ C    S L  +IC+  + +T 
Sbjct  121  VTIKRWAPKQPDNAGGREHCIHLGYIYGYSTEFQLNDRPCHNHASSLFKYICEAPKQETV  180

Query  175  SFLI  178
            S ++
Sbjct  181  SIVV  184



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110437.1 uncharacterized protein LOC108134590 [Drosophila
elegans]

Length=111
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VHN7_DROME  unnamed protein product                                 26.6    5.8  
Q7KSU6_DROME  unnamed protein product                                 26.6    6.2  
YAKA_DICDI  unnamed protein product                                   26.6    6.4  


>Q9VHN7_DROME unnamed protein product
Length=626

 Score = 26.6 bits (57),  Expect = 5.8, Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 1/60 (2%)

Query  1    MPQSTVFTFLALIIIIRGV-LAANIHYEIFADNGHPNKCVIEGPKGEVIVESGQSIRHPT  59
            +P ST+F     +   R V LAAN     F     PN CVI   +    +  G+ +R  +
Sbjct  444  IPGSTIFYPSDAVSTERAVELAANTKGVCFIRTSRPNTCVIYDNEEPFTIGRGKVVRQKS  503


>Q7KSU6_DROME unnamed protein product
Length=580

 Score = 26.6 bits (57),  Expect = 6.2, Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 1/60 (2%)

Query  1    MPQSTVFTFLALIIIIRGV-LAANIHYEIFADNGHPNKCVIEGPKGEVIVESGQSIRHPT  59
            +P ST+F     +   R V LAAN     F     PN CVI   +    +  G+ +R  +
Sbjct  398  IPGSTIFYPSDAVSTERAVELAANTKGVCFIRTSRPNTCVIYDNEEPFTIGRGKVVRQKS  457


>YAKA_DICDI unnamed protein product
Length=1458

 Score = 26.6 bits (57),  Expect = 6.4, Method: Composition-based stats.
 Identities = 8/18 (44%), Positives = 14/18 (78%), Gaps = 0/18 (0%)

Query  81   NPPKGCENDGYENINADF  98
            +P +   NDGY+N+N+D+
Sbjct  171  HPSEPLSNDGYDNVNSDY  188



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110438.1 uncharacterized protein LOC108134591 [Drosophila
elegans]

Length=83
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D1Z365_DROME  unnamed protein product                                 40.0    1e-05
C0PV13_DROME  unnamed protein product                                 34.3    0.002
Q9VNL6_DROME  unnamed protein product                                 35.4    0.002


>D1Z365_DROME unnamed protein product
Length=81

 Score = 40.0 bits (92),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/82 (33%), Positives = 42/82 (51%), Gaps = 7/82 (9%)

Query  1   MKLLWLVLLACVA-----AQHCDKPCPIKQNPGCASRDGKCFYTVRNPCILKAINCYRKL  55
           MKL +LV+LAC+       ++C+KPC     P C + DGKC++   + C L+   C RK 
Sbjct  1   MKLFFLVILACMLIGIAWGENCNKPCGKCILPTC-NYDGKCYFEGTSACALENEKCRRKK  59

Query  56  KSLSALKPISRSKCTKIQVPLC  77
            +L          C ++ V +C
Sbjct  60  NNLDQFVKTVSGFC-EMGVKMC  80


>C0PV13_DROME unnamed protein product
Length=84

 Score = 34.3 bits (77),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 36/74 (49%), Gaps = 3/74 (4%)

Query  1   MKLLWLVLLACVAAQHCDK--PCPIKQNPGCAS-RDGKCFYTVRNPCILKAINCYRKLKS  57
           + L+++++   +A    D+   C  K N  C    DG C +T  N C ++ I+C R+ K 
Sbjct  3   IHLIFVIVSLVLAKTIADECLTCDWKSNIHCGKVADGSCVFTALNRCQVERISCRREQKK  62

Query  58  LSALKPISRSKCTK  71
           L     I + KC K
Sbjct  63  LKPFTEIVKGKCPK  76


>Q9VNL6_DROME unnamed protein product
Length=730

 Score = 35.4 bits (80),  Expect = 0.002, Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 23/39 (59%), Gaps = 1/39 (3%)

Query  13   AAQHCDKPCPIKQNPGCASRDGKCFYTVRNPCILKAINC  51
            A + CDK CP    P CA+R+G   +T+ N C L+ + C
Sbjct  331  ACRRCDKTCPTVYQPICATRNG-INHTIVNECYLERVRC  368



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110441.1 uncharacterized protein LOC108134567 isoform X2
[Drosophila elegans]

Length=312
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95U15_DROME  unnamed protein product                                 619     0.0  
C1C553_DROME  unnamed protein product                                 610     0.0  
A0A0B4KG65_DROME  unnamed protein product                             609     0.0  


>Q95U15_DROME unnamed protein product
Length=312

 Score = 619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/312 (99%), Positives = 312/312 (100%), Gaps = 0/312 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF  240
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF  240

Query  241  RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH  300
            RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH
Sbjct  241  RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH  300

Query  301  PARPLTPHRSIL  312
            PARPLTPHRSIL
Sbjct  301  PARPLTPHRSIL  312


>C1C553_DROME unnamed protein product
Length=313

 Score = 610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/312 (98%), Positives = 308/312 (99%), Gaps = 0/312 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF  240
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF  240

Query  241  RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH  300
            RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH
Sbjct  241  RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH  300

Query  301  PARPLTPHRSIL  312
            PARPLTP    L
Sbjct  301  PARPLTPEEEDL  312


>A0A0B4KG65_DROME unnamed protein product
Length=310

 Score = 609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/312 (99%), Positives = 309/312 (99%), Gaps = 2/312 (1%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT   NYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT--TNYDAEKAWNDHLKRMQE  118

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  119  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  178

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF  240
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF
Sbjct  179  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRF  238

Query  241  RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH  300
            RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH
Sbjct  239  RDLLSPSPNLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH  298

Query  301  PARPLTPHRSIL  312
            PARPLTPHRSIL
Sbjct  299  PARPLTPHRSIL  310



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110443.1 uncharacterized protein LOC108134594 [Drosophila
elegans]

Length=122
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q21801_CAEEL  unnamed protein product                                 29.3    0.77 
G5EBN5_CAEEL  unnamed protein product                                 28.9    1.3  
H8ESG1_CAEEL  unnamed protein product                                 28.9    1.3  


>Q21801_CAEEL unnamed protein product
Length=451

 Score = 29.3 bits (64),  Expect = 0.77, Method: Composition-based stats.
 Identities = 24/89 (27%), Positives = 41/89 (46%), Gaps = 19/89 (21%)

Query  1    MVNPGDAIQPKNDAPSDIEFYRAKVRSVLRQLHAMKDYLTAGATEQFDESDVLARLEWVN  60
            ++  GD+I   + AP+   F+RA + S L Q    + Y       +FD S+V+       
Sbjct  382  LLRSGDSIV-VSIAPAGSVFFRADLAS-LHQPKGKRRY-------KFDNSNVV-------  425

Query  61   SMNLEFDSAQTSLEKLDFSEISKNTRFEF  89
                EF+  Q+ L + DF +  +  R +F
Sbjct  426  ---YEFEREQSQLGRFDFGDYLRTNRVQF  451


>G5EBN5_CAEEL unnamed protein product
Length=1492

 Score = 28.9 bits (63),  Expect = 1.3, Method: Composition-based stats.
 Identities = 19/80 (24%), Positives = 40/80 (50%), Gaps = 2/80 (3%)

Query  15   PSDIEFYRAKVRSVLRQLHAMKDYLTAGATEQFDESDVLARLEWVNSMN--LEFDSAQTS  72
            P  ++ Y AK+ S+   ++A+  Y++ G   + ++  +  RL++ N  N  +E  S+  S
Sbjct  244  PESVQRYYAKICSLKSAMYAVIAYMSFGDNLEKEDKKMGWRLQYYNIANKYMELLSSNHS  303

Query  73   LEKLDFSEISKNTRFEFSAI  92
              +  + E+   + F F  I
Sbjct  304  KMRERYPELFVTSSFLFDVI  323


>H8ESG1_CAEEL unnamed protein product
Length=1494

 Score = 28.9 bits (63),  Expect = 1.3, Method: Composition-based stats.
 Identities = 19/80 (24%), Positives = 40/80 (50%), Gaps = 2/80 (3%)

Query  15   PSDIEFYRAKVRSVLRQLHAMKDYLTAGATEQFDESDVLARLEWVNSMN--LEFDSAQTS  72
            P  ++ Y AK+ S+   ++A+  Y++ G   + ++  +  RL++ N  N  +E  S+  S
Sbjct  244  PESVQRYYAKICSLKSAMYAVIAYMSFGDNLEKEDKKMGWRLQYYNIANKYMELLSSNHS  303

Query  73   LEKLDFSEISKNTRFEFSAI  92
              +  + E+   + F F  I
Sbjct  304  KMRERYPELFVTSSFLFDVI  323



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110444.1 uncharacterized protein LOC108134595 isoform X1
[Drosophila elegans]

Length=437
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q585D1_TRYB2  unnamed protein product                                 30.0    5.0  
Q57XC6_TRYB2  unnamed protein product                                 29.6    6.5  
PRS6A_DICDI  unnamed protein product                                  29.3    7.0  


>Q585D1_TRYB2 unnamed protein product
Length=741

 Score = 30.0 bits (66),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 65/162 (40%), Gaps = 15/162 (9%)

Query  151  NNKRIVKNKGTTLRNQRPKLSVKNDVGIRSSSASTHTQPTIGSMGWSHRTLN--TVILP-  207
            + KR+V  K +   N++ +  VK D+ +         Q          R++N   V LP 
Sbjct  102  SGKRVVIMKHSDTNNKKGQKFVKPDIAMARPITHAGVQRDRNGTKHGERSVNGTCVWLPK  161

Query  208  -SCCTKRRFPQNLMDVVCEDCRHGVSL--LHGSRNSNTA---VNNTMDVDVHGMGSTNCA  261
             +C T   F +  +  +   C HG      HGS   + A   VN    V V  +      
Sbjct  162  ETCLTFLDFSEKRLRTL--PCPHGPGKHSCHGSGIVSLAKGRVNPMECVQVLQLSR----  215

Query  262  DPVGLNVRPAGYTSGGESDVENASAIGLCGSPLCLKAEQVVV  303
            + + L  RP     GGE  V+   A G+ G PL L A + VV
Sbjct  216  NKISLLTRPTPVARGGEEGVKANGAAGVVGKPLRLTAFRRVV  257


>Q57XC6_TRYB2 unnamed protein product
Length=750

 Score = 29.6 bits (65),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query  358  EAKTAVSQDLQNSKSREELIISQQPQKALSEEAFNSEVKGSTSHEIQSSTLLEANSSESS  417
            E + AV + LQN K+REE +     +   ++EAF  E+    S E++  T +EA  +++ 
Sbjct  604  ERENAVKRKLQNLKAREEELHKLVAKNDATDEAFREEL---ASAELRYQTEMEAAGADNV  660

Query  418  NVQVPMSIYN  427
              ++  SI N
Sbjct  661  VSRLTESIEN  670


>PRS6A_DICDI unnamed protein product
Length=421

 Score = 29.3 bits (64),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 32/64 (50%), Gaps = 8/64 (13%)

Query  128  TRVLTEESLSGN-EMDKARKRIRSNNKRIVKNKGTTLRNQRPKLSVKNDVGIRSSSASTH  186
            T+VL  E +S + EMD  +KRI+ NN ++  N       Q P L V N V I        
Sbjct  45   TKVLRSEHISKHLEMDSIQKRIKENNDKLQVN------TQLPHL-VANVVEIIDMVLDGE  97

Query  187  TQPT  190
            TQP+
Sbjct  98   TQPS  101



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110445.1 uncharacterized protein LOC108134595 isoform X3
[Drosophila elegans]

Length=112
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q586W2_TRYB2  unnamed protein product                                 32.3    0.064
Q8I5W5_PLAF7  unnamed protein product                                 28.5    1.2  
ANXB9_DROME  unnamed protein product                                  27.3    3.1  


>Q586W2_TRYB2 unnamed protein product
Length=603

 Score = 32.3 bits (72),  Expect = 0.064, Method: Composition-based stats.
 Identities = 27/101 (27%), Positives = 44/101 (44%), Gaps = 8/101 (8%)

Query  14   VLKALGILQSSGTHYVDVNDITRQVKAQMRNYNPVANMEEAILESLCNLT--NLGIVKRN  71
            +L  LG        +VD + +      ++ +Y     + E +++ LC L   + G     
Sbjct  43   ILPGLGFFTLVDGSFVDADTLGNNYFVELSDYAARKPLSEVLVKRLCELNPHSSGTACVQ  102

Query  72   SSSKYA---ICSPIFGR--VGRALPNRIIKVPGVPGTPLRR  107
            S  +++   I S   GR  VGR  P  I+  P +P T LRR
Sbjct  103  SCVEWSDSFISSTSGGRDFVGR-FPTLIVATPRLPATHLRR  142


>Q8I5W5_PLAF7 unnamed protein product
Length=3525

 Score = 28.5 bits (62),  Expect = 1.2, Method: Composition-based stats.
 Identities = 15/42 (36%), Positives = 22/42 (52%), Gaps = 6/42 (14%)

Query  4     FNVPKKVNRNVLKALGILQSSGTHYVDVNDITRQVKAQMRNY  45
             FN     N NV K++ I+        D+NDI + +KA+  NY
Sbjct  1429  FNTSDTYNHNVSKSINIISH------DINDILKIIKAREENY  1464


>ANXB9_DROME unnamed protein product
Length=324

 Score = 27.3 bits (59),  Expect = 3.1, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)

Query  52   EEAILESLCNLTNLGI  67
            EEAI+E LC L+N GI
Sbjct  113  EEAIIEILCTLSNYGI  128



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110446.1 acyl-CoA Delta12-desaturase [Drosophila elegans]

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K4Y0_DROME  unnamed protein product                                 784     0.0  
Q94541_DROME  unnamed protein product                                 781     0.0  
Q9U972_DROME  unnamed protein product                                 778     0.0  


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/383 (98%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MPPNAQAGAQSITDSLLAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60
            MPPNAQAGAQSI+DSL+AAASAAAD+GQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM
Sbjct  1    MPPNAQAGAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60

Query  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVILAYLLYVVSGLGITAGAH  120
            KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQT ILAY LYV+SGLGITAGAH
Sbjct  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180
            RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYFWGE  240
            HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYM+LMPIACFIIPTVVPMY WGE
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300
            SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360
            HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360

Query  361  GWGDVDQPKEEIEDAVITHKKSE  383
            GWGDVDQPKEEIEDAVITHKKSE
Sbjct  361  GWGDVDQPKEEIEDAVITHKKSE  383


>Q94541_DROME unnamed protein product
Length=383

 Score = 781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/383 (98%), Positives = 379/383 (99%), Gaps = 0/383 (0%)

Query  1    MPPNAQAGAQSITDSLLAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60
            MPPNAQAGAQSI+DSL+AAASAAAD+GQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM
Sbjct  1    MPPNAQAGAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60

Query  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVILAYLLYVVSGLGITAGAH  120
            KKAEKR LKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQT ILAY LYV+SGLGITAGAH
Sbjct  61   KKAEKRLLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180
            RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYFWGE  240
            HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYM+LMPIACFIIPTVVPMY WGE
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300
            SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360
            HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360

Query  361  GWGDVDQPKEEIEDAVITHKKSE  383
            GWGDVDQPKEEIEDAVITHKKSE
Sbjct  361  GWGDVDQPKEEIEDAVITHKKSE  383


>Q9U972_DROME unnamed protein product
Length=383

 Score = 778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/383 (97%), Positives = 377/383 (98%), Gaps = 0/383 (0%)

Query  1    MPPNAQAGAQSITDSLLAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60
            MPPNAQAGAQSI+DSL+AAASAAAD+GQSPTKLQEDSTGVLFE DVETTDGGLVKDITVM
Sbjct  1    MPPNAQAGAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFESDVETTDGGLVKDITVM  60

Query  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVILAYLLYVVSGLGITAGAH  120
            KKAEKRRLKLVWRNII FGY HLAALYGAYLMVTSAKWQT ILAY LYV+SGLGITAGAH
Sbjct  61   KKAEKRRLKLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180
            RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYFWGE  240
            HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYM+LMPIACFIIPTVVPMY WGE
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300
            SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360
            HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360

Query  361  GWGDVDQPKEEIEDAVITHKKSE  383
            GWGDVDQPKEEIEDAVITHKKSE
Sbjct  361  GWGDVDQPKEEIEDAVITHKKSE  383



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110447.1 acyl-CoA Delta12-desaturase [Drosophila elegans]

Length=383
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K4Y0_DROME  unnamed protein product                                 784     0.0  
Q94541_DROME  unnamed protein product                                 781     0.0  
Q9U972_DROME  unnamed protein product                                 778     0.0  


>Q7K4Y0_DROME unnamed protein product
Length=383

 Score = 784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/383 (98%), Positives = 380/383 (99%), Gaps = 0/383 (0%)

Query  1    MPPNAQAGAQSITDSLLAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60
            MPPNAQAGAQSI+DSL+AAASAAAD+GQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM
Sbjct  1    MPPNAQAGAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60

Query  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVILAYLLYVVSGLGITAGAH  120
            KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQT ILAY LYV+SGLGITAGAH
Sbjct  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180
            RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYFWGE  240
            HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYM+LMPIACFIIPTVVPMY WGE
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300
            SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360
            HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360

Query  361  GWGDVDQPKEEIEDAVITHKKSE  383
            GWGDVDQPKEEIEDAVITHKKSE
Sbjct  361  GWGDVDQPKEEIEDAVITHKKSE  383


>Q94541_DROME unnamed protein product
Length=383

 Score = 781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/383 (98%), Positives = 379/383 (99%), Gaps = 0/383 (0%)

Query  1    MPPNAQAGAQSITDSLLAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60
            MPPNAQAGAQSI+DSL+AAASAAAD+GQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM
Sbjct  1    MPPNAQAGAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60

Query  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVILAYLLYVVSGLGITAGAH  120
            KKAEKR LKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQT ILAY LYV+SGLGITAGAH
Sbjct  61   KKAEKRLLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180
            RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYFWGE  240
            HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYM+LMPIACFIIPTVVPMY WGE
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300
            SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360
            HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360

Query  361  GWGDVDQPKEEIEDAVITHKKSE  383
            GWGDVDQPKEEIEDAVITHKKSE
Sbjct  361  GWGDVDQPKEEIEDAVITHKKSE  383


>Q9U972_DROME unnamed protein product
Length=383

 Score = 778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/383 (97%), Positives = 377/383 (98%), Gaps = 0/383 (0%)

Query  1    MPPNAQAGAQSITDSLLAAASAAADSGQSPTKLQEDSTGVLFECDVETTDGGLVKDITVM  60
            MPPNAQAGAQSI+DSL+AAASAAAD+GQSPTKLQEDSTGVLFE DVETTDGGLVKDITVM
Sbjct  1    MPPNAQAGAQSISDSLIAAASAAADAGQSPTKLQEDSTGVLFESDVETTDGGLVKDITVM  60

Query  61   KKAEKRRLKLVWRNIIAFGYLHLAALYGAYLMVTSAKWQTVILAYLLYVVSGLGITAGAH  120
            KKAEKRRLKLVWRNII FGY HLAALYGAYLMVTSAKWQT ILAY LYV+SGLGITAGAH
Sbjct  61   KKAEKRRLKLVWRNIIVFGYFHLAALYGAYLMVTSAKWQTCILAYFLYVISGLGITAGAH  120

Query  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180
            RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS
Sbjct  121  RLWAHRSYKAKWPLRVILVIFNTIAFQDAAYHWARDHRVHHKYSETDADPHNATRGFFFS  180

Query  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMLLMPIACFIIPTVVPMYFWGE  240
            HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYM+LMPIACFIIPTVVPMY WGE
Sbjct  181  HVGWLLCKKHPEVKAKGKGVDLSDLRADPILMFQKKYYMILMPIACFIIPTVVPMYAWGE  240

Query  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300
            SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY
Sbjct  241  SFMNAWFVATMFRWCFILNVTWLVNSAAHKFGGRPYDKFINPSENISVAILAFGEGWHNY  300

Query  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360
            HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW
Sbjct  301  HHVFPWDYKTAEFGKYSLNFTTAFIDFFAKIGWAYDLKTVSTDIIKKRVKRTGDGTHATW  360

Query  361  GWGDVDQPKEEIEDAVITHKKSE  383
            GWGDVDQPKEEIEDAVITHKKSE
Sbjct  361  GWGDVDQPKEEIEDAVITHKKSE  383



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110448.1 uncharacterized protein LOC108134567 isoform X3
[Drosophila elegans]

Length=230
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E1JIK9_DROME  unnamed protein product                                 460     3e-167
E1JIK6_DROME  unnamed protein product                                 458     2e-166
Q95U15_DROME  unnamed protein product                                 457     1e-164


>E1JIK9_DROME unnamed protein product
Length=230

 Score = 460 bits (1183),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 229/230 (99%), Positives = 230/230 (100%), Gaps = 0/230 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFEL  230
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFEL
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFEL  230


>E1JIK6_DROME unnamed protein product
Length=236

 Score = 458 bits (1179),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/229 (99%), Positives = 229/229 (100%), Gaps = 0/229 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFE  229
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFE
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFE  229


>Q95U15_DROME unnamed protein product
Length=312

 Score = 457 bits (1175),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/229 (99%), Positives = 229/229 (100%), Gaps = 0/229 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARSTRAGSEP  180
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPAR+TRAGSEP
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKARRSASPFRPARTTRAGSEP  180

Query  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFE  229
            YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFE
Sbjct  181  YVPPPSYWNREGSVPRGGPSVFDRATSLAPFTRPSFRASSLEPLDELFE  229



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110450.1 protein VAC14 homolog [Drosophila elegans]

Length=687
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57WG8_TRYB2  unnamed protein product                                 106     1e-23
Q9VN44_DROME  unnamed protein product                                 38.9    0.018
Q8I3M5_PLAF7  unnamed protein product                                 37.4    0.054


>Q57WG8_TRYB2 unnamed protein product
Length=691

 Score = 106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 149/682 (22%), Positives = 293/682 (43%), Gaps = 64/682 (9%)

Query  1    MEPSYAPLSESCAKALGDKVYEKRKLASQEIEKMVTEFNNKNNSTQ-----IRKLIEVLA  55
            M  S+ P      K L D   E R+  ++E+ + V+     ++ T+      ++L E+  
Sbjct  1    MGESFVPARSF--KLLVDAKVELRQKGAKEVSQKVSTVFRSSSITEAYEITTKELHEIER  58

Query  56   TDYATSRDVNRRKGALIGLAA--TGLGLGKDSDKYVQGLVTPIMTCLSDPDLRVRYFACE  113
            +   T+    RR G +I + A    L       + V+ L T +   ++D D+ VR  A E
Sbjct  59   SLLRTTSPTYRR-GGMIAIRAIIASLPPRNHEQRLVEDLATIVFDSVADVDVSVRMAAFE  117

Query  114  SLYNVVKVARSAIIPF-FPELFAALSRLVTDSDQMVKDGSELLDRLLKDIVTESSQ-TFN  171
            + + +V+  +  ++ F F   F  ++  +++ D+ V   +  +   ++++VT +   +F 
Sbjct  118  AAHALVRNLQQQLLNFCFLRTFRGVACGISEGDKRVVLLAREVSSAIRELVTGNDNFSFK  177

Query  172  LQGFIPLLREHIY----------VKDAFARQYVISWI-SILNAVPDINMVNYLTEILDGL  220
             + F+  + E +              +   ++ + WI  +LN   D  ++     +   L
Sbjct  178  TELFVTFINETLVPFCCATGDEGSTHSAVVEWCLEWIYHVLNLPGDDFIIQLWQLLKPLL  237

Query  221  FVMLEDNTPE----IQRMCETTISQFLKSIRNDSSSVRMEDTINTLITHAQSPNE-LIKS  275
             +    N  E    +Q+    T   F + +      VR+   ++      Q  N  L K 
Sbjct  238  LLSGTCNGSEALSLLQKCLGKTKDAFTRHV-----DVRVAKLVSIACECVQDANAALAKK  292

Query  276  IAITWIREFVQIFGPNVLPYASGIFTAILPCLEYNVESKRSIKECAVSVNNSMMLLVSTK  335
             A+ WI E   +    +L    G+  A   CL          +  A  VN  +   ++  
Sbjct  293  SALEWISELHTVGALELLDLTDGVVKA---CLSQLGSKDLETRLAAQKVNQKITQFIAAP  349

Query  336  ELKTQTESKIDLRSIM-DVLSQYLTHNSMHTKIAVLKWIHHLFTNFPTEMSVHASNLNNN  394
               T+    I   +++  VL Q    +    ++A L+WI  +    P  +        + 
Sbjct  350  RDDTKA---IPYEAVLKGVLEQLADRSVEEVRVAALEWIVLVLHAAPDVLECCFDASFDT  406

Query  395  LLSTLADNSDEVVLQSLSVLAEIVNSQDSRELNDFNKSHYRKFLLSLLNLFSEEKLMLEN  454
             ++ L D S  VV + + VL  I             + H+  F+  L++L   +  +L  
Sbjct  407  TVALLCDRSLHVVHKCIEVLCLISG-----------EVHFDHFIARLVDLIHTKADVLLP  455

Query  455  RASLIIRKLCV------LLNAEYIYRTFAEIIAEEVPNLKFASTVVRLLNIILLTSTELF  508
            +   II++L +      L   E +    A++++    + +F    V  LN +LLTS EL 
Sbjct  456  KVPTIIKQLQLRYQEEDLGQCEKLCLKLADVVSSH-KDKRFVEKFVITLNTMLLTSRELL  514

Query  509  ELRTSL-RNIANEKSADLFQCLYKSWAHCPVSTLSLCLLAQSYQHVSRLVTLFADVEITL  567
             LR  L R + + ++ + F  LY  + +  VS LSLC L+++Y+H  +LV      E++ 
Sbjct  515  PLREVLHRGVDDARAREAFLGLYNCFCYNTVSALSLCFLSRAYEHAYQLVRFMGSCEMSA  574

Query  568  ELLTELDKLVQLIESPIFAPLRLTLVSKANNCADAQYLAHALFGILMLLPQ-TEAFDTLR  626
              L +L++LV+LIE+P  + +R+ L+ + + C     L   LF + ++LPQ +  +  L 
Sbjct  575  NTLVQLERLVRLIETPALSYVRIALM-EPSKCLP---LVRTLFAMQLILPQCSPQYMILY  630

Query  627  NRLQCVPNYWGHDPIDERNSLE  648
             R++ +P+    +  D  N+++
Sbjct  631  RRIKTIPSLARLEREDSANAVQ  652


>Q9VN44_DROME unnamed protein product
Length=1105

 Score = 38.9 bits (89),  Expect = 0.018, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 30/53 (57%), Gaps = 0/53 (0%)

Query  63   DVNRRKGALIGLAATGLGLGKDSDKYVQGLVTPIMTCLSDPDLRVRYFACESL  115
            D   R  AL+ ++A G G  K  +  +  +++ ++  LSDP  RVRY AC ++
Sbjct  372  DWKHRFAALMAISAIGEGCHKQMEAILDEVMSGVLNFLSDPHPRVRYAACNAI  424


>Q8I3M5_PLAF7 unnamed protein product
Length=1123

 Score = 37.4 bits (85),  Expect = 0.054, Method: Compositional matrix adjust.
 Identities = 51/260 (20%), Positives = 110/260 (42%), Gaps = 34/260 (13%)

Query  70   ALIGLAATGLGLGKDS-DKYVQGLVTPIMTCLSDPDLRVRYFACESLYNVVKVARSAI-I  127
             ++ +A T   L +D  ++ ++ ++  ++  L D D+RVRY AC+++  +    +  +  
Sbjct  409  GIMAIAQTIEYLPEDEIEEQLEHVIKMLLQILVDQDVRVRYAACQAIGQISLDHQPYVQK  468

Query  128  PFFPELFAALSRLVTDSDQMVK--------DGSELLDRL----LKDIVTES-SQTFNLQG  174
             FF E+ +AL   + D    V+        + +E LD++      DI+ +   Q  N   
Sbjct  469  EFFSEILSALINTMNDVHLRVQSHATAAFVNYAEELDKMALLPYADIIIDILLQKLNSSN  528

Query  175  FIPLLREHIYVKDAFARQYVISWISILNAVPDINMVNYLTEILDGLFVMLEDNTPEIQRM  234
            ++              R+  ++ I+++  V + + + Y + ++  +  +++    E +R 
Sbjct  529  YL------------LVREQAVTAIAVIAGVIEEDFLKYYSTVVPMMKDIIQKAVSEEERT  576

Query  235  CET----TISQFLKSIRNDSSSVRMEDTINTLI---THAQSPNELIKSIAITWIREFVQI  287
            C       IS    S+  D      ++ +N L+   +    P++ +K      I    + 
Sbjct  577  CRGKAIECISIIGLSVGKDIFIEDAKECMNALLQISSTKMDPDDTVKEYIQEAIGRICRA  636

Query  288  FGPNVLPYASGIFTAILPCL  307
             G +  PY S I   IL  L
Sbjct  637  LGNDFYPYLSSIVPTILSVL  656



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110451.1 DNA-directed RNA polymerase III subunit RPC3
[Drosophila elegans]

Length=522
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38C53_TRYB2  unnamed protein product                                 32.0    1.7  
Q38AY8_TRYB2  unnamed protein product                                 31.2    2.4  
Q18496_CAEEL  unnamed protein product                                 31.2    2.6  


>Q38C53_TRYB2 unnamed protein product
Length=1594

 Score = 32.0 bits (71),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 41/90 (46%), Gaps = 2/90 (2%)

Query  64    DFAASKQNPFLAEYALRREDVLC-LLRYPRYVH-LVQTKYGNVGASIAEELINSGSDTAS  121
             +F +   NPF+A    RR  ++  LL+YPR     V  + GN  A +   ++N  +    
Sbjct  1458  EFGSWVNNPFVALNTFRRTQIVALLLQYPRGPEKPVVKRAGNKKAFLPPVIVNPNNRMEI  1517

Query  122   GILIKCLAEGENKAESPESYRNTFLQMITD  151
              I + C  E   +  +    RN+ + ++ +
Sbjct  1518  AIDLNCQDENMTRIATTPYTRNSEVALVAN  1547


>Q38AY8_TRYB2 unnamed protein product
Length=499

 Score = 31.2 bits (69),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 14/47 (30%), Positives = 25/47 (53%), Gaps = 0/47 (0%)

Query  403  YLFQVKEKDTVRMLLDASYKSLYNTIERSNFEKNEHKGLIEKSQRLD  449
            YLF V E+D    +LD  Y  ++N  + S +  N++   + +  R+D
Sbjct  116  YLFTVAEQDDNNPMLDHPYAIVFNPDDDSLYASNQNSVTVARYTRVD  162


>Q18496_CAEEL unnamed protein product
Length=680

 Score = 31.2 bits (69),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 28/119 (24%), Positives = 49/119 (41%), Gaps = 18/119 (15%)

Query  310  GGVYVVDMEHAFESLAFACVESVITERFGSKAARIFRVIRCKKYIEQEDLQKEAMIPSKE  369
            G V+V  M+ A  ++++ C+E  I   +G+K A IF                E   P+ +
Sbjct  81   GNVFVKFMDGAKTNISYNCLERNIKRGYGNKIAYIF----------------EGNEPT-D  123

Query  370  AKSLAYNLFQEQFIHVKIIKKPGGGSNGPAKAFYLFQVKEKDTVRMLLDASYKSLYNTI  428
              +  YN    Q +    + +  G   G   A YL  + E   V ML  A   ++++ +
Sbjct  124  TSTWTYNELHAQVVQFSAVLRSHGVKRGDVVALYLPMIPEL-AVAMLACARIGAMHSVV  181



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110453.1 programmed cell death protein 2-like [Drosophila
elegans]

Length=486
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MZ50_DROME  unnamed protein product                                 57.8    7e-09
Q9W1A3_DROME  unnamed protein product                                 57.8    7e-09
Q580E6_TRYB2  unnamed protein product                                 50.1    2e-06


>Q8MZ50_DROME unnamed protein product
Length=347

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 8/89 (9%)

Query  30   NKIGGTPDWPRHEVTIPT----CPLCGAVRPLIVQMYAPL-DRSQFHRSLYVFGCVSPAC  84
            +K+GG P W   E   PT    C  C A +  + Q+YAP  D   FHRS+YVF C +  C
Sbjct  24   SKLGGQPAWLELEALPPTSQLQCSKCRAPKSFLAQLYAPFEDEYNFHRSIYVFLCRNSDC  83

Query  85   --SQNSKSWACVRTQHLDHQFEVISEQSP  111
              +QN+ ++  +R+Q L  + +  SE+ P
Sbjct  84   QEAQNASNFTVLRSQ-LPRKNKFFSEEEP  111


 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 48/118 (41%), Gaps = 15/118 (13%)

Query  358  TGGASGSGEAGEDHESYEKALPAHGDIVFHNFITTIQQNPGQVLRYSRDALPLLVAPLTE  417
            TG  S   EA  D   Y     A  D  F  F       P Q++RY R   PL +    +
Sbjct  217  TGDLSNVSEAEMD--KYFGNSAAADDKTFRQFKKQTAAEPDQIVRYKRGGQPLWITNTVK  274

Query  418  PI-------PKCPNCKGETICEVQLLPTLIPKLRFQLNGCNAPIEFGNVLVFTCLKSC  468
             +       P C  C GE   E Q++P  +  L       +  +++G + V+TC KSC
Sbjct  275  TVEDQLNKLPNCIACGGERQFEFQIMPQALTLLE------DENLDWGVLAVYTCAKSC  326


>Q9W1A3_DROME unnamed protein product
Length=347

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 49/89 (55%), Gaps = 8/89 (9%)

Query  30   NKIGGTPDWPRHEVTIPT----CPLCGAVRPLIVQMYAPL-DRSQFHRSLYVFGCVSPAC  84
            +K+GG P W   E   PT    C  C A +  + Q+YAP  D   FHRS+YVF C +  C
Sbjct  24   SKLGGQPAWLELEALPPTSQLQCSKCRAPKSFLAQLYAPFEDEYNFHRSIYVFLCRNSDC  83

Query  85   --SQNSKSWACVRTQHLDHQFEVISEQSP  111
              +QN+ ++  +R+Q L  + +  SE+ P
Sbjct  84   QEAQNASNFTVLRSQ-LPRKNKFFSEEEP  111


 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/118 (29%), Positives = 48/118 (41%), Gaps = 15/118 (13%)

Query  358  TGGASGSGEAGEDHESYEKALPAHGDIVFHNFITTIQQNPGQVLRYSRDALPLLVAPLTE  417
            TG  S   EA  D   Y     A  D  F  F       P Q++RY R   PL +    +
Sbjct  217  TGDLSNVSEAEMD--KYFGNSAAADDKTFRQFKKQTAAEPDQIVRYKRGGQPLWITNTVK  274

Query  418  PI-------PKCPNCKGETICEVQLLPTLIPKLRFQLNGCNAPIEFGNVLVFTCLKSC  468
             +       P C  C GE   E Q++P  +  L       +  +++G + V+TC KSC
Sbjct  275  TVEDQLNKLPNCIACGGERQFEFQIMPQALTLLE------DENLDWGVLAVYTCAKSC  326


>Q580E6_TRYB2 unnamed protein product
Length=335

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 48/101 (48%), Gaps = 2/101 (2%)

Query  385  VFHNFITTIQQNPGQVLRYSRDALPLLVAPLTEPIPKCPNCKGETICEVQLLPTLIPKLR  444
            +   ++  I + P Q +R+     PL  +P    IP+CP C  E   E+QL   +I  L 
Sbjct  236  LLRKYVDRIGRVPSQCVRWGPGQKPLRSSPAPIVIPRCPRCSNERRYELQLTSPIIYFLT  295

Query  445  FQLNGCNAPIEFGNVLVFTCLKSCWDTPDLMRYEHIVVQSE  485
                  +  + FG+VLV+TC  +C   P     EH VV+ E
Sbjct  296  KGKEEKDHSLHFGSVLVYTCGGNCNVQP--YSLEHCVVEDE  334



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110454.1 F-box only protein 9 [Drosophila elegans]

Length=444
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VY46_DROME  unnamed protein product                                 35.8    0.074
ESM5_DROME  unnamed protein product                                   32.0    0.60 
Q388V9_TRYB2  unnamed protein product                                 31.2    2.1  


>Q9VY46_DROME unnamed protein product
Length=669

 Score = 35.8 bits (81),  Expect = 0.074, Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 45/92 (49%), Gaps = 17/92 (18%)

Query  138  DVGEEVVDNLYDKFQQDLRQ---DSIYNGKMIASSRDASVLTTGLHFSDLPPEIVMRILR  194
            + GE+    L++    DL Q   D+  +G+  A           +  +DLP EI++RIL 
Sbjct  289  NCGEDGATKLHEFINNDLSQFLADNCVDGEAAAPQ---------ICLTDLPFEILLRILS  339

Query  195  WVVSAQLDMRSLEQCAAVSKGFYVYARDEELW  226
            +     LD++SL +   VS+ FY  +R   L+
Sbjct  340  Y-----LDLKSLFRVGHVSRTFYDISRHPLLY  366


>ESM5_DROME unnamed protein product
Length=178

 Score = 32.0 bits (71),  Expect = 0.60, Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 34/63 (54%), Gaps = 0/63 (0%)

Query  118  YHSLASDLAKQLDLGPPDTSDVGEEVVDNLYDKFQQDLRQDSIYNGKMIASSRDASVLTT  177
            Y +  S++++ +   P  + DVG+ V+ +L  +FQ+ L+ D +      ++ R  S  ++
Sbjct  93   YMNAVSEISRVMACTPAMSVDVGKTVMTHLGVEFQRMLQADQVQTSVTTSTPRPLSPASS  152

Query  178  GLH  180
            G H
Sbjct  153  GYH  155


>Q388V9_TRYB2 unnamed protein product
Length=1087

 Score = 31.2 bits (69),  Expect = 2.1, Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (55%), Gaps = 1/44 (2%)

Query  233  VWGHNVGTLEAQDSDISNVYYSWRDMFI-RRERVLFNGCYISKT  275
            +W  N G+LE +DS +  VY    ++ +  + R   +GC IS T
Sbjct  272  IWVRNQGSLEIRDSSLEAVYGGRSNLVLTEKGRCTSHGCTISAT  315



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110455.1 uncharacterized protein LOC108134567 isoform X4
[Drosophila elegans]

Length=164
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8INF1_DROME  unnamed protein product                                 327     8e-117
Q8I062_DROME  unnamed protein product                                 326     2e-116
E1JIK6_DROME  unnamed protein product                                 327     7e-116


>Q8INF1_DROME unnamed protein product
Length=166

 Score = 327 bits (838),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKA  161
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKA
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKA  161


>Q8I062_DROME unnamed protein product
Length=168

 Score = 326 bits (836),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 160/164 (98%), Positives = 161/164 (98%), Gaps = 0/164 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKAIKV  164
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNK   +
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKGKDI  164


>E1JIK6_DROME unnamed protein product
Length=236

 Score = 327 bits (839),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%), Gaps = 0/161 (0%)

Query  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60
            MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY
Sbjct  1    MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSYLDSPSYRSIY  60

Query  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120
            DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE
Sbjct  61   DEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRTIPANYDAEKAWNDHLKRMQE  120

Query  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKA  161
            IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKA
Sbjct  121  IERRYPSRYGLYLRDKPLTPNSLVPLEYEPEDKLLAELNKA  161



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


Query= XP_017110456.1 UNC93-like protein MFSD11 [Drosophila elegans]

Length=436
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UNC93_CAEEL  unnamed protein product                                  77.0    7e-15
B7YZU1_DROME  unnamed protein product                                 66.6    1e-11
Q7K3V9_DROME  unnamed protein product                                 65.9    2e-11


>UNC93_CAEEL unnamed protein product
Length=705

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 109/474 (23%), Positives = 199/474 (42%), Gaps = 94/474 (20%)

Query  1    MDRKFLMIL-ILGFGFMFVFTAFQTMCNIEKTILDSISQEDDSFKGEGYTSLAIIYLFFS  59
            + RK +  L IL   F+F+FTAF  + N++ ++   +          G  SL  +YL  +
Sbjct  242  IKRKIMSNLWILSVAFLFLFTAFNGLQNLQTSVNGDL----------GSDSLVALYLSLA  291

Query  60   LSNWLAPSF-ISFTGPRVAMVVGALTYTVFMITFMFPSTVLLYVGSAVLGLGASITWTGQ  118
            +S+   PSF I+  G ++  ++    Y ++++  + P+   +   S   G+ AS  W  +
Sbjct  292  ISSLFVPSFMINRLGCKLTFLIAIFVYFLYIVINLRPTYSSMIPASIFCGIAASCIWGAK  351

Query  119  GTYLARC----------SETTTISRNSGVFWALLECSMFIGNLF----------------  152
              Y+             S+TT I R  G F+ ++ C   +GN+                 
Sbjct  352  CAYITEMGIRYASLNFESQTTVIVRFFGYFFMIVHCGQVVGNMVSSYIFTLSYSQALRGP  411

Query  153  ---VY----YQFQD---------KTHIDKETRNLVIGV----LTVIAVLGIVFLAALRFM  192
               +Y    YQF           ++++ +  + + + V    L  + + G++    L  +
Sbjct  412  EDSIYDSCGYQFPKNLSDLTELAESNLARPPQKVYVAVCLAYLACVIISGMIMSMFLNAL  471

Query  193  ADNAEHDNELEQKHTGCGQAMYALKSAGQLFLTKKMLLLSLAFFYTGLELSFFSGVFGSA  252
            A +A  + ++ QK     +  Y +     L   K MLL+ L  F  GLE +F  GV+  A
Sbjct  472  AKDA-RNRKMAQKFN--SEIFYLM--LKHLINIKFMLLVPLTIF-NGLEQAFLVGVYTKA  525

Query  253  -IGFTTKIAETPKEIVGLVGICIGAGEVFGGGLFGILGNKTTRYGRDPIVIVGYLMHMAA  311
             +G    I +     +G V  C G  +     +FG L      +GR P+ + G ++++  
Sbjct  526  FVGCGLGIWQ-----IGFVMACFGISDAVCSLVFGPL---IKLFGRMPLFVFGAVVNLLM  577

Query  312  YFMIFINLPNSAPFKDTTDISYLDPPRASIALVCAFLLGLGDACFNTQI----YSMLGGE  367
               + +   N+A     T I Y          V A + G+ D  +NTQI     +++G +
Sbjct  578  IVTLMVWPLNAA----DTQIFY----------VVAAMWGMADGVWNTQINGFWVALVGRQ  623

Query  368  YVNNAVGAFALFKFTQSVAAAISFFYSSHFGLYVQLGILVVMGTIGTIAFVFVE  421
             +     AF  ++F +S+  AI F    H  + + L I   M  +G   F+ +E
Sbjct  624  SLQ---FAFTKYRFWESLGIAIGFALIRHVTVEIYLLITFFMLLLGMCGFLAIE  674


>B7YZU1_DROME unnamed protein product
Length=536

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 99/487 (20%), Positives = 185/487 (38%), Gaps = 94/487 (19%)

Query  8    ILILGFGFMFVFTAFQTMCNIEKTILDSISQEDDSFKGEGYTSLAIIYLFFSLSNWLAP-  66
            ++++G  FM  FTAF    N++ ++        ++ K  G T+LA+IY    LSN   P 
Sbjct  81   VVVIGLAFMIHFTAFHGTSNLQSSV--------NADKALGTTTLAVIYGSLILSNIFLPM  132

Query  67   SFISFTGPRVAMVVGALTYTVFMITFMFPSTVLLYVGSAVLGLGASITWTGQGTYLARCS  126
            + I + G R+ M +    Y  ++    +P    L   + ++G G    W  + TYL+  S
Sbjct  133  TVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVS  192

Query  127  ETTTISRNS------------GVFWALLECSMFIGNLFV-----------------YYQF  157
            E  T  R +            G+F+   + +   GNL                    ++ 
Sbjct  193  EALTQVRGNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDSFEL  252

Query  158  QDKTHIDKE------------------TRNLVIGVLTVIAVLGIVFL----AALRFMADN  195
            + +  +++                     NLV      I +L  +FL    AA+  M   
Sbjct  253  EVQRELERNRVAELCGARFCPGVGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVMMIFG  312

Query  196  AEHDNELEQKHTGCGQAMYALK----SAGQLFLTKKMLLLSLAFFYTGLELSFFSGVFGS  251
                     K    G  M  LK    +   L   +++L+L +  F  GLE +F       
Sbjct  313  VSSLKRYGVKRGDTGDGMSGLKLLTVTINLLRKRRQILMLPITMF-IGLEEAFL------  365

Query  252  AIGFTTKIAETPKEI--VGLVGICIGAGEVFGGGLFGILGNKTTRYGRDPIVIVGYLMHM  309
            A+ FT         I  +G   IC G       G+ G L     R GR  +  +  ++++
Sbjct  366  AVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIAGAL---VERIGRVTLAALCAVVNL  422

Query  310  AAYFMIFINLPNSAPFKDTTDISYLDPPRASIALVCAF--LLGLGDACFNTQIYSMLGGE  367
                 ++     +   ++   +SY           C F  + G+ D  +   + +  G  
Sbjct  423  CLLTYMY-----TWEAREGDYMSY-----------CTFAAVWGICDGVWLVVVNAFYGIL  466

Query  368  YVNNAVGAFALFKFTQSVAAAISFFYSSHFGLYVQLGILVVMGTIGTIAFVFVEWGFKRH  427
            + N+ + A++ F+  +S  + I +  SS      +L IL++   +G + +  +E+ F + 
Sbjct  467  FPNHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQK  526

Query  428  HREQEAL  434
             +  E +
Sbjct  527  QKNLEVM  533


>Q7K3V9_DROME unnamed protein product
Length=522

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 99/487 (20%), Positives = 185/487 (38%), Gaps = 94/487 (19%)

Query  8    ILILGFGFMFVFTAFQTMCNIEKTILDSISQEDDSFKGEGYTSLAIIYLFFSLSNWLAP-  66
            ++++G  FM  FTAF    N++ ++        ++ K  G T+LA+IY    LSN   P 
Sbjct  67   VVVIGLAFMIHFTAFHGTSNLQSSV--------NADKALGTTTLAVIYGSLILSNIFLPM  118

Query  67   SFISFTGPRVAMVVGALTYTVFMITFMFPSTVLLYVGSAVLGLGASITWTGQGTYLARCS  126
            + I + G R+ M +    Y  ++    +P    L   + ++G G    W  + TYL+  S
Sbjct  119  TVIRWFGCRLTMALALFAYMPYIAAQFYPRFETLIPAALMVGFGGGPLWCSKCTYLSTVS  178

Query  127  ETTTISRNS------------GVFWALLECSMFIGNLFV-----------------YYQF  157
            E  T  R +            G+F+   + +   GNL                    ++ 
Sbjct  179  EALTQVRGNKSRKDVNTVKFFGLFFIFYQMAQVWGNLISSSVLTLSAPAAQSAANDSFEL  238

Query  158  QDKTHIDKE------------------TRNLVIGVLTVIAVLGIVFL----AALRFMADN  195
            + +  +++                     NLV      I +L  +FL    AA+  M   
Sbjct  239  EVQRELERNRVAELCGARFCPGVGAEANPNLVPPAPEQIQLLNSIFLTCMAAAVVMMIFG  298

Query  196  AEHDNELEQKHTGCGQAMYALK----SAGQLFLTKKMLLLSLAFFYTGLELSFFSGVFGS  251
                     K    G  M  LK    +   L   +++L+L +  F  GLE +F       
Sbjct  299  VSSLKRYGVKRGDTGDGMSGLKLLTVTINLLRKRRQILMLPITMF-IGLEEAFL------  351

Query  252  AIGFTTKIAETPKEI--VGLVGICIGAGEVFGGGLFGILGNKTTRYGRDPIVIVGYLMHM  309
            A+ FT         I  +G   IC G       G+ G L     R GR  +  +  ++++
Sbjct  352  AVDFTRSFVACGWGISRIGFAMICFGVANAVAAGIAGAL---VERIGRVTLAALCAVVNL  408

Query  310  AAYFMIFINLPNSAPFKDTTDISYLDPPRASIALVCAF--LLGLGDACFNTQIYSMLGGE  367
                 ++     +   ++   +SY           C F  + G+ D  +   + +  G  
Sbjct  409  CLLTYMY-----TWEAREGDYMSY-----------CTFAAVWGICDGVWLVVVNAFYGIL  452

Query  368  YVNNAVGAFALFKFTQSVAAAISFFYSSHFGLYVQLGILVVMGTIGTIAFVFVEWGFKRH  427
            + N+ + A++ F+  +S  + I +  SS      +L IL++   +G + +  +E+ F + 
Sbjct  453  FPNHLIAAYSNFRLWESTGSVIGYVISSQLCTSTKLVILIIFILVGCVGYGLIEYRFWQK  512

Query  428  HREQEAL  434
             +  E +
Sbjct  513  QKNLEVM  519



Lambda      K        H
   0.314    0.129    0.372 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 20763458190


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110457.1 uncharacterized protein LOC108134603 [Drosophila
elegans]

Length=148
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VGJ2_DROME  unnamed protein product                                 76.3    5e-18
O96723_DROME  unnamed protein product                                 76.3    6e-18
CLH3_CAEEL  unnamed protein product                                   28.5    2.5  


>Q9VGJ2_DROME unnamed protein product
Length=184

 Score = 76.3 bits (186),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 77/144 (53%), Gaps = 10/144 (7%)

Query  14   ERDTHQTNARTYGFMKTTRSDTPIPLAKKSIVPITLMERLSGLTAIRSQTSENEEGLSEE  73
            E D   T  R YG   +  S TP P  +K +    L  +L   + +RS+ S+    +SE 
Sbjct  38   EYDDRTTTNRDYGLKSSKGSGTPFPQKQKKLDTAALTAKLETDSLLRSELSDLSIVISER  97

Query  74   QSSSSSYSKASNKTT---FEMKRKLFDEAEFTITRGQKLSDVFH-----PGHVEGQMSFT  125
            ++SS     ASN TT   FEM+RKLFDEAEFTI +G KL+  FH       H   + S  
Sbjct  98   KASSEP-QVASNTTTEPTFEMRRKLFDEAEFTICKGHKLNQDFHHIVEDEKHFNKRQSAK  156

Query  126  DPGKHS-LEEMEAYCERMNIKFAK  148
            D   +S   +++ +C++ NIKF+K
Sbjct  157  DNIPYSNFMDLKNFCDQNNIKFSK  180


>O96723_DROME unnamed protein product
Length=184

 Score = 76.3 bits (186),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 77/144 (53%), Gaps = 10/144 (7%)

Query  14   ERDTHQTNARTYGFMKTTRSDTPIPLAKKSIVPITLMERLSGLTAIRSQTSENEEGLSEE  73
            E D   T  R YG   +  S TP P  +K +    L  +L   + +RS+ S+    +SE 
Sbjct  38   EYDDRTTTNRDYGLKSSKGSGTPFPQKQKKLDTAALTAKLETDSLLRSELSDLSIVISER  97

Query  74   QSSSSSYSKASNKTT---FEMKRKLFDEAEFTITRGQKLSDVFH-----PGHVEGQMSFT  125
            ++SS     ASN TT   FEM+RKLFDEAEFTI +G KL+  FH       H   + S  
Sbjct  98   KASSEP-QVASNTTTEPTFEMRRKLFDEAEFTICKGHKLNQDFHHIVEDEKHFNKRQSAK  156

Query  126  DPGKHS-LEEMEAYCERMNIKFAK  148
            D   +S   +++ +C++ NIKF+K
Sbjct  157  DNIPYSNFMDLKNFCDQNNIKFSK  180


>CLH3_CAEEL unnamed protein product
Length=1001

 Score = 28.5 bits (62),  Expect = 2.5, Method: Composition-based stats.
 Identities = 20/67 (30%), Positives = 28/67 (42%), Gaps = 10/67 (15%)

Query  62   QTSENEE--GLSEEQSSSSSYSKASNKTTFEMKRKLFDEAEFTITRGQKLSDVFHPGHVE  119
            Q ++NE   GLSEE         A    T E K+ LFD A     + +      +P H+E
Sbjct  680  QVAKNETLTGLSEEN--------ARKILTVEEKQALFDAASLATPKREMSGKTINPVHIE  731

Query  120  GQMSFTD  126
               +  D
Sbjct  732  SHHTIGD  738



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110458.1 chondroitin sulfate N-acetylgalactosaminyltransferase
1 [Drosophila elegans]

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z863_DROME  unnamed protein product                                 961     0.0  
CHSSA_CAEEL  unnamed protein product                                  130     1e-31
CHSSB_CAEEL  unnamed protein product                                  41.2    0.002


>A1Z863_DROME unnamed protein product
Length=540

 Score = 961 bits (2485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/542 (90%), Positives = 506/542 (93%), Gaps = 2/542 (0%)

Query  1    MHNSLVSKLLLRLLLLFALVTAASIVILTKCGFDELTTRETQPSNPSESSGFSYALSERE  60
            MHNSLV+KLLLRLLLLFAL+T ASIV+LTKCGFDELTTRETQ +NPSESSGFSY LSERE
Sbjct  1    MHNSLVTKLLLRLLLLFALLTGASIVVLTKCGFDELTTRETQANNPSESSGFSYTLSERE  60

Query  61   AAIERLKQEVLTLRAQILFLQNNRSTGKLSNGSSLQLQETTVGPSTAPLAHHYDCSSYIR  120
            A IERLKQEVL LR QILFLQNNRST K SNGS LQLQETT GP TAPL HHYDCSSYIR
Sbjct  61   AEIERLKQEVLALRTQILFLQNNRSTAKPSNGS-LQLQETTAGPPTAPLGHHYDCSSYIR  119

Query  121  KQVGAAEILHGLPLNNEYELIPFNHFTFTRVYPIDLGLGKRVVEKPIGYRRRDLIDAVNK  180
            KQVGAAEILHGLPLNNEYELIP+NHFTFTRVYPIDLGLGKRVVEKPIGYRRRDLI+AVNK
Sbjct  120  KQVGAAEILHGLPLNNEYELIPYNHFTFTRVYPIDLGLGKRVVEKPIGYRRRDLIEAVNK  179

Query  181  ALESLNRNHSARIRAKAAGSPVGPPSEVIKYTLDDFIEGIYRNEPTTGTQYELYFQSVKN  240
            ALESLNRNHSARIRAK AGS     S+VIKYTLDDFIEGIYRNEPTTGTQYELYFQSVK+
Sbjct  180  ALESLNRNHSARIRAKGAGSAAAYASDVIKYTLDDFIEGIYRNEPTTGTQYELYFQSVKH  239

Query  241  QASPVRRALVMRPFAPLQTVQLSELSPNVDIGGRATPSRSPPVIHVILPLAGRLHSFRSF  300
            QASPVRRALVMRPFAPLQTVQLSELS +VD  G A PS SPP+IHVILPLAGRLHSFR F
Sbjct  240  QASPVRRALVMRPFAPLQTVQLSELSSSVDNSG-APPSHSPPIIHVILPLAGRLHSFRGF  298

Query  301  MQMFDKFEDPRLELIVVYFGTSGLAQAKRLAGRTKRTQFLALNETFSRAKALRLGAEHIQ  360
            +QMF K ED RLELIVVYFGTSGL QA+ LAGR++RTQFLALNETFSRAKALRLGAEHIQ
Sbjct  299  LQMFAKLEDRRLELIVVYFGTSGLEQARSLAGRSQRTQFLALNETFSRAKALRLGAEHIQ  358

Query  361  PAAEDALLFMCDVDIMFTARFLERCRWNAAPGKKVYYPVVFSLYNPHVVYMLQGKPLPGD  420
            PA ED LLFMCDVDIMFT +FLERCRWNAAPGKKVYYPVVFSLYNPHVVY LQGKPLP +
Sbjct  359  PAEEDVLLFMCDVDIMFTTKFLERCRWNAAPGKKVYYPVVFSLYNPHVVYSLQGKPLPSE  418

Query  421  EEQLVISRDTGFWRDFGYGMTCQYRSDFLQVRGFDEEEIVGWGGEDVMLYRKYVRSKIKI  480
            EEQLVISRDTGFWRDFGYGMTCQYRS+FL+VRGFDEEEIVGWGGEDVMLYRKYVRSKIKI
Sbjct  419  EEQLVISRDTGFWRDFGYGMTCQYRSNFLKVRGFDEEEIVGWGGEDVMLYRKYVRSKIKI  478

Query  481  IRATDPGIFHRWHTKICSNSLTADQYRACIRSRALNEASHAQLGFLAFRDDIAAANAAKM  540
            IRATDPGIFHRWHTKICS+SLTADQYRACIRSRALNEASHAQLGFLAFRDDIAAANAAKM
Sbjct  479  IRATDPGIFHRWHTKICSSSLTADQYRACIRSRALNEASHAQLGFLAFRDDIAAANAAKM  538

Query  541  VS  542
             S
Sbjct  539  TS  540


>CHSSA_CAEEL unnamed protein product
Length=736

 Score = 130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/370 (29%), Positives = 172/370 (46%), Gaps = 49/370 (13%)

Query  171  RRDLIDAVNKALESLNRNHSARIRAKAAGSPVGPPSEVIKYTLDDFIEGIYRNEPTTGTQ  230
            R ++ D + +  +  N N   R R     S        ++Y       G  R EPT G  
Sbjct  383  RTEMADTITQLFDEFNTNARQRGRVLQFQS--------LQY-------GYMRVEPTKGVD  427

Query  231  YEL----YFQSVK----NQASPVRRALVMRPFAPLQTVQLSELSPNVDIGGRATPSR-SP  281
            Y L    +F+  +       S  R A V + F  L+++       N+    RA  +    
Sbjct  428  YVLDMLLWFKKFRPPNRTTISVRRHAYVQQTFGKLRSLSEGVFRSNM----RANSTLIED  483

Query  282  PVIHVILPLAGRLHSFRSFMQMFDKF-----EDPRLELIVVYFGTSGLAQAKRLAGRTKR  336
            P +H+I+PL GR   F  F Q          +D  + L +V + +    +  R      R
Sbjct  484  PTLHMIMPLRGRAAIFARFAQHLKSICARGGDDLAVSLTIVLYSSEDEME-NRETIEMLR  542

Query  337  TQFLAL------NETFSRAKALRLGAEHIQPAAEDALLFMCDVDIMFTARFLERCRWNAA  390
              F+ +      + +FSR  AL  GAE + PA  +ALLF  DVD++FT   L+R + N  
Sbjct  543  ASFIPVTVIEMGDVSFSRGVALMRGAETL-PA--NALLFFTDVDMLFTCDALKRIKSNTI  599

Query  391  PGKKVYYPVVFSLYNPHVVYMLQGKPLPGDEEQLVISRDTGFWRDFGYGMTCQYRSDFLQ  450
               ++Y+P+VFS ++ H  +    K L    +     R  G++R FGYG+   Y++D + 
Sbjct  600  LNAQIYFPIVFSEFS-HESWSENDKLLA---DAFHYGRGRGYFRHFGYGLAAMYKADLMD  655

Query  451  VRGFDEEEIVGWGGEDVMLYRKYVRS-KIKIIRATDPGIFHRWHTKICSNSLTADQYRAC  509
            V GFD  +I GWG EDV L+ K +++ ++++IR  +PG+ H +H   C  ++   Q   C
Sbjct  656  VGGFD-TKIEGWGKEDVDLFEKAIKNGRLRVIRVPEPGLVHIYHPIHCDENMPTAQKDMC  714

Query  510  IRSRALNEAS  519
              S+A + AS
Sbjct  715  HGSKAASLAS  724


>CHSSB_CAEEL unnamed protein product
Length=804

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 38/179 (21%), Positives = 70/179 (39%), Gaps = 39/179 (22%)

Query  381  FLERCRWNAAPGKKVYYPVVFSLYNPHV----------------------VYMLQGKPLP  418
            F +R R N     +V++PV F  Y+P +                      +  L+    P
Sbjct  635  FFDRARINTIKHYQVFFPVPFVEYHPTISGMEMTEKEEKETPTEQAREAALSRLRDGVEP  694

Query  419  GDEEQLVISRDTGFWRDFGYGMTCQYRSDFLQVRG-FDEEE-----IVGWGGEDVMLYRK  472
              +  L++ ++ G +    +     Y  D++  R  F + E     I  + G+D      
Sbjct  695  KRKRTLIVQKEHGRFDSQDFSCFAVYGVDYVTARAKFGQNERRNDLISAFLGQD------  748

Query  473  YVRSKIKIIRATDPGIFHRWHTKICS-NSLTADQYRACIRSRALNEASHAQLGFLAFRD  530
                 I ++RA +P +  R+H + C   S+  +    C+ S+  N A+  QL  L F +
Sbjct  749  ----SIHVLRAVEPTLRIRYHKRSCDMESIDTEDIARCLDSKKENVAAKDQLAKLLFHE  803



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110459.1 uncharacterized protein LOC108134605 [Drosophila
elegans]

Length=255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q4GZ66_TRYB2  unnamed protein product                                 28.5    6.5  
Q57Y19_TRYB2  unnamed protein product                                 28.1    8.1  
Q57WL2_TRYB2  unnamed protein product                                 28.1    8.1  


>Q4GZ66_TRYB2 unnamed protein product
Length=1742

 Score = 28.5 bits (62),  Expect = 6.5, Method: Composition-based stats.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 1/53 (2%)

Query  4     ENPDPHRKSLVGPT-YRVTIIMLFIGQLQVSVAMEIKALKEFLAERYYLSLVL  55
             E P P   SL+  T Y    +++ + + +  VA    A +EF AERY +  VL
Sbjct  1339  ELPKPATTSLLHSTLYEAERMVIRVREYEERVAQMRSAFREFQAERYEMGKVL  1391


>Q57Y19_TRYB2 unnamed protein product
Length=934

 Score = 28.1 bits (61),  Expect = 8.1, Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 5/51 (10%)

Query  20   VTIIMLFIGQLQVSVAME----IKALKEFLAERYYLSLVLFLVSFLSIQLY  66
            V +++L I Q++  V +E    +  L EF AER YL + L +VS   + ++
Sbjct  691  VAVVLLKI-QMKDDVPLEALDPLTRLMEFFAERMYLLMKLHIVSLTHVDVF  740


>Q57WL2_TRYB2 unnamed protein product
Length=934

 Score = 28.1 bits (61),  Expect = 8.1, Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 29/51 (57%), Gaps = 5/51 (10%)

Query  20   VTIIMLFIGQLQVSVAME----IKALKEFLAERYYLSLVLFLVSFLSIQLY  66
            V +++L I Q++  V +E    +  L EF AER YL + L +VS   + ++
Sbjct  691  VAVVLLKI-QMKDDVPLEALDPLTRLMEFFAERMYLLMKLHIVSLTHVDVF  740



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110463.1 synaptobrevin isoform X1 [Drosophila elegans]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PE71_DROME  unnamed protein product                                 133     8e-40
M9PDW0_DROME  unnamed protein product                                 130     1e-39
Q86BQ0_DROME  unnamed protein product                                 130     2e-39


>M9PE71_DROME unnamed protein product
Length=206

 Score = 133 bits (334),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 83/116 (72%), Gaps = 3/116 (3%)

Query  31   FGDHHSSNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQ  90
             G  H+    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQ
Sbjct  27   VGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQ  86

Query  91   FEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPTSSDSGSGGGTKAITQ  146
            FEQQAGKLKRK W  N+KMMII+GVI    L++V +   P  SD  +     A+ Q
Sbjct  87   FEQQAGKLKRKFWLQNLKMMIIMGVIG---LVVVGIIAKPYMSDDNAAPQPPALQQ  139


>M9PDW0_DROME unnamed protein product
Length=125

 Score = 130 bits (327),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)

Query  32   GDHHSSNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  91
            G  H+    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  28   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  87

Query  92   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  124
            EQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  88   EQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  120


>Q86BQ0_DROME unnamed protein product
Length=135

 Score = 130 bits (326),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)

Query  31   FGDHHSSNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQ  90
             G  H+    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQ
Sbjct  36   VGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQ  95

Query  91   FEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  124
            FEQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  96   FEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  129



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110464.1 synaptobrevin isoform X1 [Drosophila elegans]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PE71_DROME  unnamed protein product                                 133     8e-40
M9PDW0_DROME  unnamed protein product                                 130     1e-39
Q86BQ0_DROME  unnamed protein product                                 130     2e-39


>M9PE71_DROME unnamed protein product
Length=206

 Score = 133 bits (334),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 83/116 (72%), Gaps = 3/116 (3%)

Query  31   FGDHHSSNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQ  90
             G  H+    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQ
Sbjct  27   VGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQ  86

Query  91   FEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPTSSDSGSGGGTKAITQ  146
            FEQQAGKLKRK W  N+KMMII+GVI    L++V +   P  SD  +     A+ Q
Sbjct  87   FEQQAGKLKRKFWLQNLKMMIIMGVIG---LVVVGIIAKPYMSDDNAAPQPPALQQ  139


>M9PDW0_DROME unnamed protein product
Length=125

 Score = 130 bits (327),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)

Query  32   GDHHSSNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  91
            G  H+    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  28   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  87

Query  92   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  124
            EQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  88   EQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  120


>Q86BQ0_DROME unnamed protein product
Length=135

 Score = 130 bits (326),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 77/94 (82%), Gaps = 0/94 (0%)

Query  31   FGDHHSSNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQ  90
             G  H+    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQ
Sbjct  36   VGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQ  95

Query  91   FEQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  124
            FEQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  96   FEQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  129



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110465.1 synaptobrevin isoform X2 [Drosophila elegans]

Length=129
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PE71_DROME  unnamed protein product                                 135     6e-41
M9PDW0_DROME  unnamed protein product                                 130     7e-40
Q86BQ0_DROME  unnamed protein product                                 129     1e-39


>M9PE71_DROME unnamed protein product
Length=206

 Score = 135 bits (339),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 83/115 (72%), Gaps = 3/115 (3%)

Query  11   GSNNNDNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  70
            G  +N    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  28   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  87

Query  71   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPTSSDSGSGGGTKAITQ  125
            EQQAGKLKRK W  N+KMMII+GVI    L++V +   P  SD  +     A+ Q
Sbjct  88   EQQAGKLKRKFWLQNLKMMIIMGVIG---LVVVGIIAKPYMSDDNAAPQPPALQQ  139


>M9PDW0_DROME unnamed protein product
Length=125

 Score = 130 bits (326),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)

Query  11   GSNNNDNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  70
            G  +N    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  28   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  87

Query  71   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  103
            EQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  88   EQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  120


>Q86BQ0_DROME unnamed protein product
Length=135

 Score = 129 bits (325),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)

Query  11   GSNNNDNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  70
            G  +N    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  37   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  96

Query  71   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  103
            EQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  97   EQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  129



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110466.1 synaptobrevin isoform X2 [Drosophila elegans]

Length=129
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PE71_DROME  unnamed protein product                                 135     6e-41
M9PDW0_DROME  unnamed protein product                                 130     7e-40
Q86BQ0_DROME  unnamed protein product                                 129     1e-39


>M9PE71_DROME unnamed protein product
Length=206

 Score = 135 bits (339),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 83/115 (72%), Gaps = 3/115 (3%)

Query  11   GSNNNDNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  70
            G  +N    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  28   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  87

Query  71   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIVLVSVWPTSSDSGSGGGTKAITQ  125
            EQQAGKLKRK W  N+KMMII+GVI    L++V +   P  SD  +     A+ Q
Sbjct  88   EQQAGKLKRKFWLQNLKMMIIMGVIG---LVVVGIIAKPYMSDDNAAPQPPALQQ  139


>M9PDW0_DROME unnamed protein product
Length=125

 Score = 130 bits (326),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)

Query  11   GSNNNDNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  70
            G  +N    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  28   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  87

Query  71   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  103
            EQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  88   EQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  120


>Q86BQ0_DROME unnamed protein product
Length=135

 Score = 129 bits (325),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 77/93 (83%), Gaps = 0/93 (0%)

Query  11   GSNNNDNNNAAQKRLQQTQAKVDEVVGIMRVNVEKVLERDQKLSELGERADQLEQGASQF  70
            G  +N    AAQKRLQQTQA+VDEVV IMR NVEKVLERD KLSEL +RAD L+QGASQF
Sbjct  37   GGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQF  96

Query  71   EQQAGKLKRKQWWANMKMMIILGVIAVVLLIIV  103
            EQQAGKLKRK W  N+KMMII+GVI +V++ I+
Sbjct  97   EQQAGKLKRKFWLQNLKMMIIMGVIGLVVVGII  129



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110468.1 protein timeless homolog [Drosophila elegans]

Length=1395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NAX2_DROME  unnamed protein product                                 2314    0.0  
Q8INH7_DROME  unnamed protein product                                 2312    0.0  
Q9NG27_DROME  unnamed protein product                                 2308    0.0  


>Q9NAX2_DROME unnamed protein product
Length=1384

 Score = 2314 bits (5997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1227/1391 (88%), Positives = 1300/1391 (93%), Gaps = 19/1391 (1%)

Query  1     MSVLLADLDATCAALGYSDGQKYQAEPDAAESLKHLIWILRRDLDNHEYRRHLGRAKVLQ  60
             MS+LLAD+DATCAALGYSDGQKYQAEPDAAE LKHLIWILRRDLDNHEYRRHLGR+KVLQ
Sbjct  1     MSILLADIDATCAALGYSDGQKYQAEPDAAEGLKHLIWILRRDLDNHEYRRHLGRSKVLQ  60

Query  61    TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYRDGAPKDNHGRKVFMELIDILQGYK  120
             TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYR+GAPKDNHGRKVFMELIDILQGYK
Sbjct  61    TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYREGAPKDNHGRKVFMELIDILQGYK  120

Query  121   AAFARDKIWSSLFEKLKQALEIDFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN  180
             AAFA+DK+WS+LFEKLKQALEI FAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN
Sbjct  121   AAFAKDKVWSALFEKLKQALEIAFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN  180

Query  181   DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLYREQSAESLADASLQR  240
             DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLL+REQSAESLADASLQR
Sbjct  181   DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLFREQSAESLADASLQR  240

Query  241   SLSEKQRDQQELLAARRRERARRQARPPTGRHSRFGGTYVIRNMKSVSDRDVICHQALER  300
             SLSEKQRDQQELLAARRRERARRQARPP GRHSRFGGTYVIRNMKSVSDRDVICHQALER
Sbjct  241   SLSEKQRDQQELLAARRRERARRQARPPPGRHSRFGGTYVIRNMKSVSDRDVICHQALER  300

Query  301   VSAIDFDREKEQQKRSHRHIKEEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV  360
             VS+IDFDREK+QQKRSHRHI+EEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV
Sbjct  301   VSSIDFDREKQQQKRSHRHIQEEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV  360

Query  361   LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV  420
             LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV
Sbjct  361   LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV  420

Query  421   SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNAQALFDMLLNNVCYVLEYRETV  480
             SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNA+ALFDMLLNNVCYVLEYRETV
Sbjct  421   SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNARALFDMLLNNVCYVLEYRETV  480

Query  481   LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDKRRGGGGGRKKKQPAAK  540
             LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDK+RGGG  RKKKQ A K
Sbjct  481   LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDKKRGGGASRKKKQAATK  540

Query  541   SKPSTAPQPTEEELSSKWAELATEVCSLLSAELEIPEDEQPMPFDAASEKSIDDQREDCM  600
             SKP  APQPTEEELSSKWAELATEVCSLLS ELE+PEDEQP+PFDAASEKSIDDQREDCM
Sbjct  541   SKPPAAPQPTEEELSSKWAELATEVCSLLSTELEMPEDEQPLPFDAASEKSIDDQREDCM  600

Query  601   IRINKLLRSEKLDQAVALLRAAREVWPENEVFGAISAAPEDELLLLREIFMYNITTAEPV  660
             IRINKLLRSEKLDQA+ALLRAAREVWPENEVFGAISAAPEDELLLLREIFM NITT E  
Sbjct  601   IRINKLLRSEKLDQAIALLRAAREVWPENEVFGAISAAPEDELLLLREIFMSNITTVESE  660

Query  661   EKENRSGDEQ----DEDDDLDNEEFEEQDNGLTEKTFKFDDIARRLLNPKIVRACTLVLS  716
             +KEN    +Q    DEDDDLDNEE+EEQDNGLTEKTFKFDD ARRLLNPKIVRACTLVLS
Sbjct  661   DKENEKDQKQDEYEDEDDDLDNEEYEEQDNGLTEKTFKFDDFARRLLNPKIVRACTLVLS  720

Query  717   DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF  776
             DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF
Sbjct  721   DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF  780

Query  777   VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWSEEQESELRFLFE  836
             VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAW+EEQESELRFLFE
Sbjct  781   VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWTEEQESELRFLFE  840

Query  837   ENQRNPETDKDVIDWILDNLADKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQGGKNLWQ  896
             ENQRNPETDKDVIDWILDNL DKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQ GKN+WQ
Sbjct  841   ENQRNPETDKDVIDWILDNLVDKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQSGKNVWQ  900

Query  897   PEEDEELRSLYDQHRIEPDCLQRIVQEFADRRSKQQIIKRMLQIHLIADKSEILPAKTGK  956
             PEED+ELRSLYDQHRIEPDCL+R+V EFA+RRSKQQIIKRMLQIHLIADKSEILPAK  K
Sbjct  901   PEEDDELRSLYDQHRIEPDCLERLVNEFAERRSKQQIIKRMLQIHLIADKSEILPAK--K  958

Query  957   GRGKAKGKQAEIGGDGDGDEYDFAEEPMIEDDGYRKPNTKSKPKKAKKRQVVRTPLDVGT  1016
             GRGK K K+ ++  +G+GDE+DFAEEPM ED GY+K   KSKPKK +KRQ+VRTPLDVGT
Sbjct  959   GRGKDKPKK-DVEMEGEGDEFDFAEEPMFEDQGYKK--PKSKPKKVQKRQMVRTPLDVGT  1015

Query  1017  VRALIGQVNAGKYQSAIEWLQECIQDASEETEEPAEDDDGVPLLPLMQDQKDAMEDGDFQ  1076
             +RALIGQV++ KYQSAIEWLQEC+QDASE+TEE  EDDDGVPLLPLM++QK+AMEDGDFQ
Sbjct  1016  IRALIGQVDSEKYQSAIEWLQECLQDASEDTEEAVEDDDGVPLLPLMENQKNAMEDGDFQ  1075

Query  1077  KVLVALGMQPPIAQMETYWRIPTYLNAADLQVRSKILSGEEVDMEPEDQAAEDAEDDEEQ  1136
             KVLVALGMQPPI+ ME YWRIP YLN+ADL +RSKIL+GEEV    + +  ++A DDE+ 
Sbjct  1076  KVLVALGMQPPISGMEAYWRIPIYLNSADLILRSKILAGEEV----DAEPEDEAADDEDG  1131

Query  1137  DEESEEEEEEDFLEKHSRQRQENILAQQQQKLDSLMFNQSDDEAEQRAPPKSKAKPKAGE  1196
             +E  E +EEEDFLEKHSRQR+ENI  QQQ+KLDSLMFNQSDDE EQRAPPK+K KPKA E
Sbjct  1132  EEAEESDEEEDFLEKHSRQRKENIATQQQRKLDSLMFNQSDDETEQRAPPKAKDKPKASE  1191

Query  1197  KKAKRKVKDKAKESKDSGEEGRNTTERQKPNTDDLFDHLRAKRATKIKLNDMVLNESTKA  1256
             KKAKRKVK KAKESKD  ++G +  E +KPNTDDLF+ LRAKRATKIKL+DM LNEST A
Sbjct  1192  KKAKRKVKGKAKESKDCNDDGTDKAELEKPNTDDLFNQLRAKRATKIKLSDMALNESTNA  1251

Query  1257  AQEADDDAFNFNSEDYRARLLELEDEDKDVEKQDEDGAANEDKENNTNKSVQRARRVNVI  1316
             AQEADDDAFNFNSEDYRARLLELEDE+++ +  DE+G    DKEN TNKS+QRARRVNVI
Sbjct  1252  AQEADDDAFNFNSEDYRARLLELEDEEQNSKDADENGG---DKENITNKSLQRARRVNVI  1308

Query  1317  DSDSDNDDDGALPAANKTNKRPRSNDDRENEDDDVEDEDKDSDEEANFLARKKPAKSVDG  1376
             DSDSDNDDDGALP A+KTNKRPRS+DD ++   D   E+ DSDEEANFLARKKPAK VDG
Sbjct  1309  DSDSDNDDDGALP-ADKTNKRPRSDDDGDSGHMDANAEE-DSDEEANFLARKKPAK-VDG  1365

Query  1377  EPAKRRRLAII  1387
             EPAKRRRLAII
Sbjct  1366  EPAKRRRLAII  1376


>Q8INH7_DROME unnamed protein product
Length=1384

 Score = 2312 bits (5991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1226/1391 (88%), Positives = 1299/1391 (93%), Gaps = 19/1391 (1%)

Query  1     MSVLLADLDATCAALGYSDGQKYQAEPDAAESLKHLIWILRRDLDNHEYRRHLGRAKVLQ  60
             MS+LLAD+DATCAALGYSDGQKYQAEPDAAE LKHLIWILRRDLDNHEYRRHLGR+KVLQ
Sbjct  1     MSILLADIDATCAALGYSDGQKYQAEPDAAEGLKHLIWILRRDLDNHEYRRHLGRSKVLQ  60

Query  61    TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYRDGAPKDNHGRKVFMELIDILQGYK  120
             TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYR+GAPKDNHGRKVFMELIDILQGYK
Sbjct  61    TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYREGAPKDNHGRKVFMELIDILQGYK  120

Query  121   AAFARDKIWSSLFEKLKQALEIDFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN  180
             AAFA+DK+WS+LFEKLKQALEI FAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN
Sbjct  121   AAFAKDKVWSALFEKLKQALEIAFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN  180

Query  181   DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLYREQSAESLADASLQR  240
             DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLL+REQSAESLADASLQR
Sbjct  181   DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLFREQSAESLADASLQR  240

Query  241   SLSEKQRDQQELLAARRRERARRQARPPTGRHSRFGGTYVIRNMKSVSDRDVICHQALER  300
             SLSEKQRDQQELLAARRRERARRQARPP GRHSRFGGTYVIRNMKSVSDRDVICHQALER
Sbjct  241   SLSEKQRDQQELLAARRRERARRQARPPPGRHSRFGGTYVIRNMKSVSDRDVICHQALER  300

Query  301   VSAIDFDREKEQQKRSHRHIKEEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV  360
             VS+IDFDREK+QQKRSHRHI+EEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV
Sbjct  301   VSSIDFDREKQQQKRSHRHIQEEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV  360

Query  361   LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV  420
             LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV
Sbjct  361   LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV  420

Query  421   SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNAQALFDMLLNNVCYVLEYRETV  480
             SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNA+ALFDMLLNNVCYVLEYRETV
Sbjct  421   SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNARALFDMLLNNVCYVLEYRETV  480

Query  481   LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDKRRGGGGGRKKKQPAAK  540
             LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDK+RG G  RKKKQ A K
Sbjct  481   LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDKKRGRGASRKKKQAATK  540

Query  541   SKPSTAPQPTEEELSSKWAELATEVCSLLSAELEIPEDEQPMPFDAASEKSIDDQREDCM  600
             SKP  APQPTEEELSSKWAELATEVCSLLS ELE+PEDEQP+PFDAASEKSIDDQREDCM
Sbjct  541   SKPPAAPQPTEEELSSKWAELATEVCSLLSTELEMPEDEQPLPFDAASEKSIDDQREDCM  600

Query  601   IRINKLLRSEKLDQAVALLRAAREVWPENEVFGAISAAPEDELLLLREIFMYNITTAEPV  660
             IRINKLLRSEKLDQA+ALLRAAREVWPENEVFGAISAAPEDELLLLREIFM NITT E  
Sbjct  601   IRINKLLRSEKLDQAIALLRAAREVWPENEVFGAISAAPEDELLLLREIFMSNITTVESE  660

Query  661   EKENRSGDEQ----DEDDDLDNEEFEEQDNGLTEKTFKFDDIARRLLNPKIVRACTLVLS  716
             +KEN    +Q    DEDDDLDNEE+EEQDNGLTEKTFKFDD ARRLLNPKIVRACTLVLS
Sbjct  661   DKENEKDQKQDEYEDEDDDLDNEEYEEQDNGLTEKTFKFDDFARRLLNPKIVRACTLVLS  720

Query  717   DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF  776
             DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF
Sbjct  721   DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF  780

Query  777   VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWSEEQESELRFLFE  836
             VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAW+EEQESELRFLFE
Sbjct  781   VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWTEEQESELRFLFE  840

Query  837   ENQRNPETDKDVIDWILDNLADKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQGGKNLWQ  896
             ENQRNPETDKDVIDWILDNL DKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQ GKN+WQ
Sbjct  841   ENQRNPETDKDVIDWILDNLVDKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQSGKNVWQ  900

Query  897   PEEDEELRSLYDQHRIEPDCLQRIVQEFADRRSKQQIIKRMLQIHLIADKSEILPAKTGK  956
             PEED+ELRSLYDQHRIEPDCL+R+V EFA+RRSKQQIIKRMLQIHLIADKSEILPAK  K
Sbjct  901   PEEDDELRSLYDQHRIEPDCLERLVNEFAERRSKQQIIKRMLQIHLIADKSEILPAK--K  958

Query  957   GRGKAKGKQAEIGGDGDGDEYDFAEEPMIEDDGYRKPNTKSKPKKAKKRQVVRTPLDVGT  1016
             GRGK K K+ ++  +G+GDE+DFAEEPM ED GY+K   KSKPKK +KRQ+VRTPLDVGT
Sbjct  959   GRGKDKPKK-DVEMEGEGDEFDFAEEPMFEDQGYKK--PKSKPKKVQKRQMVRTPLDVGT  1015

Query  1017  VRALIGQVNAGKYQSAIEWLQECIQDASEETEEPAEDDDGVPLLPLMQDQKDAMEDGDFQ  1076
             +RALIGQV++ KYQSAIEWLQEC+QDASE+TEE  EDDDGVPLLPLM++QK+AMEDGDFQ
Sbjct  1016  IRALIGQVDSEKYQSAIEWLQECLQDASEDTEEAVEDDDGVPLLPLMENQKNAMEDGDFQ  1075

Query  1077  KVLVALGMQPPIAQMETYWRIPTYLNAADLQVRSKILSGEEVDMEPEDQAAEDAEDDEEQ  1136
             KVLVALGMQPPI+ ME YWRIP YLN+ADL +RSKIL+GEEV    + +  ++A DDE+ 
Sbjct  1076  KVLVALGMQPPISGMEAYWRIPIYLNSADLILRSKILAGEEV----DAEPEDEAADDEDG  1131

Query  1137  DEESEEEEEEDFLEKHSRQRQENILAQQQQKLDSLMFNQSDDEAEQRAPPKSKAKPKAGE  1196
             +E  E +EEEDFLEKHSRQR+ENI  QQQ+KLDSLMFNQSDDE EQRAPPK+K KPKA E
Sbjct  1132  EEAEESDEEEDFLEKHSRQRKENIATQQQRKLDSLMFNQSDDETEQRAPPKAKDKPKASE  1191

Query  1197  KKAKRKVKDKAKESKDSGEEGRNTTERQKPNTDDLFDHLRAKRATKIKLNDMVLNESTKA  1256
             KKAKRKVK KAKESKD  ++G +  E +KPNTDDLF+ LRAKRATKIKL+DM LNEST A
Sbjct  1192  KKAKRKVKGKAKESKDCNDDGTDKAELEKPNTDDLFNQLRAKRATKIKLSDMALNESTNA  1251

Query  1257  AQEADDDAFNFNSEDYRARLLELEDEDKDVEKQDEDGAANEDKENNTNKSVQRARRVNVI  1316
             AQEADDDAFNFNSEDYRARLLELEDE+++ +  DE+G    DKEN TNKS+QRARRVNVI
Sbjct  1252  AQEADDDAFNFNSEDYRARLLELEDEEQNSKDADENGG---DKENITNKSLQRARRVNVI  1308

Query  1317  DSDSDNDDDGALPAANKTNKRPRSNDDRENEDDDVEDEDKDSDEEANFLARKKPAKSVDG  1376
             DSDSDNDDDGALP A+KTNKRPRS+DD ++   D   E+ DSDEEANFLARKKPAK VDG
Sbjct  1309  DSDSDNDDDGALP-ADKTNKRPRSDDDGDSGHMDANAEE-DSDEEANFLARKKPAK-VDG  1365

Query  1377  EPAKRRRLAII  1387
             EPAKRRRLAII
Sbjct  1366  EPAKRRRLAII  1376


>Q9NG27_DROME unnamed protein product
Length=1384

 Score = 2308 bits (5981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1225/1391 (88%), Positives = 1298/1391 (93%), Gaps = 19/1391 (1%)

Query  1     MSVLLADLDATCAALGYSDGQKYQAEPDAAESLKHLIWILRRDLDNHEYRRHLGRAKVLQ  60
             MS+LLAD+DATCAALGYSDGQKYQAEPDAAE LKHLIWILRRDLDNHEYRRHLGR+KVLQ
Sbjct  1     MSILLADIDATCAALGYSDGQKYQAEPDAAEGLKHLIWILRRDLDNHEYRRHLGRSKVLQ  60

Query  61    TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYRDGAPKDNHGRKVFMELIDILQGYK  120
             TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYR+GAPKDNHGRKVFMELIDILQGYK
Sbjct  61    TDLVYMLPDYVHHEELSDLLIRLLVILTNPTLLLYREGAPKDNHGRKVFMELIDILQGYK  120

Query  121   AAFARDKIWSSLFEKLKQALEIDFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN  180
             AAFA+DK+WS+LFEKLKQALEI FAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN
Sbjct  121   AAFAKDKVWSALFEKLKQALEIAFAIRSEEQNLLIERILVLVRNVLQVPANPEAECRADN  180

Query  181   DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLYREQSAESLADASLQR  240
             DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLL+REQSAESLADASLQR
Sbjct  181   DASLHDQVIWALHQTGMLDLVLFVISSPDEEQFHLHGLEIVCLLFREQSAESLADASLQR  240

Query  241   SLSEKQRDQQELLAARRRERARRQARPPTGRHSRFGGTYVIRNMKSVSDRDVICHQALER  300
             SLSEKQRDQQELLAARRRERARRQARPP GRHSRFGGTYVIRNMKSVSDRDVICHQALER
Sbjct  241   SLSEKQRDQQELLAARRRERARRQARPPPGRHSRFGGTYVIRNMKSVSDRDVICHQALER  300

Query  301   VSAIDFDREKEQQKRSHRHIKEEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV  360
             VS+IDFDREK+QQKRSHRHI+EEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV
Sbjct  301   VSSIDFDREKQQQKRSHRHIQEEAQVTRRSAFTVRLCLREYCIEVLRSAYNTLVRQVRRV  360

Query  361   LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV  420
             LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV
Sbjct  361   LERNAGSSSHDDSYLLWAIRFFMEFNRLSGLQLQLVSESLSVQCFHWVLTRMQHDMDMIV  420

Query  421   SDKKQARLWAKRLHVALLTFRELLQSLLALQKLKDDNNAQALFDMLLNNVCYVLEYRETV  480
             SDKKQARLWAKRLHVAL TFRELLQSLLALQKLKDDNNA+ALFDMLLNNVCYVLEYRETV
Sbjct  421   SDKKQARLWAKRLHVALKTFRELLQSLLALQKLKDDNNARALFDMLLNNVCYVLEYRETV  480

Query  481   LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDKRRGGGGGRKKKQPAAK  540
             LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDK+RG G  RKKKQ A K
Sbjct  481   LHLLMNYNEAHSTKVFLRDVVETANVFIKMMERFCQDSVVVQDKKRGRGASRKKKQAATK  540

Query  541   SKPSTAPQPTEEELSSKWAELATEVCSLLSAELEIPEDEQPMPFDAASEKSIDDQREDCM  600
             SKP  APQPTEEELSSKWAELATEVCSLLS ELE+PEDEQP+PFDAASEKSIDDQREDCM
Sbjct  541   SKPPAAPQPTEEELSSKWAELATEVCSLLSTELEMPEDEQPLPFDAASEKSIDDQREDCM  600

Query  601   IRINKLLRSEKLDQAVALLRAAREVWPENEVFGAISAAPEDELLLLREIFMYNITTAEPV  660
             IRINKLLRSEKLDQA+ALLRAAREVWPENEVFGAISAAPEDELLLLREIFM NITT E  
Sbjct  601   IRINKLLRSEKLDQAIALLRAAREVWPENEVFGAISAAPEDELLLLREIFMSNITTVESE  660

Query  661   EKENRSGDEQ----DEDDDLDNEEFEEQDNGLTEKTFKFDDIARRLLNPKIVRACTLVLS  716
             +KEN    +Q    DEDDDLDNEE+EEQDNGLTEKTFKFDD ARRLLNPKIVRACTLVLS
Sbjct  661   DKENEKDQKQDEYEDEDDDLDNEEYEEQDNGLTEKTFKFDDFARRLLNPKIVRACTLVLS  720

Query  717   DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF  776
             DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF
Sbjct  721   DWADIPTRSLKAAVTILHRIAYGCKCAGMLFQAKLFRIFQQVFSVERDVHQEELRRLAIF  780

Query  777   VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWSEEQESELRFLFE  836
             VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAW+EEQESELRFLFE
Sbjct  781   VVRKFVEVAPTNPKIYAELLFYKGIREANELESGYCDAYEAGTKGAWTEEQESELRFLFE  840

Query  837   ENQRNPETDKDVIDWILDNLADKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQGGKNLWQ  896
             ENQRNPETDKDVIDWILDNL DKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQ GKN+WQ
Sbjct  841   ENQRNPETDKDVIDWILDNLVDKTRNRRTVLKKLKELGLLFKAPTKRSTKSAQSGKNVWQ  900

Query  897   PEEDEELRSLYDQHRIEPDCLQRIVQEFADRRSKQQIIKRMLQIHLIADKSEILPAKTGK  956
             PEED+ELRSLYDQHRIEPDCL+R+V EFA+RRSKQQIIKRMLQIHLIADKSEILPAK  K
Sbjct  901   PEEDDELRSLYDQHRIEPDCLERLVNEFAERRSKQQIIKRMLQIHLIADKSEILPAK--K  958

Query  957   GRGKAKGKQAEIGGDGDGDEYDFAEEPMIEDDGYRKPNTKSKPKKAKKRQVVRTPLDVGT  1016
             GRGK K K+ ++  +G+GDE+DFAEEPM ED GY+K   KSKPKK +KRQ+VRTPLDVGT
Sbjct  959   GRGKDKPKK-DVEMEGEGDEFDFAEEPMFEDQGYKK--PKSKPKKVQKRQMVRTPLDVGT  1015

Query  1017  VRALIGQVNAGKYQSAIEWLQECIQDASEETEEPAEDDDGVPLLPLMQDQKDAMEDGDFQ  1076
             +RALIGQV++ KYQSAIEWLQEC+QDASE+TEE  EDDDGVPLLPLM++QK+AMEDGDFQ
Sbjct  1016  IRALIGQVDSEKYQSAIEWLQECLQDASEDTEEAVEDDDGVPLLPLMENQKNAMEDGDFQ  1075

Query  1077  KVLVALGMQPPIAQMETYWRIPTYLNAADLQVRSKILSGEEVDMEPEDQAAEDAEDDEEQ  1136
             KVLVALGMQPPI+ ME YWRIP YLN+ADL +RSKIL+GEEV    + +  ++A DDE+ 
Sbjct  1076  KVLVALGMQPPISGMEAYWRIPIYLNSADLILRSKILAGEEV----DAEPEDEAADDEDG  1131

Query  1137  DEESEEEEEEDFLEKHSRQRQENILAQQQQKLDSLMFNQSDDEAEQRAPPKSKAKPKAGE  1196
             +E  E +EEEDFLEKHSRQR+ENI  QQQ+KLDSLMFNQSDDE EQRAPPK+K KPKA E
Sbjct  1132  EEAEESDEEEDFLEKHSRQRKENIATQQQRKLDSLMFNQSDDETEQRAPPKAKDKPKASE  1191

Query  1197  KKAKRKVKDKAKESKDSGEEGRNTTERQKPNTDDLFDHLRAKRATKIKLNDMVLNESTKA  1256
             KKAKRKVK KAKESKD  ++G +  E +KPNTDDLF+ LRAKRATKIKL+DM LNEST A
Sbjct  1192  KKAKRKVKGKAKESKDCNDDGTDKAELEKPNTDDLFNQLRAKRATKIKLSDMALNESTNA  1251

Query  1257  AQEADDDAFNFNSEDYRARLLELEDEDKDVEKQDEDGAANEDKENNTNKSVQRARRVNVI  1316
             AQEADDDAFNFNSEDYRARLLELEDE+++ +  DE+G    DKEN TNKS+QRARRVNVI
Sbjct  1252  AQEADDDAFNFNSEDYRARLLELEDEEQNSKDADENGG---DKENITNKSLQRARRVNVI  1308

Query  1317  DSDSDNDDDGALPAANKTNKRPRSNDDRENEDDDVEDEDKDSDEEANFLARKKPAKSVDG  1376
             DSDSDNDDDGALP A+KTNKRPRS+DD ++   D   E+ DSDEEANFLARKKPAK VDG
Sbjct  1309  DSDSDNDDDGALP-ADKTNKRPRSDDDGDSGHMDANAEE-DSDEEANFLARKKPAK-VDG  1365

Query  1377  EPAKRRRLAII  1387
             EPAKRRRLAII
Sbjct  1366  EPAKRRRLAII  1376



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110472.1 uncharacterized protein LOC108134609 [Drosophila
elegans]

Length=288
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TH12_TRYBB  unnamed protein product                                   29.6    3.3  
TH2A_TRYBB  unnamed protein product                                   29.6    3.4  
Q26765_9TRYP  unnamed protein product                                 29.3    4.5  


>TH12_TRYBB unnamed protein product
Length=528

 Score = 29.6 bits (65),  Expect = 3.3, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 54/125 (43%), Gaps = 12/125 (10%)

Query  112  IMWFFICVLLVLLFVLLGSIMPHDFTLDVVILFVLAFIFLIVTIFFIMMHILIAMPY---  168
             M  F+C + V   V    +  +      + LF+ AF F + + FF++   L    +   
Sbjct  377  CMCLFLCGIPVFPGVAEEKVK-NGVATTGIALFIAAFEFGVGSCFFVLAQDLFPPSFRPK  435

Query  169  --SFVVFQIFI-SVIVLLFVMYHTQTINGGRFAEMRLNDHLLASLILFHDFIIIFLLTFY  225
              SFVV   FI ++++ L     T+ I+GG        D      ++F  F +I L+ F 
Sbjct  436  GSSFVVMMQFIFNILINLLYPITTEAISGG-----ATGDQDKGQAVVFILFGLIGLICFV  490

Query  226  VQIVY  230
            +Q  Y
Sbjct  491  LQFFY  495


>TH2A_TRYBB unnamed protein product
Length=529

 Score = 29.6 bits (65),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 32/125 (26%), Positives = 54/125 (43%), Gaps = 12/125 (10%)

Query  112  IMWFFICVLLVLLFVLLGSIMPHDFTLDVVILFVLAFIFLIVTIFFIMMHILIAMPY---  168
             M  F+C + V   V    +  +      + LF+ AF F + + FF++   L    +   
Sbjct  378  CMCLFLCGIPVFPGVAEEKVK-NGVATTGIALFIAAFEFGVGSCFFVLAQDLFPPSFRPK  436

Query  169  --SFVVFQIFI-SVIVLLFVMYHTQTINGGRFAEMRLNDHLLASLILFHDFIIIFLLTFY  225
              SFVV   FI ++++ L     T+ I+GG        D      ++F  F +I L+ F 
Sbjct  437  GSSFVVMMQFIFNILINLLYPITTEAISGG-----ATGDQDKGQAVVFILFGLIGLICFV  491

Query  226  VQIVY  230
            +Q  Y
Sbjct  492  LQFFY  496


>Q26765_9TRYP unnamed protein product
Length=527

 Score = 29.3 bits (64),  Expect = 4.5, Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 43/95 (45%), Gaps = 7/95 (7%)

Query  112  IMWFFICVLLVLLFVLLGSIMPHDFTLDVVILFVLAFIFLIVTIFFIMMHILIAMPY---  168
             M  F+C + V   V  G  + +      + LF+ AF F + + FF++   L    +   
Sbjct  377  CMCLFLCGIPVFPGVA-GKEVKNGVATTGIALFIAAFEFGVGSCFFVLAQDLFPPSFRPK  435

Query  169  --SFVVFQIFI-SVIVLLFVMYHTQTINGGRFAEM  200
              SFVV   FI ++++ L     T+ I+GG  A  
Sbjct  436  GGSFVVMMQFIFNILINLLYPITTEAISGGPTANQ  470



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110473.2 eukaryotic translation initiation factor 4B isoform
X3 [Drosophila elegans]

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8J4_DROME  unnamed protein product                                 30.4    3.4  
A1Z8J3_DROME  unnamed protein product                                 30.4    3.5  


>A1Z8J4_DROME unnamed protein product
Length=1557

 Score = 30.4 bits (67),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 45/102 (44%), Gaps = 27/102 (26%)

Query  99   DRDYDRYYDRSRYDDRYTP--------RTYDRYEGRGYDDYRRGSGYSGSY---------  141
            DRD DRY    RY  RY          R YDR+    YD Y  G+G +G           
Sbjct  521  DRDRDRY-PPDRYGSRYPTGGDGIGYNRPYDRFPD-DYDRYPAGAGVNGDRDRERDRDRY  578

Query  142  ----DRERGYGYDNRDRYYGG-DRYSADRYSEGYSRDRLYDR  178
                DR+R  G  +RDRY G  DR   DRY E Y  +R  DR
Sbjct  579  PVVGDRDRYPGAVDRDRYPGVRDR---DRYPEPYPPERYADR  617


>A1Z8J3_DROME unnamed protein product
Length=1549

 Score = 30.4 bits (67),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 45/102 (44%), Gaps = 27/102 (26%)

Query  99   DRDYDRYYDRSRYDDRYTP--------RTYDRYEGRGYDDYRRGSGYSGSY---------  141
            DRD DRY    RY  RY          R YDR+    YD Y  G+G +G           
Sbjct  521  DRDRDRY-PPDRYGSRYPTGGDGIGYNRPYDRFPD-DYDRYPAGAGVNGDRDRERDRDRY  578

Query  142  ----DRERGYGYDNRDRYYGG-DRYSADRYSEGYSRDRLYDR  178
                DR+R  G  +RDRY G  DR   DRY E Y  +R  DR
Sbjct  579  PVVGDRDRYPGAVDRDRYPGVRDR---DRYPEPYPPERYADR  617



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110474.2 TATA-binding protein-associated factor 2N isoform X4
[Drosophila elegans]

Length=358
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1Z8J3_DROME  unnamed protein product                                 30.4    2.6  
A1Z8J4_DROME  unnamed protein product                                 30.4    2.8  


>A1Z8J3_DROME unnamed protein product
Length=1549

 Score = 30.4 bits (67),  Expect = 2.6, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 45/102 (44%), Gaps = 27/102 (26%)

Query  99   DRDYDRYYDRSRYDDRYTP--------RTYDRYEGRGYDDYRRGSGYSGSY---------  141
            DRD DRY    RY  RY          R YDR+    YD Y  G+G +G           
Sbjct  521  DRDRDRY-PPDRYGSRYPTGGDGIGYNRPYDRFPD-DYDRYPAGAGVNGDRDRERDRDRY  578

Query  142  ----DRERGYGYDNRDRYYGG-DRYSADRYSEGYSRDRLYDR  178
                DR+R  G  +RDRY G  DR   DRY E Y  +R  DR
Sbjct  579  PVVGDRDRYPGAVDRDRYPGVRDR---DRYPEPYPPERYADR  617


>A1Z8J4_DROME unnamed protein product
Length=1557

 Score = 30.4 bits (67),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 45/102 (44%), Gaps = 27/102 (26%)

Query  99   DRDYDRYYDRSRYDDRYTP--------RTYDRYEGRGYDDYRRGSGYSGSY---------  141
            DRD DRY    RY  RY          R YDR+    YD Y  G+G +G           
Sbjct  521  DRDRDRY-PPDRYGSRYPTGGDGIGYNRPYDRFPD-DYDRYPAGAGVNGDRDRERDRDRY  578

Query  142  ----DRERGYGYDNRDRYYGG-DRYSADRYSEGYSRDRLYDR  178
                DR+R  G  +RDRY G  DR   DRY E Y  +R  DR
Sbjct  579  PVVGDRDRYPGAVDRDRYPGVRDR---DRYPEPYPPERYADR  617



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110476.1 uncharacterized protein LOC108134612 isoform X1
[Drosophila elegans]

Length=614
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAPR2_DROME  unnamed protein product                                  38.1    0.020
Q57UQ9_TRYB2  unnamed protein product                                 33.5    0.39 
KAPR_DICDI  unnamed protein product                                   33.1    0.64 


>KAPR2_DROME unnamed protein product
Length=377

 Score = 38.1 bits (87),  Expect = 0.020, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (46%), Gaps = 7/87 (8%)

Query  123  IIKKGNMPISVYFILNGEVEMKKTVYNKTTKQEESVPEAIFGPGDCFGDVEMVEDCPRMN  182
            IIK+G+    +YFI  G      TV  +  + +  V  +  G G  FG++ +V   PR  
Sbjct  269  IIKQGDAADGMYFIEEG------TVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAA  322

Query  183  SYQPMSSCEVLSIYDVD-YERILKPFM  208
            S         L+  DV  +ER+L P M
Sbjct  323  SVYATGGVVKLAFLDVKAFERLLGPCM  349


>Q57UQ9_TRYB2 unnamed protein product
Length=297

 Score = 33.5 bits (75),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 35/56 (63%), Gaps = 2/56 (4%)

Query  304  FQFWKDLSMHSSFVDIQDILASSSSSEEVEGATKKKQTMRKMGLNEIQKNCGIRTS  359
             ++WK + +  + +D+Q ++  +S  ++++G T  +QT+ KM  ++ QK  G+ TS
Sbjct  217  MEWWKTVMVGDAEIDLQKVMPENSKLDDLDGDT--RQTVEKMMYDQRQKAMGLPTS  270


>KAPR_DICDI unnamed protein product
Length=327

 Score = 33.1 bits (74),  Expect = 0.64, Method: Compositional matrix adjust.
 Identities = 32/155 (21%), Positives = 66/155 (43%), Gaps = 16/155 (10%)

Query  79   RTIEERKKLCILIAGLNCFSRIPPKIRARMVPVLKFMSISETRLIIKKGNMPISVYFILN  138
            +TI++RK     +  ++    I    R  +   L+ ++  +  +I+++G+     Y I+ 
Sbjct  172  QTIKKRKLYEEFLEKVSILRHIDKYERVSLADALEPVNFQDGEVIVRQGDPGDRFYIIVE  231

Query  139  GEVEMKKTVYNKTTKQEESVPEAI--FGPGDCFGDVEMVEDCPRMNSYQPMSSCEVLSIY  196
            G+V     V  +T   + S    +    P D FG++ ++ D PR  +   +   + + + 
Sbjct  232  GKV----VVTQETVPGDHSTSHVVSELHPSDYFGEIALLTDRPRAATVTSIGYTKCVELD  287

Query  197  DVDYERILKPF--MLKQWDEKKLALKAFDYFDFLN  229
               + R+  P   ML++  E         Y  FLN
Sbjct  288  RQRFNRLCGPIDQMLRRNMET--------YNQFLN  314



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110477.1 uncharacterized protein LOC108134612 isoform X2
[Drosophila elegans]

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAPR2_DROME  unnamed protein product                                  37.7    0.023
Q57UQ9_TRYB2  unnamed protein product                                 33.5    0.39 
KAPR_DICDI  unnamed protein product                                   33.5    0.47 


>KAPR2_DROME unnamed protein product
Length=377

 Score = 37.7 bits (86),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (46%), Gaps = 7/87 (8%)

Query  123  IIKKGNMPISVYFILNGEVEMKKTVYNKTTKQEESVPEAIFGPGDCFGDVEMVEDCPRMN  182
            IIK+G+    +YFI  G      TV  +  + +  V  +  G G  FG++ +V   PR  
Sbjct  269  IIKQGDAADGMYFIEEG------TVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAA  322

Query  183  SYQPMSSCEVLSIYDVD-YERILKPFM  208
            S         L+  DV  +ER+L P M
Sbjct  323  SVYATGGVVKLAFLDVKAFERLLGPCM  349


>Q57UQ9_TRYB2 unnamed protein product
Length=297

 Score = 33.5 bits (75),  Expect = 0.39, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 35/56 (63%), Gaps = 2/56 (4%)

Query  304  FQFWKDLSMHSSFVDIQDILASSSSSEEVEGATKKKQTMRKMGLNEIQKNCGIRTS  359
             ++WK + +  + +D+Q ++  +S  ++++G T  +QT+ KM  ++ QK  G+ TS
Sbjct  217  MEWWKTVMVGDAEIDLQKVMPENSKLDDLDGDT--RQTVEKMMYDQRQKAMGLPTS  270


>KAPR_DICDI unnamed protein product
Length=327

 Score = 33.5 bits (75),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 32/155 (21%), Positives = 66/155 (43%), Gaps = 16/155 (10%)

Query  79   RTIEERKKLCILIAGLNCFSRIPPKIRARMVPVLKFMSISETRLIIKKGNMPISVYFILN  138
            +TI++RK     +  ++    I    R  +   L+ ++  +  +I+++G+     Y I+ 
Sbjct  172  QTIKKRKLYEEFLEKVSILRHIDKYERVSLADALEPVNFQDGEVIVRQGDPGDRFYIIVE  231

Query  139  GEVEMKKTVYNKTTKQEESVPEAI--FGPGDCFGDVEMVEDCPRMNSYQPMSSCEVLSIY  196
            G+V     V  +T   + S    +    P D FG++ ++ D PR  +   +   + + + 
Sbjct  232  GKV----VVTQETVPGDHSTSHVVSELHPSDYFGEIALLTDRPRAATVTSIGYTKCVELD  287

Query  197  DVDYERILKPF--MLKQWDEKKLALKAFDYFDFLN  229
               + R+  P   ML++  E         Y  FLN
Sbjct  288  RQRFNRLCGPIDQMLRRNMET--------YNQFLN  314



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110479.1 uncharacterized protein LOC108134612 isoform X3
[Drosophila elegans]

Length=407
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q57UQ9_TRYB2  unnamed protein product                                 33.5    0.26 
Q4GZ92_TRYB2  unnamed protein product                                 32.3    0.67 
Q57XP2_TRYB2  unnamed protein product                                 31.2    2.0  


>Q57UQ9_TRYB2 unnamed protein product
Length=297

 Score = 33.5 bits (75),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 35/56 (63%), Gaps = 2/56 (4%)

Query  97   FQFWKDLSMHSSFVDIQDILASSSSSEEVEGATKKKQTMRKMGLNEIQKNCGIRTS  152
             ++WK + +  + +D+Q ++  +S  ++++G T  +QT+ KM  ++ QK  G+ TS
Sbjct  217  MEWWKTVMVGDAEIDLQKVMPENSKLDDLDGDT--RQTVEKMMYDQRQKAMGLPTS  270


>Q4GZ92_TRYB2 unnamed protein product
Length=433

 Score = 32.3 bits (72),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 26/131 (20%), Positives = 57/131 (44%), Gaps = 19/131 (15%)

Query  105  MHSSFVDI-QDILASSSSSEEVEGATKKKQTMRKMGLNEIQKNCGIRTSVTPSRKKAKPR  163
            +H S++D+  D++ +++      G  +   TM ++    ++  C     +TP R  A   
Sbjct  64   VHKSYLDVGADVILTNTYQMHAAGCAQAGVTMNEVVNTAVRVLC---DGITPERAAATKE  120

Query  164  RTMNLQAQAQTRKTQLIQSLR----------RGTPWLPGAALGSYGSDDSLDDNED---A  210
              +  Q     ++++ +                 P L G +LGSYG+  SL + ++    
Sbjct  121  AKVWAQHVMNNKRSEFVNVFAPLFYGPRDDASKCPVLVGGSLGSYGA--SLGNAQEYRGE  178

Query  211  FDYGEDLLDEY  221
            ++  ED++ +Y
Sbjct  179  YEVNEDIIRDY  189


>Q57XP2_TRYB2 unnamed protein product
Length=605

 Score = 31.2 bits (69),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (62%), Gaps = 0/34 (0%)

Query  349  FECNVPSRQDLFTNFLKTRQWNKFRHDYIQGLLN  382
            F    PSR+D+  ++ + R+W+K+R   +  +LN
Sbjct  555  FANGYPSREDIEIHYERQRKWSKYRKTLVNDVLN  588



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110480.1 uncharacterized protein LOC108134612 isoform X4
[Drosophila elegans]

Length=623
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KAPR2_DROME  unnamed protein product                                  38.1    0.017
Q57UQ9_TRYB2  unnamed protein product                                 33.5    0.40 
KAPR_DICDI  unnamed protein product                                   33.1    0.63 


>KAPR2_DROME unnamed protein product
Length=377

 Score = 38.1 bits (87),  Expect = 0.017, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 40/87 (46%), Gaps = 7/87 (8%)

Query  123  IIKKGNMPISVYFILNGEVEMKKTVYNKTTKQEESVPEAIFGPGDCFGDVEMVEDCPRMN  182
            IIK+G+    +YFI  G      TV  +  + +  V  +  G G  FG++ +V   PR  
Sbjct  269  IIKQGDAADGMYFIEEG------TVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAA  322

Query  183  SYQPMSSCEVLSIYDVD-YERILKPFM  208
            S         L+  DV  +ER+L P M
Sbjct  323  SVYATGGVVKLAFLDVKAFERLLGPCM  349


>Q57UQ9_TRYB2 unnamed protein product
Length=297

 Score = 33.5 bits (75),  Expect = 0.40, Method: Compositional matrix adjust.
 Identities = 16/56 (29%), Positives = 35/56 (63%), Gaps = 2/56 (4%)

Query  304  FQFWKDLSMHSSFVDIQDILASSSSSEEVEGATKKKQTMRKMGLNEIQKNCGIRTS  359
             ++WK + +  + +D+Q ++  +S  ++++G T  +QT+ KM  ++ QK  G+ TS
Sbjct  217  MEWWKTVMVGDAEIDLQKVMPENSKLDDLDGDT--RQTVEKMMYDQRQKAMGLPTS  270


>KAPR_DICDI unnamed protein product
Length=327

 Score = 33.1 bits (74),  Expect = 0.63, Method: Compositional matrix adjust.
 Identities = 32/155 (21%), Positives = 66/155 (43%), Gaps = 16/155 (10%)

Query  79   RTIEERKKLCILIAGLNCFSRIPPKIRARMVPVLKFMSISETRLIIKKGNMPISVYFILN  138
            +TI++RK     +  ++    I    R  +   L+ ++  +  +I+++G+     Y I+ 
Sbjct  172  QTIKKRKLYEEFLEKVSILRHIDKYERVSLADALEPVNFQDGEVIVRQGDPGDRFYIIVE  231

Query  139  GEVEMKKTVYNKTTKQEESVPEAI--FGPGDCFGDVEMVEDCPRMNSYQPMSSCEVLSIY  196
            G+V     V  +T   + S    +    P D FG++ ++ D PR  +   +   + + + 
Sbjct  232  GKV----VVTQETVPGDHSTSHVVSELHPSDYFGEIALLTDRPRAATVTSIGYTKCVELD  287

Query  197  DVDYERILKPF--MLKQWDEKKLALKAFDYFDFLN  229
               + R+  P   ML++  E         Y  FLN
Sbjct  288  RQRFNRLCGPIDQMLRRNMET--------YNQFLN  314



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110481.1 protein Tob1 isoform X1 [Drosophila elegans]

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 678     0.0  
BTG_DICDI  unnamed protein product                                    79.0    2e-15
G5EDX7_CAEEL  unnamed protein product                                 71.2    1e-13


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/571 (71%), Positives = 448/571 (78%), Gaps = 43/571 (8%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQ HWYPEKPFKGSAYRCLKT
Sbjct  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKGAVKILYTENNENH  120
            GDPIDSVLERAARESGVPIGDILENLPNELSVW+DPGEVSFRIGEKGAVKILYTENNENH
Sbjct  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENH  120

Query  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNLSLSPKNLPLALPQAGSGSSPHSAASS  180
            EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNN+SLSPK          SGSSPHSAASS
Sbjct  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKG------HHQSGSSPHSAASS  174

Query  181  SPTYKGSPNPTI------SGSCSSGSGAGSGSNLGPGPGPGTAPVPVPGNSATANASGGA  234
            SPTYKGSPN TI           SG+G+GS S     PGPGTAP PVPGN ATANA+  A
Sbjct  175  SPTYKGSPNRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAA  234

Query  235  FMQRGAQTPLTFTTATFAQTKFGSTKLKTSSKRTN-SSAYRMSPTEFSNYIKQRAMQQQM  293
            FMQRGAQ PLTFTTATFAQTKFGSTKLKTSSKRTN SSAYRMSPTEFSNYIKQRAMQQQM
Sbjct  235  FMQRGAQAPLTFTTATFAQTKFGSTKLKTSSKRTNSSSAYRMSPTEFSNYIKQRAMQQQM  294

Query  294  HHGHGVVPSAGSSVS-AFGGLEAVSPARSLSPNPLSLGGGPSGAAVGTPAADPFYYPNMA  352
            HHGH VVPSAGSSVS A+GG++AVSPARSLSPNPLSL G  + +  G+ +AD +YYPNM 
Sbjct  295  HHGHAVVPSAGSSVSAAYGGMDAVSPARSLSPNPLSLAGNQNQSVSGS-SADSYYYPNMP  353

Query  353  IGLYPPFGNPRNLFEPHFNAD-ASLGLFVSGT--------GSTGANKYSTYLEPCYFGAG  403
            I +YP +GNPR LFE HF+AD +S+GL+VSGT        GS GANKYSTYLEPCY+G G
Sbjct  354  INMYPQYGNPRCLFESHFSADVSSMGLYVSGTAGAAVTAVGSVGANKYSTYLEPCYYGNG  413

Query  404  HPGS-QHQQGRGASGPDRPNRSDSCFGLNVECGVGLVEE-------TSPSVALAITGDSS  455
            H  + QH Q +   G DRPN S+SCFGLNV+CG  ++E+        + +VA+ I GDSS
Sbjct  414  HANTQQHSQQQTRVGMDRPNSSESCFGLNVDCGSVVLEDSSSSSSAAAAAVAVTIAGDSS  473

Query  456  ADNSPLSTPTVGVV-------PPLPAAASSPS----TAGAATGAASTTSSHQPQQPAAQD  504
            A+NSPLSTPT+  V       PP  +  +S S         + ++   + +        +
Sbjct  474  AENSPLSTPTLAAVNVGKATSPPTNSTNNSSSHPIQQQEQPSSSSGNGNGNANANANGNN  533

Query  505  SSPGNSNSKLIDGISSFYGSGSSYQQLLVAN  535
             +  NSN+KLIDGISSFYG+GSSYQQLLVAN
Sbjct  534  GNNSNSNTKLIDGISSFYGTGSSYQQLLVAN  564


>BTG_DICDI unnamed protein product
Length=423

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)

Query  20   LPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKTGDPIDSVLERAARESGVPI  79
            +P+  +  F +EL  ALRD+ +GHWYP+ P +G  YR +   +  D +L  AA++S + +
Sbjct  131  IPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIICEETTDRLLMDAAKKSDI-V  189

Query  80   GDILENLPNELSVWVDPGEVSFRIGEKGAVKILY  113
            G+  + +    ++W+DPG V++R G K   K LY
Sbjct  190  GEFRQLVKQNTTMWIDPGNVTYRHG-KHYEKTLY  222


>G5EDX7_CAEEL unnamed protein product
Length=263

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            M+ E++  +NFV  YL+  +PRR V IFG EL   L   F   W    P  G   R + T
Sbjct  1    MYTEVRELVNFVCRYLFGHIPRRPVGIFGAELGNYLVSHFSSTWDVHHPKNGEMKRMINT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKG  107
               +      +A E+GVP  D+L  LP  + ++ +PG V  R+ E G
Sbjct  61   TTSL--CFASSAEEAGVPPSDVLRLLPTNMIIFANPGHVFVRLSENG  105



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110482.1 uncharacterized protein LOC108134613 [Drosophila
elegans]

Length=1154
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VFY9_DROME  unnamed protein product                                 1761    0.0  
A0A0B4KFU1_DROME  unnamed protein product                             1761    0.0  
TOLL6_DROME  unnamed protein product                                  99.8    8e-21


>Q9VFY9_DROME unnamed protein product
Length=1141

 Score = 1761 bits (4561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 952/1169 (81%), Positives = 1012/1169 (87%), Gaps = 43/1169 (4%)

Query  1     MVKIVNRHCNQGLALLLTWTWLTRLVVAGQLAIESELPSSSRQAAEREEQQLSLQDVGGL  60
             MVKIVN+HC+ GLALLL WTWLTRLVVA  L    ++P+SSR AAEREEQQLS QDVG L
Sbjct  1     MVKIVNQHCDLGLALLLAWTWLTRLVVAAHLV---DIPTSSRLAAEREEQQLSRQDVGRL  57

Query  61    SYQSIHRMLRDENEPASFRGELRYQQKRHKRELELNAPANKLNLTHRDLRSFNGSGGQWR  120
             SYQSIHRMLRDENEP SFRGELRYQQKRHKRELELNAPANKLNLTHRDLR+FN +GGQW+
Sbjct  58    SYQSIHRMLRDENEPDSFRGELRYQQKRHKRELELNAPANKLNLTHRDLRTFNSTGGQWK  117

Query  121   GDFQVITAMDLSSNQLSTLSLDNFSQLRQLDVSNNSLELIPLSLTDNNSSLPLVTLDLSC  180
             GDFQVITAMDLSSNQL +LSLDNF+QLRQLD+ NNSLE+IPLSL D N SLP VTLDLSC
Sbjct  118   GDFQVITAMDLSSNQLESLSLDNFNQLRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSC  177

Query  181   NRFRHISTNFFVQHLPQLKNLNLAHNQLLNISRESFYNLLELQTLILSHNHISDIDYETF  240
             N+F  IST+FF Q LPQLKNLNLAHN+LLNISRESFYNLLELQTL+LSHN+ISDIDYETF
Sbjct  178   NKFSQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETF  237

Query  241   LALPNLQHLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPEVGVAMQEFVASWSLKELDAS  300
             LALPNLQ+LDLSHNRLSGSAIRALQGIPDLVSLSIAYNP+VGVAMQEFVASWSLKELDAS
Sbjct  238   LALPNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDAS  297

Query  301   GTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRL  360
             GTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRL
Sbjct  298   GTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRL  357

Query  361   ELLESLFLDHNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSGNRLIF  420
             ELLESLFLD NLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLS NRLIF
Sbjct  358   ELLESLFLDRNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIF  417

Query  421   LPALSLPKLLTLNLQSSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRS  480
             LP LSLPKLLTLNL+SSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRS
Sbjct  418   LPPLSLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRS  477

Query  481   VDVGQSIGRSASGQVDLKAEYLQFHDFYENFSSRECGAMKPENDTMPPSCSIASAMA---  537
             VD GQS G S SG+VDLK EYLQFH+FYENFSSRECG  KPENDT PPSCS+  A A   
Sbjct  478   VDAGQSNGASVSGRVDLKTEYLQFHNFYENFSSRECGIRKPENDTKPPSCSLTRASATLT  537

Query  538   TTPKTMSKVKKSKGADSAATSAKIAAAETQAAATAGTTTAATSA---------EKSASTT  588
             TTP++MSKV+KS+ A + ATS ++AAA    +   G    + +           ++ +T 
Sbjct  538   TTPRSMSKVEKSQEAQATATSVEVAAATAATSEKTGIQATSAAQSTAAATTAEREAIATA  597

Query  589   ATPADTPATPTYPKAGMQSAGNNVAQLTTKTLRPTETTSLEPVQQQRQQMPGMPAKTTAM  648
              +   T        A +QSAGN  AQLTTKTLRPTETTSL  + Q+RQQMPGMPAKTT  
Sbjct  598   TSSDTTATPTLAAAAAIQSAGNIPAQLTTKTLRPTETTSLAQL-QRRQQMPGMPAKTTET  656

Query  649   PAKNLPSLAQTKATTAVHILATPTAATATTPINSNKPTTGPANISGATKTAATAATAATA  708
             PAKNLPSLAQTKATTA+ ILAT  AATATT INS+KPT    NISGATKT AT+A     
Sbjct  657   PAKNLPSLAQTKATTALPILATRDAATATTEINSDKPT----NISGATKTVATSA-----  707

Query  709   ATSATEIAEAAATAAIEVPQTILAGKKSVKMPEDKTQETLLKYPTSDTSGQVATPQHKHA  768
                    AE A   AIEVPQTILAGKKS KMP DK  ETLLKYPT DTSGQVAT  HKHA
Sbjct  708   -------AEIATPPAIEVPQTILAGKKSDKMPADKAHETLLKYPTRDTSGQVATTPHKHA  760

Query  769   TLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLPGTATVADANADAEAEVLD-AGQHQLA  827
             TLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLPGTATV    ADA++EVLD + QHQ A
Sbjct  761   TLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLPGTATV----ADADSEVLDPSQQHQSA  816

Query  828   EQERHQSAADKRQAEAINGDTKSPPKSHKKKPSLSIKKMTYSTKHAVKTPVAEVSVTAKT  887
             EQE+HQSA DKRQA+AINGDTKSP K HKKKPSLSIKKMTYSTKHA KT V +++ T+KT
Sbjct  817   EQEKHQSATDKRQADAINGDTKSPAKGHKKKPSLSIKKMTYSTKHAAKT-VEDMAATSKT  875

Query  888   TQHQHSSVNTPKEATPEELSTFAQLKAYVELKSESKPEHLMDQREENLHNLTGNHPGVML  947
              QHQHSSVNTPKEA PEELSTFAQLKAYVELKSESKPEHLMDQREEN HNLTGNHPGVML
Sbjct  876   PQHQHSSVNTPKEAAPEELSTFAQLKAYVELKSESKPEHLMDQREENHHNLTGNHPGVML  935

Query  948   LVACVLFIVLLAGLAHVYRCELPWQRSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNSS  1007
             LVACVLFIVLLAGLAHVYRCELPWQRSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNS+
Sbjct  936   LVACVLFIVLLAGLAHVYRCELPWQRSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNSN  995

Query  1008  -GDPARLQKWHHSTRREAPYSSPLHNLQARELQQQRCQQFYSSSLADRSSTTASTSSSSG  1066
              GDPARLQKWHHSTRREAPYSSPLHNLQARELQQQRCQQFYSSSLAD+SS+T+S+SS S 
Sbjct  996   GGDPARLQKWHHSTRREAPYSSPLHNLQARELQQQRCQQFYSSSLADKSSSTSSSSSGSS  1055

Query  1067  SSRSSLHSPSRDDSYYIEMAPSSPP-ATLPSLPMELLGSRSKGGIGCRADRVAATDLGGT  1125
              S     SPSRDDSYYIEMAPSSPP A LPSLPMELLGSRS   +GCR DRVAATDLGGT
Sbjct  1056  RSSLH--SPSRDDSYYIEMAPSSPPAANLPSLPMELLGSRS-NALGCRTDRVAATDLGGT  1112

Query  1126  TAAVPSPAASIRSVSSRLMAPSSRRLGIW  1154
             T AVPS AA+I+SVSSRLM PSSRRL IW
Sbjct  1113  TEAVPSSAAAIKSVSSRLMTPSSRRLNIW  1141


>A0A0B4KFU1_DROME unnamed protein product
Length=1155

 Score = 1761 bits (4561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 952/1169 (81%), Positives = 1012/1169 (87%), Gaps = 43/1169 (4%)

Query  1     MVKIVNRHCNQGLALLLTWTWLTRLVVAGQLAIESELPSSSRQAAEREEQQLSLQDVGGL  60
             MVKIVN+HC+ GLALLL WTWLTRLVVA  L    ++P+SSR AAEREEQQLS QDVG L
Sbjct  1     MVKIVNQHCDLGLALLLAWTWLTRLVVAAHLV---DIPTSSRLAAEREEQQLSRQDVGRL  57

Query  61    SYQSIHRMLRDENEPASFRGELRYQQKRHKRELELNAPANKLNLTHRDLRSFNGSGGQWR  120
             SYQSIHRMLRDENEP SFRGELRYQQKRHKRELELNAPANKLNLTHRDLR+FN +GGQW+
Sbjct  58    SYQSIHRMLRDENEPDSFRGELRYQQKRHKRELELNAPANKLNLTHRDLRTFNSTGGQWK  117

Query  121   GDFQVITAMDLSSNQLSTLSLDNFSQLRQLDVSNNSLELIPLSLTDNNSSLPLVTLDLSC  180
             GDFQVITAMDLSSNQL +LSLDNF+QLRQLD+ NNSLE+IPLSL D N SLP VTLDLSC
Sbjct  118   GDFQVITAMDLSSNQLESLSLDNFNQLRQLDLGNNSLEVIPLSLADTNMSLPFVTLDLSC  177

Query  181   NRFRHISTNFFVQHLPQLKNLNLAHNQLLNISRESFYNLLELQTLILSHNHISDIDYETF  240
             N+F  IST+FF Q LPQLKNLNLAHN+LLNISRESFYNLLELQTL+LSHN+ISDIDYETF
Sbjct  178   NKFSQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETF  237

Query  241   LALPNLQHLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPEVGVAMQEFVASWSLKELDAS  300
             LALPNLQ+LDLSHNRLSGSAIRALQGIPDLVSLSIAYNP+VGVAMQEFVASWSLKELDAS
Sbjct  238   LALPNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDAS  297

Query  301   GTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRL  360
             GTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRL
Sbjct  298   GTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRL  357

Query  361   ELLESLFLDHNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSGNRLIF  420
             ELLESLFLD NLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLS NRLIF
Sbjct  358   ELLESLFLDRNLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIF  417

Query  421   LPALSLPKLLTLNLQSSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRS  480
             LP LSLPKLLTLNL+SSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRS
Sbjct  418   LPPLSLPKLLTLNLESSGVESVSQSIVHTLPQLRDLLLEDNPIKCSDLLGIAEWASPCRS  477

Query  481   VDVGQSIGRSASGQVDLKAEYLQFHDFYENFSSRECGAMKPENDTMPPSCSIASAMA---  537
             VD GQS G S SG+VDLK EYLQFH+FYENFSSRECG  KPENDT PPSCS+  A A   
Sbjct  478   VDAGQSNGASVSGRVDLKTEYLQFHNFYENFSSRECGIRKPENDTKPPSCSLTRASATLT  537

Query  538   TTPKTMSKVKKSKGADSAATSAKIAAAETQAAATAGTTTAATSA---------EKSASTT  588
             TTP++MSKV+KS+ A + ATS ++AAA    +   G    + +           ++ +T 
Sbjct  538   TTPRSMSKVEKSQEAQATATSVEVAAATAATSEKTGIQATSAAQSTAAATTAEREAIATA  597

Query  589   ATPADTPATPTYPKAGMQSAGNNVAQLTTKTLRPTETTSLEPVQQQRQQMPGMPAKTTAM  648
              +   T        A +QSAGN  AQLTTKTLRPTETTSL  + Q+RQQMPGMPAKTT  
Sbjct  598   TSSDTTATPTLAAAAAIQSAGNIPAQLTTKTLRPTETTSLAQL-QRRQQMPGMPAKTTET  656

Query  649   PAKNLPSLAQTKATTAVHILATPTAATATTPINSNKPTTGPANISGATKTAATAATAATA  708
             PAKNLPSLAQTKATTA+ ILAT  AATATT INS+KPT    NISGATKT AT+A     
Sbjct  657   PAKNLPSLAQTKATTALPILATRDAATATTEINSDKPT----NISGATKTVATSA-----  707

Query  709   ATSATEIAEAAATAAIEVPQTILAGKKSVKMPEDKTQETLLKYPTSDTSGQVATPQHKHA  768
                    AE A   AIEVPQTILAGKKS KMP DK  ETLLKYPT DTSGQVAT  HKHA
Sbjct  708   -------AEIATPPAIEVPQTILAGKKSDKMPADKAHETLLKYPTRDTSGQVATTPHKHA  760

Query  769   TLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLPGTATVADANADAEAEVLD-AGQHQLA  827
             TLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLPGTATV    ADA++EVLD + QHQ A
Sbjct  761   TLQLHVKDRHLIGTPLLMHKGDVLLVDAEQLLLPGTATV----ADADSEVLDPSQQHQSA  816

Query  828   EQERHQSAADKRQAEAINGDTKSPPKSHKKKPSLSIKKMTYSTKHAVKTPVAEVSVTAKT  887
             EQE+HQSA DKRQA+AINGDTKSP K HKKKPSLSIKKMTYSTKHA KT V +++ T+KT
Sbjct  817   EQEKHQSATDKRQADAINGDTKSPAKGHKKKPSLSIKKMTYSTKHAAKT-VEDMAATSKT  875

Query  888   TQHQHSSVNTPKEATPEELSTFAQLKAYVELKSESKPEHLMDQREENLHNLTGNHPGVML  947
              QHQHSSVNTPKEA PEELSTFAQLKAYVELKSESKPEHLMDQREEN HNLTGNHPGVML
Sbjct  876   PQHQHSSVNTPKEAAPEELSTFAQLKAYVELKSESKPEHLMDQREENHHNLTGNHPGVML  935

Query  948   LVACVLFIVLLAGLAHVYRCELPWQRSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNSS  1007
             LVACVLFIVLLAGLAHVYRCELPWQRSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNS+
Sbjct  936   LVACVLFIVLLAGLAHVYRCELPWQRSNRSGQLRPHHQRHLNETDDAHSFLHYQGSVNSN  995

Query  1008  -GDPARLQKWHHSTRREAPYSSPLHNLQARELQQQRCQQFYSSSLADRSSTTASTSSSSG  1066
              GDPARLQKWHHSTRREAPYSSPLHNLQARELQQQRCQQFYSSSLAD+SS+T+S+SS S 
Sbjct  996   GGDPARLQKWHHSTRREAPYSSPLHNLQARELQQQRCQQFYSSSLADKSSSTSSSSSGSS  1055

Query  1067  SSRSSLHSPSRDDSYYIEMAPSSPP-ATLPSLPMELLGSRSKGGIGCRADRVAATDLGGT  1125
              S     SPSRDDSYYIEMAPSSPP A LPSLPMELLGSRS   +GCR DRVAATDLGGT
Sbjct  1056  RSSLH--SPSRDDSYYIEMAPSSPPAANLPSLPMELLGSRS-NALGCRTDRVAATDLGGT  1112

Query  1126  TAAVPSPAASIRSVSSRLMAPSSRRLGIW  1154
             T AVPS AA+I+SVSSRLM PSSRRL IW
Sbjct  1113  TEAVPSSAAAIKSVSSRLMTPSSRRLNIW  1141


>TOLL6_DROME unnamed protein product
Length=1514

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 124/395 (31%), Positives = 184/395 (47%), Gaps = 48/395 (12%)

Query  81   ELRYQQKRHKRELELNAPANKLNLTHRDLR--SFNGSGGQWRGD-----FQVITAMDLSS  133
            +L Y    H   + L  PAN    T R LR  S N +G     D      + +  ++LSS
Sbjct  278  DLEYLDVSHNDFVVL--PANGFG-TLRRLRVLSVNNNGISMIADKALSGLKNLQILNLSS  334

Query  134  NQLSTLSLDNFSQ----LRQLDVSNNSLELIPLSLTDNNSSLPLVTLDLSCNRFR--HIS  187
            N++  L  + F++    ++++ + NNS+ ++   L  N   L    LDLS N+     I 
Sbjct  335  NKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQ--ALDLSMNQITSTWID  392

Query  188  TNFFVQHLPQLKNLNLAHNQLLNISRESFYNLLELQTLILSHNHISDIDYETFLALPNLQ  247
             N FV  L +L  LNL+HN+L  +  E F +L  LQ L L HN + +I  +TF  + NL 
Sbjct  393  KNTFVG-LIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTFAPMNNLH  451

Query  248  HLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPEVGVAMQEFVASWSLKELDASGTGLCQV  307
             L LSHN+L      AL G+  L  LS+  N  +GV    F    +L++L+ +G  L  V
Sbjct  452  TLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLNGNQLKTV  511

Query  308  PAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLELLESLF  367
            P AL +++R L+                      +DL  + I  +ED A   L  L  L 
Sbjct  512  PLAL-RNMRHLRT---------------------VDLGENMITVMEDSAFKGLGNLYGLR  549

Query  368  LDHNLL----MRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSGNRLIFLPA  423
            L  N L    M     L P+L+ L L  N+I  + P AF    ++Q + L GN L  +  
Sbjct  550  LIGNYLENITMHTFRDL-PNLQILNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDING  608

Query  424  L--SLPKLLTLNLQSSGVESVSQSIVHTLPQLRDL  456
            L  ++P LL LN+  + +ES     V +  Q  DL
Sbjct  609  LFSNMPSLLWLNISDNRLESFDYGHVPSTLQWLDL  643


 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 97/338 (29%), Positives = 160/338 (47%), Gaps = 28/338 (8%)

Query  102  LNLTHRDLRSFNGSGGQWRGDFQVITAMDLSSNQLSTLSLDNFS---QLRQLDVSNNSLE  158
            LNL+H  L        +   D   +  ++L  NQL  ++ D F+    L  L +S+N L+
Sbjct  405  LNLSHNKLTKLEP---EIFSDLYTLQILNLRHNQLENIAADTFAPMNNLHTLLLSHNKLK  461

Query  159  LIPLSLTDNNSSLPLVTLDLSC------NRFRHISTNFFVQHLPQLKNLNLAHNQLLNIS  212
             +     +    L L++LD +       + FR+ S          L++LNL  NQL  + 
Sbjct  462  YLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSA---------LQDLNLNGNQLKTVP  512

Query  213  RESFYNLLELQTLILSHNHISDIDYETFLALPNLQHLDLSHNRLSGSAIRALQGIPDLVS  272
              +  N+  L+T+ L  N I+ ++   F  L NL  L L  N L    +   + +P+L  
Sbjct  513  L-ALRNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTFRDLPNLQI  571

Query  273  LSIAYNPEVGVAMQEFVASWSLKELDASGTGLCQVPAALAQ--SVRTLKLSDNWLKAINC  330
            L++A N    V    F  + S++ +   G  L  +    +   S+  L +SDN L++ + 
Sbjct  572  LNLARNRIAVVEPGAFEMTSSIQAVRLDGNELNDINGLFSNMPSLLWLNISDNRLESFDY  631

Query  331  GDMDSYPLLQYLDLSHSRIAQVEDDALGRLEL-LESLFLDHNLLMRV-PSSLPPSLEHLF  388
            G + S   LQ+LDL  +R++ + +      EL L++L +  N L R+ PSS+P S+E LF
Sbjct  632  GHVPS--TLQWLDLHKNRLSSLSNRFGLDSELKLQTLDVSFNQLQRIGPSSIPNSIELLF  689

Query  389  LQHNQIMELPPQAFVGLVNLQTLDLSGNRLIFLPALSL  426
            L  N I  + P  F+   NL  +DL  N++  L   SL
Sbjct  690  LNDNLITTVDPDTFMHKTNLTRVDLYANQITTLDIKSL  727


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 164/379 (43%), Gaps = 66/379 (17%)

Query  129  MDLSSNQLSTLSLDNF---SQLRQLDVSNNSLELI-PLSLTDNNSS--------------  170
            +DLSSN + +L  + F   S+L  L++S N L+ +  L   D +                
Sbjct  205  LDLSSNNIWSLPDNIFCTLSELSALNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTES  264

Query  171  ------------LPLVTLDLSCNRFRHISTNFF-----------------------VQHL  195
                        L L  LD+S N F  +  N F                       +  L
Sbjct  265  AKKSSSSSTSCSLDLEYLDVSHNDFVVLPANGFGTLRRLRVLSVNNNGISMIADKALSGL  324

Query  196  PQLKNLNLAHNQLLNISRESFYNLLE-LQTLILSHNHISDIDYETFLALPNLQHLDLSHN  254
              L+ LNL+ N+++ +  E F    + +Q + L +N IS ++ + F  L  LQ LDLS N
Sbjct  325  KNLQILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMN  384

Query  255  RLSGSAI--RALQGIPDLVSLSIAYNPEVGVAMQEFVASWSLKELDASGTGLCQVPA---  309
            +++ + I      G+  LV L++++N    +  + F   ++L+ L+     L  + A   
Sbjct  385  QITSTWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLENIAADTF  444

Query  310  ALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLELLESLFLD  369
            A   ++ TL LS N LK ++   ++   +L  L L ++ +  V  DA      L+ L L+
Sbjct  445  APMNNLHTLLLSHNKLKYLDAYALNGLYVLSLLSLDNNALIGVHPDAFRNCSALQDLNLN  504

Query  370  HNLLMRVPSSLPPSLEHLF---LQHNQIMELPPQAFVGLVNLQTLDLSGNRL--IFLPAL  424
             N L  VP +L  ++ HL    L  N I  +   AF GL NL  L L GN L  I +   
Sbjct  505  GNQLKTVPLAL-RNMRHLRTVDLGENMITVMEDSAFKGLGNLYGLRLIGNYLENITMHTF  563

Query  425  -SLPKLLTLNLQSSGVESV  442
              LP L  LNL  + +  V
Sbjct  564  RDLPNLQILNLARNRIAVV  582


 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 80/153 (52%), Gaps = 11/153 (7%)

Query  121  GDFQV---ITAMDLSSNQLSTLS--LDNFSQLRQLDVSNNSLELIPLSLTDNNSSLPLVT  175
            G F++   I A+ L  N+L+ ++    N   L  L++S+N LE    S    +    L  
Sbjct  585  GAFEMTSSIQAVRLDGNELNDINGLFSNMPSLLWLNISDNRLE----SFDYGHVPSTLQW  640

Query  176  LDLSCNRFRHISTNFFVQHLPQLKNLNLAHNQLLNISRESFYNLLELQTLILSHNHISDI  235
            LDL  NR   +S  F +    +L+ L+++ NQL  I   S  N +EL  L L+ N I+ +
Sbjct  641  LDLHKNRLSSLSNRFGLDSELKLQTLDVSFNQLQRIGPSSIPNSIEL--LFLNDNLITTV  698

Query  236  DYETFLALPNLQHLDLSHNRLSGSAIRALQGIP  268
            D +TF+   NL  +DL  N+++   I++L+ +P
Sbjct  699  DPDTFMHKTNLTRVDLYANQITTLDIKSLRILP  731


 Score = 50.8 bits (120),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 75/290 (26%), Positives = 121/290 (42%), Gaps = 41/290 (14%)

Query  195  LPQLKNLNL-AHNQL-----LNISRESFYNLLELQTLILSHNHISDIDYETFLALPNLQH  248
            L QL+NL L  HN L       I  ++F     L+ L LS N+I  +    F  L  L  
Sbjct  169  LEQLRNLTLRTHNILWPALNFEIEADAFSVTRRLERLDLSSNNIWSLPDNIFCTLSELSA  228

Query  249  LDLSHNRLS-----GSAIRALQGIPDLVSLSIAYNPEVGVAMQEFVASWSLKELDASGTG  303
            L++S NRL      G   R+ +        +         +      S  L+ LD S   
Sbjct  229  LNMSENRLQDVNELGFRDRSKEPTNGSTESTSTTESAKKSSSSSTSCSLDLEYLDVSHND  288

Query  304  LCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDALGRLELL  363
               +PA    ++R L++                     L ++++ I+ + D AL  L+ L
Sbjct  289  FVVLPANGFGTLRRLRV---------------------LSVNNNGISMIADKALSGLKNL  327

Query  364  ESLFLDHNLLMRVPSSL----PPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSGNRLI  419
            + L L  N ++ +P+ L       ++ ++LQ+N I  L PQ F  L  LQ LDLS N++ 
Sbjct  328  QILNLSSNKIVALPTELFAEQAKIIQEVYLQNNSISVLNPQLFSNLDQLQALDLSMNQIT  387

Query  420  FL-----PALSLPKLLTLNLQSSGVESVSQSIVHTLPQLRDLLLEDNPIK  464
                     + L +L+ LNL  + +  +   I   L  L+ L L  N ++
Sbjct  388  STWIDKNTFVGLIRLVLLNLSHNKLTKLEPEIFSDLYTLQILNLRHNQLE  437


 Score = 40.8 bits (94),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 55/111 (50%), Gaps = 5/111 (5%)

Query  195   LPQLKNLNLAHNQLLNISRESFYNLLELQTLILSHNHISDIDYETFLALPNLQHLDLSHN  254
             L +L  L+L  N ++++    F+NL  L+ L L  N I+ I   +F  L  L+ L L  N
Sbjct  906   LKRLLILHLEDNHIISLEGNEFHNLENLRELYLQSNKIASIANGSFQMLRKLEVLRLDGN  965

Query  255   RLSGSAIRALQGIPDLVSLSIA---YNPEVGVA--MQEFVASWSLKELDAS  300
             RL    +  L   P LV +S+A   ++ E G     + ++   S K +DAS
Sbjct  966   RLMHFEVWQLSANPYLVEISLADNQWSCECGYLARFRNYLGQSSEKIIDAS  1016


 Score = 40.4 bits (93),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 27/91 (30%), Positives = 47/91 (52%), Gaps = 3/91 (3%)

Query  376  VPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSGNRL--IFLPALS-LPKLLTL  432
            +P  +P     L++  N  +EL   +F+G  NL  L  + + +  I+    S L +LL L
Sbjct  853  MPRRVPMDTSELYIDGNNFVELAGHSFLGRKNLAVLYANNSNVAHIYNTTFSGLKRLLIL  912

Query  433  NLQSSGVESVSQSIVHTLPQLRDLLLEDNPI  463
            +L+ + + S+  +  H L  LR+L L+ N I
Sbjct  913  HLEDNHIISLEGNEFHNLENLRELYLQSNKI  943


 Score = 33.1 bits (74),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 41/89 (46%), Gaps = 9/89 (10%)

Query  339  LQYLDLSHSRIAQVEDDALGRLELLESLFL-DHNLLMRVPS--------SLPPSLEHLFL  389
            LQ L + + ++ ++    L  LE L +L L  HN+L    +        S+   LE L L
Sbjct  148  LQQLSIQYCKLGRLGRQVLDGLEQLRNLTLRTHNILWPALNFEIEADAFSVTRRLERLDL  207

Query  390  QHNQIMELPPQAFVGLVNLQTLDLSGNRL  418
              N I  LP   F  L  L  L++S NRL
Sbjct  208  SSNNIWSLPDNIFCTLSELSALNMSENRL  236



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110483.1 protein Tob1 isoform X1 [Drosophila elegans]

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 678     0.0  
BTG_DICDI  unnamed protein product                                    79.0    2e-15
G5EDX7_CAEEL  unnamed protein product                                 71.2    1e-13


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/571 (71%), Positives = 448/571 (78%), Gaps = 43/571 (8%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQ HWYPEKPFKGSAYRCLKT
Sbjct  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKGAVKILYTENNENH  120
            GDPIDSVLERAARESGVPIGDILENLPNELSVW+DPGEVSFRIGEKGAVKILYTENNENH
Sbjct  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENH  120

Query  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNLSLSPKNLPLALPQAGSGSSPHSAASS  180
            EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNN+SLSPK          SGSSPHSAASS
Sbjct  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKG------HHQSGSSPHSAASS  174

Query  181  SPTYKGSPNPTI------SGSCSSGSGAGSGSNLGPGPGPGTAPVPVPGNSATANASGGA  234
            SPTYKGSPN TI           SG+G+GS S     PGPGTAP PVPGN ATANA+  A
Sbjct  175  SPTYKGSPNRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAA  234

Query  235  FMQRGAQTPLTFTTATFAQTKFGSTKLKTSSKRTN-SSAYRMSPTEFSNYIKQRAMQQQM  293
            FMQRGAQ PLTFTTATFAQTKFGSTKLKTSSKRTN SSAYRMSPTEFSNYIKQRAMQQQM
Sbjct  235  FMQRGAQAPLTFTTATFAQTKFGSTKLKTSSKRTNSSSAYRMSPTEFSNYIKQRAMQQQM  294

Query  294  HHGHGVVPSAGSSVS-AFGGLEAVSPARSLSPNPLSLGGGPSGAAVGTPAADPFYYPNMA  352
            HHGH VVPSAGSSVS A+GG++AVSPARSLSPNPLSL G  + +  G+ +AD +YYPNM 
Sbjct  295  HHGHAVVPSAGSSVSAAYGGMDAVSPARSLSPNPLSLAGNQNQSVSGS-SADSYYYPNMP  353

Query  353  IGLYPPFGNPRNLFEPHFNAD-ASLGLFVSGT--------GSTGANKYSTYLEPCYFGAG  403
            I +YP +GNPR LFE HF+AD +S+GL+VSGT        GS GANKYSTYLEPCY+G G
Sbjct  354  INMYPQYGNPRCLFESHFSADVSSMGLYVSGTAGAAVTAVGSVGANKYSTYLEPCYYGNG  413

Query  404  HPGS-QHQQGRGASGPDRPNRSDSCFGLNVECGVGLVEE-------TSPSVALAITGDSS  455
            H  + QH Q +   G DRPN S+SCFGLNV+CG  ++E+        + +VA+ I GDSS
Sbjct  414  HANTQQHSQQQTRVGMDRPNSSESCFGLNVDCGSVVLEDSSSSSSAAAAAVAVTIAGDSS  473

Query  456  ADNSPLSTPTVGVV-------PPLPAAASSPS----TAGAATGAASTTSSHQPQQPAAQD  504
            A+NSPLSTPT+  V       PP  +  +S S         + ++   + +        +
Sbjct  474  AENSPLSTPTLAAVNVGKATSPPTNSTNNSSSHPIQQQEQPSSSSGNGNGNANANANGNN  533

Query  505  SSPGNSNSKLIDGISSFYGSGSSYQQLLVAN  535
             +  NSN+KLIDGISSFYG+GSSYQQLLVAN
Sbjct  534  GNNSNSNTKLIDGISSFYGTGSSYQQLLVAN  564


>BTG_DICDI unnamed protein product
Length=423

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)

Query  20   LPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKTGDPIDSVLERAARESGVPI  79
            +P+  +  F +EL  ALRD+ +GHWYP+ P +G  YR +   +  D +L  AA++S + +
Sbjct  131  IPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIICEETTDRLLMDAAKKSDI-V  189

Query  80   GDILENLPNELSVWVDPGEVSFRIGEKGAVKILY  113
            G+  + +    ++W+DPG V++R G K   K LY
Sbjct  190  GEFRQLVKQNTTMWIDPGNVTYRHG-KHYEKTLY  222


>G5EDX7_CAEEL unnamed protein product
Length=263

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            M+ E++  +NFV  YL+  +PRR V IFG EL   L   F   W    P  G   R + T
Sbjct  1    MYTEVRELVNFVCRYLFGHIPRRPVGIFGAELGNYLVSHFSSTWDVHHPKNGEMKRMINT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKG  107
               +      +A E+GVP  D+L  LP  + ++ +PG V  R+ E G
Sbjct  61   TTSL--CFASSAEEAGVPPSDVLRLLPTNMIIFANPGHVFVRLSENG  105



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110484.1 protein Tob1 isoform X1 [Drosophila elegans]

Length=535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 678     0.0  
BTG_DICDI  unnamed protein product                                    79.0    2e-15
G5EDX7_CAEEL  unnamed protein product                                 71.2    1e-13


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/571 (71%), Positives = 448/571 (78%), Gaps = 43/571 (8%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQ HWYPEKPFKGSAYRCLKT
Sbjct  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKGAVKILYTENNENH  120
            GDPIDSVLERAARESGVPIGDILENLPNELSVW+DPGEVSFRIGEKGAVKILYTENNENH
Sbjct  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENH  120

Query  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNLSLSPKNLPLALPQAGSGSSPHSAASS  180
            EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNN+SLSPK          SGSSPHSAASS
Sbjct  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKG------HHQSGSSPHSAASS  174

Query  181  SPTYKGSPNPTI------SGSCSSGSGAGSGSNLGPGPGPGTAPVPVPGNSATANASGGA  234
            SPTYKGSPN TI           SG+G+GS S     PGPGTAP PVPGN ATANA+  A
Sbjct  175  SPTYKGSPNRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAA  234

Query  235  FMQRGAQTPLTFTTATFAQTKFGSTKLKTSSKRTN-SSAYRMSPTEFSNYIKQRAMQQQM  293
            FMQRGAQ PLTFTTATFAQTKFGSTKLKTSSKRTN SSAYRMSPTEFSNYIKQRAMQQQM
Sbjct  235  FMQRGAQAPLTFTTATFAQTKFGSTKLKTSSKRTNSSSAYRMSPTEFSNYIKQRAMQQQM  294

Query  294  HHGHGVVPSAGSSVS-AFGGLEAVSPARSLSPNPLSLGGGPSGAAVGTPAADPFYYPNMA  352
            HHGH VVPSAGSSVS A+GG++AVSPARSLSPNPLSL G  + +  G+ +AD +YYPNM 
Sbjct  295  HHGHAVVPSAGSSVSAAYGGMDAVSPARSLSPNPLSLAGNQNQSVSGS-SADSYYYPNMP  353

Query  353  IGLYPPFGNPRNLFEPHFNAD-ASLGLFVSGT--------GSTGANKYSTYLEPCYFGAG  403
            I +YP +GNPR LFE HF+AD +S+GL+VSGT        GS GANKYSTYLEPCY+G G
Sbjct  354  INMYPQYGNPRCLFESHFSADVSSMGLYVSGTAGAAVTAVGSVGANKYSTYLEPCYYGNG  413

Query  404  HPGS-QHQQGRGASGPDRPNRSDSCFGLNVECGVGLVEE-------TSPSVALAITGDSS  455
            H  + QH Q +   G DRPN S+SCFGLNV+CG  ++E+        + +VA+ I GDSS
Sbjct  414  HANTQQHSQQQTRVGMDRPNSSESCFGLNVDCGSVVLEDSSSSSSAAAAAVAVTIAGDSS  473

Query  456  ADNSPLSTPTVGVV-------PPLPAAASSPS----TAGAATGAASTTSSHQPQQPAAQD  504
            A+NSPLSTPT+  V       PP  +  +S S         + ++   + +        +
Sbjct  474  AENSPLSTPTLAAVNVGKATSPPTNSTNNSSSHPIQQQEQPSSSSGNGNGNANANANGNN  533

Query  505  SSPGNSNSKLIDGISSFYGSGSSYQQLLVAN  535
             +  NSN+KLIDGISSFYG+GSSYQQLLVAN
Sbjct  534  GNNSNSNTKLIDGISSFYGTGSSYQQLLVAN  564


>BTG_DICDI unnamed protein product
Length=423

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)

Query  20   LPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKTGDPIDSVLERAARESGVPI  79
            +P+  +  F +EL  ALRD+ +GHWYP+ P +G  YR +   +  D +L  AA++S + +
Sbjct  131  IPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIICEETTDRLLMDAAKKSDI-V  189

Query  80   GDILENLPNELSVWVDPGEVSFRIGEKGAVKILY  113
            G+  + +    ++W+DPG V++R G K   K LY
Sbjct  190  GEFRQLVKQNTTMWIDPGNVTYRHG-KHYEKTLY  222


>G5EDX7_CAEEL unnamed protein product
Length=263

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            M+ E++  +NFV  YL+  +PRR V IFG EL   L   F   W    P  G   R + T
Sbjct  1    MYTEVRELVNFVCRYLFGHIPRRPVGIFGAELGNYLVSHFSSTWDVHHPKNGEMKRMINT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKG  107
               +      +A E+GVP  D+L  LP  + ++ +PG V  R+ E G
Sbjct  61   TTSL--CFASSAEEAGVPPSDVLRLLPTNMIIFANPGHVFVRLSENG  105



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110485.1 protein Tob1 isoform X2 [Drosophila elegans]

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 676     0.0  
BTG_DICDI  unnamed protein product                                    79.0    2e-15
G5EDX7_CAEEL  unnamed protein product                                 71.2    1e-13


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/571 (71%), Positives = 447/571 (78%), Gaps = 44/571 (8%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQ HWYPEKPFKGSAYRCLKT
Sbjct  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKGAVKILYTENNENH  120
            GDPIDSVLERAARESGVPIGDILENLPNELSVW+DPGEVSFRIGEKGAVKILYTENNENH
Sbjct  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENH  120

Query  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNLSLSPKNLPLALPQAGSGSSPHSAASS  180
            EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNN+SLSPK          SGSSPHSAASS
Sbjct  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKG------HHQSGSSPHSAASS  174

Query  181  SPTYKGSPNPTI------SGSCSSGSGAGSGSNLGPGPGPGTAPVPVPGNSATANASGGA  234
            SPTYKGSPN TI           SG+G+GS S     PGPGTAP PVPGN ATANA+  A
Sbjct  175  SPTYKGSPNRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAA  234

Query  235  FMQRGAQTPLTFTTATFAQTKFGSTKLKTSSKRTN--SAYRMSPTEFSNYIKQRAMQQQM  292
            FMQRGAQ PLTFTTATFAQTKFGSTKLKTSSKRTN  SAYRMSPTEFSNYIKQRAMQQQM
Sbjct  235  FMQRGAQAPLTFTTATFAQTKFGSTKLKTSSKRTNSSSAYRMSPTEFSNYIKQRAMQQQM  294

Query  293  HHGHGVVPSAGSSVS-AFGGLEAVSPARSLSPNPLSLGGGPSGAAVGTPAADPFYYPNMA  351
            HHGH VVPSAGSSVS A+GG++AVSPARSLSPNPLSL G  + +  G+ +AD +YYPNM 
Sbjct  295  HHGHAVVPSAGSSVSAAYGGMDAVSPARSLSPNPLSLAGNQNQSVSGS-SADSYYYPNMP  353

Query  352  IGLYPPFGNPRNLFEPHFNAD-ASLGLFVSGT--------GSTGANKYSTYLEPCYFGAG  402
            I +YP +GNPR LFE HF+AD +S+GL+VSGT        GS GANKYSTYLEPCY+G G
Sbjct  354  INMYPQYGNPRCLFESHFSADVSSMGLYVSGTAGAAVTAVGSVGANKYSTYLEPCYYGNG  413

Query  403  HPGS-QHQQGRGASGPDRPNRSDSCFGLNVECGVGLVEE-------TSPSVALAITGDSS  454
            H  + QH Q +   G DRPN S+SCFGLNV+CG  ++E+        + +VA+ I GDSS
Sbjct  414  HANTQQHSQQQTRVGMDRPNSSESCFGLNVDCGSVVLEDSSSSSSAAAAAVAVTIAGDSS  473

Query  455  ADNSPLSTPTVGVV-------PPLPAAASSPS----TAGAATGAASTTSSHQPQQPAAQD  503
            A+NSPLSTPT+  V       PP  +  +S S         + ++   + +        +
Sbjct  474  AENSPLSTPTLAAVNVGKATSPPTNSTNNSSSHPIQQQEQPSSSSGNGNGNANANANGNN  533

Query  504  SSPGNSNSKLIDGISSFYGSGSSYQQLLVAN  534
             +  NSN+KLIDGISSFYG+GSSYQQLLVAN
Sbjct  534  GNNSNSNTKLIDGISSFYGTGSSYQQLLVAN  564


>BTG_DICDI unnamed protein product
Length=423

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)

Query  20   LPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKTGDPIDSVLERAARESGVPI  79
            +P+  +  F +EL  ALRD+ +GHWYP+ P +G  YR +   +  D +L  AA++S + +
Sbjct  131  IPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIICEETTDRLLMDAAKKSDI-V  189

Query  80   GDILENLPNELSVWVDPGEVSFRIGEKGAVKILY  113
            G+  + +    ++W+DPG V++R G K   K LY
Sbjct  190  GEFRQLVKQNTTMWIDPGNVTYRHG-KHYEKTLY  222


>G5EDX7_CAEEL unnamed protein product
Length=263

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 2/107 (2%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            M+ E++  +NFV  YL+  +PRR V IFG EL   L   F   W    P  G   R + T
Sbjct  1    MYTEVRELVNFVCRYLFGHIPRRPVGIFGAELGNYLVSHFSSTWDVHHPKNGEMKRMINT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKG  107
               +      +A E+GVP  D+L  LP  + ++ +PG V  R+ E G
Sbjct  61   TTSL--CFASSAEEAGVPPSDVLRLLPTNMIIFANPGHVFVRLSENG  105



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110486.1 protein Tob1 isoform X3 [Drosophila elegans]

Length=296
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXJ9_DROME  unnamed protein product                                 393     9e-135
BTG_DICDI  unnamed protein product                                    76.6    1e-15 
G5EDX7_CAEEL  unnamed protein product                                 72.8    1e-14 


>Q9VXJ9_DROME unnamed protein product
Length=564

 Score = 393 bits (1009),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 236/275 (86%), Positives = 241/275 (88%), Gaps = 12/275 (4%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQ HWYPEKPFKGSAYRCLKT
Sbjct  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQDHWYPEKPFKGSAYRCLKT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKGAVKILYTENNENH  120
            GDPIDSVLERAARESGVPIGDILENLPNELSVW+DPGEVSFRIGEKGAVKILYTENNENH
Sbjct  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWIDPGEVSFRIGEKGAVKILYTENNENH  120

Query  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNLSLSPKNLPLALPQAGSGSSPHSAASS  180
            EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNN+SLSPK          SGSSPHSAASS
Sbjct  121  EDSHSADREVTKMFNPEAQCFRPIDAVNTTMNNMSLSPKG------HHQSGSSPHSAASS  174

Query  181  SPTYKGSPNPTI------SGSCSSGSGAGSGSNLGPGPGPGTAPVPVPGNSATANASGGA  234
            SPTYKGSPN TI           SG+G+GS S     PGPGTAP PVPGN ATANA+  A
Sbjct  175  SPTYKGSPNRTISGSCSSVSGAGSGTGSGSRSGSNHAPGPGTAPGPVPGNGATANAAAAA  234

Query  235  FMQRGAQTPLTFTTATFAQTKFGSTKLKTSSKRTN  269
            FMQRGAQ PLTFTTATFAQTKFGSTKLKTSSKRTN
Sbjct  235  FMQRGAQAPLTFTTATFAQTKFGSTKLKTSSKRTN  269


>BTG_DICDI unnamed protein product
Length=423

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (61%), Gaps = 2/94 (2%)

Query  20   LPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKTGDPIDSVLERAARESGVPI  79
            +P+  +  F +EL  ALRD+ +GHWYP+ P +G  YR +   +  D +L  AA++S + +
Sbjct  131  IPKENIKRFRKELIFALRDRIKGHWYPDYPERGQGYRAIICEETTDRLLMDAAKKSDI-V  189

Query  80   GDILENLPNELSVWVDPGEVSFRIGEKGAVKILY  113
            G+  + +    ++W+DPG V++R G K   K LY
Sbjct  190  GEFRQLVKQNTTMWIDPGNVTYRHG-KHYEKTLY  222


>G5EDX7_CAEEL unnamed protein product
Length=263

 Score = 72.8 bits (177),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 62/132 (47%), Gaps = 2/132 (2%)

Query  1    MHIEIQVALNFVISYLYNKLPRRRVNIFGEELEKALRDKFQGHWYPEKPFKGSAYRCLKT  60
            M+ E++  +NFV  YL+  +PRR V IFG EL   L   F   W    P  G   R + T
Sbjct  1    MYTEVRELVNFVCRYLFGHIPRRPVGIFGAELGNYLVSHFSSTWDVHHPKNGEMKRMINT  60

Query  61   GDPIDSVLERAARESGVPIGDILENLPNELSVWVDPGEVSFRIGEKGAVKILYTENNENH  120
               +      +A E+GVP  D+L  LP  + ++ +PG V  R+ E G    ++  +    
Sbjct  61   TTSL--CFASSAEEAGVPPSDVLRLLPTNMIIFANPGHVFVRLSENGIETPIWIGDVNCD  118

Query  121  EDSHSADREVTK  132
            E+  S    V +
Sbjct  119  ENYQSVPEYVVR  130



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


Query= XP_017110488.1 putative dual specificity
tyrosine-phosphorylation-regulated kinase 3 homolog isoform X1
[Drosophila elegans]

Length=846
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MBK2_CAEEL  unnamed protein product                                   581     0.0   
DYRK2_DROME  unnamed protein product                                  423     1e-136
MNB_DROME  unnamed protein product                                    292     1e-85 


>MBK2_CAEEL unnamed protein product
Length=817

 Score = 581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/388 (67%), Positives = 316/388 (81%), Gaps = 1/388 (0%)

Query  217  PQQVMILYMHKLTPYERTEIVTYPQIYFIGANAKKRPGIYG-PNNSDYDNEQGAYIHIPH  275
            P+  +  +  KL P+E+ EI  Y +++F+G++AKK+ G+ G  NN  YD+E G+Y  + H
Sbjct  395  PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVH  454

Query  276  DHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRR  335
            DH+AYRYE+LK+IGKGSFGQVIKA+DHK  ++VALK+VRNEKRFHRQA EEIRIL HLRR
Sbjct  455  DHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR  514

Query  336  HDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQC  395
             D   T NIIHM DYF FRNH CITFELLSINLYELIK+N F+GFSL LVRKFA+S+L C
Sbjct  515  QDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLC  574

Query  396  LDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVIL  455
            LD L KN +IHCD+KPENVLLKQQGRSGIKVIDFGSSCF++QRIYTYIQSRFYRAPEVIL
Sbjct  575  LDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVIL  634

Query  456  GAKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSKRSKSF  515
            G KYG  IDMWSLGCILAELL+G+ L PGE+E+DQLA IIE+LGMP    L ++KR+++F
Sbjct  635  GTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTF  694

Query  516  FSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKPRGPPCSKSLSKALDGCKDPLFLNFIRGC  575
             + KGYPRYCT  +M DG VVL G +S+RGK RGPP S+S S AL    D LF++F++ C
Sbjct  695  ITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRC  754

Query  576  LEWDADKRLTPSEALKHPWLRRRLPRPP  603
            L+WD + R+TP++ALKH WLRRRLP PP
Sbjct  755  LDWDPETRMTPAQALKHKWLRRRLPNPP  782


>DYRK2_DROME unnamed protein product
Length=722

 Score = 423 bits (1088),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 273/386 (71%), Gaps = 21/386 (5%)

Query  215  VSPQQVMILYMHKLTPYERTEIVTYPQIYFIGANAKKRPGIYGPN----NSDYDNEQGAY  270
            ++P +++  + + LT  E  E+  Y ++++ G +A K      P     N  YD++ G Y
Sbjct  127  MTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNY  186

Query  271  IHIPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRIL  330
              I HDH+A+RYE+L++IGKGSFGQVI+A DHKT+ HVA+KI+RN+KRF  QA  E+ IL
Sbjct  187  KIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNIL  246

Query  331  HHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAH  390
              LR  D   + N+IHM DY  FR H CITFEL+S+NLYELIKKN + GFS+ L+R+F +
Sbjct  247  DELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCN  306

Query  391  SLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRA  450
            S+++CL  LYK +IIHCD+KPEN+LLKQ+G S IKVIDFGSSC+ +++IYTYIQSRFYR+
Sbjct  307  SIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRS  366

Query  451  PEVILGAKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILASSK  510
            PEVILG +YG AIDMWSLGCILAEL +G  LFPGENE +QLACI+EVLG+P K +++ ++
Sbjct  367  PEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVAR  426

Query  511  RSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQSRRGKPRGPPCSKSLSKALDGCKDPLFLN  570
            R + FF  +  PR C   T              +G+ R P  SKSL+  L  C+D  F++
Sbjct  427  RRRLFFDSRDAPR-CITNT--------------KGRKRSPG-SKSLAHILH-CQDRYFID  469

Query  571  FIRGCLEWDADKRLTPSEALKHPWLR  596
            F++ CLEWD  +R+TP EA  H +L+
Sbjct  470  FLQRCLEWDPAERMTPDEAAHHEFLQ  495


>MNB_DROME unnamed protein product
Length=908

 Score = 292 bits (748),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 159/355 (45%), Positives = 214/355 (60%), Gaps = 27/355 (8%)

Query  260  NSDYDNEQGAYIHIPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRF  319
            N  YD++   YI    +    RYE+  +IGKGSFGQV+KAYDH+   HVA+KI++N+K F
Sbjct  142  NDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPF  201

Query  320  HRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKG  379
              QAQ E+++L  + R D  N   I+ +  +F +RNH C+ FELLS NLY+L++   F+G
Sbjct  202  LNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRG  261

Query  380  FSLQLVRKFAHSLLQCLDALYKND--IIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQ  437
             SL L RKFA  L   L  L   +  IIHCD+KPEN+LL    RS IK++DFGSSC   Q
Sbjct  262  VSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQ  321

Query  438  RIYTYIQSRFYRAPEVILGAKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEV  497
            RIY YIQSRFYR+PEV+LG +Y  AIDMWSLGCIL E+ +G  LF G NE DQ+  I+EV
Sbjct  322  RIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEV  381

Query  498  LGMPNKNILASSKRSKSFFSPKGYPRYCTVRTMSDGMVVLIGGQS-RRGKP---------  547
            LGMP K +L  + +++ FF           + ++DG  VL   Q+ R+ KP         
Sbjct  382  LGMPPKYLLDQAHKTRKFFD----------KIVADGSYVLKKNQNGRKYKPPGSRKLHDI  431

Query  548  ----RGPPCSKSLSKALDGCKDPL-FLNFIRGCLEWDADKRLTPSEALKHPWLRR  597
                 G P  + L +      D L F + I   L++D   R+TP  AL+H + +R
Sbjct  432  LGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR  486



Lambda      K        H
   0.311    0.126    0.345 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 816791470


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Sep 30, 2021  10:43 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017110490.2 uncharacterized protein LOC108134617 isoform X1
[Drosophila elegans]

Length=884
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C3KGP2_DROME  unnamed protein product                                 1145    0.0  
Q6WSQ9_DROME  unnamed protein product                                 939     0.0  
H9XVQ2_DROME  unnamed protein product                                 909     0.0  


>C3KGP2_DROME unnamed protein product
Length=837

 Score = 1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 628/857 (73%), Positives = 716/857 (84%), Gaps = 24/857 (3%)

Query  32   MFSYWSKKSIPSKVEEKRNETFVSINESISQTEIKMDKEKMALSTTDRHVLEFHDFLRRV  91
            MFSYW+K++I S V+ K+ +  VS     + T++KM+K++  +  T+   LEF DFL+RV
Sbjct  1    MFSYWTKQNISSSVDGKKMDK-VSTMRKKNSTKVKMEKKETVVPITEMRALEFQDFLKRV  59

Query  92   QTLQMSHIEANKNQDLIVNRPNMCSSTAVEVGEEPATSSEADNIDMEYPH---LTSECEY  148
            QTLQMSH   N+++DL VN PN+CSS  +EVGEEP T+S ADNID   P     +S+C+ 
Sbjct  60   QTLQMSH---NESRDL-VNGPNICSSMDIEVGEEPPTTSFADNIDKACPLPVLRSSDCDC  115

Query  149  MPVATTNIRVTVGIDKDLEMILEMDPSIVDLGDISIAETAEPRIVGLPPLSGGPTFKTAT  208
            +P+  TNIRV+VGIDKDLEMILEMDPSIVDLGDISI ETAEPRIVGLPPLSGGPTFKTAT
Sbjct  116  VPLCMTNIRVSVGIDKDLEMILEMDPSIVDLGDISIDETAEPRIVGLPPLSGGPTFKTAT  175

Query  209  PTSRTQLKLQLQREQHQQQQMMIQQQTLDSPDPKIHLLFGGGQGSTESEFIDSGSTSACG  268
            PTSRTQLKLQLQREQ QQ  +  Q     + DPK+HLLFG GQG  ESEFIDSGSTSACG
Sbjct  176  PTSRTQLKLQLQREQQQQMMIQQQTLDT-AMDPKMHLLFGSGQGLMESEFIDSGSTSACG  234

Query  269  SGSSSLEQMSQLVQMDNLIDSSTAAKLKVPLQSIGVDVPPQVLQVSTVLENPTRYHVIQK  328
            SGSSSLEQMSQLVQMDNLIDSS+ AKLKVPLQSIGVDVPPQVLQVSTVLENPTRYHVIQK
Sbjct  235  SGSSSLEQMSQLVQMDNLIDSSSGAKLKVPLQSIGVDVPPQVLQVSTVLENPTRYHVIQK  294

Query  329  QKNQVRQYLSESLKPSIWGCHNSDMKLANNSASTGNLQSSSLEKGVSLPLERTNSFGCDT  388
            QKNQVRQYLSES KPS+WG H S++KLANNSASTGNLQ+SSL+KG+  PLERTN FGCD+
Sbjct  295  QKNQVRQYLSESFKPSMWGSHTSEIKLANNSASTGNLQNSSLQKGICDPLERTNRFGCDS  354

Query  389  AVTAKRPNHSDDSMPISFFGGNFPRSDNLNSNDPSLLGRINHVSAESASAQKNIHLGFVK  448
            AV+AKR   SDD+MPIS FGG+F R D++N  +P++L   +H + E  +A +   LG  K
Sbjct  355  AVSAKRIMPSDDAMPISPFGGSFVRCDDINPIEPTVLRPNSHGAGEPENAHRTAQLGLSK  414

Query  449  TNSNLSSSTTRTSSGMINSIRLSSTASSSQSTSAPISPSLSSVATSASELPSFDSDPDDL  508
              +N S S+TR+SSG++NSIR+SST+SS QSTSAPISPS+SSVATS SE       PDD+
Sbjct  415  --ANSSLSSTRSSSGIVNSIRISSTSSSLQSTSAPISPSVSSVATSVSE-------PDDI  465

Query  509  FDDILQNDSFNFDTNFNSELSIKQEPQNLTDAEINALAKDRQKKDNHNMIERRRRFNIND  568
            FDDILQNDSFNFD NFNSELSIKQEPQNLTDAE+NALAKDRQKKDNHNMIERRRRFNIND
Sbjct  466  FDDILQNDSFNFDKNFNSELSIKQEPQNLTDAEMNALAKDRQKKDNHNMIERRRRFNIND  525

Query  569  RIKELGTLLPKGSDAFYEVVRDIRPNKGTILKSSVDYIKCLKHEVSRLRQNECRQRQMEL  628
            RIKELGTLLPKGSDAFYEVVRDIRPNKGTILKSSVDYIKCLKHEV+RLRQNE RQRQ+EL
Sbjct  526  RIKELGTLLPKGSDAFYEVVRDIRPNKGTILKSSVDYIKCLKHEVTRLRQNELRQRQVEL  585

Query  629  QNRKLMSRIRELEMQAKSHGISLSDYHLTSVSAPTQADAYLKSSSLSPSVSRSRRSLFDL  688
            QNRKLMSRI+ELEMQAKSHGI LS+ HLTS+SAPTQ   YLKS SLSP+ SRSRRSLFD 
Sbjct  586  QNRKLMSRIKELEMQAKSHGILLSENHLTSLSAPTQ--PYLKSFSLSPTASRSRRSLFDQ  643

Query  689  PVEKKIQVINSSDVNMGMNQIDELMEDCKHPVQGGDPMLSSHSHMHSAPQSPTANQLNCA  748
            PVEKKIQVI+ +D NMGMNQ+DE MEDCK+ VQGGDPMLSSHSHM SAPQSP++  LN  
Sbjct  644  PVEKKIQVIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTLNSG  703

Query  749  SYEPKKVSEVDAGIFRGKSNLVADECCSINCTTSCYSQHQLPTHESHQNHCHQPSIRDIH  808
            S+EPK  SE D  +FRGKS+L +D+CC INC+TSCY QHQL + E H NH H   IR+IH
Sbjct  704  SFEPKNFSEADESLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGHPNHSHHTGIREIH  763

Query  809  SLSDSVQSSEFSRLEHCDGNHDPLLSSS-RSLGTVDEDHHSSVDISTVMINDSLSSLVDD  867
            SLSDS Q+SEFSRLEHCD   DPLLSSS RSLGTVDED H+SVD+S VM++DSLSSLVDD
Sbjct  764  SLSDSAQNSEFSRLEHCD---DPLLSSSHRSLGTVD