BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062553.1 fork head protein homolog 2 isoform X3 [Drosophila
eugracilis]

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q18694_CAEEL  unnamed protein product                                 115     5e-28
PHA4_CAEEL  unnamed protein product                                   106     3e-24
Q10924_CAEEL  unnamed protein product                                 103     6e-24


>Q18694_CAEEL unnamed protein product
Length=333

 Score = 115 bits (287),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/98 (52%), Positives = 69/98 (70%), Gaps = 2/98 (2%)

Query  123  KPQHSYIGLIAMAILSSNEMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFI  182
            KP +SYI LIAM+IL+S E KL LS+I ++I++ + Y++ + P W+NSIRHNLSLNDCF+
Sbjct  127  KPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFV  186

Query  183  KSGRSAN--GKGHYWAIHPANMDDFRKGDFRRRKAQRK  218
            K  R     GKG+YWA+ P   D F  G F RR+ + K
Sbjct  187  KVARGPGNPGKGNYWALDPNCEDMFDNGSFLRRRKRYK  224


>PHA4_CAEEL unnamed protein product
Length=506

 Score = 106 bits (265),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 69/103 (67%), Gaps = 2/103 (2%)

Query  121  EPKPQHSYIGLIAMAILSSNEMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDC  180
            + KP +SYI LI MAI  SN  +L LS+IY +I+D +PY+++    W+NSIRH+LS NDC
Sbjct  234  QSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDC  293

Query  181  FIKSGRSAN--GKGHYWAIHPANMDDFRKGDFRRRKAQRKVRK  221
            F+K  RS +  GKG +W +H    + F  G + RR+ + KV++
Sbjct  294  FVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQKRFKVKE  336


>Q10924_CAEEL unnamed protein product
Length=323

 Score = 103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 9/113 (8%)

Query  123  KPQHSYIGLIAMAILSSNEMKLVLSDIYQYILDNYPYFR----SRGPGWRNSIRHNLSLN  178
            KP +SY+ LIAMAI +S + ++ L+ IY++I   +PY+R     R  GW+NSIRHNLSLN
Sbjct  21   KPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLN  80

Query  179  DCFIKSGRSA-----NGKGHYWAIHPANMDDFRKGDFRRRKAQRKVRKHMGLS  226
            DCF+K  R       + KG+YW +   N   F  G+F+RR+ +R     MG +
Sbjct  81   DCFVKKARDGQSCANDRKGNYWQMVADNAPQFDNGNFKRRRVKRLGIGKMGYA  133



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062554.2 SKI family transcriptional corepressor 1 homolog-B
isoform X1 [Drosophila eugracilis]

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D1YSG4_DROME  unnamed protein product                                 979     0.0  
Q00G34_DROME  unnamed protein product                                 100     1e-23
Q00G33_DROME  unnamed protein product                                 103     2e-22


>D1YSG4_DROME unnamed protein product
Length=770

 Score = 979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/763 (72%), Positives = 611/763 (80%), Gaps = 29/763 (4%)

Query  1    MTAVLVASVNGMENSQMAQRSNHVSSVSLYGVPIVSLFIEGQERLCLAQISNTLLKQFSY  60
            M ++ VA  + MEN Q +QRSNHVSSV LYGV IVSL IEGQERLCLAQISNTLLKQFSY
Sbjct  9    MASISVAHFDRMENCQTSQRSNHVSSVLLYGVQIVSLHIEGQERLCLAQISNTLLKQFSY  68

Query  61   NEIHNRRVALGITCVQCTPVQLEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPP  120
            NEIHNRRVALGITCVQCTPVQLEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPP
Sbjct  69   NEIHNRRVALGITCVQCTPVQLEILRRAGAMPVSSRRCGMITRREAERLCKSFLGDNTPP  128

Query  121  RLPDDFAFNVQHKCAWGCRGSFLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHSHRITTND  180
            RLPDDFAFNVQHKCAWGCRGSFLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHSHRITTND
Sbjct  129  RLPDDFAFNVQHKCAWGCRGSFLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHSHRITTND  188

Query  181  RYVQPDAANFNSWRRHMTLSGNPCDEKIIHEWEDVKAMFNGGTRKRIVSSTVSNRSLDSP  240
            RYVQPDAANFNSWRRHM+LSGN  DEKIIH WEDVKAMFNGGTRKR+V S+++ RS  SP
Sbjct  189  RYVQPDAANFNSWRRHMSLSGNDYDEKIIHAWEDVKAMFNGGTRKRLVGSSINPRSPGSP  248

Query  241  TPSVTTKTGVVNSSCSSPTNFDRDTKEGGGDSESQLPQR-QIDSQYNY-SSVAAAAVVGV  298
            T S    +GV +SSC SPT+F+RDT E  G S S LPQR QIDSQYNY +  AAAAVVGV
Sbjct  249  TQSTAVSSGVGSSSCGSPTSFERDTNEVDGKSGSSLPQRSQIDSQYNYGTVAAAAAVVGV  308

Query  299  TAVAAATVGVPFNLHGSAVLSPMQSLRSERDISLMPISRNFVVDYMWQQKDQHYQQQYCK  358
            TAVAAATVGVPFNLHGS VLSP+ SLR+ERD+S+MPISRNFVVDYMWQQKDQHYQQ Y +
Sbjct  309  TAVAAATVGVPFNLHGSTVLSPLHSLRNERDLSIMPISRNFVVDYMWQQKDQHYQQPYAR  368

Query  359  KFSTSEPSEPSLDLESCQRSWVRPDGNIPLPNENTVRLTDNSSFNIKNDSHSSI--IIKN  416
            K  + + S+ SLD +    SWV+PD N P+PN N+VR +DN SFNIKN+SHSSI  IIKN
Sbjct  369  KIPSGDNSDSSLDFD----SWVKPDSNNPIPNANSVRTSDNCSFNIKNESHSSIYGIIKN  424

Query  417  HNLSGVASSGISISDYNIPSILNCSAFKPVVASTAIVSTSLYTRSSDSKRTEYIHPKQTT  476
            H LSGV +SG+++SDYNIPSILNCSAFKPVVASTAIVSTSLYTRS++S RT+  +P Q+T
Sbjct  425  HKLSGVPNSGLNLSDYNIPSILNCSAFKPVVASTAIVSTSLYTRSNESTRTDCNNPAQST  484

Query  477  RTTTVLTHNSISGSSHHIIDHETFSPIIEKVQSNMEKKPSVS-------------DNDDE  523
            RTTTVLTHNSIS SSH I+ H+TFSPI+ K+ SN EK   VS             D+DDE
Sbjct  485  RTTTVLTHNSISASSHQIVGHKTFSPILGKIHSNPEKNRIVSVFASSSTGNADDNDDDDE  544

Query  524  LVDIETTEDEGKFISQQIHVSHTPADIVSESESTSLSPSTSTNIDVEGDVDVDVITTDAE  583
            +VDIETTEDEGKF  Q      T  D +S S+S S SPSTSTNIDVE DVDVD+ITTD E
Sbjct  545  VVDIETTEDEGKFTVQHADSPKTQYDAISGSDSPSRSPSTSTNIDVEQDVDVDIITTDTE  604

Query  584  DQTELNPNRCSIENTSHSLSIFQTEKIQISGSSLNSK-SILDKEVKLSENAKRFNGHLKI  642
            DQ EL+  R S ENTSHSLS FQ EKIQIS  S N+K S  D E    ++AK  NG+L+I
Sbjct  605  DQLELSVGRYSTENTSHSLSFFQAEKIQISDLSPNTKTSSGDNETNTLKDAKGINGNLQI  664

Query  643  IARRKTDKIQHDRSL-----SRLVNDKSLSNTSATKEISSSLQIQQRVAFPVFFKSHLHS  697
            +ARRK +K+Q DR L     S+ V+DKSL    A  E+SSSLQIQQ VAFPVF KS LHS
Sbjct  665  LARRKRNKLQKDRCLSKRTVSKCVSDKSLIKGLAANELSSSLQIQQHVAFPVFLKSQLHS  724

Query  698  FCPQSRQ--ANFNPNSVTESHKWSCPVGSIGSVCCYETSVNEN  738
              PQ  Q   +   NSV ES+KWS PVG+I  +CCY+TS N+N
Sbjct  725  LRPQQAQQVVSLTTNSVAESNKWSYPVGNIEPLCCYQTSGNKN  767


>Q00G34_DROME unnamed protein product
Length=210

 Score = 100 bits (248),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 55/144 (38%), Positives = 75/144 (52%), Gaps = 7/144 (5%)

Query  39   IEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEILRRAGAMPVSSRRC  98
            + G+ RLCL Q  N +L  FS  +I+     LGI C QCT  QL   + A  +P   +  
Sbjct  3    VGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAAKILPSDVKAS  62

Query  99   GMITRREAERLCKSFLG-DNTPPRLPDD------FAFNVQHKCAWGCRGSFLPSRYNSSR  151
            G+ITR +AERLC + L   +    +P +       +F+V HKC   C G   P  Y+  +
Sbjct  63   GLITRTDAERLCAALLHRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGICTPDMYSYQK  122

Query  152  AKCIKCSYCGMFFSPNKFIFHSHR  175
              CIKC  C  +FSP KF+ H HR
Sbjct  123  PTCIKCLECDGWFSPQKFVGHVHR  146


>Q00G33_DROME unnamed protein product
Length=958

 Score = 103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 79/158 (50%), Gaps = 7/158 (4%)

Query  29   LYGVPIVSLFIEGQERLCLAQISNTLLKQFSYNEIHNRRVALGITCVQCTPVQLEILRRA  88
            L G  I    + G+ RLCL Q  N +L  FS  +I+     LGI C QCT  QL   + A
Sbjct  121  LEGKTIGCFSVGGEMRLCLPQFLNNVLNDFSLEQINRIFDELGIYCSQCTHDQLVEFKAA  180

Query  89   GAMPVSSRRCGMITRREAERLCKSFLG-DNTPPRLPDD------FAFNVQHKCAWGCRGS  141
              +P   +  G+ITR +AERLC + L   +    +P +       +F+V HKC   C G 
Sbjct  181  KILPSDVKASGLITRTDAERLCAALLHRSDRNSYVPIESLAKGALSFHVYHKCFGKCEGI  240

Query  142  FLPSRYNSSRAKCIKCSYCGMFFSPNKFIFHSHRITTN  179
              P  Y+  +  CIKC  C  +FSP KF+ H HR   N
Sbjct  241  CTPDMYSYQKPTCIKCLECDGWFSPQKFVGHVHRKFEN  278



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062555.1 uncharacterized protein LOC108102306 isoform X2
[Drosophila eugracilis]

Length=233
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D1YSG4_DROME  unnamed protein product                                 205     2e-61
41_DROME  unnamed protein product                                     33.9    0.12 
HS7C2_DICDI  unnamed protein product                                  28.9    4.0  


>D1YSG4_DROME unnamed protein product
Length=770

 Score = 205 bits (521),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 151/220 (69%), Gaps = 8/220 (4%)

Query  17   IETTEDEGKFISQQIHVSHTPADIVSESESTSLSPSTSTNIDVEGDVDVDVITTDAEDQT  76
            IETTEDEGKF  Q      T  D +S S+S S SPSTSTNIDVE DVDVD+ITTD EDQ 
Sbjct  548  IETTEDEGKFTVQHADSPKTQYDAISGSDSPSRSPSTSTNIDVEQDVDVDIITTDTEDQL  607

Query  77   ELNPNRCSIENTSHSLSIFQTEKIQISGSSLNSK-SILDKEVKLSENAKRFNGHLKIIAR  135
            EL+  R S ENTSHSLS FQ EKIQIS  S N+K S  D E    ++AK  NG+L+I+AR
Sbjct  608  ELSVGRYSTENTSHSLSFFQAEKIQISDLSPNTKTSSGDNETNTLKDAKGINGNLQILAR  667

Query  136  RKTDKIQHDRSL-----SRLVNDKSLSNTSATKEISSSLQIQQRVAFPVFFKSHLHSFCP  190
            RK +K+Q DR L     S+ V+DKSL    A  E+SSSLQIQQ VAFPVF KS LHS  P
Sbjct  668  RKRNKLQKDRCLSKRTVSKCVSDKSLIKGLAANELSSSLQIQQHVAFPVFLKSQLHSLRP  727

Query  191  QSRQ--ANFNPNSVTESHKWSCPVGSIGSVCCYETSVNEN  228
            Q  Q   +   NSV ES+KWS PVG+I  +CCY+TS N+N
Sbjct  728  QQAQQVVSLTTNSVAESNKWSYPVGNIEPLCCYQTSGNKN  767


>41_DROME unnamed protein product
Length=1698

 Score = 33.9 bits (76),  Expect = 0.12, Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 44/92 (48%), Gaps = 5/92 (5%)

Query  28    SQQIHVSHTPADIVSESE---STSLSPSTSTNIDVEGDVDVDVITTDAEDQTELNPNRCS  84
             S QI V     D  ++ +   S+S+ P T   I + G +D    T + + QT+L+PN   
Sbjct  1126  SNQIWVPTGATDPATKEQQYISSSVDPKTGYVITIYGYLDPK--TNEIKKQTKLDPNTIK  1183

Query  85    IENTSHSLSIFQTEKIQISGSSLNSKSILDKE  116
             IE TS  +     E  Q +G  L + + +D E
Sbjct  1184  IEPTSGKIYTATGEVDQATGEPLYAATQVDPE  1215


>HS7C2_DICDI unnamed protein product
Length=632

 Score = 28.9 bits (63),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 11/125 (9%)

Query  50   SPSTSTNIDVEGDVDVD-VITTDAEDQTELNPNRCSIENTSHSLSIFQTEKIQISGSSLN  108
            +P     I+V  D+D + ++   AED++  N ++ +I N    L+  Q EK+        
Sbjct  466  APRGVPQIEVTFDIDANGILNVSAEDKSTGNKHKITITNDKGRLTAEQIEKMVKDAEMFK  525

Query  109  SKSILDKEVKLSENAKRFNGHLKIIARRKTDKI-----QHDRSLSRLVNDKSL----SNT  159
            ++    +EV  S+N K  N    + +  K DKI     + DR      +D+++    +N 
Sbjct  526  AQDEAQREVVESKN-KLENYAYTVRSTIKDDKIAAKLSKEDRKTVEEKSDEAINWLHAND  584

Query  160  SATKE  164
            SATKE
Sbjct  585  SATKE  589



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062556.1 uncharacterized protein LOC108102307 [Drosophila
eugracilis]

Length=169
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q6WSQ9_DROME  unnamed protein product                                 235     7e-74
H9XVQ2_DROME  unnamed protein product                                 234     8e-74
C3KGP2_DROME  unnamed protein product                                 234     8e-73


>Q6WSQ9_DROME unnamed protein product
Length=730

 Score = 235 bits (599),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 3/169 (2%)

Query  1    MEKK--VISISDVNMGMNQIDELMEDCKHPVQGGDPMLSSHSHMQSAPQSPSSKPMDYGS  58
            +EKK  VI  +D NMGMNQ+DE MEDCK+ VQGGDPMLSSHSHMQSAPQSPSSK ++ GS
Sbjct  538  VEKKIQVIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTLNSGS  597

Query  59   FEPQKISEADAVRLFRGKTNLLIDDLCSINCSTSCFIQNQLPKHQGRPSHCHPPRAKEIH  118
            FEP+  SEAD   LFRGK++L  DD C INCSTSC+IQ+QL   +G P+H H    +EIH
Sbjct  598  FEPKNFSEADE-SLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGHPNHSHHTGIREIH  656

Query  119  SLSDSATSSELSRLEQCEDPLLSSSHRSLGTVDEDHHSSIDMSAVMIND  167
            SLSDSA +SE SRLE C+DPLLSSSHRSLGTVDED H+S+DMSAVM++D
Sbjct  657  SLSDSAQNSEFSRLEHCDDPLLSSSHRSLGTVDEDQHNSVDMSAVMVHD  705


>H9XVQ2_DROME unnamed protein product
Length=704

 Score = 234 bits (597),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 3/169 (2%)

Query  1    MEKK--VISISDVNMGMNQIDELMEDCKHPVQGGDPMLSSHSHMQSAPQSPSSKPMDYGS  58
            +EKK  VI  +D NMGMNQ+DE MEDCK+ VQGGDPMLSSHSHMQSAPQSPSSK ++ GS
Sbjct  512  VEKKIQVIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTLNSGS  571

Query  59   FEPQKISEADAVRLFRGKTNLLIDDLCSINCSTSCFIQNQLPKHQGRPSHCHPPRAKEIH  118
            FEP+  SEAD   LFRGK++L  DD C INCSTSC+IQ+QL   +G P+H H    +EIH
Sbjct  572  FEPKNFSEADE-SLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGHPNHSHHTGIREIH  630

Query  119  SLSDSATSSELSRLEQCEDPLLSSSHRSLGTVDEDHHSSIDMSAVMIND  167
            SLSDSA +SE SRLE C+DPLLSSSHRSLGTVDED H+S+DMSAVM++D
Sbjct  631  SLSDSAQNSEFSRLEHCDDPLLSSSHRSLGTVDEDQHNSVDMSAVMVHD  679


>C3KGP2_DROME unnamed protein product
Length=837

 Score = 234 bits (596),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 138/169 (82%), Gaps = 3/169 (2%)

Query  1    MEKK--VISISDVNMGMNQIDELMEDCKHPVQGGDPMLSSHSHMQSAPQSPSSKPMDYGS  58
            +EKK  VI  +D NMGMNQ+DE MEDCK+ VQGGDPMLSSHSHMQSAPQSPSSK ++ GS
Sbjct  645  VEKKIQVIDGADGNMGMNQVDEFMEDCKYAVQGGDPMLSSHSHMQSAPQSPSSKTLNSGS  704

Query  59   FEPQKISEADAVRLFRGKTNLLIDDLCSINCSTSCFIQNQLPKHQGRPSHCHPPRAKEIH  118
            FEP+  SEAD   LFRGK++L  DD C INCSTSC+IQ+QL   +G P+H H    +EIH
Sbjct  705  FEPKNFSEADE-SLFRGKSSLASDDCCGINCSTSCYIQHQLTSREGHPNHSHHTGIREIH  763

Query  119  SLSDSATSSELSRLEQCEDPLLSSSHRSLGTVDEDHHSSIDMSAVMIND  167
            SLSDSA +SE SRLE C+DPLLSSSHRSLGTVDED H+S+DMSAVM++D
Sbjct  764  SLSDSAQNSEFSRLEHCDDPLLSSSHRSLGTVDEDQHNSVDMSAVMVHD  812



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062558.2 zinc finger protein 2 isoform X2 [Drosophila
eugracilis]

Length=2997
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ZFH2_DROME  unnamed protein product                                   4024    0.0  
G5EEA1_CAEEL  unnamed protein product                                 65.1    3e-10
AWH_DROME  unnamed protein product                                    62.8    8e-10


>ZFH2_DROME unnamed protein product
Length=3005

 Score = 4024 bits (10436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2238/3041 (74%), Positives = 2497/3041 (82%), Gaps = 80/3041 (3%)

Query  1     MSSSDVETFNGKIVYNLDGSAYIIAADNANGCGSGSAQ-CYAPTCASIGKLSKVKDRGQG  59
             MSS DVETFNGKIVYNLDGSA+IIA DN NG GSGS Q CY  T  S+  LSK K RGQ 
Sbjct  1     MSSFDVETFNGKIVYNLDGSAHIIATDNTNGGGSGSGQNCYGSTTNSLKNLSKDKGRGQE  60

Query  60    EKEKEQHHQHHQEQSEKEGREDSVGAGPGLEALSGAIYKSSPKVHSFRVVSAQDANSTCQ  119
             EK+ E   Q+H+EQS+ + +E++V   PG+E+L  A YKSSPK+HSFRVVSAQDANSTCQ
Sbjct  61    EKDIEHPSQYHREQSDNKRQEEAVDNRPGVESLGSACYKSSPKIHSFRVVSAQDANSTCQ  120

Query  120   DQIKAFKIQKPILMCFICKLSFGNVKSFSLHANIEHRLNLEELDQQLLNREYSSAIIQRN  179
             DQI+AFKIQKPILMCFICKLSFGNVKSFSLHAN EHRLNLEELDQQLLNREYSSAIIQRN
Sbjct  121   DQIRAFKIQKPILMCFICKLSFGNVKSFSLHANTEHRLNLEELDQQLLNREYSSAIIQRN  180

Query  180   MDEKPQISFLQPLDHNVTCAANDNTEQLQITPEVSGVAKSSSPQPGLGNEDDLELEKKQE  239
             MDEKPQISFLQPL +N   A  ++TE+LQ   E S     SSPQP   N  +LE E KQE
Sbjct  181   MDEKPQISFLQPLANNDASADTNDTEKLQTATEGSDATLPSSPQPVFRNVSELEPENKQE  240

Query  240   TEPVRTLEQDLEHEPETNQDTSRSKMAAPSAYLPSSSPKVAVKSTVKFCSLNSETAKTNN  299
             TE  R L QD E EPE++Q TS SKMAAPSAY+P SSPKVA K TVKF SLNS TAKTNN
Sbjct  241   TEQNRLLNQDREQEPESDQHTSSSKMAAPSAYIPLSSPKVAGKLTVKFGSLNSATAKTNN  300

Query  300   LSKVSSTSSPTSTYTSGEVSLPSTDNISINKLTNFNQGIEPPSSSSSEIEMKTGSMSTSP  359
             LSKVSSTSSP STY SGEV  PSTDNIS +K T+ NQ  EPPSSSSSE+EMK GSMSTSP
Sbjct  301   LSKVSSTSSPPSTYASGEVLSPSTDNISNHKSTHCNQETEPPSSSSSEVEMKIGSMSTSP  360

Query  360   QTNDSD-----FVQLQHVATGGIHPSQVTSFHASLAALAANDSNDNRVKLITEFIQQQLQ  414
             QTNDSD     F+Q+QH+ TGG +  QV+SFHASLAALAAN+SNDNRVKLITEF+QQQLQ
Sbjct  361   QTNDSDVPCSGFLQMQHMTTGGAYTPQVSSFHASLAALAANESNDNRVKLITEFLQQQLQ  420

Query  415   QHQQNSSIIPSQCPDHPDPNG-DCKTCELLDIHKRLKSPPSSHCHLSQSLPQLQVQSQPQ  473
             Q    SS+ PS CPDHPD NG DCKTCELLDI +R KSP SSH   SQSLPQLQ+QSQPQ
Sbjct  421   Q--HQSSLFPSPCPDHPDLNGVDCKTCELLDIQQRSKSPSSSHHQFSQSLPQLQIQSQPQ  478

Query  474   QIPHRSPCNNSVGLAISPSASSVTSVGNASSATSSFTIGACSEHINGRPQGVDCARCEML  533
             Q PHRSPC+NSV L +SPSASSV SVGNAS+ATSSFTIGACSEHINGRPQGVDCARCEML
Sbjct  479   QTPHRSPCSNSVALPVSPSASSVASVGNASTATSSFTIGACSEHINGRPQGVDCARCEML  538

Query  534   LSSARLNSGVQMSTRNSCKTLKCPQCNWHYKYQETLEIHMREKHPDGESACGYCLAGQQH  593
             L+SARLNSGVQMSTRNSCKTLKCPQCNWHYKYQETLEIHMREKHPDGESACGYCLAGQQH
Sbjct  539   LNSARLNSGVQMSTRNSCKTLKCPQCNWHYKYQETLEIHMREKHPDGESACGYCLAGQQH  598

Query  594   PRLARGESYSCGYKPYRCEICNYSTTTKGNLSIHMQSDKHLNNMQELNSSQNMVAAAAAA  653
             PRLARGESYSCGYKPYRCEICNYSTTTKGNLSIHMQSDKHLNNMQELNSSQNMVAAAAAA
Sbjct  599   PRLARGESYSCGYKPYRCEICNYSTTTKGNLSIHMQSDKHLNNMQELNSSQNMVAAAAAA  658

Query  654   AATSKLLISSSSSQTGAGSNTTGSGATGGAGCGSVQNIGSNSTQGGNVATAATGACNSNA  713
             A T KLL+SSSS Q  A   +      G     S   +G  ++  GN   + TGA +SNA
Sbjct  659   AVTGKLLLSSSSPQVTAACPSNSGSGAGSG---SSNIVGGTASLSGNATPSVTGANSSNA  715

Query  714   NAGSSANSGSAKQKPLFRCDICSYETSVARNLRIHMTSEKHTHNIAVLQNNIKHIQAFNF  773
             NAGS+ N+   K KP FRCDICSY+TSVARNLRIHMTSEKHTHN+AVLQNNIKHIQAFNF
Sbjct  716   NAGSNTNNAGTKPKPSFRCDICSYDTSVARNLRIHMTSEKHTHNMAVLQNNIKHIQAFNF  775

Query  774   LQQQQQGVTGNVSSHCSGSFIPEVALADLAYNQALMIQLLHQQQQHQQSANTKLSPLNSP  833
             LQQQQQ  TGN++SH SGSF+PEVALADLAYNQALMIQLLHQQQQHQQSANTKLSP +SP
Sbjct  776   LQQQQQSGTGNIASHSSGSFMPEVALADLAYNQALMIQLLHQQQQHQQSANTKLSPSSSP  835

Query  834   VGTPDQFSFSPKPVKISHGSAVGMGLGMSIGM--TNSNEVPGELSGDPHPLTKPDKWPKA  891
             V TPDQFSFSPKP+K++HG+   MG+GM++GM  ++SNEV  ELSGDPHPLTK DKWP A
Sbjct  836   VSTPDQFSFSPKPIKLNHGTGAAMGIGMAMGMGMSHSNEVSCELSGDPHPLTKTDKWPMA  895

Query  892   FYSCLICDSFSTNNLDDLNQHLVIDRSRQSSSASSEIMVIHNNNYICRLCNYKTNLKANF  951
             FYSCL+CD +STNNLDDLNQHL++DRSRQSSSASSEIMVIHNNNYICRLCNYKTNLKANF
Sbjct  896   FYSCLVCDCYSTNNLDDLNQHLLLDRSRQSSSASSEIMVIHNNNYICRLCNYKTNLKANF  955

Query  952   QLHSKTDKHLQKLNFINHIREGGPRNEYKMQYQQQ-LAANIVQLKCNCCDFHTNSIQKLS  1010
             QLHSKTDKHLQKLNFINHIREGGP+NEYKMQYQQQ LAAN+VQLKCNCCDFHTNSIQKLS
Sbjct  956   QLHSKTDKHLQKLNFINHIREGGPQNEYKMQYQQQQLAANVVQLKCNCCDFHTNSIQKLS  1015

Query  1011  LHTQQMRHDTMRMIFQHLQYIIQQSQMHKKSPCTVEVDPQCSFPGEDQQVQSNSPTKMLL  1070
             LHTQQMRHDTMRMIFQHL YI+QQS+MH KS  + E DPQC+ P EDQQ+Q  S  K+LL
Sbjct  1016  LHTQQMRHDTMRMIFQHLLYIVQQSEMHNKSSGSAEDDPQCACPDEDQQLQLQSSKKLLL  1075

Query  1071  CQICNFTASNLHEMIQHVKSIRHMQVEQFICLQRRSENQEIPALKEVFKVTEWIANTEDI  1130
             CQ+CNFTA N+HEM+QHVK IRH+QVEQFICLQRRSENQEIPAL EVFKVTEW+   ED+
Sbjct  1076  CQLCNFTAQNIHEMVQHVKGIRHLQVEQFICLQRRSENQEIPALNEVFKVTEWVMENEDV  1135

Query  1131  TVEAGFNLTRTLSKDAFSDTSNSVPSSATVVPAILNASIISPTSSLNFAT----------  1180
             ++  G NL RT + DA +D S +  +S+  VPAI + S+ SPTS  + AT          
Sbjct  1136  SLAPGLNLARTTTNDATTDASYAA-ASSAAVPAIPDVSMFSPTSPSSCATSCDKNLSQIV  1194

Query  1181  -PGEKTEESTLSTTVFKCKLCEYFVQSKSDIASHIETEHPNADSDDFISIPTNTAALQAF  1239
              P      S + TTVFKC LCEYFVQSKS+IA+HIETEH  A+SD+FI+IPTNTAALQAF
Sbjct  1195  LPNVNNLGSGVPTTVFKCNLCEYFVQSKSEIAAHIETEHSCAESDEFITIPTNTAALQAF  1254

Query  1240  QTAVAAAALAAVQQRCGTINAPTQDTVDAGND--TNIRDGPLAIKKERLDEDDSMAVTED  1297
             QTAVAAAALAAV QRC  IN PTQDTVD   D  TN+ DGP+ IK+ERL+++     + D
Sbjct  1255  QTAVAAAALAAVHQRCAVINPPTQDTVDEDKDLDTNVSDGPVGIKQERLEQEVDRTTSMD  1314

Query  1298  I-KEVTSQILASVAPESPKDQESPVGVQCPLCLENHFREKQYLENHLASVHSVTRDGLSR  1356
             + K++ SQ     APESPK  E+ VGVQCPLCLENHFREKQYLE+HL SVHSVTRDGLSR
Sbjct  1315  VTKDLASQATDFGAPESPKVAETEVGVQCPLCLENHFREKQYLEDHLTSVHSVTRDGLSR  1374

Query  1357  LLLLVDQKAWKKESETTNIP-DIKPQTLYPTTSTDEGKPLSNEGSSSANTIKVSTASSTS  1415
             LLLLVDQKA KKES     P D  P   Y  T+  E  P   E + + + IK ST+++ S
Sbjct  1375  LLLLVDQKALKKESTDIACPTDKAP---YANTNALERAPTPIENTCNVSLIK-STSANPS  1430

Query  1416  LPVGMQGLGLSCQQCEASFKHEEQLLQHAQQNKHFSLQNGEYLCLATSHISRPCYMTFKT  1475
               V +QGL  SCQQCEASFKHEEQLL+HAQQN+HFSLQNGEYLCLA SHISRPC+MTF+T
Sbjct  1431  QSVSLQGL--SCQQCEASFKHEEQLLKHAQQNQHFSLQNGEYLCLAASHISRPCFMTFRT  1488

Query  1476  ISAMITHFQESHMSLVISERHVYKYRCKQCSLAFKTQDKLTTHMLYHTMRDATKCALCQR  1535
             I  MI+HFQ+ HMSL+ISERHVYKYRCKQCSLAFKTQ+KLTTHMLYH+MRDATKC+ CQR
Sbjct  1489  IPTMISHFQDLHMSLIISERHVYKYRCKQCSLAFKTQEKLTTHMLYHSMRDATKCSFCQR  1548

Query  1536  NFRSTQALQKHMELAHSEDGVPLDRQNSPQLPTLIAEDTHNLSLAETN--EKEVTGND--  1591
             NFRSTQALQKHME AH+EDG P  R NSPQ P L  E+TH   LAE++  E+EV+G+D  
Sbjct  1549  NFRSTQALQKHMEQAHAEDGTPSTRTNSPQTPMLSTEETHKHLLAESHAVEREVSGSDVS  1608

Query  1592  ---FESELSKETRHLSSSPMSLDSQSQQQYLATFAALLKQQQQCNSDAVGKHPEDFSLSA  1648
                 E+ L+KETRHLS +PMSLDSQS Q++LATFAALLKQQQ CNSDA G HPE  S+S 
Sbjct  1609  PIELETHLNKETRHLSPTPMSLDSQSHQKHLATFAALLKQQQ-CNSDAGGLHPEALSMST  1667

Query  1649  GEFSQHLQGLQNLQHFQHMQQQFGAVAAASGLPINPVDMLNLMQFHHLMSLNFMNLAPPL  1708
             GE    LQGLQNLQH   +QQ FGAVAAA+GLPINPVDMLN+MQFHHLMSLNFMNLAPPL
Sbjct  1668  GEMPPQLQGLQNLQH---IQQHFGAVAAAAGLPINPVDMLNIMQFHHLMSLNFMNLAPPL  1724

Query  1709  VFGANAAGSSAIPASSMQNNIITSSSTVASAPGLSDVQIGSGINALPGDSAKATIVSAQS  1768
             VFGANAAG++    S++ N+I TS++T  SA GL D  + SG++++P DS KAT V  Q+
Sbjct  1725  VFGANAAGNAVSGPSALNNSITTSTAT--SASGLGDTHLTSGVSSIPVDSGKATAVPPQT  1782

Query  1769  QHNANSNSQ-LASNQKRARTRITDDQLKILRAHFDINNSPSEESIMEMSQKSNLPMKVVK  1827
             Q NAN+NSQ LASNQKRARTRITDDQLKILRAHFDINNSPSEESIMEMSQK+NLPMKVVK
Sbjct  1783  QLNANANSQQLASNQKRARTRITDDQLKILRAHFDINNSPSEESIMEMSQKANLPMKVVK  1842

Query  1828  HWFRNTLFKERQRNKDSPYNFNNPPSTTLNLEEYERTGQAKVTPLNDTSSAAIANSISTS  1887
             HWFRNTLFKERQRNKDSPYNFNNPPSTTLNLEEYERTGQAKVTPLNDT S A+   +++S
Sbjct  1843  HWFRNTLFKERQRNKDSPYNFNNPPSTTLNLEEYERTGQAKVTPLNDTCSVAVTGPMTSS  1902

Query  1888  TMSSAPSANLNLTSKESITSKIPASGKAIATAPVSYPATVPSSTPVSRPESTNSSGNTSD  1947
             T+S  PS N+NL+SKE+ TSK+ A+GKA A+ PV++ ATVP STP+SRPESTNSSGN SD
Sbjct  1903  TISLPPSGNINLSSKENATSKVLAAGKANASGPVTFSATVPVSTPLSRPESTNSSGNISD  1962

Query  1948  YLSNNLFFGQTGGKEQGLPYAVEGQIKSEPQDDMTGATDFVFQAKQLSNFNFLKHQQELM  2007
             Y+ NN+FFGQ G KEQ LPY+++GQIKSEPQDDM GATDF +Q KQ S+F+FLK QQ+L+
Sbjct  1963  YIGNNIFFGQLGSKEQILPYSLDGQIKSEPQDDMIGATDFAYQTKQHSSFSFLKQQQDLV  2022

Query  2008  DHQEQSITNQESEMSQDQSLLASSSLSVHCQNQQQNNVFETKSESGSSDVMSRPPTPNSG  2067
             D  EQ +TNQ ++ +QDQSLLA SSL+ +CQ+QQQ N+FETKSESGSSDV+SRPP+PNSG
Sbjct  2023  DPPEQCLTNQNADTAQDQSLLAGSSLASNCQSQQQINIFETKSESGSSDVLSRPPSPNSG  2082

Query  2068  TAGNIYGTMNDLINQQLENIGNNMGPPKKLQIVAKPFDKNSTPTSSSIGSNTQFE-CNSS  2126
              AGN+YG+MNDL+NQQLEN+G+NMGPPKK+QIV K F+KN  P  +S   +TQFE  +S+
Sbjct  2083  AAGNVYGSMNDLLNQQLENMGSNMGPPKKMQIVGKTFEKNVAPMVTSGSVSTQFESNSSN  2142

Query  2127  NSSSSSSTSGGKRANRTRFTDYQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVWF  2186
             +SSSSSSTSGGKRANRTRFTDYQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVWF
Sbjct  2143  SSSSSSSTSGGKRANRTRFTDYQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVWF  2202

Query  2187  QNARQKQRKIYENQPNNSLFENEETKKQNINYACKKCSLVFQRYYELIRHQKNHCFKEEN  2246
             QNARQKQRKIYENQPNN+LFENEETKKQNINYACKKC+LVFQRYYELIRHQKNHCFKEEN
Sbjct  2203  QNARQKQRKIYENQPNNTLFENEETKKQNINYACKKCNLVFQRYYELIRHQKNHCFKEEN  2262

Query  2247  NKKSAKAQIAAAQIAHNLSSEDSNSSMDIHNVSSGMPGITVVSQSVSTTGSAA---GQYA  2303
             NKKSAKAQIAAAQIA NLSSEDSNSSMDIH+V    PG  V S ++ST GSAA   GQY 
Sbjct  2263  NKKSAKAQIAAAQIAQNLSSEDSNSSMDIHHVGICPPGSAVASHTLSTPGSAAPLPGQYT  2322

Query  2304  QQTFGASPSPQHSFAKSSSLTDFSPSTTPTPPQRERSNSLDHPQRPSKLDCDKCELQFSQ  2363
             Q +FGA PSPQH FAKSSSLTDFSPSTTPTPPQRERSNSLD  QRP K DCDKCEL F+Q
Sbjct  2323  QHSFGALPSPQHLFAKSSSLTDFSPSTTPTPPQRERSNSLDQIQRPPKFDCDKCELNFNQ  2382

Query  2364  LEKLREHQLVHLMSPANIFSDASLNPNPDDSFGPFGSILQSL-----QQAAAQHQQPPKK  2418
             LEKLREHQL+HLM+P NI SD   N NP+ +FGPFGSILQSL     QQ    HQQPP K
Sbjct  2383  LEKLREHQLLHLMNPGNICSDVGQNSNPEANFGPFGSILQSLQQAAAQQQQQHHQQPPTK  2442

Query  2419  KRKYSDTSSNADDSSTLLEPEASHKKQEFLYKYFMLNETNPEIKKQFIMQKQHKKAMQIQ  2478
             KRKYSD SSNAD+  +L E EAS KK E+LYKYFM NET+ E+K+QF+MQ+Q KK     
Sbjct  2443  KRKYSDCSSNADEMQSLSELEASQKKHEYLYKYFMQNETSQEVKQQFLMQQQQKKL----  2498

Query  2479  QQDEGNESDIGLEFLTNFYQQNELKKVSNYDFLLQYYRTQEEAVLNKKPKQQHLFSSSKK  2538
               ++GNE D  L+FLTNFYQQNELKKVSNYDFLLQYYRT EEA    K  QQH FSSSKK
Sbjct  2499  --EQGNECDFELDFLTNFYQQNELKKVSNYDFLLQYYRTHEEA----KSSQQHTFSSSKK  2552

Query  2539  PTIEFLLQYYQLNESKKFFQLVASPQIIPDGSDYKPLSQTPISTMNEHELNNVIGEPSLE  2598
             PTIEFLLQYYQLNESKKFFQLVASPQIIPD   YKP  + P ST +E      IGE SLE
Sbjct  2553  PTIEFLLQYYQLNESKKFFQLVASPQIIPDVPGYKPSLRIPKSTSDEAP---YIGETSLE  2609

Query  2599  QATEFKKDEHEYQFCKDILCEGNLL--YENKNEIQKLNNNNINNSNLVQTTEVNGNQLIE  2656
             QATE ++++ + Q   D   E N L   +NK E    NN N++ SNL +T    G   +E
Sbjct  2610  QATELQREKQDEQLRIDRPSEENDLSMNKNKVENINNNNINVDQSNLTETN--GGVPSVE  2667

Query  2657  MTETLSVDPTLIAIKDKNTHLRRSSLETDDTGPKSQYLHNLEDFLDATMIENNSQTLTFN  2716
               E  + + +LIA+ D+N +L   S + DD   KS YLHNLEDFLDATMIENNSQTLTFN
Sbjct  2668  TKEECTQESSLIAMDDENKYLCTRSKQKDDK-EKSHYLHNLEDFLDATMIENNSQTLTFN  2726

Query  2717  DDEKAVQTDNSTHKPNDIEKRSSVSPVNVSSKQNKRLRTTILPEQLNFLYECYQSESNPS  2776
             DDEKA Q D  T   N IEKRSSVSPVNVSSKQNKRLRTTILPEQLNFLYECYQSESNPS
Sbjct  2727  DDEKACQKDELTQNSNAIEKRSSVSPVNVSSKQNKRLRTTILPEQLNFLYECYQSESNPS  2786

Query  2777  RKMLEEISKKVNLKKRVVQVWFQNSRAKDKKSRNQRHYAHISDDNSYDGSSGKEVVNDQK  2836
             RKMLEEISKKVNLKKRVVQVWFQNSRAKDKKSRNQRHYAHISDDNSYDGSSGKEV +D +
Sbjct  2787  RKMLEEISKKVNLKKRVVQVWFQNSRAKDKKSRNQRHYAHISDDNSYDGSSGKEVYSDLR  2846

Query  2837  GNDEPVEPDLEISLQDCQLCQVTQVNIQKHAFSVEHICKMKKLLEQTTELYAQSNGSGSD  2896
              N   V+ DLE +LQDCQLCQVTQVNI+KHAFSVEHI KMKKLLEQTTELYAQSNGSGS+
Sbjct  2847  SNGITVDTDLETNLQDCQLCQVTQVNIRKHAFSVEHISKMKKLLEQTTELYAQSNGSGSE  2906

Query  2897  DNDSDREKRFYNLSKAFLFQHVVSNATRNANLTPGSGKDLNASPEENSLLNYDTTSGDSK  2956
             DNDSDREKRFYNLSKAFL QHVV+NAT +A  T     D+ A  E N +LNYDT  GDSK
Sbjct  2907  DNDSDREKRFYNLSKAFLLQHVVTNATSHAIHTARQDSDVIA--EGNCILNYDTNGGDSK  2964

Query  2957  SHIQHNSPTEVVSEGVRKVSSNQELIQQLFNRNHITVIGGK  2997
             SH+QHN P EVVSE  RK++ NQEL+QQLFNRNHITVIGGK
Sbjct  2965  SHVQHNLPNEVVSEDARKIAGNQELMQQLFNRNHITVIGGK  3005


>G5EEA1_CAEEL unnamed protein product
Length=355

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 0/90 (0%)

Query  2718  DEKAVQTDNSTHKPNDIEKRSSVSPVNVSSKQNKRLRTTILPEQLNFLYECYQSESNPSR  2777
             +E A+Q  N   K + +E     S V+    + KR+RTT   +QL+ L   +  +SNP  
Sbjct  207   EEYALQEGNLLCKQHFLELVEGDSGVSSQKAKTKRVRTTFAEDQLSVLQTYFNRDSNPDG  266

Query  2778  KMLEEISKKVNLKKRVVQVWFQNSRAKDKK  2807
               LE+I+    L KRV QVWFQNSRA+ KK
Sbjct  267   ADLEKIASMTGLSKRVTQVWFQNSRARQKK  296


 Score = 58.2 bits (139),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 45/72 (63%), Gaps = 1/72 (1%)

Query  2127  NSSSSSSTSGGKRANRTRFTDYQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVWF  2186
             +S  SS  +  KR  RT F + Q+ VLQ +F  +S P  +DLE ++ +  LS RV  VWF
Sbjct  229   DSGVSSQKAKTKRV-RTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWF  287

Query  2187  QNARQKQRKIYE  2198
             QN+R +Q+K ++
Sbjct  288   QNSRARQKKWHQ  299


 Score = 42.0 bits (97),  Expect = 0.006, Method: Compositional matrix adjust.
 Identities = 16/62 (26%), Positives = 39/62 (63%), Gaps = 0/62 (0%)

Query  1783  KRARTRITDDQLKILRAHFDINNSPSEESIMEMSQKSNLPMKVVKHWFRNTLFKERQRNK  1842
             KR RT   +DQL +L+ +F+ +++P    + +++  + L  +V + WF+N+  ++++ ++
Sbjct  240   KRVRTTFAEDQLSVLQTYFNRDSNPDGADLEKIASMTGLSKRVTQVWFQNSRARQKKWHQ  299

Query  1843  DS  1844
              S
Sbjct  300   KS  301


>AWH_DROME unnamed protein product
Length=275

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 0/59 (0%)

Query  2749  QNKRLRTTILPEQLNFLYECYQSESNPSRKMLEEISKKVNLKKRVVQVWFQNSRAKDKK  2807
             + KR+RTT   EQL  L   +Q +SNP  + LE I+    L KRV QVWFQNSRA+ KK
Sbjct  147   KTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK  205


 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 37/54 (69%), Gaps = 0/54 (0%)

Query  2142  RTRFTDYQIKVLQEFFENNSYPKDSDLEYLSKLLLLSPRVIVVWFQNARQKQRK  2195
             RT FT+ Q++VLQ  F+ +S P   DLE ++ +  LS RV  VWFQN+R +Q+K
Sbjct  152   RTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK  205


 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 40/60 (67%), Gaps = 0/60 (0%)

Query  1780  SNQKRARTRITDDQLKILRAHFDINNSPSEESIMEMSQKSNLPMKVVKHWFRNTLFKERQ  1839
             S  KR RT  T++QL++L+A+F I+++P  + +  ++  + L  +V + WF+N+  ++++
Sbjct  146   SKTKRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKK  205



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062559.2 uncharacterized protein LOC108102309 isoform X1
[Drosophila eugracilis]

Length=1697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D8_DROME  unnamed protein product                                 1975    0.0  
Q9XYZ3_DROME  unnamed protein product                                 1358    0.0  


>Q9V4D8_DROME unnamed protein product
Length=1738

 Score = 1975 bits (5116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1142/1757 (65%), Positives = 1330/1757 (76%), Gaps = 79/1757 (4%)

Query  1     MQVESENIPLISSSFTHAPFVSSLVVGI-------------FSINIFRTLNFALTDQVIL  47
             MQ ES + PL+SSSF++ P V+ LV+ I             ++I +  +LN AL++Q I+
Sbjct  1     MQEESGSTPLLSSSFSYTPTVAPLVLKIALIQAARSFAASKYTIKVLLSLNLALSEQAIV  60

Query  48    KKTRKLVISVMSSKVDVILSP-DGSVPILMPSSHYPTHSESGNNESEKYDSGLPCNNKCQ  106
             +K  K + +VM+S+VD    P DG+VP LM  + Y T+ E GNNES KY SGLP N K Q
Sbjct  61    QKAVKPICTVMASEVDASSGPEDGTVPTLMSLTPYITNLEHGNNESGKYVSGLPNNRKRQ  120

Query  107   KLSVLSLNCSQRNKVNNPIDETDLAPNARMSENKRDDFTKMEKQLPSNSNSFIERTLCVD  166
             KLS+L  N  Q N V+N   E ++ P ++MS+ K + +++MEK L  NS   IE T+ + 
Sbjct  121   KLSILEHNTIQNNDVDNTEVEPNMDPKSKMSDTKSNKYSEMEKHLNDNSKIVIEGTISIG  180

Query  167   HSEKKNTTKLESFDNDCYMPPEQALVTNVELVVSASQASSSSILVGQGQDQ--SSIGEKS  224
             +S++K+  KL  +DNDCYMPPEQALVT+VELVV A Q  SS+    Q ++   S++GE S
Sbjct  181   NSKRKSPEKLVPYDNDCYMPPEQALVTSVELVVPAPQTHSSNTPGRQSEEPNLSTLGESS  240

Query  225   TASSSTTDNKLKLSTPGLCNSSSCTSVLAND---GCANNSSNLNLRIPTKLAVTAATGDI  281
             T  SST DNKL+ ST GL NS+S TS+LAND   GCAN+SSNLNLRIPTKL VT A+GDI
Sbjct  241   TTPSSTIDNKLQYSTAGLYNSTSSTSILANDKIVGCANDSSNLNLRIPTKLVVTTASGDI  300

Query  282   LLDDRSTSLWTPHHDQTEERHQHIELATSENKQDPVNVSSELSYQHQHRQSELLLQIEKE  341
             L+DDR  SLWTPHHD++ +R Q    A+S+ KQ+P+NVSSELSY HQ+R SELLLQIEKE
Sbjct  301   LIDDRRASLWTPHHDESGQRQQRTGTASSDTKQEPMNVSSELSYHHQNRHSELLLQIEKE  360

Query  342   SSDTGSFPQAISIPLHHDHNNSPQEQYGQTEPTSIMDSQLHNNFYTQMMQQQHLHQNSDL  401
             SS  GSF QA  IPL  +HNN+   Q+GQTE TS +DSQ HNNFY QMMQ QHL  N   
Sbjct  361   SS--GSFLQASPIPLQDNHNNAASGQFGQTEETSNIDSQSHNNFYAQMMQPQHLLHNQHQ  418

Query  402   QNIHEHSPRHQQLMNYTSYIPHYQNSALFGTHQSD----LQRQQQSLQHPMECHGHLHQL  457
             Q++HEHSPRHQQ  +Y+ YI HYQN  +FG HQS+    L +QQQ LQH ++CHGHL Q 
Sbjct  419   QSMHEHSPRHQQPASYSGYITHYQNPPMFGAHQSEHHQRLNQQQQPLQHLLDCHGHLEQS  478

Query  458   AHITQEHQHHLQHEQQQIHQRQHQPTQQQQQLHETYHDLIMDEYHEEPSPAFKLALSPSN  517
               I+Q++QHHL  +  Q   +Q   T Q+  L E YHD+IMD++HEEPS AFKL LSPSN
Sbjct  479   TPISQQNQHHLSQQIHQHQHQQ---THQRLPLRENYHDIIMDDFHEEPSHAFKLTLSPSN  535

Query  518   TKPENQDDGYETSAGDVLTPNSHSSSTHSVTPQHQMQHPNMV-MPQNQKKPDDLLLTK--  574
             TKPENQDDGYETSAGDVLTPNSHSSSTHS+TPQHQMQH N+V M QNQKK DDL LTK  
Sbjct  536   TKPENQDDGYETSAGDVLTPNSHSSSTHSITPQHQMQHSNIVLMTQNQKKSDDLQLTKVT  595

Query  575   -------NSTACASNGNQGPSL--QTHIDMSVGTRCSSHASVVDGYSYINEEIRMHSPTH  625
                    +  AC+SN +QG  L  Q+H+++S GTRCSSHASVVD YS++ EE+ MHSP+H
Sbjct  596   LSGEAHTDPNACSSNSSQGQVLASQSHLELSEGTRCSSHASVVDPYSFMGEELHMHSPSH  655

Query  626   QVMETVNPEAVRYATASVAMAVPNGNPEVVSEDIYQHTHQITSIQEQTDNSHRGLNSKPT  685
             + ++ V     RY      + V N  PE +S ++Y+H+ Q T++ EQTD+S  G+N KP 
Sbjct  656   RHLDAVTTGPGRYG-----ILVSNDTPECLSREMYRHSQQSTTVLEQTDSSSCGINFKPM  710

Query  686   PKKRGRKKKVVSDSTDAKQMSTSAIHQDISGGTLVGEDGSDLNQAIKPKERKKHDRFNGM  745
             PKKRGRKKK+V+ + D  QM+T    Q +S G    EDG   +QA KPKERKKHDRFNGM
Sbjct  711   PKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGG-DQAAKPKERKKHDRFNGM  769

Query  746   SEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAFKGHHYAGPGNHFWKCLYLAGLTVEQMS  805
             SEEEVIKRTIPDHLCDNLDIVIVGINPGLFAA+KGHHYAGPGNHFWKCLYLAGLT EQMS
Sbjct  770   SEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKCLYLAGLTQEQMS  829

Query  806   ADEDYKLLKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKIAVFNGKLIF  865
             ADED+KL+KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPK+AVFNGKLIF
Sbjct  830   ADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFRPKVAVFNGKLIF  889

Query  866   EVFSGKKEFHFGRQPDRVEGTDTYIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNG  925
             EVFSGKKEFHFGRQPDRV+GTDT+IWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNG
Sbjct  890   EVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFYAALKKFRDFLNG  949

Query  926   DITHIAESECVFTDQRIRQSSEQQHAETSGKEKQNDKNSLTDHQAGLALVEHCSGSSARA  985
              I HI ESECVFTDQRIR  S QQ  +  GK  +  +  L DH + L +V +CSG  A  
Sbjct  950   QIPHIDESECVFTDQRIRLCSAQQQVDIVGKINKTHQPPLGDHPSSLTVVSNCSGPIAGD  1009

Query  986   VECGNALEESEQVKSDKLLPSMVSNVSSCNNR---GSFSYSGDERSLLPVSNNNLPPSES  1042
              ECG   EES+QV+S+K++P M   V S +N     SFSY+ +   LLPVSN+N   +E+
Sbjct  1010  AECGIVAEESDQVQSEKMIPQMDPTVPSSSNATDGKSFSYTAENTPLLPVSNHNPSINEN  1069

Query  1043  TYLSVFGSQLSQTQHPLEKKKRGRPKKIKGQEIIDHNVAGK--MGAQHMPHHDFNNILNL  1100
              YLSV GSQ   +Q PLEKKKRGRPKKIKGQ+IIDH+V GK  +  QH+P HDFNNILNL
Sbjct  1070  NYLSVMGSQQPLSQQPLEKKKRGRPKKIKGQDIIDHSVGGKASIAGQHIPSHDFNNILNL  1129

Query  1101  SVVPSGGNIETPKKKRGRPKKLKPAIDNVMTVKQLQHGNANPNTAAGLLVSSMHPLSMEQ  1160
             SV+  GG IETPKKKRGRPKKLKPAIDN+MTVKQLQHGN N NT AGL  SSMHP+SME 
Sbjct  1130  SVMSGGGTIETPKKKRGRPKKLKPAIDNIMTVKQLQHGNNNLNTTAGLSASSMHPISMEH  1189

Query  1161  IAASPQSSHQMPPSLYNTPPPSHLLYTASASPMASPALNCNYTQLHGHGTPPVGQANSVA  1220
             IAASPQSSHQMPPSLYNTPPPSHLLYTASASPMASPALNCNYTQ+HGHGTPPVGQ  SVA
Sbjct  1190  IAASPQSSHQMPPSLYNTPPPSHLLYTASASPMASPALNCNYTQVHGHGTPPVGQVASVA  1249

Query  1221  QGTTPIIDPQNEQLVSQKQNQHGNLKTALDMRDEPHLGETPPPSSPNICTAVDFDPPND-  1279
             QG++P+ID QN+ L  QKQ+ HGNL   LDMRD PHLGETPPPSSPN+C+ VDFDPP++ 
Sbjct  1250  QGSSPVIDTQNDHLAQQKQSHHGNLGAGLDMRDHPHLGETPPPSSPNMCSTVDFDPPDEH  1309

Query  1280  -DSQVVSADHNKAVELGQRQPLIAQKNQYDSPVHDTEANAGQSHEQYQHWLSPHPHQSHQ  1338
               SQV S   NKAVEL  + P I +K QYDSPV +TEAN    HE YQ WLSPHPHQS+Q
Sbjct  1310  SGSQVGSRVQNKAVELDHQHPQIMEKVQYDSPVPNTEANPAHPHENYQQWLSPHPHQSNQ  1369

Query  1339  PTQKVTHQQFQHSMQHFHQEHSENWQRYEEQNSNPYRLITAHHQHLSPRLGNQTHHNSCQ  1398
             P QK+TH+Q    M HFHQE +ENWQRYEEQNSNPY +I+AHHQHLSPRLGNQTH NS  
Sbjct  1370  PAQKLTHRQQHPPMHHFHQEQTENWQRYEEQNSNPYMVISAHHQHLSPRLGNQTHQNSSP  1429

Query  1399  SGHIGSDVARKSLCGLESLVDQIPAIKEHECGNNIPSVTATAAAAAVESRLLGLQ-QHQH  1457
             SGHI SDVA KSLCGLESLVDQIPAI+E +C +NIP  T  AAAAAVESR+L LQ QHQH
Sbjct  1430  SGHISSDVAHKSLCGLESLVDQIPAIREQDC-SNIPLATVAAAAAAVESRILSLQHQHQH  1488

Query  1458  -HQQQEQSQQQQQQQPKRCNQESPAQAESFRLT-----RENNNFSVSSLAASALIARADN  1511
               Q  +Q+QQ QQQQ K+C QE+ A  ES R T       N+NFSVSSLAASA  AR DN
Sbjct  1489  PLQPHQQNQQNQQQQLKQCKQENSAHRESCRPTSENSNVSNSNFSVSSLAASASSARTDN  1548

Query  1512  EAMYG-GETRGHHESNNSNGNNCSNSNDYPIHNPSGYHHQAPQLIGSPLGPSI--SHP--  1566
              A+YG GET+G++ES  S+ N+C  + DYPIHN S YHH  P LIGS LG ++  S P  
Sbjct  1549  -AIYGNGETKGNNES--SHHNSCDTNIDYPIHNQSAYHH-TPHLIGSALGTNVNNSEPNL  1604

Query  1567  -----PAPSQSHPHPMYMDQTHHMAHISSVNVNAMYGPSAYGTHPQHNTGEYAVTHSLYS  1621
                  P P   HPH MY+DQ HHMAHI SVNVN+MYGP AYG+HPQH TGEY  TH  YS
Sbjct  1605  HTISHPHPPHPHPHSMYVDQAHHMAHIPSVNVNSMYGP-AYGSHPQHTTGEYPGTHGHYS  1663

Query  1622  LGSTVQSTGPTNS-TLHVPSPNYPFGHHPYSHAPPQANYPSYTHTHTHHHSHHSQPSHHL  1680
             LG +VQ+  PT+S TLHVPSPNYPFGHHPY H PPQANYPSYTH HT  H HHS PSHHL
Sbjct  1664  LGGSVQTAVPTSSATLHVPSPNYPFGHHPYGHTPPQANYPSYTHPHT--HHHHSHPSHHL  1721

Query  1681  SVFDHLKPSDISGYGGF  1697
             +VFDHLKPSDISGYGGF
Sbjct  1722  TVFDHLKPSDISGYGGF  1738


>Q9XYZ3_DROME unnamed protein product
Length=1095

 Score = 1358 bits (3514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 767/1113 (69%), Positives = 868/1113 (78%), Gaps = 47/1113 (4%)

Query  614   INEEIRMHSPTHQVMETVNPEAVRYATASVAMAVPNGNPEVVSEDIYQHTHQITSIQEQT  673
             + EE+ MHSP+H+ ++ V     RY      + V N  PE +S ++Y+H+ Q T++ EQT
Sbjct  1     MGEELHMHSPSHRHLDAVTTGPGRYG-----ILVSNDTPECLSREMYRHSQQSTTVLEQT  55

Query  674   DNSHRGLNSKPTPKKRGRKKKVVSDSTDAKQMSTSAIHQDISGGTLVGEDGSDLNQAIKP  733
             D+S  G+N KP PKKRGRKKK+V+ + D  QM+T    Q +S G    EDG   +QA KP
Sbjct  56    DSSSCGINFKPMPKKRGRKKKLVAVNADTSQMTTPVDQQKVSAGRADCEDGGG-DQAAKP  114

Query  734   KERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAFKGHHYAGPGNHFWKC  793
             KERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAA+KGHHYAGPGNHFWKC
Sbjct  115   KERKKHDRFNGMSEEEVIKRTIPDHLCDNLDIVIVGINPGLFAAYKGHHYAGPGNHFWKC  174

Query  794   LYLAGLTVEQMSADEDYKLLKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFR  853
             LYLAGLT EQMSADED+KL+KQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFR
Sbjct  175   LYLAGLTQEQMSADEDHKLIKQGIGFTNMVARATKGSADLTRKEIKEGSRILLEKLQRFR  234

Query  854   PKIAVFNGKLIFEVFSGKKEFHFGRQPDRVEGTDTYIWVMPSSSARCAQLPRAADKVPFY  913
             PK+AVFNGKLIFEVFSGKKEFHFGRQPDRV+GTDT+IWVMPSSSARCAQLPRAADKVPFY
Sbjct  235   PKVAVFNGKLIFEVFSGKKEFHFGRQPDRVDGTDTFIWVMPSSSARCAQLPRAADKVPFY  294

Query  914   AALKKFRDFLNGDITHIAESECVFTDQRIRQSSEQQHAETSGKEKQNDKNSLTDHQAGLA  973
             AALKKFRDFLNG I HI ESECVFTDQRIR  S QQ  +  GK  +  +  L DH + L 
Sbjct  295   AALKKFRDFLNGQIPHIDESECVFTDQRIRLCSAQQQVDIVGKINKTHQPPLGDHPSSLT  354

Query  974   LVEHCSGSSARAVECGNALEESEQVKSDKLLPSMVSNVSSCNNR---GSFSYSGDERSLL  1030
             +V +CSG  A   ECG   EES+QV+S+K++P M   V S +N     SFSY+ +   LL
Sbjct  355   VVSNCSGPIAGDAECGIVAEESDQVQSEKMIPQMDPTVPSSSNATDGKSFSYTAENTPLL  414

Query  1031  PVSNNNLPPSESTYLSVFGSQLSQTQHPLEKKKRGRPKKIKGQEIIDHNVAGK--MGAQH  1088
             PVSN+N   +E+ YLSV GSQ   +Q PLEKKKRGRPKKIKGQ+IIDH+V GK  +  QH
Sbjct  415   PVSNHNPSINENNYLSVMGSQQPLSQQPLEKKKRGRPKKIKGQDIIDHSVGGKASIAGQH  474

Query  1089  MPHHDFNNILNLSVVPSGGNIETPKKKRGRPKKLKPAIDNVMTVKQLQHGNANPNTAAGL  1148
             +P HDFNNILNLSV+  GG IETPKKKRGRPKKLKPAIDN+MTVKQLQHGN N NT AGL
Sbjct  475   IPSHDFNNILNLSVMSGGGTIETPKKKRGRPKKLKPAIDNIMTVKQLQHGNNNLNTTAGL  534

Query  1149  LVSSMHPLSMEQIAASPQSSHQMPPSLYNTPPPSHLLYTASASPMASPALNCNYTQLHGH  1208
               SSMHP+SME IAA PQSSHQMPPSLYNTPPPSHLLYTASASPMASPALNCNYTQ+HGH
Sbjct  535   SASSMHPISMEHIAAFPQSSHQMPPSLYNTPPPSHLLYTASASPMASPALNCNYTQVHGH  594

Query  1209  GTPPVGQANSVAQGTTPIIDPQNEQLVSQKQNQHGNLKTALDMRDEPHLGETPPPSSPNI  1268
             GTPPVGQ  SVAQG++P+ID QN+ L  QKQ+ HGNL   LDMRD PHLGETPPPSSPN+
Sbjct  595   GTPPVGQVASVAQGSSPVIDTQNDHLAQQKQSHHGNLGAGLDMRDHPHLGETPPPSSPNM  654

Query  1269  CTAVDFDPPND--DSQVVSADHNKAVELGQRQPLIAQKNQYDSPVHDTEANAGQSHEQYQ  1326
             C+ VDFDPP++   SQV S   NKAVEL  + P I +K QYDSPV +TEAN    HE YQ
Sbjct  655   CSTVDFDPPDEHSGSQVGSRVQNKAVELDHQHPQIMEKVQYDSPVPNTEANPAHPHENYQ  714

Query  1327  HWLSPHPHQSHQPTQKVTHQQFQHSMQHFHQEHSENWQRYEEQNSNPYRLITAHHQHLSP  1386
              WLSPHPHQS+QP QK+TH+Q    M HFHQE +ENWQRYEEQNSNPY +I+AHHQHLSP
Sbjct  715   QWLSPHPHQSNQPAQKLTHRQQHPPMHHFHQEQTENWQRYEEQNSNPYMVISAHHQHLSP  774

Query  1387  RLGNQTHHNSCQSGHIGSDVARKSLCGLESLVDQIPAIKEHECGNNIPSVTATAAAAAVE  1446
             RLGNQTH NS  SGHI SDVA KSLCGLESLVDQIPAI+E +C +NIP  T  AAAAAVE
Sbjct  775   RLGNQTHQNSSPSGHISSDVAHKSLCGLESLVDQIPAIREQDC-SNIPLATVAAAAAAVE  833

Query  1447  SRLLGLQ-QHQH-HQQQEQSQQQQQQQPKRCNQESPAQAESFRLT-----RENNNFSVSS  1499
             SR+L LQ QHQH  Q  +Q+QQ QQQQ K+C QE+ A  ES R T       N+NFSVSS
Sbjct  834   SRILSLQHQHQHPLQPHQQNQQNQQQQLKQCKQENSAHRESCRPTSENSNVSNSNFSVSS  893

Query  1500  LAASALIARADNEAMYG-GETRGHHESNNSNGNNCSNSNDYPIHNPSGYHHQAPQLIGSP  1558
             LAASA  AR DN A+YG GET+G++ES  S+ N+C  + DYPIHN S YHH  P LIGS 
Sbjct  894   LAASASSARTDN-AIYGNGETKGNNES--SHHNSCDTNIDYPIHNQSAYHH-TPHLIGSA  949

Query  1559  LGPSISHPPAPSQSHPHP-------------MYMDQTHHMAHISSVNVNAMYGPSAYGTH  1605
             LG ++++    S+ + H              MY+DQ HHMAHI SVNVN+MYGP AYG+H
Sbjct  950   LGTNVNN----SEPNLHTISHPHPPHPHPHSMYVDQAHHMAHIPSVNVNSMYGP-AYGSH  1004

Query  1606  PQHNTGEYAVTHSLYSLGSTVQSTGPTNS-TLHVPSPNYPFGHHPYSHAPPQANYPSYTH  1664
             PQH TGEY  TH  YSLG +VQ+  PT+S TLHVPSPNYPFGHHPY H PPQANYPSYTH
Sbjct  1005  PQHTTGEYPGTHGHYSLGGSVQTAVPTSSATLHVPSPNYPFGHHPYGHTPPQANYPSYTH  1064

Query  1665  THTHHHSHHSQPSHHLSVFDHLKPSDISGYGGF  1697
              HT  H HHS PSHHL+VFDHLKPSDISGYGGF
Sbjct  1065  PHT--HHHHSHPSHHLTVFDHLKPSDISGYGGF  1095



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062560.1 uncharacterized protein LOC108102310 isoform X1
[Drosophila eugracilis]

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4E1_DROME  unnamed protein product                                 837     0.0  
Q8ST77_DROME  unnamed protein product                                 124     9e-34
G5EEE7_CAEEL  unnamed protein product                                 81.3    1e-16


>Q9V4E1_DROME unnamed protein product
Length=652

 Score = 837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/669 (67%), Positives = 510/669 (76%), Gaps = 43/669 (6%)

Query  2    QERLRVSWTQKKS-IKDNNKRSNMLSCKRRLISSKVLADPPPLFVSFPNCK--------D  52
            Q RL VSWTQ KS I D+ +R +ML+CKRRL +SKVL D  P  V+FPNCK        +
Sbjct  7    QLRLTVSWTQSKSQIHDSCQRRSMLACKRRLTTSKVLEDSHPP-VAFPNCKSHRHQQQKE  65

Query  53   QHNVQLYSGSLLNIKLYAPVTIDTSPQIQNQPLTKTNYQRPAMHRKSKSKCKLTVFNNIS  112
            +H VQLYSG  L+IKLY P +I++ P+I+++ LT TN Q+PAMHRKSKSK K   FNN+ 
Sbjct  66   KHKVQLYSGKPLSIKLYVPGSIESIPKIRHKALTTTNKQQPAMHRKSKSKSKFQGFNNLK  125

Query  113  PLLSLSERKNQPSTEHSSETAVTVQKHEETSAGIEVKTSQYLPSITNSKKGCHYHKRIKS  172
            PL S S+R  QP  +HSS   V V+      AGIE K S++              KRIK+
Sbjct  126  PLYSPSKR--QPPEKHSS---VLVE------AGIESKASRHFVG----------KKRIKN  164

Query  173  KNGSLSSSLLSSKRCKMAIPFPTLGATSFLTLLTLICIETILLSTMSSCAKTFYMHWNTS  232
            +N  LSS   S  RCKM IPFP  GATSF+TLLTLIC+ET+LLSTMSSCAKTFYMHWNTS
Sbjct  165  RNCLLSSPQPSPMRCKMMIPFPKFGATSFVTLLTLICMETVLLSTMSSCAKTFYMHWNTS  224

Query  233  NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR  292
            NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR
Sbjct  225  NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR  284

Query  293  ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG  352
            ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG
Sbjct  285  ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG  344

Query  353  RCSTNNMKVVFKVCCAAEGKNKTTASSKSISGAETGVAISVNIAANDDSHVHGQGLKNIG  412
            RCSTNNMKVVFKVCCA E  NKTTA S S S  +TG AI+VNIA ND+SHV+  G  NI 
Sbjct  345  RCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGGAINVNIANNDESHVNSHG-NNIA  403

Query  413  LNGGLTSGVS------QSAGMPLNPINGNINLNGIETTINSNIDQFNRIPIQPNIIGNNV  466
            +   +           QSAG+P+NP++GN N+NGI TTINSNIDQFNRIPIQPNIIGN+V
Sbjct  404  IGTNIGINGGQIIGGPQSAGIPINPLSGNNNINGIPTTINSNIDQFNRIPIQPNIIGNHV  463

Query  467  GNNV-GGSAIVGGGIMLTPGHGHG-INMLQPGRGGVNVAYPGHHHIQTGIRINNVPTQHS  524
            G N  G   + GGGI+LTPGH HG INMLQPGRGG+N AYPGHHHIQTGIRINNVPTQH+
Sbjct  464  GTNAVGTGIVGGGGIILTPGHAHGNINMLQPGRGGINGAYPGHHHIQTGIRINNVPTQHN  523

Query  525  YTPHKGIVKSNNNGNDDHHNYDKHPNEVVKNEELTYNSGTASTDRHILTTWKWFLTFIPM  584
            Y  HKG   SN NGNDDHH+Y+KHPNEVVKNEELTYNSG A++D +I   W W L+  P+
Sbjct  524  YPSHKGNANSNINGNDDHHHYNKHPNEVVKNEELTYNSGAATSDGNIFALWIWILSIFPL  583

Query  585  PSFQSCCLSAYWINSYLVLSIFSILGFHYLVENVLQTTIPWYGSIMIECSPTS---LFVS  641
             S QSC LS+YWI++  ++S  +ILG HYL++  LQTT+  Y   M+E + TS   +F  
Sbjct  584  LSIQSCHLSSYWISASFLVSTIAILGIHYLIQITLQTTVQRYSPGMVEITATSMNGMFDQ  643

Query  642  TSNTVIIDR  650
             + T+  DR
Sbjct  644  NAGTIEYDR  652


>Q8ST77_DROME unnamed protein product
Length=96

 Score = 124 bits (311),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 72/95 (76%), Gaps = 0/95 (0%)

Query  529  KGIVKSNNNGNDDHHNYDKHPNEVVKNEELTYNSGTASTDRHILTTWKWFLTFIPMPSFQ  588
            KG   SN NGNDDHH+Y+KHPNEVVKNEELTYNSG A++D +I   W W L+  P+ S Q
Sbjct  1    KGNANSNINGNDDHHHYNKHPNEVVKNEELTYNSGAATSDGNIFALWIWILSIFPLLSIQ  60

Query  589  SCCLSAYWINSYLVLSIFSILGFHYLVENVLQTTI  623
            SC LS+YWI++  ++S  +ILG HYL++  LQTT+
Sbjct  61   SCHLSSYWISASFLVSTIAILGIHYLIQITLQTTV  95


>G5EEE7_CAEEL unnamed protein product
Length=279

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 21/164 (13%)

Query  208  ICIETILLSTMS----SCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIIC  263
            I I+TILL  ++    S  +   ++WN++N +                 A   D + I+C
Sbjct  5    IKIQTILLFILTTVHCSAKRLPQIYWNSTNPLVE-------------RYAAIGDTLDIVC  51

Query  264  PVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQ  323
            P ++  + E  TE+ IIY V++ EYE C    +  + +  C +P +     + FR  +P 
Sbjct  52   PFFDENSDEL-TEQSIIYRVTEEEYENCE-RRSKAKELGRCTQPYQEEKLKVAFRLMSPN  109

Query  324  PGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKV  365
            P GL++ PG  YYFISTS  S+  LY   GG C+++N+K+V  +
Sbjct  110  PSGLDYRPGVTYYFISTSTGSRKGLYNEQGGLCASHNLKMVIHI  153



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062561.1 uncharacterized protein LOC108102310 isoform X1
[Drosophila eugracilis]

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4E1_DROME  unnamed protein product                                 837     0.0  
Q8ST77_DROME  unnamed protein product                                 124     9e-34
G5EEE7_CAEEL  unnamed protein product                                 81.3    1e-16


>Q9V4E1_DROME unnamed protein product
Length=652

 Score = 837 bits (2162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 445/669 (67%), Positives = 510/669 (76%), Gaps = 43/669 (6%)

Query  2    QERLRVSWTQKKS-IKDNNKRSNMLSCKRRLISSKVLADPPPLFVSFPNCK--------D  52
            Q RL VSWTQ KS I D+ +R +ML+CKRRL +SKVL D  P  V+FPNCK        +
Sbjct  7    QLRLTVSWTQSKSQIHDSCQRRSMLACKRRLTTSKVLEDSHPP-VAFPNCKSHRHQQQKE  65

Query  53   QHNVQLYSGSLLNIKLYAPVTIDTSPQIQNQPLTKTNYQRPAMHRKSKSKCKLTVFNNIS  112
            +H VQLYSG  L+IKLY P +I++ P+I+++ LT TN Q+PAMHRKSKSK K   FNN+ 
Sbjct  66   KHKVQLYSGKPLSIKLYVPGSIESIPKIRHKALTTTNKQQPAMHRKSKSKSKFQGFNNLK  125

Query  113  PLLSLSERKNQPSTEHSSETAVTVQKHEETSAGIEVKTSQYLPSITNSKKGCHYHKRIKS  172
            PL S S+R  QP  +HSS   V V+      AGIE K S++              KRIK+
Sbjct  126  PLYSPSKR--QPPEKHSS---VLVE------AGIESKASRHFVG----------KKRIKN  164

Query  173  KNGSLSSSLLSSKRCKMAIPFPTLGATSFLTLLTLICIETILLSTMSSCAKTFYMHWNTS  232
            +N  LSS   S  RCKM IPFP  GATSF+TLLTLIC+ET+LLSTMSSCAKTFYMHWNTS
Sbjct  165  RNCLLSSPQPSPMRCKMMIPFPKFGATSFVTLLTLICMETVLLSTMSSCAKTFYMHWNTS  224

Query  233  NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR  292
            NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR
Sbjct  225  NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR  284

Query  293  ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG  352
            ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG
Sbjct  285  ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG  344

Query  353  RCSTNNMKVVFKVCCAAEGKNKTTASSKSISGAETGVAISVNIAANDDSHVHGQGLKNIG  412
            RCSTNNMKVVFKVCCA E  NKTTA S S S  +TG AI+VNIA ND+SHV+  G  NI 
Sbjct  345  RCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGGAINVNIANNDESHVNSHG-NNIA  403

Query  413  LNGGLTSGVS------QSAGMPLNPINGNINLNGIETTINSNIDQFNRIPIQPNIIGNNV  466
            +   +           QSAG+P+NP++GN N+NGI TTINSNIDQFNRIPIQPNIIGN+V
Sbjct  404  IGTNIGINGGQIIGGPQSAGIPINPLSGNNNINGIPTTINSNIDQFNRIPIQPNIIGNHV  463

Query  467  GNNV-GGSAIVGGGIMLTPGHGHG-INMLQPGRGGVNVAYPGHHHIQTGIRINNVPTQHS  524
            G N  G   + GGGI+LTPGH HG INMLQPGRGG+N AYPGHHHIQTGIRINNVPTQH+
Sbjct  464  GTNAVGTGIVGGGGIILTPGHAHGNINMLQPGRGGINGAYPGHHHIQTGIRINNVPTQHN  523

Query  525  YTPHKGIVKSNNNGNDDHHNYDKHPNEVVKNEELTYNSGTASTDRHILTTWKWFLTFIPM  584
            Y  HKG   SN NGNDDHH+Y+KHPNEVVKNEELTYNSG A++D +I   W W L+  P+
Sbjct  524  YPSHKGNANSNINGNDDHHHYNKHPNEVVKNEELTYNSGAATSDGNIFALWIWILSIFPL  583

Query  585  PSFQSCCLSAYWINSYLVLSIFSILGFHYLVENVLQTTIPWYGSIMIECSPTS---LFVS  641
             S QSC LS+YWI++  ++S  +ILG HYL++  LQTT+  Y   M+E + TS   +F  
Sbjct  584  LSIQSCHLSSYWISASFLVSTIAILGIHYLIQITLQTTVQRYSPGMVEITATSMNGMFDQ  643

Query  642  TSNTVIIDR  650
             + T+  DR
Sbjct  644  NAGTIEYDR  652


>Q8ST77_DROME unnamed protein product
Length=96

 Score = 124 bits (311),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 72/95 (76%), Gaps = 0/95 (0%)

Query  529  KGIVKSNNNGNDDHHNYDKHPNEVVKNEELTYNSGTASTDRHILTTWKWFLTFIPMPSFQ  588
            KG   SN NGNDDHH+Y+KHPNEVVKNEELTYNSG A++D +I   W W L+  P+ S Q
Sbjct  1    KGNANSNINGNDDHHHYNKHPNEVVKNEELTYNSGAATSDGNIFALWIWILSIFPLLSIQ  60

Query  589  SCCLSAYWINSYLVLSIFSILGFHYLVENVLQTTI  623
            SC LS+YWI++  ++S  +ILG HYL++  LQTT+
Sbjct  61   SCHLSSYWISASFLVSTIAILGIHYLIQITLQTTV  95


>G5EEE7_CAEEL unnamed protein product
Length=279

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 21/164 (13%)

Query  208  ICIETILLSTMS----SCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIIC  263
            I I+TILL  ++    S  +   ++WN++N +                 A   D + I+C
Sbjct  5    IKIQTILLFILTTVHCSAKRLPQIYWNSTNPLVE-------------RYAAIGDTLDIVC  51

Query  264  PVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQ  323
            P ++  + E  TE+ IIY V++ EYE C    +  + +  C +P +     + FR  +P 
Sbjct  52   PFFDENSDEL-TEQSIIYRVTEEEYENCE-RRSKAKELGRCTQPYQEEKLKVAFRLMSPN  109

Query  324  PGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKV  365
            P GL++ PG  YYFISTS  S+  LY   GG C+++N+K+V  +
Sbjct  110  PSGLDYRPGVTYYFISTSTGSRKGLYNEQGGLCASHNLKMVIHI  153



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062562.1 uncharacterized protein LOC108102310 isoform X2
[Drosophila eugracilis]

Length=640
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4E1_DROME  unnamed protein product                                 820     0.0  
Q8ST77_DROME  unnamed protein product                                 114     5e-30
G5EEE7_CAEEL  unnamed protein product                                 81.3    9e-17


>Q9V4E1_DROME unnamed protein product
Length=652

 Score = 820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/669 (66%), Positives = 504/669 (75%), Gaps = 53/669 (8%)

Query  2    QERLRVSWTQKKS-IKDNNKRSNMLSCKRRLISSKVLADPPPLFVSFPNCK--------D  52
            Q RL VSWTQ KS I D+ +R +ML+CKRRL +SKVL D  P  V+FPNCK        +
Sbjct  7    QLRLTVSWTQSKSQIHDSCQRRSMLACKRRLTTSKVLEDSHPP-VAFPNCKSHRHQQQKE  65

Query  53   QHNVQLYSGSLLNIKLYAPVTIDTSPQIQNQPLTKTNYQRPAMHRKSKSKCKLTVFNNIS  112
            +H VQLYSG  L+IKLY P +I++ P+I+++ LT TN Q+PAMHRKSKSK K   FNN+ 
Sbjct  66   KHKVQLYSGKPLSIKLYVPGSIESIPKIRHKALTTTNKQQPAMHRKSKSKSKFQGFNNLK  125

Query  113  PLLSLSERKNQPSTEHSSETAVTVQKHEETSAGIEVKTSQYLPSITNSKKGCHYHKRIKS  172
            PL S S+R  QP  +HSS   V V+      AGIE K S++              KRIK+
Sbjct  126  PLYSPSKR--QPPEKHSS---VLVE------AGIESKASRHFVG----------KKRIKN  164

Query  173  KNGSLSSSLLSSKRCKMAIPFPTLGATSFLTLLTLICIETILLSTMSSCAKTFYMHWNTS  232
            +N  LSS   S  RCKM IPFP  GATSF+TLLTLIC+ET+LLSTMSSCAKTFYMHWNTS
Sbjct  165  RNCLLSSPQPSPMRCKMMIPFPKFGATSFVTLLTLICMETVLLSTMSSCAKTFYMHWNTS  224

Query  233  NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR  292
            NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR
Sbjct  225  NSIFRIDNTDHIIDVNKGNLAFEFDQVHIICPVYEPGTFENETEKYIIYNVSKVEYETCR  284

Query  293  ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG  352
            ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG
Sbjct  285  ITNADPRVIAICDKPQKLMFFTITFRPFTPQPGGLEFLPGNDYYFISTSSKDDLYRRIGG  344

Query  353  RCSTNNMKVVFKVCCAAEGKNKTTASSKSISGAETGVAISVNIAANDDSHVHGQGLKNIG  412
            RCSTNNMKVVFKVCCA E  NKTTA S S S  +TG AI+VNIA ND+SHV+  G  NI 
Sbjct  345  RCSTNNMKVVFKVCCAPEDNNKTTALSNSKSVTDTGGAINVNIANNDESHVNSHG-NNIA  403

Query  413  LNGGLTSGVS------QSAGMPLNPINGNINLNGIETTINSNIDQFNRIPIQPNIIGNNV  466
            +   +           QSAG+P+NP++GN N+NGI TTINSNIDQFNRIPIQPNIIGN+V
Sbjct  404  IGTNIGINGGQIIGGPQSAGIPINPLSGNNNINGIPTTINSNIDQFNRIPIQPNIIGNHV  463

Query  467  GNNV-GGSAIVGGGIMLTPGHGHG-INMLQPGRGGVNVAYPGHHHIQTGIRINNVPTQHS  524
            G N  G   + GGGI+LTPGH HG INMLQPGRGG+N AYPGHHHIQTGIRINNVPTQH+
Sbjct  464  GTNAVGTGIVGGGGIILTPGHAHGNINMLQPGRGGINGAYPGHHHIQTGIRINNVPTQHN  523

Query  525  YTPHK----------DDHHNYDKHPNEVVKNEELTYNSGTASTDRHILTTWKWFLTFIPM  574
            Y  HK          DDHH+Y+KHPNEVVKNEELTYNSG A++D +I   W W L+  P+
Sbjct  524  YPSHKGNANSNINGNDDHHHYNKHPNEVVKNEELTYNSGAATSDGNIFALWIWILSIFPL  583

Query  575  PSFQSCCLSAYWINSYLVLSIFSILGFHYLVENVLQTTIPWYGSIMIECSPTS---LFVS  631
             S QSC LS+YWI++  ++S  +ILG HYL++  LQTT+  Y   M+E + TS   +F  
Sbjct  584  LSIQSCHLSSYWISASFLVSTIAILGIHYLIQITLQTTVQRYSPGMVEITATSMNGMFDQ  643

Query  632  TSNTVIIDR  640
             + T+  DR
Sbjct  644  NAGTIEYDR  652


>Q8ST77_DROME unnamed protein product
Length=96

 Score = 114 bits (284),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 0/84 (0%)

Query  530  DDHHNYDKHPNEVVKNEELTYNSGTASTDRHILTTWKWFLTFIPMPSFQSCCLSAYWINS  589
            DDHH+Y+KHPNEVVKNEELTYNSG A++D +I   W W L+  P+ S QSC LS+YWI++
Sbjct  12   DDHHHYNKHPNEVVKNEELTYNSGAATSDGNIFALWIWILSIFPLLSIQSCHLSSYWISA  71

Query  590  YLVLSIFSILGFHYLVENVLQTTI  613
              ++S  +ILG HYL++  LQTT+
Sbjct  72   SFLVSTIAILGIHYLIQITLQTTV  95


>G5EEE7_CAEEL unnamed protein product
Length=279

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/164 (32%), Positives = 85/164 (52%), Gaps = 21/164 (13%)

Query  208  ICIETILLSTMS----SCAKTFYMHWNTSNSIFRIDNTDHIIDVNKGNLAFEFDQVHIIC  263
            I I+TILL  ++    S  +   ++WN++N +                 A   D + I+C
Sbjct  5    IKIQTILLFILTTVHCSAKRLPQIYWNSTNPLVE-------------RYAAIGDTLDIVC  51

Query  264  PVYEPGTFENETEKYIIYNVSKVEYETCRITNADPRVIAICDKPQKLMFFTITFRPFTPQ  323
            P ++  + E  TE+ IIY V++ EYE C    +  + +  C +P +     + FR  +P 
Sbjct  52   PFFDENSDEL-TEQSIIYRVTEEEYENCE-RRSKAKELGRCTQPYQEEKLKVAFRLMSPN  109

Query  324  PGGLEFLPGNDYYFISTS--SKDDLYRRIGGRCSTNNMKVVFKV  365
            P GL++ PG  YYFISTS  S+  LY   GG C+++N+K+V  +
Sbjct  110  PSGLDYRPGVTYYFISTSTGSRKGLYNEQGGLCASHNLKMVIHI  153



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062563.1 NADH-ubiquinone oxidoreductase 49 kDa subunit
[Drosophila eugracilis]

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4E0_DROME  unnamed protein product                                 941     0.0  
NDUS2_CAEEL  unnamed protein product                                  640     0.0  
NDUS2_DICDI  unnamed protein product                                  520     0.0  


>Q9V4E0_DROME unnamed protein product
Length=468

 Score = 941 bits (2431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/468 (96%), Positives = 457/468 (98%), Gaps = 0/468 (0%)

Query  3    FANITRRSLIPGLSHIRLLPQIVAGRLNVLSSHETRRGAAKWYPDPEFMKQFSGPVMYPD  62
             ANI RR+LIPGLSH+RL PQ+VA     L+S ETRRGAAKWYPDPEFMKQFSGPVMYPD
Sbjct  1    MANIMRRTLIPGLSHLRLRPQLVAAGSAALTSQETRRGAAKWYPDPEFMKQFSGPVMYPD  60

Query  63   EVTSLWKVPPWNSKVTPVEKSVRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGL  122
            EVTSLW VPPWNSKVTPVEKSVRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGL
Sbjct  61   EVTSLWTVPPWNSKVTPVEKSVRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGL  120

Query  123  LHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIEVPLRAKYIRTLFA  182
            LHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNI+VPLRAKYIRTLFA
Sbjct  121  LHRGTEKLIEYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIDVPLRAKYIRTLFA  180

Query  183  EITRILNHIMAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLD  242
            EITRILNHIMAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLD
Sbjct  181  EITRILNHIMAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLD  240

Query  243  MPIGLMDDIYEFASKFAERLDEVEDVLTTNRIWVQRTEDIGIVTAEEALNYGFSGVMLRG  302
            MP+GLMDDIYEFASKFAERLDEVEDVLTTNRIWVQRTEDIGIVTAEEALNYGFSGVMLRG
Sbjct  241  MPLGLMDDIYEFASKFAERLDEVEDVLTTNRIWVQRTEDIGIVTAEEALNYGFSGVMLRG  300

Query  303  SGIKWDLRKQQPYDAYNLVDFDVPIGTKGDCYDRYLCRIEEMRQSLRIIDQCLNQMTAGE  362
            SGIKWDLRKQQPYDAYNLV+FDVPIGTKGDCYDRYLCR+EEMRQSLRIIDQCLNQM AGE
Sbjct  301  SGIKWDLRKQQPYDAYNLVNFDVPIGTKGDCYDRYLCRVEEMRQSLRIIDQCLNQMPAGE  360

Query  363  IKTDDAKVAPPSRSEMKTSMEALIHHFKLFTQGYQVPPGATYTAIEAPKGEFGVYLVSDG  422
            IKTDDAKVAPPSRSEMKTSMEALIHHFKLFTQGYQVPPGATYTAIEAPKGEFGVYL+SDG
Sbjct  361  IKTDDAKVAPPSRSEMKTSMEALIHHFKLFTQGYQVPPGATYTAIEAPKGEFGVYLISDG  420

Query  423  SSRPYRCKIKAPGFAHLAALEKIGKQHMLADVVAIIGTLDVVFGEIDR  470
            SSRPYRCKIKAPGFAHLAALEKIGKQHMLADVVAIIGTLDVVFGEIDR
Sbjct  421  SSRPYRCKIKAPGFAHLAALEKIGKQHMLADVVAIIGTLDVVFGEIDR  468


>NDUS2_CAEEL unnamed protein product
Length=482

 Score = 640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/459 (66%), Positives = 366/459 (80%), Gaps = 28/459 (6%)

Query  36   ETRRGAAKWYPDPEFMKQFSGPVMYPDEVTSLW---KVPPWNSKV-----------TPV-  80
            +TR     WYPD +F +QF         +  LW   +V  ++ K+            PV 
Sbjct  28   QTRNSHTIWYPDAKFERQFK----TGGTLGKLWMSERVSDFDEKIGLDKLEKLAYSDPVM  83

Query  81   ---------EKSVRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLI  131
                     EK++ N+ LNFGPQHPAAHGVLRLVL+L+GE +++A PHIGLLHR TEKLI
Sbjct  84   SDNYSGKQREKNLENMILNFGPQHPAAHGVLRLVLKLEGEVIIKAIPHIGLLHRATEKLI  143

Query  132  EYKTYTQALPYFDRLDYVSMMCNEQCYSLAVEKLLNIEVPLRAKYIRTLFAEITRILNHI  191
            E+KTYTQALPYFDRLDYVSMMCNEQ +SLAVEKLL I++P RAKYIRTL  E+TRI NHI
Sbjct  144  EHKTYTQALPYFDRLDYVSMMCNEQAWSLAVEKLLGIDIPTRAKYIRTLMGELTRIQNHI  203

Query  192  MAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLDMPIGLMDDI  251
            M + THALDVGA+TPFFW+FEEREK+ EF ERVSGARMHA Y+RPGGV+ D+PIGLMDDI
Sbjct  204  MGITTHALDVGAMTPFFWMFEEREKLFEFSERVSGARMHANYVRPGGVAWDLPIGLMDDI  263

Query  252  YEFASKFAERLDEVEDVLTTNRIWVQRTEDIGIVTAEEALNYGFSGVMLRGSGIKWDLRK  311
            Y++A KF ER+DE+ED+LT NRIW  RT DIG+V+A +ALN+GFSGVM+RGSGIK D+RK
Sbjct  264  YDWAIKFPERIDELEDMLTENRIWKARTIDIGLVSAADALNWGFSGVMVRGSGIKQDVRK  323

Query  312  QQPYDAYNLVDFDVPIGTKGDCYDRYLCRIEEMRQSLRIIDQCLNQMTAGEIKTDDAKVA  371
             +PYDAY  ++FDVPIGTKGDCYDRYLCRIEEMRQSL I+ QCLN+M AGEIK DD KV 
Sbjct  324  TEPYDAYADMEFDVPIGTKGDCYDRYLCRIEEMRQSLNIVHQCLNKMPAGEIKVDDHKVV  383

Query  372  PPSRSEMKTSMEALIHHFKLFTQGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKI  431
            PP R+EMK +ME+LIHHFK FT+G+QVPPGATY  IEAPKGEFGVYLV+DG+ +PYRC I
Sbjct  384  PPKRAEMKENMESLIHHFKFFTEGFQVPPGATYVPIEAPKGEFGVYLVADGTGKPYRCFI  443

Query  432  KAPGFAHLAALEKIGKQHMLADVVAIIGTLDVVFGEIDR  470
            +APGFAHLAA+  +    ++AD+VA+IGT+D+VFGE+DR
Sbjct  444  RAPGFAHLAAIHDVCYMSLIADIVAVIGTMDIVFGEVDR  482


>NDUS2_DICDI unnamed protein product
Length=406

 Score = 520 bits (1340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/402 (61%), Positives = 312/402 (78%), Gaps = 6/402 (1%)

Query  75   SKVTPVEKSVRNLTLNFGPQHPAAHGVLRLVLELDGETVMRADPHIGLLHRGTEKLIEYK  134
            SK+    K ++N TLNFGPQHPAAHGVLRL++EL+ E V+R +PHIGLLHRGTEKLIE K
Sbjct  5    SKIFEEVKVMKNFTLNFGPQHPAAHGVLRLIVELESENVVRVEPHIGLLHRGTEKLIEGK  64

Query  135  TYTQALPYFDRLDYVSMMCNEQCYSLAVEKL------LNIEVPLRAKYIRTLFAEITRIL  188
            TYTQALPYFDRLDYVSM   E  YSLAVE+L      + +E+P RAK IR LF+EITR+L
Sbjct  65   TYTQALPYFDRLDYVSMNVQEHAYSLAVERLYLDSLDIELEIPQRAKVIRVLFSEITRVL  124

Query  189  NHIMAVGTHALDVGALTPFFWLFEEREKMMEFYERVSGARMHAAYIRPGGVSLDMPIGLM  248
            NHIMA  THA+DVGALTPF W FEEREK+MEFYERVSGARMHAAYIRPGGV+ D+P+ + 
Sbjct  125  NHIMATTTHAMDVGALTPFLWAFEEREKLMEFYERVSGARMHAAYIRPGGVAFDLPMNIS  184

Query  249  DDIYEFASKFAERLDEVEDVLTTNRIWVQRTEDIGIVTAEEALNYGFSGVMLRGSGIKWD  308
            +DIY+F  ++ +RL+E+ED+L  NRIW QR  DIGIV+AEEALNYGF+G +LRG+GI +D
Sbjct  185  EDIYKFVIQYRKRLEEIEDMLINNRIWKQRLVDIGIVSAEEALNYGFTGPLLRGAGIVYD  244

Query  309  LRKQQPYDAYNLVDFDVPIGTKGDCYDRYLCRIEEMRQSLRIIDQCLNQMTAGEIKTDDA  368
            +RK  PYD Y+  DF + IG + + Y R++ R++EM QSL II+Q LN +  G IK +  
Sbjct  245  IRKNYPYDDYDKYDFKIIIGEENNSYTRFIIRMKEMYQSLSIIEQALNNLRPGLIKLEGV  304

Query  369  KVAPPSRSEMKTSMEALIHHFKLFTQGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYR  428
             +  P R+ +K  ME+ I+HFK F++G+ +P    YT +EAPKGEFG+YL ++ +++PYR
Sbjct  305  NITAPDRAFVKKDMESCINHFKFFSEGFIIPANENYTIVEAPKGEFGIYLNANDTAKPYR  364

Query  429  CKIKAPGFAHLAALEKIGKQHMLADVVAIIGTLDVVFGEIDR  470
            C+IKAPGF HL  L  + K H+LADVV +IGT D+VFGE+DR
Sbjct  365  CRIKAPGFLHLQGLNMMSKDHLLADVVTLIGTQDIVFGEVDR  406



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062564.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062565.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062566.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062567.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


Query= XP_017062568.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.313    0.127    0.366 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6686190588


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062569.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062571.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062572.1 transcriptional activator protein Pur-beta isoform X1
[Drosophila eugracilis]

Length=280
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 546     0.0  
Q95RR6_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 516     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/280 (95%), Positives = 273/280 (98%), Gaps = 5/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/280 (92%), Positives = 265/280 (95%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  240
            TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  241  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  280
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062573.1 transcriptional activator protein Pur-beta isoform X2
[Drosophila eugracilis]

Length=279
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RR6_DROME  unnamed protein product                                 544     0.0  
Q9V4D9_DROME  unnamed protein product                                 540     0.0  
O16860_DROME  unnamed protein product                                 510     0.0  


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/279 (95%), Positives = 272/279 (97%), Gaps = 5/279 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIP  240
            TDLLEEFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIP
Sbjct  176  TDLLEEFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIP  235

Query  241  EKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  279
            EKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  EKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/280 (95%), Positives = 272/280 (97%), Gaps = 6/280 (2%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASL     GPPNT+NL
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASL-----GPPNTDNL  115

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  116  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  175

Query  181  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  239
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  176  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  235

Query  240  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  279
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  236  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>O16860_DROME unnamed protein product
Length=274

 Score = 510 bits (1314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/280 (91%), Positives = 264/280 (94%), Gaps = 7/280 (3%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLAGQNTGPPNTENL  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL+     P NT+NL
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLS-----PQNTDNL  114

Query  121  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  180
            PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL
Sbjct  115  PEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDAL  174

Query  181  TDLLEEFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  239
            TDLLEEFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI
Sbjct  175  TDLLEEFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITI  234

Query  240  PEKCWIRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  279
            PEKCWIRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  235  PEKCWIRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062574.1 transcriptional activator protein Pur-beta isoform X3
[Drosophila eugracilis]

Length=275
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4D9_DROME  unnamed protein product                                 551     0.0  
Q95RR6_DROME  unnamed protein product                                 545     0.0  
O16860_DROME  unnamed protein product                                 522     0.0  


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/275 (97%), Positives = 273/275 (99%), Gaps = 0/275 (0%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLGPPNTENLPEDGK  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASLGPPNT+NLPEDGK
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGK  120

Query  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180
            LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE
Sbjct  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180

Query  181  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  240
            EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW
Sbjct  181  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  240

Query  241  IRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  275
            IRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  241  IRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/275 (97%), Positives = 272/275 (99%), Gaps = 1/275 (0%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLGPPNTENLPEDGK  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASLGPPNT+NLPEDGK
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGK  120

Query  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180
            LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE
Sbjct  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180

Query  181  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  240
            EFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW
Sbjct  181  EFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  239

Query  241  IRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  275
            IRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  240  IRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>O16860_DROME unnamed protein product
Length=274

 Score = 522 bits (1344),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/275 (93%), Positives = 264/275 (96%), Gaps = 1/275 (0%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLGPPNTENLPEDGK  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL P NT+NLPEDGK
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLSPQNTDNLPEDGK  119

Query  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180
            LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE
Sbjct  120  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  179

Query  181  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  240
            EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW
Sbjct  180  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  239

Query  241  IRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  275
            IRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  240  IRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062575.1 transcriptional activator protein Pur-beta isoform X4
[Drosophila eugracilis]

Length=274
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q95RR6_DROME  unnamed protein product                                 550     0.0  
Q9V4D9_DROME  unnamed protein product                                 545     0.0  
O16860_DROME  unnamed protein product                                 515     0.0  


>Q95RR6_DROME unnamed protein product
Length=274

 Score = 550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/274 (97%), Positives = 272/274 (99%), Gaps = 0/274 (0%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLGPPNTENLPEDGK  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASLGPPNT+NLPEDGK
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGK  120

Query  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180
            LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE
Sbjct  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180

Query  181  EFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWI  240
            EFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWI
Sbjct  181  EFGANDGGFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWI  240

Query  241  RFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  274
            RFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  241  RFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/275 (97%), Positives = 272/275 (99%), Gaps = 1/275 (0%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KGGSGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGGSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLGPPNTENLPEDGK  120
            KQNRRGRFIKVAEIGADGRRSQIYLALSTA+EFRDHLSSFSDYYASLGPPNT+NLPEDGK
Sbjct  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTAAEFRDHLSSFSDYYASLGPPNTDNLPEDGK  120

Query  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180
            LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE
Sbjct  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180

Query  181  EFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  239
            EFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW
Sbjct  181  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  240

Query  240  IRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  274
            IRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  241  IRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


>O16860_DROME unnamed protein product
Length=274

 Score = 515 bits (1327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/275 (93%), Positives = 263/275 (96%), Gaps = 2/275 (1%)

Query  1    MSDLGSGDEGISGSKYNVANMEGSSSRNEFESSIKGGSGVEQELATKMLQIQSKRFYLDV  60
            MSDLGSGD+GISGSKYNVANMEGSSSRN+F+SS KG SGVEQELATKMLQIQSKRFYLDV
Sbjct  1    MSDLGSGDDGISGSKYNVANMEGSSSRNDFDSSAKGRSGVEQELATKMLQIQSKRFYLDV  60

Query  61   KQNRRGRFIKVAEIGADGRRSQIYLALSTASEFRDHLSSFSDYYASLGPPNTENLPEDGK  120
            KQNRR RFIKVAEIGADGRR+ I L   TA+EFRDHLSSFSDYYASL P NT+NLPEDGK
Sbjct  61   KQNRRSRFIKVAEIGADGRRNPI-LGSFTAAEFRDHLSSFSDYYASLSPQNTDNLPEDGK  119

Query  121  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  180
            LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE
Sbjct  120  LKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLE  179

Query  181  EFGANDGG-FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  239
            EFGANDGG FKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW
Sbjct  180  EFGANDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCW  239

Query  240  IRFRDIFNDYCDKMKKSSDSITAENNLPTSSNSLK  274
            IRFRDIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  240  IRFRDIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062576.1 transcriptional activator protein Pur-alpha isoform
X5 [Drosophila eugracilis]

Length=151
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IMC4_DROME  unnamed protein product                                 313     4e-110
O16860_DROME  unnamed protein product                                 313     1e-109
Q9V4D9_DROME  unnamed protein product                                 312     1e-109


>Q8IMC4_DROME unnamed protein product
Length=260

 Score = 313 bits (802),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 150/151 (99%), Gaps = 0/151 (0%)

Query  1    MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  60
            MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA
Sbjct  110  MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  169

Query  61   NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR  120
            NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR
Sbjct  170  NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR  229

Query  121  DIFNDYCDKMKKSSDSITAENNLPTSSNSLK  151
            DIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  230  DIFNDYCEKMKKSSDSITAEINLPTSSNSLK  260


 Score = 75.1 bits (183),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 76/136 (56%), Gaps = 9/136 (7%)

Query  1    MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  60
            M+    +R+YLD+K+N RGRF++V++ I   G RSQI L      EFRD L+    ++ A
Sbjct  33   MLQIQSKRFYLDVKQNRRGRFIKVAE-IGADGRRSQIYLALSTAAEFRDHLSS-FSDYYA  90

Query  61   NDGGRFKGDLPEERHMKV-----DNKNFYFDIGQNNRGVYMRISE--VKNNFRTSITIPE  113
            + G     +LPE+  +K      D + +Y D+ +N RG ++R+S+   +   R+ I +P 
Sbjct  91   SLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPA  150

Query  114  KCWIRFRDIFNDYCDK  129
            +  I FRD   D  ++
Sbjct  151  QGMIEFRDALTDLLEE  166


>O16860_DROME unnamed protein product
Length=274

 Score = 313 bits (801),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 150/151 (99%), Gaps = 0/151 (0%)

Query  1    MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  60
            MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA
Sbjct  124  MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  183

Query  61   NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR  120
            NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR
Sbjct  184  NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR  243

Query  121  DIFNDYCDKMKKSSDSITAENNLPTSSNSLK  151
            DIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  244  DIFNDYCEKMKKSSDSITAEINLPTSSNSLK  274


 Score = 62.4 bits (150),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 75/136 (55%), Gaps = 10/136 (7%)

Query  1    MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  60
            M+    +R+YLD+K+N R RF++V++ I   G R+ I L +    EFRD L+    ++ A
Sbjct  48   MLQIQSKRFYLDVKQNRRSRFIKVAE-IGADGRRNPI-LGSFTAAEFRDHLSS-FSDYYA  104

Query  61   NDGGRFKGDLPEERHMKV-----DNKNFYFDIGQNNRGVYMRISE--VKNNFRTSITIPE  113
            +   +   +LPE+  +K      D + +Y D+ +N RG ++R+S+   +   R+ I +P 
Sbjct  105  SLSPQNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPA  164

Query  114  KCWIRFRDIFNDYCDK  129
            +  I FRD   D  ++
Sbjct  165  QGMIEFRDALTDLLEE  180


 Score = 33.9 bits (76),  Expect = 0.032, Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 36/71 (51%), Gaps = 2/71 (3%)

Query  74   RHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFRDIFNDYCDKMKKS  133
            + +++ +K FY D+ QN R  +++++E+  + R +  +       FRD  + + D     
Sbjct  47   KMLQIQSKRFYLDVKQNRRSRFIKVAEIGADGRRNPILGSFTAAEFRDHLSSFSDYYASL  106

Query  134  SDSITAENNLP  144
            S   T  +NLP
Sbjct  107  SPQNT--DNLP  115


>Q9V4D9_DROME unnamed protein product
Length=275

 Score = 312 bits (800),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 149/151 (99%), Positives = 150/151 (99%), Gaps = 0/151 (0%)

Query  1    MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  60
            MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA
Sbjct  125  MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  184

Query  61   NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR  120
            NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR
Sbjct  185  NDGGRFKGDLPEERHMKVDNKNFYFDIGQNNRGVYMRISEVKNNFRTSITIPEKCWIRFR  244

Query  121  DIFNDYCDKMKKSSDSITAENNLPTSSNSLK  151
            DIFNDYC+KMKKSSDSITAE NLPTSSNSLK
Sbjct  245  DIFNDYCEKMKKSSDSITAEINLPTSSNSLK  275


 Score = 75.1 bits (183),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/136 (34%), Positives = 76/136 (56%), Gaps = 9/136 (7%)

Query  1    MMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPAQGMIEFRDALTDLLEEFGA  60
            M+    +R+YLD+K+N RGRF++V++ I   G RSQI L      EFRD L+    ++ A
Sbjct  48   MLQIQSKRFYLDVKQNRRGRFIKVAE-IGADGRRSQIYLALSTAAEFRDHLSS-FSDYYA  105

Query  61   NDGGRFKGDLPEERHMKV-----DNKNFYFDIGQNNRGVYMRISE--VKNNFRTSITIPE  113
            + G     +LPE+  +K      D + +Y D+ +N RG ++R+S+   +   R+ I +P 
Sbjct  106  SLGPPNTDNLPEDGKLKSEMMIKDYRRYYLDLKENARGRFLRVSQTITRGGPRSQIALPA  165

Query  114  KCWIRFRDIFNDYCDK  129
            +  I FRD   D  ++
Sbjct  166  QGMIEFRDALTDLLEE  181



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


Query= XP_017062577.2 twitchin isoform X4 [Drosophila eugracilis]

Length=8930
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

D1YSG0_DROME  unnamed protein product                                 16354   0.0  
L0MN91_DROME  unnamed protein product                                 16127   0.0  
Q7KQP6_DROME  unnamed protein product                                 15466   0.0  


>D1YSG0_DROME unnamed protein product
Length=8933

 Score = 16354 bits (42445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 7900/8939 (88%), Positives = 8433/8939 (94%), Gaps = 17/8939 (0%)

Query  1     MGVAEDFAPSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQ  60
             MGVAEDFAPSF+KKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRS+NK+VED RTKFKIQ
Sbjct  1     MGVAEDFAPSFVKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSDNKVVEDVRTKFKIQ  60

Query  61    PVEDNKYTVVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPT  120
             PV +NKYTVVLELDDVVETDAGLYKVKA NKSGEVSASINLNFTPADEPKEKQIDGFAPT
Sbjct  61    PVGENKYTVVLELDDVVETDAGLYKVKAKNKSGEVSASINLNFTPADEPKEKQIDGFAPT  120

Query  121   FAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATL  180
             FAKKPAIRQEEDGKRLLFECRVNADP P I+WFHNGAAVKES RHK+TVDKDVHSYFATL
Sbjct  121   FAKKPAIRQEEDGKRLLFECRVNADPIPAIIWFHNGAAVKESERHKITVDKDVHSYFATL  180

Query  181   EIQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIRQSE  240
             EI NVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEG KPTFTERPVIRQSE
Sbjct  181   EILNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGIKPTFTERPVIRQSE  240

Query  241   DGGNVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQ  300
             DGGNVTFECRCVGDPTP +TWSHGET LN+S RYKMSLTMDQKLYH+ACLEISSVVSSDQ
Sbjct  241   DGGNVTFECRCVGDPTPTVTWSHGETELNESNRYKMSLTMDQKLYHIACLEISSVVSSDQ  300

Query  301   GEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHP  360
             GEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHP
Sbjct  301   GEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHP  360

Query  361   VPDIVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESN  420
             VPDIVWYC+EKEI NNQRTKMTRKAI+KDSYILTLEIQNPTKEDGGNYRCNAIN+YGESN
Sbjct  361   VPDIVWYCSEKEICNNQRTKMTRKAITKDSYILTLEIQNPTKEDGGNYRCNAINMYGESN  420

Query  421   ANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPIVTWYRGQEIVEK  480
             ANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEP VTWYRGQ++VEK
Sbjct  421   ANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPTVTWYRGQDLVEK  480

Query  481   SKKIKINTTVIADDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPDPEG  540
             SKKIKINTTVIA+DTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEP+PEG
Sbjct  481   SKKIKINTTVIAEDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPEPEG  540

Query  541   EGPTFVEKPRIISENNGKLVIMECKVKADPKPDVIWYRNGEVVKESNKIKTFIEQRGDQY  600
             EGPTF+EKPRI+SENNGKLVIMECKVKADPKPDVIW+RNGEV+KESNKIKTFIEQRGDQY
Sbjct  541   EGPTFIEKPRIVSENNGKLVIMECKVKADPKPDVIWFRNGEVIKESNKIKTFIEQRGDQY  600

Query  601   YIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKRTVVIE  660
             YIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKRTVVIE
Sbjct  601   YIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKRTVVIE  660

Query  661   CTVASKFEPKCTWYKETNTVKESKRHVYIVEQTKDGEFAVKLEINNVDDSDKGAYKLVAS  720
             CTVASKFEPKCTWYKET+TVKESKRHVY VEQTK+GEFAVKLEIN+V++SDKGAYKLVAS
Sbjct  661   CTVASKFEPKCTWYKETSTVKESKRHVYQVEQTKEGEFAVKLEINDVEESDKGAYKLVAS  720

Query  721   NEKGEAVSQIVNLVDIPEEERKPSKPEISRKLVDQKVSESKTFELLISIAHSDRKCKIEW  780
             NEKGEAVSQIVNLVDIPEEERKP KPEISRKL DQKV+ESKTFELL+S++ +DRKCK+EW
Sbjct  721   NEKGEAVSQIVNLVDIPEEERKPCKPEISRKLADQKVAESKTFELLVSLSQTDRKCKVEW  780

Query  781   YKGSTLIRETKDITTTFDGTTARLTFSSARTEHTSNYKVVVTNEVGKDESSCKVTVEKST  840
             YKGST+IRETKDITTTFDGTTARLTFSSARTEHTSNYKV+VTNEVGKDESSCK+TVEK  
Sbjct  781   YKGSTVIRETKDITTTFDGTTARLTFSSARTEHTSNYKVIVTNEVGKDESSCKITVEKVA  840

Query  841   KKKEGQPKSKTEKDTDQKEKEKEGEETPSDQPAISTDTQAEEEL-HIKETDPTKKLTGNE  899
             KKKE +PK K +   +++ ++KE EE  ++       T+    +  I E DP ++LT  E
Sbjct  841   KKKEEKPKEKEKTKNEKEVEQKEMEEDKNESGQSVAQTEGRINIEQISEGDPKEELTVKE  900

Query  900   NSSENKNESSEANENQVNPPKSKHNKNNE--KDFSKPKHEEPKQNIGDKNDKNNKKQEKT  957
                + K ++ E  E+ V    S  ++  E  K  S  K ++  Q   DK  K ++ + KT
Sbjct  901   EILD-KRDTQEVKESSVELQDSAGHEVPEPKKATSDSKLDQSNQKNLDKKHKTDQSESKT  959

Query  958   S-----SDKPKENNKDPEKQQETQQIGLKKVERKGSIVSEKEEISSEVRRQSIFIEEEKI  1012
             +     ++  K N ++ E+QQ T+QIGLKKV+RK SIVS KEEISS+VRR+S    +E+I
Sbjct  960   NKNVSLAEPIKSNKQESEEQQATEQIGLKKVDRKASIVSVKEEISSDVRRKSTIKAKEEI  1019

Query  1013  VADDKKVSSRRSSLAVEESKTDSRRSSVIEKKPLDQVDRKQLDANKNPQALKEEIPKLKP  1072
               DDKK SSRRSSLAVEES T+SRRSS+I+KKPL+QVD K +DANKNPQ LKEEIP+LKP
Sbjct  1020  TVDDKKASSRRSSLAVEESNTESRRSSIIDKKPLEQVDNKPIDANKNPQPLKEEIPRLKP  1079

Query  1073  AEKRRTSKVVEEEKQVEELPKLRKTSISQVKEEPKPEVAKPKAKAKGKPKPKYDELPEIP  1132
             AEKRRTSKV+EE K  E LPKLRK SI+QVKEE K   A PK KAK K KPKY+ELPEIP
Sbjct  1080  AEKRRTSKVIEEPKPDEGLPKLRKASIAQVKEEAK--PAAPKLKAKAKAKPKYEELPEIP  1137

Query  1133  DYERPQLEKYEKSEFTPSDFARDLEIPNKMEKPILDSGKKESEDPTQKKGMPRKAEIIEK  1192
             DYERPQLEKYEKS+FTPSDFARDLEIPNKMEKPI+DSGKKE     QK G+P+K +IIE+
Sbjct  1138  DYERPQLEKYEKSDFTPSDFARDLEIPNKMEKPIIDSGKKEPAVLAQKNGIPKKTDIIEQ  1197

Query  1193  PAENIKSLKIGKGKLPDEDDSRDGATLKPVIIEPEDK-SDAENKKLEQ-AEKPSVLDIIK  1250
              A+  K LK+GKGKLPDE D RDGA LKPVIIEPE +  D  NKK  Q A+KP+VLDIIK
Sbjct  1198  YADEPKGLKVGKGKLPDEGDGRDGAVLKPVIIEPEKEILDLGNKKNNQHADKPTVLDIIK  1257

Query  1251  QRRRSSIRNLMTKEPIQNESFLGVVLKPVIKDSKEQTAPQQAIQLTKANATEQISSTREI  1310
             QRRRSSIRNLMTKEPIQNESFLGVVLKPVIKD++EQ APQQAIQLTKANATEQ S T+ +
Sbjct  1258  QRRRSSIRNLMTKEPIQNESFLGVVLKPVIKDTREQAAPQQAIQLTKANATEQFSPTKAV  1317

Query  1311  KAQISDLKKPEALATLEDDYERPLLEKYKPVSIDKNKSETPTPAINIPDTKHPEVKLPLE  1370
             KAQ++DLKKPE LATLED+YERP+LEKY P SIDK KSE  TP+I  PD + PEVKLP++
Sbjct  1318  KAQVADLKKPETLATLEDNYERPVLEKYDPFSIDKTKSEKSTPSIITPDIRGPEVKLPVQ  1377

Query  1371  TTKEEKQKVPRMQPPAPGEPPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIIND  1430
              TKEEKQKVP+MQPPAPG+PPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIIND
Sbjct  1378  ETKEEKQKVPKMQPPAPGDPPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIIND  1437

Query  1431  EKKLRPGEVMDTRLLRPGEVGEGQRRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGPP  1490
             EKKLRPGEVMDTRLLRPGEVGEGQRRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGPP
Sbjct  1438  EKKLRPGEVMDTRLLRPGEVGEGQRRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGPP  1497

Query  1491  SIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLC  1550
             SIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLC
Sbjct  1498  SIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITLC  1557

Query  1551  MRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNW  1610
             MRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNW
Sbjct  1558  MRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNW  1617

Query  1611  GDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKD  1670
             GDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKD
Sbjct  1618  GDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRKD  1677

Query  1671  EVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKPL  1730
             EVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKPL
Sbjct  1678  EVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKPL  1737

Query  1731  KKKLEGFTQHETTLECSVSSSMANVHWFKDNTKLESDDPRYLISKDINGNLKLIIKDSVV  1790
             KKKLEGFTQHETTLECSVSSSMANVHWFK+NTKLESDDPRYLISKDINGNLKLIIKDSV+
Sbjct  1738  KKKLEGFTQHETTLECSVSSSMANVHWFKNNTKLESDDPRYLISKDINGNLKLIIKDSVL  1797

Query  1791  EDAGLYRCQLDKQPDKTECNLKITEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQW  1850
             +DAGLYRCQLDKQPDKTECNLK+TEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQW
Sbjct  1798  DDAGLYRCQLDKQPDKTECNLKVTEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQW  1857

Query  1851  FRNGEEIKPDKRIQILKDGRKRKLVIKDCKVTDAGLFKCSTNADTTEAEIIINYQNRFNK  1910
              RNGEEIKPDKRIQI+KDGRKRKLVIKDCKVTDAG FKC+TNADTTE+EIIINYQNRFNK
Sbjct  1858  LRNGEEIKPDKRIQIVKDGRKRKLVIKDCKVTDAGQFKCTTNADTTESEIIINYQNRFNK  1917

Query  1911  KLKDTDAVERERLVLDVELQDQTAPCDWKLNGEPIVPSERIEVKNLGGGKHQLIFNSLDM  1970
             KLKDT+AVERE+L+LD+ELQDQTAPCDWK NGEPIVPSE IE+KN+GGGKHQLIF+SLDM
Sbjct  1918  KLKDTEAVEREKLILDIELQDQTAPCDWKFNGEPIVPSESIEIKNMGGGKHQLIFSSLDM  1977

Query  1971  SNEGEITCESGQLSSKCKLSIRKGESRPNIDCPDTFAGPISAPVLVKVPFKVSGTKQTPI  2030
             SNEGEITCESGQLSSKCKLSIRKGESRPNIDCPD F+GPISAPVL++VPFKVSGTKQTP+
Sbjct  1978  SNEGEITCESGQLSSKCKLSIRKGESRPNIDCPDKFSGPISAPVLLEVPFKVSGTKQTPV  2037

Query  2031  EAKLFKDGKPLPVKDVEVAVTDDNVTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIICQ  2090
             EAKLFKDGKPLPVKDVEVAVTDD VTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIICQ
Sbjct  2038  EAKLFKDGKPLPVKDVEVAVTDDKVTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIICQ  2097

Query  2091  DVPQPPQDVDITDVYQTSCVVNFKQPADDGGTPIINYVIERQDLSKKQGWEPVAEVQPSE  2150
             DVPQPPQDVDITDVYQTSCVV+F  P+DDGGTPI  YVIERQDLSKK GWE VAEV PSE
Sbjct  2098  DVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITKYVIERQDLSKKHGWESVAEVLPSE  2157

Query  2151  PCRKKIDDLVPKKQYRFRIRAVNAIGPSDPATFKNSILAKDPWDEPGKPKAVDLTDWDKD  2210
             PC KKIDDL+PKKQYRFRIRAVNAIG SDPATFKN+ILAKDPWDEPGKPKAVDLTDWDKD
Sbjct  2158  PCLKKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNTILAKDPWDEPGKPKAVDLTDWDKD  2217

Query  2211  HADLKWEAPDSDGGDPITAYIVEYKEKFSNDWVAGKEVDGDSRTATVDQLNEGQQYEFRV  2270
             HADLKWEAP++DGGDPITAYIVEYKEKFSNDWV+GKEVDGD+RTATVD L EGQQYEFRV
Sbjct  2218  HADLKWEAPETDGGDPITAYIVEYKEKFSNDWVSGKEVDGDARTATVDGLKEGQQYEFRV  2277

Query  2271  RAVNKAGPGEPSDKTKSIIAKCRFVKPFLVGDGLKNITVKKGQTIRFDVKYDGEPEPTAT  2330
             RAVN+AGPGEPSDKTKSIIAKCRFVKPF+VG+GLKN+TVKKGQTIRFD+KYDGEPEP AT
Sbjct  2278  RAVNRAGPGEPSDKTKSIIAKCRFVKPFIVGEGLKNVTVKKGQTIRFDIKYDGEPEPAAT  2337

Query  2331  WVKGTNNLNFDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSGSIESEAQVVVLD  2390
             WVKGT+NL FDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSG+IESEAQVVVLD
Sbjct  2338  WVKGTDNLKFDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSGTIESEAQVVVLD  2397

Query  2391  RPLAPGGPFEPEEVRANHIKMKWNCPEDDGGCEITGYALERMDEETGRWIPAGEVGPNET  2450
             RPL PGGPFEPEE+RA+HIKMKW  P+DDGGCEI+GYALERMDEETGRWIPAGEVGPNET
Sbjct  2398  RPLPPGGPFEPEEIRASHIKMKWKRPDDDGGCEISGYALERMDEETGRWIPAGEVGPNET  2457

Query  2451  SFDFKGLTPNKKYKFRVKAINKEGESDPLETSDAIVAKNPYDPPSAPSQPVIDDYDNKSV  2510
             SFDFKGLTPNKKYKFRVKAINKEGES+PLET DAIVA+NPYDPPS PSQPVIDDYDNKSV
Sbjct  2458  SFDFKGLTPNKKYKFRVKAINKEGESEPLETFDAIVARNPYDPPSPPSQPVIDDYDNKSV  2517

Query  2511  VLKWKRPPSDGGRPITHYIVEIKDKFSPTWSEVKKTEDPTPELTVEGLKESMVYQFRVRA  2570
             +LKWKRPPSDGGRPITHYIVEIKDKF+P+WSEV KT+DP PE  VEGLKE MVYQFRVRA
Sbjct  2518  LLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKTDDPNPECNVEGLKEKMVYQFRVRA  2577

Query  2571  VNKAGPSEPSQPTDNHICKYKNLKPQIDQSTFKRIVLKSGRTHKWSVDVIGEPVPELFWS  2630
             VNKAGPSEPSQPTDNH+CK+KNLKPQID+STFKR+ +KSGRTHKWSVDV+GEP+PEL WS
Sbjct  2578  VNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFKRVTIKSGRTHKWSVDVLGEPIPELHWS  2637

Query  2631  WRDDIPLTNGDRIKIENVDYHTDFRITNVLRKDSGFYTLKAENRNGIDRETVELVVLGKP  2690
             WRDDIPLTNGDRIKIENVDYHTDF ITNVLRKDSGFYTLKAENRNGIDRETVELVVLGKP
Sbjct  2638  WRDDIPLTNGDRIKIENVDYHTDFSITNVLRKDSGFYTLKAENRNGIDRETVELVVLGKP  2697

Query  2691  SSPKGPLAVDDVTATGCKLQWKKPEDDGGVPIKEYVVEKMDTSTGKWVRVGRSPGEKEPP  2750
             SSPKGPLAV DVTA+GCKLQWKKPEDDGGVPIKEYVVEKMDT+TGKWVRVGRSPGEKEPP
Sbjct  2698  SSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYVVEKMDTATGKWVRVGRSPGEKEPP  2757

Query  2751  SFDVTGLNPGSEYMFRVSAVNEEGESEPLTTLIGIVAKDPFDEPNKPGTPEVYDYDNQSV  2810
             SFDVTGL+ GSEYMFRVSAVNEEGESEPLTTL+G+VAKDPFDEPNKPGTPEV DYDNQS+
Sbjct  2758  SFDVTGLSLGSEYMFRVSAVNEEGESEPLTTLVGVVAKDPFDEPNKPGTPEVTDYDNQSI  2817

Query  2811  SLKWTPPNNDGGAPIQKYIIEKKDKNKPDWEKAAEIPGDQLEANVGGLQEYGEYQFRVIA  2870
             SLKW  PNNDGGAPIQKYIIEKK+KNK +WEKA EIPGDQLEA V GLQEYGEYQFRVIA
Sbjct  2818  SLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKALEIPGDQLEATVAGLQEYGEYQFRVIA  2877

Query  2871  VNKAGLSPPSDSSVPQIVKYKKLKPRIDRSNLKPLLIRAGKPVKYDVNVRGEPAPTITWY  2930
             VNKAGLSPPSD+SVPQIVKYKKLKPRIDRSNLKPLLIRAGKP++YDVNVRGEPAP ITWY
Sbjct  2878  VNKAGLSPPSDASVPQIVKYKKLKPRIDRSNLKPLLIRAGKPIRYDVNVRGEPAPVITWY  2937

Query  2931  HNNFELKQEELPSNCEIKNIPYNTKISIINTMRKHTGVYKIKAINEHGEDEATVEVNILA  2990
              N+ ELK EELPS+ EIKNIPYNTKISII T+RKHTG+YKI A+NEHG+DEATVEVNILA
Sbjct  2938  QNDKELKPEELPSSSEIKNIPYNTKISIIETVRKHTGIYKIIAVNEHGQDEATVEVNILA  2997

Query  2991  PPGMPKGPLEVKDVTKDSCKLKWKKPEDDGGKPITAYQVEKFDKKQGRWVPVGRTSANDT  3050
             PP  P+GPL+VKDVTKDSCKLKWKKPEDDGGKPI+AYQVEKFDKKQGRWVP+GRTSANDT
Sbjct  2998  PPSKPRGPLDVKDVTKDSCKLKWKKPEDDGGKPISAYQVEKFDKKQGRWVPLGRTSANDT  3057

Query  3051  EFDVKGLQEGHEYQFRVKAINEEGESDPLETDSSIIAKNPYDLASKPGTPRIEDYNENMV  3110
             EFDVKGLQEGHEYQFRVKAINEEGESDPL++D SIIAKNPYD ASKPGTP I DYNE+MV
Sbjct  3058  EFDVKGLQEGHEYQFRVKAINEEGESDPLDSDDSIIAKNPYDAASKPGTPNIVDYNEHMV  3117

Query  3111  ILKWEAPKSDGGAPITGYIIEKKDRFSPVWDEILSTNTTAPEATVTNLVEGNVYQFRIRA  3170
              LKWEAP+SDGGAPI+GYIIEKKD+FSP+WDEILSTNT+ PEATV  LVEGN+YQFR+RA
Sbjct  3118  KLKWEAPRSDGGAPISGYIIEKKDKFSPIWDEILSTNTSVPEATVEGLVEGNIYQFRVRA  3177

Query  3171  VNKAGPSEPSDATQPHLAKPRNLKPSINREKMKPIKVRAGQTVKFDVDVKGEPAPILTWF  3230
             VNKAG S+PSDAT+PHLAKPRNLKP INR+KMKPIKVRAGQ VKFDVDVKGEPAP LTWF
Sbjct  3178  VNKAGFSDPSDATEPHLAKPRNLKPYINRDKMKPIKVRAGQPVKFDVDVKGEPAPSLTWF  3237

Query  3231  LKETQLTTTPQVRLENEDYNTKLTLLDSSRNQSGEYKLRAENINGVDEALVEVIILDKPS  3290
             LKET+LT+T QVRLEN DYNTKLTLLD+ R QSG+YKLRAENINGVDEA+VEVIILDKPS
Sbjct  3238  LKETELTSTGQVRLENIDYNTKLTLLDTDRKQSGQYKLRAENINGVDEAVVEVIILDKPS  3297

Query  3291  KPQGPLEVADIHKEGCKLNWKKPKDDGGIPITGYVVEKMDVATGKWVPAGSVDPEKTDIE  3350
             KP+GP+EV+DIHKEGCKL W+KPKDDGGIPITGYV+EKMD ATGKWVPAGSVDPEK DIE
Sbjct  3298  KPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYVIEKMDTATGKWVPAGSVDPEKYDIE  3357

Query  3351  IKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPEFEDWDEHHVKLK  3410
             IKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPE EDWDEHHVKLK
Sbjct  3358  IKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPELEDWDEHHVKLK  3417

Query  3411  WEPPIRDGGSPITSYIIEVMDKDSGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVNK  3470
             WEPPIRDGGSPIT+YIIEVMDKDSGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVNK
Sbjct  3418  WEPPIRDGGSPITNYIIEVMDKDSGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVNK  3477

Query  3471  AGPSEPSEQTNWHIAKPRFLKPYIDRNNLKPVVVKTGLSISLDINIRGEPAPKVEWFFNA  3530
             AGPS+PSEQTNWH+AKPRFLKP+IDR NLKPV+VKTGLSISLDINIRGEPAPKVEWFFN 
Sbjct  3478  AGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKTGLSISLDINIRGEPAPKVEWFFNN  3537

Query  3531  MPLISNEESIKIDNVDYNTKFFVMRAQRSQSGKYIIKARNEVGEDEAELEVTVLGKPGKP  3590
               + S+E S+KIDNVDYNTKFFVMRAQRSQSGKYIIKA NEVGEDEAELEVTVLGKPGKP
Sbjct  3538  SSVTSDEHSVKIDNVDYNTKFFVMRAQRSQSGKYIIKATNEVGEDEAELEVTVLGKPGKP  3597

Query  3591  KGPLHVNDITKHSCKLKWEKPDDDGGTPIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIGL  3650
             KGPL VNDITKHSCKLKWEKPDDDGG+PIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIGL
Sbjct  3598  KGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIGL  3657

Query  3651  HEGKPYKFRVRAVNKEGESEDLETEKPIIAKNPFDEPEKPGRPNPTNWDKDFVDLAWDPP  3710
             HEGK YKFRVRAVNKEGESEDLETEKPIIAKNP+DEP++PG+P PTNWDKDFVDLAWDPP
Sbjct  3658  HEGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDEPDRPGKPEPTNWDKDFVDLAWDPP  3717

Query  3711  KNDGGAPIQKYIIQMRDKSGRAWVDAATVPGDKSNGTVTGIEEGHEYEFRIVAVNKAGPS  3770
             KNDGGAPIQKY+IQMRDKSGRAWVD+ATVPGDK NGTVTG+EEGHEYEFRIVAVNKAGPS
Sbjct  3718  KNDGGAPIQKYVIQMRDKSGRAWVDSATVPGDKCNGTVTGVEEGHEYEFRIVAVNKAGPS  3777

Query  3771  EPSDVSKSVVAKPRFLKPHIDRKNLQKKIMRSGQMLHMDAAVKAEPPAKITWTYNGTEIK  3830
             +PSDVSKSV+AKPRFLKPHIDRKNLQKKIMRSGQMLH+DA +KAEPPAK+TWTYN TEIK
Sbjct  3778  DPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEIK  3837

Query  3831  TSDNLKIENEDYKTTFIIPKVKRVNRGKYVVTAKNDSGSDSVEVELEVVCKPSKPKGPLA  3890
             TSD++KIENEDYKTTFI+PKVKR +RG Y+VTAKNDSGSD+VEVELEV+CKPSKPKGPLA
Sbjct  3838  TSDHIKIENEDYKTTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPLA  3897

Query  3891  VSEVTAESAHLKWDKPEDDGGEPIEQYIVERMDTETGRWVPVLTTKIPEADITGLTEGKE  3950
             VS VTAE+ HLKW+KPEDDGG+PIEQY+VERMDTETGRWVPVLTTK PEAD+TGLTEGKE
Sbjct  3898  VSNVTAETLHLKWEKPEDDGGDPIEQYLVERMDTETGRWVPVLTTKTPEADVTGLTEGKE  3957

Query  3951  YLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQISDWSASHCDLKWRAPEDDGG  4010
             YLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQI DWS +HCDLKWRAPEDDGG
Sbjct  3958  YLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQIVDWSGNHCDLKWRAPEDDGG  4017

Query  4011  APITGYLVEKKDPNTGKWQKALETNTPECKARVNDLITGKKYQFRVKAINKAGKSKPSEP  4070
             A ITGY+VE+KDPNTGKWQKALET+TP+CKARVNDLI G KYQFR+ A+NKAGKSKPSEP
Sbjct  4018  ASITGYIVERKDPNTGKWQKALETSTPDCKARVNDLIAGNKYQFRIMAVNKAGKSKPSEP  4077

Query  4071  SDQMTARDRFAPPKIDRTNIKDITIKAGQHIRYDIKVSGEPPATKVWLHNKARIDNEDSD  4130
             SDQMTA+DRFAPPKIDRTNIKDITIKAGQHIR+DIKVSGEPPATKVWLHNKAR++N+DS+
Sbjct  4078  SDQMTAKDRFAPPKIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSN  4137

Query  4131  YNIDMESYRTKLAVPISKRFHSGKYTLKAENESGHDEASFEVIVLDKPGAPEGPLRITDV  4190
             YNIDMESYRTKL VPISKRFHSGKYTLKAENESG DEASFEVIVLDKPG PEGPLR+TDV
Sbjct  4138  YNIDMESYRTKLTVPISKRFHSGKYTLKAENESGRDEASFEVIVLDKPGPPEGPLRVTDV  4197

Query  4191  HKEGCKLKWNAPLDDGGLPIEHYIVEKMDVESGRWLPSGRFKEPFAELNNLEPGHEYKFR  4250
             HKEGCKLKWNAPLDDGGLPI+HYI+EKMDVESGRWLPSGRFKE FAELNNLEP HEYKFR
Sbjct  4198  HKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGRWLPSGRFKESFAELNNLEPSHEYKFR  4257

Query  4251  VLAVNTEGESEPLTGEQSIIAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPIT  4310
             VLAVNTEGESEPLTGEQS+IAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPIT
Sbjct  4258  VLAVNTEGESEPLTGEQSVIAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPIT  4317

Query  4311  GYIVEKREKGTDKWIKGTEVTAPRFGEECKASVPNLNENCEYEFRIKAINAAGPGEPSDA  4370
             GY+VEKREKGTDKWIKGTE+T P  GEECKA+VP LNENCEYEFR+KAINAAGPGEPSDA
Sbjct  4318  GYVVEKREKGTDKWIKGTEITIPCLGEECKATVPTLNENCEYEFRVKAINAAGPGEPSDA  4377

Query  4371  SKSVITKPRKLAPKIDRKNIRTYNVKAGEIIFLDINVSGEPAPDVTWNQNNKSVQATSVS  4430
             SK +ITKPRKLAPKIDRKNIRTYN K+GE IFLDIN+SGEPAPDVTWNQNNKSVQ TS S
Sbjct  4378  SKPIITKPRKLAPKIDRKNIRTYNFKSGEPIFLDINISGEPAPDVTWNQNNKSVQTTSFS  4437

Query  4431  YIQDVPYNTKYINNNPERKDTGLYKISAHNLYGQDQVEFQINIITKPGKPEGPLEVSDIH  4490
             +I+++PYNTKYINNNPERKDTGLYKISAHN YGQDQVEFQINIITKPGKPEGPLEVS++H
Sbjct  4438  HIENLPYNTKYINNNPERKDTGLYKISAHNFYGQDQVEFQINIITKPGKPEGPLEVSEVH  4497

Query  4491  KDGCKLKWKKPKDDGGEPIDSYIVEKFDPDTGIWLAVGKTDTPEYTVDSLVPGHEYKFRV  4550
             KDGCKLKWKKPKDDGGEP++SY+VEKFDPDTGIWL VG++D PEY VD LVPGH+YKFRV
Sbjct  4498  KDGCKLKWKKPKDDGGEPVESYLVEKFDPDTGIWLPVGRSDGPEYNVDGLVPGHDYKFRV  4557

Query  4551  KAVNKEGYSEPLETLGSIIAKDPFTAPSKPGVPEATDWTANKVELAWPEPASDGGSPITG  4610
             KAVNKEG SEPLETLGSIIAKDPF+ P+KPGVPE TDWTANKVELAWPEPASDGGSPI G
Sbjct  4558  KAVNKEGESEPLETLGSIIAKDPFSVPTKPGVPEPTDWTANKVELAWPEPASDGGSPIQG  4617

Query  4611  YIIEVKDKYSPLWEKALETVSPTPIATVQGLIEGNEYQFRVIALNKGGQSEPSDASKIFI  4670
             YI+EVKDKYSPLWEKALET SPTP ATVQGLIEGNEYQFRV+ALNKGG SEPSD SKIF 
Sbjct  4618  YIVEVKDKYSPLWEKALETNSPTPTATVQGLIEGNEYQFRVVALNKGGLSEPSDPSKIFT  4677

Query  4671  AKPRYLAPRIDRRNLRDISLSSGTALKLDANIIGEPVPKVEWKFSNYSLQSGKNVTIETP  4730
             AKPRYLAP+IDRRNLR+I+LSSGTALKLDANI GEP PKVEWK SNY LQSGKNVTIETP
Sbjct  4678  AKPRYLAPKIDRRNLRNITLSSGTALKLDANITGEPAPKVEWKLSNYHLQSGKNVTIETP  4737

Query  4731  DYYTKLVIRPTQRNDSGEYLVIATNSSGKDSVLVNVIITDKPTPPNGPLQISDVHKEGCH  4790
             DYYTKLVIRPTQR+DSGEYLV ATN+SGKDSVLVNV+ITDKP+PPNGPLQISDVHKEGCH
Sbjct  4738  DYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVITDKPSPPNGPLQISDVHKEGCH  4797

Query  4791  LKWKRPSDDGGTPIEYFQIDKLDPETGCWIPTCRSSEPQVDVTGLTPGNEYKFRVSAVNS  4850
             LKWKRPSDDGGTPIEYFQIDKL+PETGCWIP+CRS+EPQVDVTGL+PGNEYKFRVSAVN+
Sbjct  4798  LKWKRPSDDGGTPIEYFQIDKLEPETGCWIPSCRSTEPQVDVTGLSPGNEYKFRVSAVNA  4857

Query  4851  EGESQPLVGEETIIAKNPFDEPGKPENLKATDWDKDHIDLAWTPPLTDGGSPICGYIVEK  4910
             EGESQPLVG+E+I+A+NPFDEPGKPENLKATDWDKDH+DLAWTPPL DGGSPI  YI+EK
Sbjct  4858  EGESQPLVGDESIVARNPFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIEK  4917

Query  4911  KDKYGKWEKTLDVPADQCKATIPDLVENQVYEFRVSAVNAAGPGEPSDATPPVIAKSRNK  4970
             +DKYGKWE+ LDVPADQCKATIPDLVE Q Y+FRVSAVNAAG GEPSD+TPP+IAK+RNK
Sbjct  4918  QDKYGKWERALDVPADQCKATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARNK  4977

Query  4971  PPVIDRSNLIEIRIKAGQAFTFDCKVSGEPAPRTKWIFKKKDLYSKDNVKVTNVDYNTKL  5030
             PP+IDRS+L+E+RIKAGQ+FTFDCKVSGEPAP+TKW+ KKK++YSKDNVKVTNVDYNTKL
Sbjct  4978  PPIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKWLLKKKEVYSKDNVKVTNVDYNTKL  5037

Query  5031  KVTSATRSDSGVYTVHAENANGEDCAEVKVTVIDIPSPPNGPLNIDEINSESCSLHWNPP  5090
             KV SATRSDSG+YTV AENANGED A+VKVTVID P+PPNGPL +DEINSESC+LHWNPP
Sbjct  5038  KVNSATRSDSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPP  5097

Query  5091  DNDGGQPIDNYVVEKLDEATGRWVPGGETDGPITSLKVKGLTPGHKYKFRVRAKNRQGLS  5150
             D+DGGQPIDNYVVEKLDE TGRW+P GETDGP+T+LKV GLTPGHKYKFRVRAKNRQG S
Sbjct  5098  DDDGGQPIDNYVVEKLDETTGRWIPAGETDGPVTALKVGGLTPGHKYKFRVRAKNRQGTS  5157

Query  5151  DPLTTLHAIEAKNPYDQPSKPGTPTIKDFDRDFVDLEWSRPESDGGSVITGYIIEKRDKY  5210
             +PLTT  AI AKNP+D P+KPGTPTIKDFD++FVDLEW+RPE+DGGS ITGY++EKRDK+
Sbjct  5158  EPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEWTRPEADGGSPITGYVVEKRDKF  5217

Query  5211  SPDWEKCAEISDDITNAYVPDLIEGLKYEFRVRAVNKAGPGSPSDPTEPHLARPKNMPPK  5270
             SPDWEKCAEISDDITNA+VPDLIEGLKYEFRVRAVNKAGPGSPSD TE H+ARPKN PPK
Sbjct  5218  SPDWEKCAEISDDITNAHVPDLIEGLKYEFRVRAVNKAGPGSPSDATETHVARPKNTPPK  5277

Query  5271  IDRNFMSDIKIKAGNIFEFDVPVTGQPLPSKEWTHEGNMVINTDRVKIVNDDDRTKIRIL  5330
             IDRNFMSDIKIKAGN+FEFDVPVTG+PLPSK+WTHEGNM+INTDRVKI N DDRTKIRIL
Sbjct  5278  IDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMIINTDRVKISNFDDRTKIRIL  5337

Query  5331  DSKRSDTGDYTLIARNINGIDRHTVRVSVLDVPSVPEGPLRNGDTTKNSIVLRWRPPKDD  5390
             D+KRSDTG YTL ARNING DRH V+V++LD PSVPEGPLRNGD +KNSIVLRWRPPKDD
Sbjct  5338  DAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKDD  5397

Query  5391  GGSEITHYIVEKMDNDAMRWVPVGECTDTETRADNLIENHDYSFRVRAVNKQGQSQPLTT  5450
             GGSEITHY+VEKMDN+AMRWVPVG+CTDTE RADNLIENHDYSFRVRAVNKQGQSQPLTT
Sbjct  5398  GGSEITHYVVEKMDNEAMRWVPVGDCTDTEIRADNLIENHDYSFRVRAVNKQGQSQPLTT  5457

Query  5451  SQPITAKDPYSHPDKPGPPQATDWGKDFVDLEWAAPKRDGGAPISSYIIQKRPKFGQWER  5510
             SQPITAKDPYSHPDKPG PQATDWGK FVDLEW+ PKRDGGAPISSYII+KRPKFGQWER
Sbjct  5458  SQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFGQWER  5517

Query  5511  AAVVPGENCKAHIPELTDGGEYEFRVIAVNQGGPSDPSDPSASIICKPRFLAPFFDKSLL  5570
             AAVV G+NCKAH+PELT+GGEYEFRVIAVN+GGPSDPSDPS++IICKPRFLAPFFDKSLL
Sbjct  5518  AAVVLGDNCKAHVPELTNGGEYEFRVIAVNRGGPSDPSDPSSTIICKPRFLAPFFDKSLL  5577

Query  5571  NDITIHAGKRLGWTLPIEASPRPSVKWLYNGKEIGSNLRAETGIFQNELTFEIQSSLRSD  5630
             NDIT+HAGKRLGWTLPIEASPRP + WLYNGKEIGSN R E+G+FQNELTFEI SSLRSD
Sbjct  5578  NDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGSNSRGESGLFQNELTFEIVSSLRSD  5637

Query  5631  EGRYTVILKNEHGTFDASAHATVLDRPSPPNGPLDITKITRDGCHLTWNIPDDDGGSPIL  5690
             EGRYT+ILKNEHG+FDASAHATVLDRPSPP GPLDITKITRDGCHLTWN+PDDDGGSPIL
Sbjct  5638  EGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDGCHLTWNVPDDDGGSPIL  5697

Query  5691  HYIIEKMDLSRSTWTDAGMSTHTVHDVTRLVHRKEYLFRVKAVNAIGESDPLEAARSIIA  5750
             HYIIEKMDLSRSTW+DAGMSTH VHDVTRLVHRKEYLFRVKAVNAIGESDPLEA  +IIA
Sbjct  5698  HYIIEKMDLSRSTWSDAGMSTHIVHDVTRLVHRKEYLFRVKAVNAIGESDPLEAVNTIIA  5757

Query  5751  KNEFDEPDSPGKPNITDWDRDHVDLQWASPKSDGGAPIMEYIIQKKEKGSPYWTNVLHVP  5810
             KNEFDEPD+PGKP ITDWDRDH+DLQWA PKSDGGAPI EYIIQKKEKGSPYWTNV HVP
Sbjct  5758  KNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPYWTNVRHVP  5817

Query  5811  SNKTIATVPELTEGKEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKILTPLSEIRLK  5870
             SNK   T+PELTEG+EYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKI+TPL+E+R+K
Sbjct  5818  SNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIITPLNEVRIK  5877

Query  5871  CGLIFHTDIHFIGEPVPEATWTLNGCPLKSNEKSTITAIGHHTVVHTVNCQRSDSGIYHL  5930
             CGLIFHTDIHFIGEP PEATWTLN  PL SN++STIT+IGHH+VVHTVNCQRSDSGIYHL
Sbjct  5878  CGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVNCQRSDSGIYHL  5937

Query  5931  LLRNSSGIDEGSFELIVLDRPGTPEGPMEYEEVTGNSVTISWKPPKDNGGSEISSYIIEK  5990
             LLRNSSGIDEGSFEL+VLDRPG PEGPMEYEE+T NSVTISWKPPKDNGGSEISSY+IEK
Sbjct  5938  LLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIEK  5997

Query  5991  RDLTHGGGWVPAINYVNAKYNHAMVPRLLEGTLYEFRVMAENLQGRSDPLTSDQPVVAKN  6050
             RDLTHGGGWVPA+NYV+AKYNHA+VPRLLEGT+YE RVMAENLQGRSDPLTSDQPVVAK+
Sbjct  5998  RDLTHGGGWVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAKS  6057

Query  6051  QYTVPGVPGKPELTDSDKDHISIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVA  6110
             QYTVPG PGKPELTDSDK+HI+IKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPV 
Sbjct  6058  QYTVPGAPGKPELTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVP  6117

Query  6111  TTEYQDDRVTPNHTYQYRISGVNAAGSGKASEPSNTFDARPLREKPRLYLDSLLGRRVKV  6170
             T EYQDDRVT NH YQYRIS VNAAG+GK SEPS  F+ARPLREKPR Y D L+G+R+KV
Sbjct  6118  TAEYQDDRVTSNHQYQYRISAVNAAGNGKTSEPSAIFNARPLREKPRFYFDGLIGKRIKV  6177

Query  6171  RAGEPVNLTIPIAGAPTPNIEWKRGDFKFEEGKRISYETNSERTIFRIDNSNREDSGKYT  6230
             RAGEPVNL IPI+GAPTP IEWKRGD K EEGKRISYETNSERT+FRID+SNR DSGKYT
Sbjct  6178  RAGEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRISYETNSERTLFRIDDSNRRDSGKYT  6237

Query  6231  VTAFNEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLKWNSPKDNGGSDITGYIIE  6290
             VTA NEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISL W SPKD+GGSDITGYIIE
Sbjct  6238  VTAANEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLHWYSPKDDGGSDITGYIIE  6297

Query  6291  FTEFGLDDWKPVPGYCSKTNNTVKGLVEGKKYIFRVRAENIYGASEALEGKPVLAKSPFD  6350
             FTEFG+DDWKPVPG C  TN TVK LVEGKKY+FR+RAENIYGASEALEGKPVLAKSPFD
Sbjct  6298  FTEFGVDDWKPVPGTCPNTNFTVKNLVEGKKYVFRIRAENIYGASEALEGKPVLAKSPFD  6357

Query  6351  PPGAPSQPKITVYTPNSATLEWHPPDYCGGKPITGYIVERRERGGEWIKCNNYPTPNTSY  6410
             PPGAPSQP I+ YTPNSA LEWHPPD CGGKPITGYIVERRERGGEWIKCNNYPTPNTSY
Sbjct  6358  PPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVERRERGGEWIKCNNYPTPNTSY  6417

Query  6411  TVPDLRDGARYEFRIIAVNEAGPGQPSKPSDPMTAEHQRYRPDAPESPKPDRISRDNVTL  6470
             TV +LRDGARYEFR++AVNEAGPG PSKPSDPMTAEHQRYRPD PE PKPDRI+R+ VTL
Sbjct  6418  TVSNLRDGARYEFRVLAVNEAGPGHPSKPSDPMTAEHQRYRPDPPEPPKPDRITRNGVTL  6477

Query  6471  SWRPPRNDGKSRIKGYFIEIRPKNEKDWKIVNDLPINSTVYTVPNLKEGEEYSFRVIAEN  6530
             SWRPPR DGKSRIKGY++E+RPKN KDWK VND+PINSTVYTVP+LKEGEEYSFRV+AEN
Sbjct  6478  SWRPPRTDGKSRIKGYYVEMRPKNGKDWKTVNDIPINSTVYTVPSLKEGEEYSFRVVAEN  6537

Query  6531  EVGRSNPSKPSQPITIEEQPNKPCMELGGVRDIVCRAGDDFSIHVPYIAFPKPSAFWYSN  6590
             EVGRS+PSKPSQPITIEEQPNKPCMELG VRDIVCRAGDDFSIHVPY+AFPKP+AFWYSN
Sbjct  6538  EVGRSDPSKPSQPITIEEQPNKPCMELGKVRDIVCRAGDDFSIHVPYLAFPKPNAFWYSN  6597

Query  6591  DSVLDDDNRVHQHLTDEAASFVVKNSKRSDSGQYRLQLKNPSGFDTATINVSVLDRPSPP  6650
             D++LDD+NRVH+HLTD+AAS VVKNSKR+DSGQYRLQLKN SGFDTATINV VLDRPSPP
Sbjct  6598  DNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSGFDTATINVRVLDRPSPP  6657

Query  6651  THLRADEFAGDSLTLYWNPPNDDGGSPIQNYIIEKKEARGSTWTKISSFCTVPFLRIRNL  6710
             T LRADEF+GDSLTLYWNPPNDDGGS IQNYIIEKKEAR STW+K+SSFCTVPF+RIRNL
Sbjct  6658  TRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKKEARSSTWSKVSSFCTVPFVRIRNL  6717

Query  6711  VINKEYDFRVLAENKCGQSDPANTSEPIRARHPFDVPNTPGIPHGIDSTEDSITIAWSKP  6770
             V+NKEYDFRV+AENK GQSDPANTSEPI ARHPFD+PNTPGIPHGIDSTEDSITIAW+KP
Sbjct  6718  VLNKEYDFRVIAENKYGQSDPANTSEPILARHPFDIPNTPGIPHGIDSTEDSITIAWTKP  6777

Query  6771  KHDGGSPITGYVLEKRLLSDDKWTKAVNALCPDLTCKIPNLIENAEYEFRVAAVNAAGQS  6830
             KHDGGSPITGY++EKRLLSDDKWTKAV+ALCPDL+CKIPNLIENAEYEFRVAAVNAAGQS
Sbjct  6778  KHDGGSPITGYIIEKRLLSDDKWTKAVHALCPDLSCKIPNLIENAEYEFRVAAVNAAGQS  6837

Query  6831  AFSGSSDLIFCRRPPHSPKITSDLSIRDMTVIAGDEFHITVPYHANPRPTPSWSINGIQV  6890
             A+SGSSDLIFCRRPPH+PKITSDLSIRDMTVIAGDEF ITVPYHA+PRPT SWS+NG++V
Sbjct  6838  AYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDEFRITVPYHASPRPTASWSLNGLEV  6897

Query  6891  TPDERIKFVSDDYSSVYYNKSAKRCETGSYAITLTNNKGSDTASCHVTVVDRPGPPQGPL  6950
              P ERIKF S+DY+S+YYNKSAKR ETGSY ITLTNNKGSDTASCHVTVVDRP PPQGPL
Sbjct  6898  IPGERIKFDSNDYASMYYNKSAKRDETGSYTITLTNNKGSDTASCHVTVVDRPLPPQGPL  6957

Query  6951  NAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLDTSGSWVKVSSFVRNIHYDVMGLEPQH  7010
             NAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLD SGSWVK+SSFVRN HYDVMGLEP +
Sbjct  6958  NAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLDNSGSWVKISSFVRNTHYDVMGLEPHY  7017

Query  7011  KYYFRVRAENQYGLSDPLDISDPIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRPAGDG  7070
             KY FRVRAENQYGLSDPLDI +PIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRP  DG
Sbjct  7018  KYNFRVRAENQYGLSDPLDIIEPIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRPLSDG  7077

Query  7071  GSRIQGYQIEYRDIVNDSSWNTYDYLIKDTKYQLYNLTNGSEYEFRIRAKNAAGLSKPSP  7130
             GSRIQGYQIEYRDI+NDSSWN YDY+IKDTKYQLYNL NGSEYEFRI+AKNAAGLSKPS 
Sbjct  7078  GSRIQGYQIEYRDILNDSSWNAYDYIIKDTKYQLYNLINGSEYEFRIKAKNAAGLSKPSS  7137

Query  7131  PSLRFKLKGKFSVPSPPGTPQVTRVGKNYVDLKWEKSLRDGGSRITSYIIERRDIGGAVW  7190
             PSLRFKLKGKF+VPSPPG PQVTRVGKNYVDLKWEK LRDGGSRIT YIIERRDIGGAVW
Sbjct  7138  PSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAVW  7197

Query  7191  VKCNDYNVLDTEYTVINLIEMGDYEFRIFAVNSAGRSDPSLCTMPIRVCEVLGGEKPEWI  7250
             VKCNDYNVLDTEYTV+NLIEMGDYEFR+FAVNSAGRS+PSLCTMPI+VCEVLGG+KP+WI
Sbjct  7198  VKCNDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDWI  7257

Query  7251  KRLQDRVAPYGKDFTLQCAASGKPSPTARWLRNGKEIQMGCGRFTCDNKDGLFRLHISNV  7310
              RLQD+VAP+GKD+TLQCAASGKPSPTARWLRNGKEIQM  GR TCD+KDG+FRLHISNV
Sbjct  7258  TRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKEIQMNGGRMTCDSKDGVFRLHISNV  7317

Query  7311  QSGDDADYTCEAINSLGFVHTSGYLKIGSPPIINRCPNELYLPEGDNTKIKVYYSGDQPL  7370
             Q+GDD DYTCEA+NSLGFV+TSGYLKIGSPPIINRCP+EL LPEGDN+KIK++YSGDQPL
Sbjct  7318  QTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRCPSELKLPEGDNSKIKIFYSGDQPL  7377

Query  7371  TVILRKNNEVISDSNDETHVKLNIFDDYVAICIRDIVKSDSGKYQIEFTNDSGSAIGQFD  7430
             TVIL+KNNEVI DSND+THVK+NIFDDYVAI IR+IVKSD G YQIEFTN+SGSA G+F 
Sbjct  7378  TVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIVKSDGGPYQIEFTNESGSATGEFY  7437

Query  7431  VYVTGLPTAPTGPLGISFINKNSCTLGWRLPSYDGGLKITHYVVERKDVKSPHWITVSST  7490
             V++TG+P+APTGP+GIS+INKNSC L WR PSYDGGLK++HYV+ERKDV SPHWITVSST
Sbjct  7438  VHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDVSSPHWITVSST  7497

Query  7491  CKDTTFSVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKAPLDPPSPPGIPQITEIG  7550
             CKDT F+VQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAK P+DPPSPPG PQITEIG
Sbjct  7498  CKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDPPSPPGSPQITEIG  7557

Query  7551  GDFVHLEWSKPESDGGAHIQGYWIDKQEVGSNTWQRVNVTICAANQINCVNLIEGRQYEF  7610
             GDFVHLEW KPESDGGAHIQGYWIDK+EVGSNTWQRVN TICAANQINC+NLIEGRQYEF
Sbjct  7558  GDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQRVNATICAANQINCINLIEGRQYEF  7617

Query  7611  RIFAQNVAGISKESSASQVVKIIDPKGASPPLIVKPLSDANCIQNHNAQFTCTISGVPKP  7670
             RIFAQNVAG+S ESSASQ VKIIDP+ ASPPLIVKPL DANCIQNHNAQFTCTI+GVPKP
Sbjct  7618  RIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKPLRDANCIQNHNAQFTCTINGVPKP  7677

Query  7671  TVTWYKGAREISNGARYHMYSEGENHFLNINDIFGEDADEYVCRAVNKAGAKSTRAALAI  7730
             T++WYKGAREISNGARYHMYSEG+NHFLNIND+FGEDADEYVCRAVNKAGAKSTRA LAI
Sbjct  7678  TISWYKGAREISNGARYHMYSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRATLAI  7737

Query  7731  MTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVREGENIECGGHYTVETKER  7790
             MTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVR+GENIE GGHYTVE KER
Sbjct  7738  MTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVRDGENIESGGHYTVEVKER  7797

Query  7791  HAVLIIRDGSRMDSGPYRIAAENELGSDTAIIQVQISDRPDPPRFPLIESIGSDSLSLSW  7850
             HAVLIIRDGS +DSGPYRI AENELGSDTAIIQVQISDRPDPPRFPLIESIG++SLSLSW
Sbjct  7798  HAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPLIESIGTESLSLSW  7857

Query  7851  KAPVWDGGSDITNYYIERREHPLSSWIRVGNTRFTSIAVCGLTSGKEYDFRISADNVYGR  7910
             KAPVWDG SDITNYY+ERREHPLSSWIRVGNTRFTS+AV GLT GKEYDFRI ADNVYGR
Sbjct  7858  KAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNVYGR  7917

Query  7911  SEPSETSTLIKTKESTKKKPVERKWQIDTNGRKVRGTADGPIKDYDSYVFDIYSKFVPQP  7970
             S+ S+TSTLIKTKES KKKP+ERKW+ID NGRK+RG ADGP+KDYDSYVFDIYSKFVPQP
Sbjct  7918  SDASDTSTLIKTKESVKKKPIERKWEIDANGRKLRGKADGPVKDYDSYVFDIYSKFVPQP  7977

Query  7971  VEISQQSVYDKYDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHSIEKDLIRREIDV  8030
             VEISQQSVYD+YDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHS+EKDLIRREID+
Sbjct  7978  VEISQQSVYDRYDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHSVEKDLIRREIDI  8037

Query  8031  MNQLHHQKLINLHDAFEDDDEMVLILEFLSGGELFERITAENYIMSEAEVINYMRQICEG  8090
             MNQLHHQKLINLHDAFEDDDEM+LILEFLSGGELFERITAE Y+M+EAEVINYMRQICEG
Sbjct  8038  MNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICEG  8097

Query  8091  IRHMHEKNIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEI  8150
             IRHMHE+NIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEI
Sbjct  8098  IRHMHEQNIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPEI  8157

Query  8151  VNREPVGFYTDMWATGVLAYVLLSGLSPFAGDNDVQTLKNVKSCDWDFDVESFKNISEEA  8210
             VNREPVGFYTDMWATGVL+YVLLSGLSPFAGDNDVQTLKNVK+CDWDFDVESFK ISEEA
Sbjct  8158  VNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEEA  8217

Query  8211  KDFIRKLLVANKEKRMTAHECLLHPWLTGDHKGITQTINRDRYLAYREKLRKKYEDFERY  8270
             KDFIRKLLV NKEKRMTAHECLLHPWLTGDH  + Q INRDRYLAYREKLR+KYEDFER+
Sbjct  8218  KDFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAMKQEINRDRYLAYREKLRRKYEDFERF  8277

Query  8271  LLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSSQFCYEGQSVKFYCRCIA  8330
             LLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSSQFCYEGQSVKFYCRCIA
Sbjct  8278  LLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSSQFCYEGQSVKFYCRCIA  8337

Query  8331  IATPTLTWSHNNIELRQSVKFMKRYTGDDYYFIINRVKLDDRGEYIIRAENHYGSREEVV  8390
             IATPTLTWSHNNIELRQSVKFMKRY GDDYYFIINRVKLDDRGEYIIRAENHYGSREEVV
Sbjct  8338  IATPTLTWSHNNIELRQSVKFMKRYVGDDYYFIINRVKLDDRGEYIIRAENHYGSREEVV  8397

Query  8391  FLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLL  8450
             FLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLL
Sbjct  8398  FLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLL  8457

Query  8451  CCLSGKPVPTVKWYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKALNCHGTD  8510
             CCLSGKPVP V+WYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKA NCHGTD
Sbjct  8458  CCLSGKPVPNVRWYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKATNCHGTD  8517

Query  8511  ETECVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQPMKPAPTPIVTSRQFAPLSSQGTSK  8570
             ET+CVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQP+KPAP PIVTSRQ+   S Q TS+
Sbjct  8518  ETDCVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQPIKPAPLPIVTSRQYTSSSVQNTSE  8577

Query  8571  SSSNNTTGTITSSSGTQNSISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKPE  8630
                +        S+   + ISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKPE
Sbjct  8578  PQGDKV----NVSNSNSSGISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKPE  8633

Query  8631  FTKPLHDLTIRDGDQLILICHVKGDPEPQITWSKNGKSISSSDIMDLKYKNGIATLTIHE  8690
             FTKPLHDLTI DG+QLIL C+VKGDPEPQI+WSKNGKS+SSSDI+DL+YKNGIATLTI+E
Sbjct  8634  FTKPLHDLTIHDGEQLILTCYVKGDPEPQISWSKNGKSLSSSDILDLRYKNGIATLTINE  8693

Query  8691  VFPEDEGVFTCTATNSICAVETKCKLTIMPLDKSSPKRKMIAGDKAPKIVSHLESRLVKD  8750
             VFPEDEGV TCTATNS+ AVETKCKLTI PLDK+  KRK+ AGD APKIVSHLESR V+D
Sbjct  8694  VFPEDEGVITCTATNSVGAVETKCKLTIQPLDKNINKRKVNAGDNAPKIVSHLESRFVRD  8753

Query  8751  GDAVTLACRIIGAENFDVVWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPEDSGTYTCE  8810
             GDAV LACRIIGA++FDVVWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPED GTYTCE
Sbjct  8754  GDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPEDGGTYTCE  8813

Query  8811  AFNDVGESFSTCTINVNVPGDEPKHPSFAKFPISVSILEGESTTFTCEIDSELLNLVWVK  8870
             AFND+GESFSTCTINV VPGDE K PSF KFP SVS+LEGE TTF CEIDSELLNLVW+K
Sbjct  8814  AFNDIGESFSTCTINVTVPGDETKQPSFVKFPTSVSVLEGEGTTFECEIDSELLNLVWLK  8873

Query  8871  DGKPVDETLSRYSFTKDENRYAFTVAKCNMDDVGQYQVKAVAKKGESTCAFSMNVHNAE  8929
             DGKP+DETL RYSFTKD +RY+F VAKCNMDDVGQYQ KAV+ K ES CAFSMNVH AE
Sbjct  8874  DGKPIDETLPRYSFTKDGHRYSFAVAKCNMDDVGQYQAKAVSGKAESICAFSMNVHTAE  8932


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query  4     AEDFAPSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVE  63
             A D AP  +   +     DG+ +   C+++ +   D+ W  + NK         +I+P +
Sbjct  8735  AGDNAPKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHN-NK---------EIKPSK  8784

Query  64    DNKYT-----VVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFT-PADEPKEKQIDGF  117
             D +YT       L++ ++   D G Y  +A N  GE  ++  +N T P DE K+      
Sbjct  8785  DFQYTNEANIYRLQIAEIFPEDGGTYTCEAFNDIGESFSTCTINVTVPGDETKQ------  8838

Query  118   APTFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKES-SRHKLTVDKDVHSY  176
              P+F K P      +G+   FEC ++++    +VW  +G  + E+  R+  T  KD H Y
Sbjct  8839  -PSFVKFPTSVSVLEGEGTTFECEIDSELL-NLVWLKDGKPIDETLPRYSFT--KDGHRY  8894

Query  177   FATLEIQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEA  217
               +  +    ++D G+Y+  A +   ES    S+N  + E+
Sbjct  8895  --SFAVAKCNMDDVGQYQAKAVSGKAESICAFSMNVHTAES  8933


>L0MN91_DROME unnamed protein product
Length=8866

 Score = 16127 bits (41856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 7811/8940 (87%), Positives = 8348/8940 (93%), Gaps = 86/8940 (1%)

Query  1     MGVAEDFAPSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQ  60
             MGVAEDFAPSF+KKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRS+NK+VED RTKFKIQ
Sbjct  1     MGVAEDFAPSFVKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSDNKVVEDVRTKFKIQ  60

Query  61    PVEDNKYTVVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEP---KEKQIDGF  117
             PV +NKYTVVLELDDVVETDAGLYKVKA NKSGEVSASINLNFT         E QIDGF
Sbjct  61    PVGENKYTVVLELDDVVETDAGLYKVKAKNKSGEVSASINLNFTHGKFSLLENEGQIDGF  120

Query  118   APTFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYF  177
             APTFAKKPAIRQEEDGKRLLFECRVNADP P I+WFHNGAAVKES RHK+TVDKDVHSYF
Sbjct  121   APTFAKKPAIRQEEDGKRLLFECRVNADPIPAIIWFHNGAAVKESERHKITVDKDVHSYF  180

Query  178   ATLEIQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIR  237
             ATLEI NVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEG KPTFTERPVIR
Sbjct  181   ATLEILNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGIKPTFTERPVIR  240

Query  238   QSEDGGNVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVS  297
             QSEDGGNVTFECRCVGDPTP +TWSHGET LN+S RYKMSLTMDQKLYH+ACLEISSVVS
Sbjct  241   QSEDGGNVTFECRCVGDPTPTVTWSHGETELNESNRYKMSLTMDQKLYHIACLEISSVVS  300

Query  298   SDQGEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLE  357
             SDQGEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLE
Sbjct  301   SDQGEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLE  360

Query  358   AHPVPDIVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYG  417
             AHPVPDIVWYC+EKEI NNQRTKMTRKAI+KDSYILTLEIQNPTKEDGGNYRCNAIN+YG
Sbjct  361   AHPVPDIVWYCSEKEICNNQRTKMTRKAITKDSYILTLEIQNPTKEDGGNYRCNAINMYG  420

Query  418   ESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPIVTWYRGQEI  477
             ESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEP VTWYRGQ++
Sbjct  421   ESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPTVTWYRGQDL  480

Query  478   VEKSKKIKINTTVIADDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPD  537
             VEKSKKIKINTTVIA+DTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEP+
Sbjct  481   VEKSKKIKINTTVIAEDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPE  540

Query  538   PEGEGPTFVEKPRIISENNGKLVIMECKVKADPKPDVIWYRNGEVVKESNKIKTFIEQRG  597
             PEGEGPTF+EKPRI+SENNGKLVIMECKVKADPKPDVIW+RNGEV+KESNKIKTFIEQRG
Sbjct  541   PEGEGPTFIEKPRIVSENNGKLVIMECKVKADPKPDVIWFRNGEVIKESNKIKTFIEQRG  600

Query  598   DQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKRTV  657
             DQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKRTV
Sbjct  601   DQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTLNIEIVPVIKDKPKIIKIIKKRTV  660

Query  658   VIECTVASKFEPKCTWYKETNTVKESKRHVYIVEQTKDGEFAVKLEINNVDDSDKGAYKL  717
             VIECTVASKFEPKCTWYKET+TVKESKRHVY VEQTK+GEFAVKLEIN+V++SDKGAYKL
Sbjct  661   VIECTVASKFEPKCTWYKETSTVKESKRHVYQVEQTKEGEFAVKLEINDVEESDKGAYKL  720

Query  718   VASNEKGEAVSQIVNLVDIPEEERKPSKPEISRKLVDQKVSESKTFELLISIAHSDRKCK  777
             VASNEKGEAVSQIVNLVDIPEEERKP KPEISRKL DQKV+ESKTFELL+S++ +DRKCK
Sbjct  721   VASNEKGEAVSQIVNLVDIPEEERKPCKPEISRKLADQKVAESKTFELLVSLSQTDRKCK  780

Query  778   IEWYKGSTLIRETKDITTTFDGTTARLTFSSARTEHTSNYKVVVTNEVGKDESSCKVTVE  837
             +EWYKGST+IRETKDITTTFDGTTARLTFSSARTEHTSNYKV+VTNEVGKDESSCK+TVE
Sbjct  781   VEWYKGSTVIRETKDITTTFDGTTARLTFSSARTEHTSNYKVIVTNEVGKDESSCKITVE  840

Query  838   KSTKKKEGQPKSKTEKDTDQKEKEKEGEETPSDQPAISTDTQAEEEL-HIKETDPTKKLT  896
             K  KKKE +PK K +   +++ ++KE EE  ++       T+    +  I E DP ++LT
Sbjct  841   KVAKKKEEKPKEKEKTKNEKEVEQKEMEEDKNESGQSVAQTEGRINIEQISEGDPKEELT  900

Query  897   GNENSSENKNESSEANENQVNPPKSKHNKNNE--KDFSKPKHEEPKQNIGDKNDKNNKKQ  954
               E   + K ++ E  E+ V    S  ++  E  K  S  K ++  Q   DK  K ++ +
Sbjct  901   VKEEILD-KRDTQEVKESSVELQDSAGHEVPEPKKATSDSKLDQSNQKNLDKKHKTDQSE  959

Query  955   EKTS-----SDKPKENNKDPEKQQETQQIGLKKVERKGSIVSEKEEISSEVRRQSIFIEE  1009
              KT+     ++  K N ++ E+QQ T+QIGLKKV+RK SIVS KEEISS+VRR+S    +
Sbjct  960   SKTNKNVSLAEPIKSNKQESEEQQATEQIGLKKVDRKASIVSVKEEISSDVRRKSTIKAK  1019

Query  1010  EKIVADDKKVSSRRSSLAVEESKTDSRRSSVIEKKPLDQVDRKQLDANKNPQALKEEIPK  1069
             E+I  DDKK SSRRSSLAVEES T+SRRSS+I+KKPL+QVD K +DANKNPQ LKEEIP+
Sbjct  1020  EEITVDDKKASSRRSSLAVEESNTESRRSSIIDKKPLEQVDNKPIDANKNPQPLKEEIPR  1079

Query  1070  LKPAEKRRTSKVVEEEKQVEELPKLRKTSISQVKEEPKPEVAKPKAKAKGKPKPKYDELP  1129
             LKPAEKRRTSKV+EE K  E LPKLRK SI+QVKEE K   A PK KAK K KPKY+ELP
Sbjct  1080  LKPAEKRRTSKVIEEPKPDEGLPKLRKASIAQVKEEAK--PAAPKLKAKAKAKPKYEELP  1137

Query  1130  EIPDYERPQLEKYEKSEFTPSDFARDLEIPNKMEKPILDSGKKESEDPTQKKGMPRKAEI  1189
             EIPDYERPQLEKYEKS+FTPSDFARDLEIPNKMEKPI+DSGKKE     QK G+P+K +I
Sbjct  1138  EIPDYERPQLEKYEKSDFTPSDFARDLEIPNKMEKPIIDSGKKEPAVLAQKNGIPKKTDI  1197

Query  1190  IEKPAENIKSLKIGKGKLPDEDDSRDGATLKPVIIEPEDKSDAENKKLEQAEKPSVLDII  1249
             IE                                              + A++P  L + 
Sbjct  1198  IE----------------------------------------------QYADEPKGLKVG  1211

Query  1250  KQRRRSSIRNLMTKEPIQNESFLGVVLKPVIKDSKEQTAPQQAIQLTKANATEQISSTRE  1309
             K            K P + +   G VLKPVI + +++       +  +ANATEQ S T+ 
Sbjct  1212  K-----------GKLPDEGDGRDGAVLKPVIIEPEKEILDLGNKKNNQANATEQFSPTKA  1260

Query  1310  IKAQISDLKKPEALATLEDDYERPLLEKYKPVSIDKNKSETPTPAINIPDTKHPEVKLPL  1369
             +KAQ++DLKKPE LATLED+YERP+LEKY P SIDK KSE  TP+I  PD + PEVKLP+
Sbjct  1261  VKAQVADLKKPETLATLEDNYERPVLEKYDPFSIDKTKSEKSTPSIITPDIRGPEVKLPV  1320

Query  1370  ETTKEEKQKVPRMQPPAPGEPPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIIN  1429
             + TKEEKQKVP+MQPPAPG+PPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIIN
Sbjct  1321  QETKEEKQKVPKMQPPAPGDPPKIEVIREKRPSLAPEPPSRRGSLIPPADTGRRPSLIIN  1380

Query  1430  DEKKLRPGEVMDTRLLRPGEVGEGQRRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGP  1489
             DEKKLRPGEVMDTR           RRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGP
Sbjct  1381  DEKKLRPGEVMDTR-----------RRRPSIDVRRPSVQDLEDLINKPSTPLRDVGDGGP  1429

Query  1490  PSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITL  1549
             PSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITL
Sbjct  1430  PSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTITL  1489

Query  1550  CMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPN  1609
             CMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPN
Sbjct  1490  CMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPN  1549

Query  1610  WGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRK  1669
             WGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRK
Sbjct  1550  WGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGKDKKVVFEARFSKPNCKPKWLFRK  1609

Query  1670  DEVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKP  1729
             DEVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKP
Sbjct  1610  DEVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEIGGVSSTAFLNVEEADPTYTFTKP  1669

Query  1730  LKKKLEGFTQHETTLECSVSSSMANVHWFKDNTKLESDDPRYLISKDINGNLKLIIKDSV  1789
             LKKKLEGFTQHETTLECSVSSSMANVHWFK+NTKLESDDPRYLISKDINGNLKLIIKDSV
Sbjct  1670  LKKKLEGFTQHETTLECSVSSSMANVHWFKNNTKLESDDPRYLISKDINGNLKLIIKDSV  1729

Query  1790  VEDAGLYRCQLDKQPDKTECNLKITEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQ  1849
             ++DAGLYRCQLDKQPDKTECNLK+TEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQ
Sbjct  1730  LDDAGLYRCQLDKQPDKTECNLKVTEYPYKFVKVLKSQQCIEKDTVTLACEIDDAMGEVQ  1789

Query  1850  WFRNGEEIKPDKRIQILKDGRKRKLVIKDCKVTDAGLFKCSTNADTTEAEIIINYQNRFN  1909
             W RNGEEIKPDKRIQI+KDGRKRKLVIKDCKVTDAG FKC+TNADTTE+EIIINYQNRFN
Sbjct  1790  WLRNGEEIKPDKRIQIVKDGRKRKLVIKDCKVTDAGQFKCTTNADTTESEIIINYQNRFN  1849

Query  1910  KKLKDTDAVERERLVLDVELQDQTAPCDWKLNGEPIVPSERIEVKNLGGGKHQLIFNSLD  1969
             KKLKDT+AVERE+L+LD+ELQDQTAPCDWK NGEPIVPSE IE+KN+GGGKHQLIF+SLD
Sbjct  1850  KKLKDTEAVEREKLILDIELQDQTAPCDWKFNGEPIVPSESIEIKNMGGGKHQLIFSSLD  1909

Query  1970  MSNEGEITCESGQLSSKCKLSIRKGESRPNIDCPDTFAGPISAPVLVKVPFKVSGTKQTP  2029
             MSNEGEITCESGQLSSKCKLSIRKGESRPNIDCPD F+GPISAPVL++VPFKVSGTKQTP
Sbjct  1910  MSNEGEITCESGQLSSKCKLSIRKGESRPNIDCPDKFSGPISAPVLLEVPFKVSGTKQTP  1969

Query  2030  IEAKLFKDGKPLPVKDVEVAVTDDNVTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIIC  2089
             +EAKLFKDGKPLPVKDVEVAVTDD VTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIIC
Sbjct  1970  VEAKLFKDGKPLPVKDVEVAVTDDKVTFKIKKPSRDLSGPYQIKISNGQGEDTKDVQIIC  2029

Query  2090  QDVPQPPQDVDITDVYQTSCVVNFKQPADDGGTPIINYVIERQDLSKKQGWEPVAEVQPS  2149
             QDVPQPPQDVDITDVYQTSCVV+F  P+DDGGTPI  YVIERQDLSKK GWE VAEV PS
Sbjct  2030  QDVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITKYVIERQDLSKKHGWESVAEVLPS  2089

Query  2150  EPCRKKIDDLVPKKQYRFRIRAVNAIGPSDPATFKNSILAKDPWDEPGKPKAVDLTDWDK  2209
             EPC KKIDDL+PKKQYRFRIRAVNAIG SDPATFKN+ILAKDPWDEPGKPKAVDLTDWDK
Sbjct  2090  EPCLKKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNTILAKDPWDEPGKPKAVDLTDWDK  2149

Query  2210  DHADLKWEAPDSDGGDPITAYIVEYKEKFSNDWVAGKEVDGDSRTATVDQLNEGQQYEFR  2269
             DHADLKWEAP++DGGDPITAYIVEYKEKFSNDWV+GKEVDGD+RTATVD L EGQQYEFR
Sbjct  2150  DHADLKWEAPETDGGDPITAYIVEYKEKFSNDWVSGKEVDGDARTATVDGLKEGQQYEFR  2209

Query  2270  VRAVNKAGPGEPSDKTKSIIAKCRFVKPFLVGDGLKNITVKKGQTIRFDVKYDGEPEPTA  2329
             VRAVN+AGPGEPSDKTKSIIAKCRFVKPF+VG+GLKN+TVKKGQTIRFD+KYDGEPEP A
Sbjct  2210  VRAVNRAGPGEPSDKTKSIIAKCRFVKPFIVGEGLKNVTVKKGQTIRFDIKYDGEPEPAA  2269

Query  2330  TWVKGTNNLNFDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSGSIESEAQVVVL  2389
             TWVKGT+NL FDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSG+IESEAQVVVL
Sbjct  2270  TWVKGTDNLKFDNQRICLDQLERNSSITIKKSVRKDTGKYKLVLSNSSGTIESEAQVVVL  2329

Query  2390  DRPLAPGGPFEPEEVRANHIKMKWNCPEDDGGCEITGYALERMDEETGRWIPAGEVGPNE  2449
             DRPL PGGPFEPEE+RA+HIKMKW  P+DDGGCEI+GYALERMDEETGRWIPAGEVGPNE
Sbjct  2330  DRPLPPGGPFEPEEIRASHIKMKWKRPDDDGGCEISGYALERMDEETGRWIPAGEVGPNE  2389

Query  2450  TSFDFKGLTPNKKYKFRVKAINKEGESDPLETSDAIVAKNPYDPPSAPSQPVIDDYDNKS  2509
             TSFDFKGLTPNKKYKFRVKAINKEGES+PLET DAIVA+NPYDPPS PSQPVIDDYDNKS
Sbjct  2390  TSFDFKGLTPNKKYKFRVKAINKEGESEPLETFDAIVARNPYDPPSPPSQPVIDDYDNKS  2449

Query  2510  VVLKWKRPPSDGGRPITHYIVEIKDKFSPTWSEVKKTEDPTPELTVEGLKESMVYQFRVR  2569
             V+LKWKRPPSDGGRPITHYIVEIKDKF+P+WSEV KT+DP PE  VEGLKE MVYQFRVR
Sbjct  2450  VLLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKTDDPNPECNVEGLKEKMVYQFRVR  2509

Query  2570  AVNKAGPSEPSQPTDNHICKYKNLKPQIDQSTFKRIVLKSGRTHKWSVDVIGEPVPELFW  2629
             AVNKAGPSEPSQPTDNH+CK+KNLKPQID+STFKR+ +KSGRTHKWSVDV+GEP+PEL W
Sbjct  2510  AVNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFKRVTIKSGRTHKWSVDVLGEPIPELHW  2569

Query  2630  SWRDDIPLTNGDRIKIENVDYHTDFRITNVLRKDSGFYTLKAENRNGIDRETVELVVLGK  2689
             SWRDDIPLTNGDRIKIENVDYHTDF ITNVLRKDSGFYTLKAENRNGIDRETVELVVLGK
Sbjct  2570  SWRDDIPLTNGDRIKIENVDYHTDFSITNVLRKDSGFYTLKAENRNGIDRETVELVVLGK  2629

Query  2690  PSSPKGPLAVDDVTATGCKLQWKKPEDDGGVPIKEYVVEKMDTSTGKWVRVGRSPGEKEP  2749
             PSSPKGPLAV DVTA+GCKLQWKKPEDDGGVPIKEYVVEKMDT+TGKWVRVGRSPGEKEP
Sbjct  2630  PSSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYVVEKMDTATGKWVRVGRSPGEKEP  2689

Query  2750  PSFDVTGLNPGSEYMFRVSAVNEEGESEPLTTLIGIVAKDPFDEPNKPGTPEVYDYDNQS  2809
             PSFDVTGL+ GSEYMFRVSAVNEEGESEPLTTL+G+VAKDPFDEPNKPGTPEV DYDNQS
Sbjct  2690  PSFDVTGLSLGSEYMFRVSAVNEEGESEPLTTLVGVVAKDPFDEPNKPGTPEVTDYDNQS  2749

Query  2810  VSLKWTPPNNDGGAPIQKYIIEKKDKNKPDWEKAAEIPGDQLEANVGGLQEYGEYQFRVI  2869
             +SLKW  PNNDGGAPIQKYIIEKK+KNK +WEKA EIPGDQLEA V GLQEYGEYQFRVI
Sbjct  2750  ISLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKALEIPGDQLEATVAGLQEYGEYQFRVI  2809

Query  2870  AVNKAGLSPPSDSSVPQIVKYKKLKPRIDRSNLKPLLIRAGKPVKYDVNVRGEPAPTITW  2929
             AVNKAGLSPPSD+SVPQIVKYKKLKPRIDRSNLKPLLIRAGKP++YDVNVRGEPAP ITW
Sbjct  2810  AVNKAGLSPPSDASVPQIVKYKKLKPRIDRSNLKPLLIRAGKPIRYDVNVRGEPAPVITW  2869

Query  2930  YHNNFELKQEELPSNCEIKNIPYNTKISIINTMRKHTGVYKIKAINEHGEDEATVEVNIL  2989
             Y N+ ELK EELPS+ EIKNIPYNTKISII T+RKHTG+YKI A+NEHG+DEATVEVNIL
Sbjct  2870  YQNDKELKPEELPSSSEIKNIPYNTKISIIETVRKHTGIYKIIAVNEHGQDEATVEVNIL  2929

Query  2990  APPGMPKGPLEVKDVTKDSCKLKWKKPEDDGGKPITAYQVEKFDKKQGRWVPVGRTSAND  3049
             APP  P+GPL+VKDVTKDSCKLKWKKPEDDGGKPI+AYQVEKFDKKQGRWVP+GRTSAND
Sbjct  2930  APPSKPRGPLDVKDVTKDSCKLKWKKPEDDGGKPISAYQVEKFDKKQGRWVPLGRTSAND  2989

Query  3050  TEFDVKGLQEGHEYQFRVKAINEEGESDPLETDSSIIAKNPYDLASKPGTPRIEDYNENM  3109
             TEFDVKGLQEGHEYQFRVKAINEEGESDPL++D SIIAKNPYD ASKPGTP I DYNE+M
Sbjct  2990  TEFDVKGLQEGHEYQFRVKAINEEGESDPLDSDDSIIAKNPYDAASKPGTPNIVDYNEHM  3049

Query  3110  VILKWEAPKSDGGAPITGYIIEKKDRFSPVWDEILSTNTTAPEATVTNLVEGNVYQFRIR  3169
             V LKWEAP+SDGGAPI+GYIIEKKD+FSP+WDEILSTNT+ PEATV  LVEGN+YQFR+R
Sbjct  3050  VKLKWEAPRSDGGAPISGYIIEKKDKFSPIWDEILSTNTSVPEATVEGLVEGNIYQFRVR  3109

Query  3170  AVNKAGPSEPSDATQPHLAKPRNLKPSINREKMKPIKVRAGQTVKFDVDVKGEPAPILTW  3229
             AVNKAG S+PSDAT+PHLAKPRNLKP INR+KMKPIKVRAGQ VKFDVDVKGEPAP LTW
Sbjct  3110  AVNKAGFSDPSDATEPHLAKPRNLKPYINRDKMKPIKVRAGQPVKFDVDVKGEPAPSLTW  3169

Query  3230  FLKETQLTTTPQVRLENEDYNTKLTLLDSSRNQSGEYKLRAENINGVDEALVEVIILDKP  3289
             FLKET+LT+T QVRLEN DYNTKLTLLD+ R QSG+YKLRAENINGVDEA+VEVIILDKP
Sbjct  3170  FLKETELTSTGQVRLENIDYNTKLTLLDTDRKQSGQYKLRAENINGVDEAVVEVIILDKP  3229

Query  3290  SKPQGPLEVADIHKEGCKLNWKKPKDDGGIPITGYVVEKMDVATGKWVPAGSVDPEKTDI  3349
             SKP+GP+EV+DIHKEGCKL W+KPKDDGGIPITGYV+EKMD ATGKWVPAGSVDPEK DI
Sbjct  3230  SKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYVIEKMDTATGKWVPAGSVDPEKYDI  3289

Query  3350  EIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPEFEDWDEHHVKL  3409
             EIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPE EDWDEHHVKL
Sbjct  3290  EIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPELEDWDEHHVKL  3349

Query  3410  KWEPPIRDGGSPITSYIIEVMDKDSGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVN  3469
             KWEPPIRDGGSPIT+YIIEVMDKDSGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVN
Sbjct  3350  KWEPPIRDGGSPITNYIIEVMDKDSGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVRAVN  3409

Query  3470  KAGPSEPSEQTNWHIAKPRFLKPYIDRNNLKPVVVKTGLSISLDINIRGEPAPKVEWFFN  3529
             KAGPS+PSEQTNWH+AKPRFLKP+IDR NLKPV+VKTGLSISLDINIRGEPAPKVEWFFN
Sbjct  3410  KAGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKTGLSISLDINIRGEPAPKVEWFFN  3469

Query  3530  AMPLISNEESIKIDNVDYNTKFFVMRAQRSQSGKYIIKARNEVGEDEAELEVTVLGKPGK  3589
                + S+E S+KIDNVDYNTKFFVMRAQRSQSGKYIIKA NEVGEDEAELEVTVLGKPGK
Sbjct  3470  NSSVTSDEHSVKIDNVDYNTKFFVMRAQRSQSGKYIIKATNEVGEDEAELEVTVLGKPGK  3529

Query  3590  PKGPLHVNDITKHSCKLKWEKPDDDGGTPIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIG  3649
             PKGPL VNDITKHSCKLKWEKPDDDGG+PIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIG
Sbjct  3530  PKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEKLDPHTGQWLPCGKSTEPEAKVIG  3589

Query  3650  LHEGKPYKFRVRAVNKEGESEDLETEKPIIAKNPFDEPEKPGRPNPTNWDKDFVDLAWDP  3709
             LHEGK YKFRVRAVNKEGESEDLETEKPIIAKNP+DEP++PG+P PTNWDKDFVDLAWDP
Sbjct  3590  LHEGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDEPDRPGKPEPTNWDKDFVDLAWDP  3649

Query  3710  PKNDGGAPIQKYIIQMRDKSGRAWVDAATVPGDKSNGTVTGIEEGHEYEFRIVAVNKAGP  3769
             PKNDGGAPIQKY+IQMRDKSGRAWVD+ATVPGDK NGTVTG+EEGHEYEFRIVAVNKAGP
Sbjct  3650  PKNDGGAPIQKYVIQMRDKSGRAWVDSATVPGDKCNGTVTGVEEGHEYEFRIVAVNKAGP  3709

Query  3770  SEPSDVSKSVVAKPRFLKPHIDRKNLQKKIMRSGQMLHMDAAVKAEPPAKITWTYNGTEI  3829
             S+PSDVSKSV+AKPRFLKPHIDRKNLQKKIMRSGQMLH+DA +KAEPPAK+TWTYN TEI
Sbjct  3710  SDPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQMLHIDALIKAEPPAKVTWTYNKTEI  3769

Query  3830  KTSDNLKIENEDYKTTFIIPKVKRVNRGKYVVTAKNDSGSDSVEVELEVVCKPSKPKGPL  3889
             KTSD++KIENEDYKTTFI+PKVKR +RG Y+VTAKNDSGSD+VEVELEV+CKPSKPKGPL
Sbjct  3770  KTSDHIKIENEDYKTTFIMPKVKRADRGIYIVTAKNDSGSDTVEVELEVLCKPSKPKGPL  3829

Query  3890  AVSEVTAESAHLKWDKPEDDGGEPIEQYIVERMDTETGRWVPVLTTKIPEADITGLTEGK  3949
             AVS VTAE+ HLKW+KPEDDGG+PIEQY+VERMDTETGRWVPVLTTK PEAD+TGLTEGK
Sbjct  3830  AVSNVTAETLHLKWEKPEDDGGDPIEQYLVERMDTETGRWVPVLTTKTPEADVTGLTEGK  3889

Query  3950  EYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQISDWSASHCDLKWRAPEDDG  4009
             EYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQI DWS +HCDLKWRAPEDDG
Sbjct  3890  EYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPGKPQIVDWSGNHCDLKWRAPEDDG  3949

Query  4010  GAPITGYLVEKKDPNTGKWQKALETNTPECKARVNDLITGKKYQFRVKAINKAGKSKPSE  4069
             GA ITGY+VE+KDPNTGKWQKALET+TP+CKARVNDLI G KYQFR+ A+NKAGKSKPSE
Sbjct  3950  GASITGYIVERKDPNTGKWQKALETSTPDCKARVNDLIAGNKYQFRIMAVNKAGKSKPSE  4009

Query  4070  PSDQMTARDRFAPPKIDRTNIKDITIKAGQHIRYDIKVSGEPPATKVWLHNKARIDNEDS  4129
             PSDQMTA+DRFAPPKIDRTNIKDITIKAGQHIR+DIKVSGEPPATKVWLHNKAR++N+DS
Sbjct  4010  PSDQMTAKDRFAPPKIDRTNIKDITIKAGQHIRFDIKVSGEPPATKVWLHNKARLENDDS  4069

Query  4130  DYNIDMESYRTKLAVPISKRFHSGKYTLKAENESGHDEASFEVIVLDKPGAPEGPLRITD  4189
             +YNIDMESYRTKL VPISKRFHSGKYTLKAENESG DEASFEVIVLDKPG PEGPLR+TD
Sbjct  4070  NYNIDMESYRTKLTVPISKRFHSGKYTLKAENESGRDEASFEVIVLDKPGPPEGPLRVTD  4129

Query  4190  VHKEGCKLKWNAPLDDGGLPIEHYIVEKMDVESGRWLPSGRFKEPFAELNNLEPGHEYKF  4249
             VHKEGCKLKWNAPLDDGGLPI+HYI+EKMDVESGRWLPSGRFKE FAELNNLEP HEYKF
Sbjct  4130  VHKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGRWLPSGRFKESFAELNNLEPSHEYKF  4189

Query  4250  RVLAVNTEGESEPLTGEQSIIAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPI  4309
             RVLAVNTEGESEPLTGEQS+IAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPI
Sbjct  4190  RVLAVNTEGESEPLTGEQSVIAKNPFDEPGKPGTPEAVDWDKDHVDLVWRPPINDGGSPI  4249

Query  4310  TGYIVEKREKGTDKWIKGTEVTAPRFGEECKASVPNLNENCEYEFRIKAINAAGPGEPSD  4369
             TGY+VEKREKGTDKWIKGTE+T P  GEECKA+VP LNENCEYEFR+KAINAAGPGEPSD
Sbjct  4250  TGYVVEKREKGTDKWIKGTEITIPCLGEECKATVPTLNENCEYEFRVKAINAAGPGEPSD  4309

Query  4370  ASKSVITKPRKLAPKIDRKNIRTYNVKAGEIIFLDINVSGEPAPDVTWNQNNKSVQATSV  4429
             ASK +ITKPRKLAPKIDRKNIRTYN K+GE IFLDIN+SGEPAPDVTWNQNNKSVQ TS 
Sbjct  4310  ASKPIITKPRKLAPKIDRKNIRTYNFKSGEPIFLDINISGEPAPDVTWNQNNKSVQTTSF  4369

Query  4430  SYIQDVPYNTKYINNNPERKDTGLYKISAHNLYGQDQVEFQINIITKPGKPEGPLEVSDI  4489
             S+I+++PYNTKYINNNPERKDTGLYKISAHN YGQDQVEFQINIITKPGKPEGPLEVS++
Sbjct  4370  SHIENLPYNTKYINNNPERKDTGLYKISAHNFYGQDQVEFQINIITKPGKPEGPLEVSEV  4429

Query  4490  HKDGCKLKWKKPKDDGGEPIDSYIVEKFDPDTGIWLAVGKTDTPEYTVDSLVPGHEYKFR  4549
             HKDGCKLKWKKPKDDGGEP++SY+VEKFDPDTGIWL VG++D PEY VD LVPGH+YKFR
Sbjct  4430  HKDGCKLKWKKPKDDGGEPVESYLVEKFDPDTGIWLPVGRSDGPEYNVDGLVPGHDYKFR  4489

Query  4550  VKAVNKEGYSEPLETLGSIIAKDPFTAPSKPGVPEATDWTANKVELAWPEPASDGGSPIT  4609
             VKAVNKEG SEPLETLGSIIAKDPF+ P+KPGVPE TDWTANKVELAWPEPASDGGSPI 
Sbjct  4490  VKAVNKEGESEPLETLGSIIAKDPFSVPTKPGVPEPTDWTANKVELAWPEPASDGGSPIQ  4549

Query  4610  GYIIEVKDKYSPLWEKALETVSPTPIATVQGLIEGNEYQFRVIALNKGGQSEPSDASKIF  4669
             GYI+EVKDKYSPLWEKALET SPTP ATVQGLIEGNEYQFRV+ALNKGG SEPSD SKIF
Sbjct  4550  GYIVEVKDKYSPLWEKALETNSPTPTATVQGLIEGNEYQFRVVALNKGGLSEPSDPSKIF  4609

Query  4670  IAKPRYLAPRIDRRNLRDISLSSGTALKLDANIIGEPVPKVEWKFSNYSLQSGKNVTIET  4729
              AKPRYLAP+IDRRNLR+I+LSSGTALKLDANI GEP PKVEWK SNY LQSGKNVTIET
Sbjct  4610  TAKPRYLAPKIDRRNLRNITLSSGTALKLDANITGEPAPKVEWKLSNYHLQSGKNVTIET  4669

Query  4730  PDYYTKLVIRPTQRNDSGEYLVIATNSSGKDSVLVNVIITDKPTPPNGPLQISDVHKEGC  4789
             PDYYTKLVIRPTQR+DSGEYLV ATN+SGKDSVLVNV+ITDKP+PPNGPLQISDVHKEGC
Sbjct  4670  PDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVITDKPSPPNGPLQISDVHKEGC  4729

Query  4790  HLKWKRPSDDGGTPIEYFQIDKLDPETGCWIPTCRSSEPQVDVTGLTPGNEYKFRVSAVN  4849
             HLKWKRPSDDGGTPIEYFQIDKL+PETGCWIP+CRS+EPQVDVTGL+PGNEYKFRVSAVN
Sbjct  4730  HLKWKRPSDDGGTPIEYFQIDKLEPETGCWIPSCRSTEPQVDVTGLSPGNEYKFRVSAVN  4789

Query  4850  SEGESQPLVGEETIIAKNPFDEPGKPENLKATDWDKDHIDLAWTPPLTDGGSPICGYIVE  4909
             +EGESQPLVG+E+I+A+NPFDEPGKPENLKATDWDKDH+DLAWTPPL DGGSPI  YI+E
Sbjct  4790  AEGESQPLVGDESIVARNPFDEPGKPENLKATDWDKDHVDLAWTPPLIDGGSPISCYIIE  4849

Query  4910  KKDKYGKWEKTLDVPADQCKATIPDLVENQVYEFRVSAVNAAGPGEPSDATPPVIAKSRN  4969
             K+DKYGKWE+ LDVPADQCKATIPDLVE Q Y+FRVSAVNAAG GEPSD+TPP+IAK+RN
Sbjct  4850  KQDKYGKWERALDVPADQCKATIPDLVEGQTYKFRVSAVNAAGTGEPSDSTPPIIAKARN  4909

Query  4970  KPPVIDRSNLIEIRIKAGQAFTFDCKVSGEPAPRTKWIFKKKDLYSKDNVKVTNVDYNTK  5029
             KPP+IDRS+L+E+RIKAGQ+FTFDCKVSGEPAP+TKW+ KKK++YSKDNVKVTNVDYNTK
Sbjct  4910  KPPIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKWLLKKKEVYSKDNVKVTNVDYNTK  4969

Query  5030  LKVTSATRSDSGVYTVHAENANGEDCAEVKVTVIDIPSPPNGPLNIDEINSESCSLHWNP  5089
             LKV SATRSDSG+YTV AENANGED A+VKVTVID P+PPNGPL +DEINSESC+LHWNP
Sbjct  4970  LKVNSATRSDSGIYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNP  5029

Query  5090  PDNDGGQPIDNYVVEKLDEATGRWVPGGETDGPITSLKVKGLTPGHKYKFRVRAKNRQGL  5149
             PD+DGGQPIDNYVVEKLDE TGRW+P GETDGP+T+LKV GLTPGHKYKFRVRAKNRQG 
Sbjct  5030  PDDDGGQPIDNYVVEKLDETTGRWIPAGETDGPVTALKVGGLTPGHKYKFRVRAKNRQGT  5089

Query  5150  SDPLTTLHAIEAKNPYDQPSKPGTPTIKDFDRDFVDLEWSRPESDGGSVITGYIIEKRDK  5209
             S+PLTT  AI AKNP+D P+KPGTPTIKDFD++FVDLEW+RPE+DGGS ITGY++EKRDK
Sbjct  5090  SEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEWTRPEADGGSPITGYVVEKRDK  5149

Query  5210  YSPDWEKCAEISDDITNAYVPDLIEGLKYEFRVRAVNKAGPGSPSDPTEPHLARPKNMPP  5269
             +SPDWEKCAEISDDITNA+VPDLIEGLKYEFRVRAVNKAGPGSPSD TE H+ARPKN PP
Sbjct  5150  FSPDWEKCAEISDDITNAHVPDLIEGLKYEFRVRAVNKAGPGSPSDATETHVARPKNTPP  5209

Query  5270  KIDRNFMSDIKIKAGNIFEFDVPVTGQPLPSKEWTHEGNMVINTDRVKIVNDDDRTKIRI  5329
             KIDRNFMSDIKIKAGN+FEFDVPVTG+PLPSK+WTHEGNM+INTDRVKI N DDRTKIRI
Sbjct  5210  KIDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHEGNMIINTDRVKISNFDDRTKIRI  5269

Query  5330  LDSKRSDTGDYTLIARNINGIDRHTVRVSVLDVPSVPEGPLRNGDTTKNSIVLRWRPPKD  5389
             LD+KRSDTG YTL ARNING DRH V+V++LD PSVPEGPLRNGD +KNSIVLRWRPPKD
Sbjct  5270  LDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVPEGPLRNGDVSKNSIVLRWRPPKD  5329

Query  5390  DGGSEITHYIVEKMDNDAMRWVPVGECTDTETRADNLIENHDYSFRVRAVNKQGQSQPLT  5449
             DGGSEITHY+VEKMDN+AMRWVPVG+CTDTE RADNLIENHDYSFRVRAVNKQGQSQPLT
Sbjct  5330  DGGSEITHYVVEKMDNEAMRWVPVGDCTDTEIRADNLIENHDYSFRVRAVNKQGQSQPLT  5389

Query  5450  TSQPITAKDPYSHPDKPGPPQATDWGKDFVDLEWAAPKRDGGAPISSYIIQKRPKFGQWE  5509
             TSQPITAKDPYSHPDKPG PQATDWGK FVDLEW+ PKRDGGAPISSYII+KRPKFGQWE
Sbjct  5390  TSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKFGQWE  5449

Query  5510  RAAVVPGENCKAHIPELTDGGEYEFRVIAVNQGGPSDPSDPSASIICKPRFLAPFFDKSL  5569
             RAAVV G+NCKAH+PELT+GGEYEFRVIAVN+GGPSDPSDPS++IICKPRFLAPFFDKSL
Sbjct  5450  RAAVVLGDNCKAHVPELTNGGEYEFRVIAVNRGGPSDPSDPSSTIICKPRFLAPFFDKSL  5509

Query  5570  LNDITIHAGKRLGWTLPIEASPRPSVKWLYNGKEIGSNLRAETGIFQNELTFEIQSSLRS  5629
             LNDIT+HAGKRLGWTLPIEASPRP + WLYNGKEIGSN R E+G+FQNELTFEI SSLRS
Sbjct  5510  LNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGSNSRGESGLFQNELTFEIVSSLRS  5569

Query  5630  DEGRYTVILKNEHGTFDASAHATVLDRPSPPNGPLDITKITRDGCHLTWNIPDDDGGSPI  5689
             DEGRYT+ILKNEHG+FDASAHATVLDRPSPP GPLDITKITRDGCHLTWN+PDDDGGSPI
Sbjct  5570  DEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDITKITRDGCHLTWNVPDDDGGSPI  5629

Query  5690  LHYIIEKMDLSRSTWTDAGMSTHTVHDVTRLVHRKEYLFRVKAVNAIGESDPLEAARSII  5749
             LHYIIEKMDLSRSTW+DAGMSTH VHDVTRLVHRKEYLFRVKAVNAIGESDPLEA  +II
Sbjct  5630  LHYIIEKMDLSRSTWSDAGMSTHIVHDVTRLVHRKEYLFRVKAVNAIGESDPLEAVNTII  5689

Query  5750  AKNEFDEPDSPGKPNITDWDRDHVDLQWASPKSDGGAPIMEYIIQKKEKGSPYWTNVLHV  5809
             AKNEFDEPD+PGKP ITDWDRDH+DLQWA PKSDGGAPI EYIIQKKEKGSPYWTNV HV
Sbjct  5690  AKNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGAPISEYIIQKKEKGSPYWTNVRHV  5749

Query  5810  PSNKTIATVPELTEGKEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKILTPLSEIRL  5869
             PSNK   T+PELTEG+EYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKI+TPL+E+R+
Sbjct  5750  PSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPSDMIMAKPRYLPPKIITPLNEVRI  5809

Query  5870  KCGLIFHTDIHFIGEPVPEATWTLNGCPLKSNEKSTITAIGHHTVVHTVNCQRSDSGIYH  5929
             KCGLIFHTDIHFIGEP PEATWTLN  PL SN++STIT+IGHH+VVHTVNCQRSDSGIYH
Sbjct  5810  KCGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTITSIGHHSVVHTVNCQRSDSGIYH  5869

Query  5930  LLLRNSSGIDEGSFELIVLDRPGTPEGPMEYEEVTGNSVTISWKPPKDNGGSEISSYIIE  5989
             LLLRNSSGIDEGSFEL+VLDRPG PEGPMEYEE+T NSVTISWKPPKDNGGSEISSY+IE
Sbjct  5870  LLLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITANSVTISWKPPKDNGGSEISSYVIE  5929

Query  5990  KRDLTHGGGWVPAINYVNAKYNHAMVPRLLEGTLYEFRVMAENLQGRSDPLTSDQPVVAK  6049
             KRDLTHGGGWVPA+NYV+AKYNHA+VPRLLEGT+YE RVMAENLQGRSDPLTSDQPVVAK
Sbjct  5930  KRDLTHGGGWVPAVNYVSAKYNHAVVPRLLEGTMYELRVMAENLQGRSDPLTSDQPVVAK  5989

Query  6050  NQYTVPGVPGKPELTDSDKDHISIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPV  6109
             +QYTVPG PGKPELTDSDK+HI+IKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPV
Sbjct  5990  SQYTVPGAPGKPELTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPV  6049

Query  6110  ATTEYQDDRVTPNHTYQYRISGVNAAGSGKASEPSNTFDARPLREKPRLYLDSLLGRRVK  6169
              T EYQDDRVT NH YQYRIS VNAAG+GK SEPS  F+ARPLREKPR Y D L+G+R+K
Sbjct  6050  PTAEYQDDRVTSNHQYQYRISAVNAAGNGKTSEPSAIFNARPLREKPRFYFDGLIGKRIK  6109

Query  6170  VRAGEPVNLTIPIAGAPTPNIEWKRGDFKFEEGKRISYETNSERTIFRIDNSNREDSGKY  6229
             VRAGEPVNL IPI+GAPTP IEWKRGD K EEGKRISYETNSERT+FRID+SNR DSGKY
Sbjct  6110  VRAGEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRISYETNSERTLFRIDDSNRRDSGKY  6169

Query  6230  TVTAFNEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLKWNSPKDNGGSDITGYII  6289
             TVTA NEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISL W SPKD+GGSDITGYII
Sbjct  6170  TVTAANEFGKDTADIEVIVVDKPSPPEGPLSYTETAPDHISLHWYSPKDDGGSDITGYII  6229

Query  6290  EFTEFGLDDWKPVPGYCSKTNNTVKGLVEGKKYIFRVRAENIYGASEALEGKPVLAKSPF  6349
             EFTEFG+DDWKPVPG C  TN TVK LVEGKKY+FR+RAENIYGASEALEGKPVLAKSPF
Sbjct  6230  EFTEFGVDDWKPVPGTCPNTNFTVKNLVEGKKYVFRIRAENIYGASEALEGKPVLAKSPF  6289

Query  6350  DPPGAPSQPKITVYTPNSATLEWHPPDYCGGKPITGYIVERRERGGEWIKCNNYPTPNTS  6409
             DPPGAPSQP I+ YTPNSA LEWHPPD CGGKPITGYIVERRERGGEWIKCNNYPTPNTS
Sbjct  6290  DPPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGYIVERRERGGEWIKCNNYPTPNTS  6349

Query  6410  YTVPDLRDGARYEFRIIAVNEAGPGQPSKPSDPMTAEHQRYRPDAPESPKPDRISRDNVT  6469
             YTV +LRDGARYEFR++AVNEAGPG PSKPSDPMTAEHQRYRPD PE PKPDRI+R+ VT
Sbjct  6350  YTVSNLRDGARYEFRVLAVNEAGPGHPSKPSDPMTAEHQRYRPDPPEPPKPDRITRNGVT  6409

Query  6470  LSWRPPRNDGKSRIKGYFIEIRPKNEKDWKIVNDLPINSTVYTVPNLKEGEEYSFRVIAE  6529
             LSWRPPR DGKSRIKGY++E+RPKN KDWK VND+PINSTVYTVP+LKEGEEYSFRV+AE
Sbjct  6410  LSWRPPRTDGKSRIKGYYVEMRPKNGKDWKTVNDIPINSTVYTVPSLKEGEEYSFRVVAE  6469

Query  6530  NEVGRSNPSKPSQPITIEEQPNKPCMELGGVRDIVCRAGDDFSIHVPYIAFPKPSAFWYS  6589
             NEVGRS+PSKPSQPITIEEQPNKPCMELG VRDIVCRAGDDFSIHVPY+AFPKP+AFWYS
Sbjct  6470  NEVGRSDPSKPSQPITIEEQPNKPCMELGKVRDIVCRAGDDFSIHVPYLAFPKPNAFWYS  6529

Query  6590  NDSVLDDDNRVHQHLTDEAASFVVKNSKRSDSGQYRLQLKNPSGFDTATINVSVLDRPSP  6649
             ND++LDD+NRVH+HLTD+AAS VVKNSKR+DSGQYRLQLKN SGFDTATINV VLDRPSP
Sbjct  6530  NDNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSGFDTATINVRVLDRPSP  6589

Query  6650  PTHLRADEFAGDSLTLYWNPPNDDGGSPIQNYIIEKKEARGSTWTKISSFCTVPFLRIRN  6709
             PT LRADEF+GDSLTLYWNPPNDDGGS IQNYIIEKKEAR STW+K+SSFCTVPF+RIRN
Sbjct  6590  PTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKKEARSSTWSKVSSFCTVPFVRIRN  6649

Query  6710  LVINKEYDFRVLAENKCGQSDPANTSEPIRARHPFDVPNTPGIPHGIDSTEDSITIAWSK  6769
             LV+NKEYDFRV+AENK GQSDPANTSEPI ARHPFD+PNTPGIPHGIDSTEDSITIAW+K
Sbjct  6650  LVLNKEYDFRVIAENKYGQSDPANTSEPILARHPFDIPNTPGIPHGIDSTEDSITIAWTK  6709

Query  6770  PKHDGGSPITGYVLEKRLLSDDKWTKAVNALCPDLTCKIPNLIENAEYEFRVAAVNAAGQ  6829
             PKHDGGSPITGY++EKRLLSDDKWTKAV+ALCPDL+CKIPNLIENAEYEFRVAAVNAAGQ
Sbjct  6710  PKHDGGSPITGYIIEKRLLSDDKWTKAVHALCPDLSCKIPNLIENAEYEFRVAAVNAAGQ  6769

Query  6830  SAFSGSSDLIFCRRPPHSPKITSDLSIRDMTVIAGDEFHITVPYHANPRPTPSWSINGIQ  6889
             SA+SGSSDLIFCRRPPH+PKITSDLSIRDMTVIAGDEF ITVPYHA+PRPT SWS+NG++
Sbjct  6770  SAYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDEFRITVPYHASPRPTASWSLNGLE  6829

Query  6890  VTPDERIKFVSDDYSSVYYNKSAKRCETGSYAITLTNNKGSDTASCHVTVVDRPGPPQGP  6949
             V P ERIKF S+DY+S+YYNKSAKR ETGSY ITLTNNKGSDTASCHVTVVDRP PPQGP
Sbjct  6830  VIPGERIKFDSNDYASMYYNKSAKRDETGSYTITLTNNKGSDTASCHVTVVDRPLPPQGP  6889

Query  6950  LNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLDTSGSWVKVSSFVRNIHYDVMGLEPQ  7009
             LNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLD SGSWVK+SSFVRN HYDVMGLEP 
Sbjct  6890  LNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLDNSGSWVKISSFVRNTHYDVMGLEPH  6949

Query  7010  HKYYFRVRAENQYGLSDPLDISDPIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRPAGD  7069
             +KY FRVRAENQYGLSDPLDI +PIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRP  D
Sbjct  6950  YKYNFRVRAENQYGLSDPLDIIEPIVAKHQFTVPDEPGQPKVIDWDSGNVTLIWTRPLSD  7009

Query  7070  GGSRIQGYQIEYRDIVNDSSWNTYDYLIKDTKYQLYNLTNGSEYEFRIRAKNAAGLSKPS  7129
             GGSRIQGYQIEYRDI+NDSSWN YDY+IKDTKYQLYNL NGSEYEFRI+AKNAAGLSKPS
Sbjct  7010  GGSRIQGYQIEYRDILNDSSWNAYDYIIKDTKYQLYNLINGSEYEFRIKAKNAAGLSKPS  7069

Query  7130  PPSLRFKLKGKFSVPSPPGTPQVTRVGKNYVDLKWEKSLRDGGSRITSYIIERRDIGGAV  7189
              PSLRFKLKGKF+VPSPPG PQVTRVGKNYVDLKWEK LRDGGSRIT YIIERRDIGGAV
Sbjct  7070  SPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEKPLRDGGSRITGYIIERRDIGGAV  7129

Query  7190  WVKCNDYNVLDTEYTVINLIEMGDYEFRIFAVNSAGRSDPSLCTMPIRVCEVLGGEKPEW  7249
             WVKCNDYNVLDTEYTV+NLIEMGDYEFR+FAVNSAGRS+PSLCTMPI+VCEVLGG+KP+W
Sbjct  7130  WVKCNDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCEVLGGKKPDW  7189

Query  7250  IKRLQDRVAPYGKDFTLQCAASGKPSPTARWLRNGKEIQMGCGRFTCDNKDGLFRLHISN  7309
             I RLQD+VAP+GKD+TLQCAASGKPSPTARWLRNGKEIQM  GR TCD+KDG+FRLHISN
Sbjct  7190  ITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKEIQMNGGRMTCDSKDGVFRLHISN  7249

Query  7310  VQSGDDADYTCEAINSLGFVHTSGYLKIGSPPIINRCPNELYLPEGDNTKIKVYYSGDQP  7369
             VQ+GDD DYTCEA+NSLGFV+TSGYLKIGSPPIINRCP+EL LPEGDN+KIK++YSGDQP
Sbjct  7250  VQTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRCPSELKLPEGDNSKIKIFYSGDQP  7309

Query  7370  LTVILRKNNEVISDSNDETHVKLNIFDDYVAICIRDIVKSDSGKYQIEFTNDSGSAIGQF  7429
             LTVIL+KNNEVI DSND+THVK+NIFDDYVAI IR+IVKSD G YQIEFTN+SGSA G+F
Sbjct  7310  LTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNIVKSDGGPYQIEFTNESGSATGEF  7369

Query  7430  DVYVTGLPTAPTGPLGISFINKNSCTLGWRLPSYDGGLKITHYVVERKDVKSPHWITVSS  7489
              V++TG+P+APTGP+GIS+INKNSC L WR PSYDGGLK++HYV+ERKDV SPHWITVSS
Sbjct  7370  YVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGGLKVSHYVIERKDVSSPHWITVSS  7429

Query  7490  TCKDTTFSVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKAPLDPPSPPGIPQITEI  7549
             TCKDT F+VQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAK P+DPPSPPG PQITEI
Sbjct  7430  TCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGLNPIRAKDPIDPPSPPGSPQITEI  7489

Query  7550  GGDFVHLEWSKPESDGGAHIQGYWIDKQEVGSNTWQRVNVTICAANQINCVNLIEGRQYE  7609
             GGDFVHLEW KPESDGGAHIQGYWIDK+EVGSNTWQRVN TICAANQINC+NLIEGRQYE
Sbjct  7490  GGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQRVNATICAANQINCINLIEGRQYE  7549

Query  7610  FRIFAQNVAGISKESSASQVVKIIDPKGASPPLIVKPLSDANCIQNHNAQFTCTISGVPK  7669
             FRIFAQNVAG+S ESSASQ VKIIDP+ ASPPLIVKPL DANCIQNHNAQFTCTI+GVPK
Sbjct  7550  FRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKPLRDANCIQNHNAQFTCTINGVPK  7609

Query  7670  PTVTWYKGAREISNGARYHMYSEGENHFLNINDIFGEDADEYVCRAVNKAGAKSTRAALA  7729
             PT++WYKGAREISNGARYHMYSEG+NHFLNIND+FGEDADEYVCRAVNKAGAKSTRA LA
Sbjct  7610  PTISWYKGAREISNGARYHMYSEGDNHFLNINDVFGEDADEYVCRAVNKAGAKSTRATLA  7669

Query  7730  IMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVREGENIECGGHYTVETKE  7789
             IMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVR+GENIE GGHYTVE KE
Sbjct  7670  IMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKPRIHWVRDGENIESGGHYTVEVKE  7729

Query  7790  RHAVLIIRDGSRMDSGPYRIAAENELGSDTAIIQVQISDRPDPPRFPLIESIGSDSLSLS  7849
             RHAVLIIRDGS +DSGPYRI AENELGSDTAIIQVQISDRPDPPRFPLIESIG++SLSLS
Sbjct  7730  RHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQISDRPDPPRFPLIESIGTESLSLS  7789

Query  7850  WKAPVWDGGSDITNYYIERREHPLSSWIRVGNTRFTSIAVCGLTSGKEYDFRISADNVYG  7909
             WKAPVWDG SDITNYY+ERREHPLSSWIRVGNTRFTS+AV GLT GKEYDFRI ADNVYG
Sbjct  7790  WKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTSMAVSGLTPGKEYDFRIFADNVYG  7849

Query  7910  RSEPSETSTLIKTKESTKKKPVERKWQIDTNGRKVRGTADGPIKDYDSYVFDIYSKFVPQ  7969
             RS+ S+TSTLIKTKES KKKP+ERKW+ID NGRK+RG ADGP+KDYDSYVFDIYSKFVPQ
Sbjct  7850  RSDASDTSTLIKTKESVKKKPIERKWEIDANGRKLRGKADGPVKDYDSYVFDIYSKFVPQ  7909

Query  7970  PVEISQQSVYDKYDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHSIEKDLIRREID  8029
             PVEISQQSVYD+YDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHS+EKDLIRREID
Sbjct  7910  PVEISQQSVYDRYDILEEIGTGAFGVVHRCRERSTGNIFAAKFIPVSHSVEKDLIRREID  7969

Query  8030  VMNQLHHQKLINLHDAFEDDDEMVLILEFLSGGELFERITAENYIMSEAEVINYMRQICE  8089
             +MNQLHHQKLINLHDAFEDDDEM+LILEFLSGGELFERITAE Y+M+EAEVINYMRQICE
Sbjct  7970  IMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFERITAEGYVMTEAEVINYMRQICE  8029

Query  8090  GIRHMHEKNIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPE  8149
             GIRHMHE+NIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPE
Sbjct  8030  GIRHMHEQNIIHLDIKPENIMCQTRSSTNVKLIDFGLATRLDPNEVVKITTGTAEFAAPE  8089

Query  8150  IVNREPVGFYTDMWATGVLAYVLLSGLSPFAGDNDVQTLKNVKSCDWDFDVESFKNISEE  8209
             IVNREPVGFYTDMWATGVL+YVLLSGLSPFAGDNDVQTLKNVK+CDWDFDVESFK ISEE
Sbjct  8090  IVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQTLKNVKACDWDFDVESFKYISEE  8149

Query  8210  AKDFIRKLLVANKEKRMTAHECLLHPWLTGDHKGITQTINRDRYLAYREKLRKKYEDFER  8269
             AKDFIRKLLV NKEKRMTAHECLLHPWLTGDH  + Q INRDRYLAYREKLR+KYEDFER
Sbjct  8150  AKDFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAMKQEINRDRYLAYREKLRRKYEDFER  8209

Query  8270  YLLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSSQFCYEGQSVKFYCRCI  8329
             +LLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSSQFCYEGQSVKFYCRCI
Sbjct  8210  FLLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPRFVIRPSSQFCYEGQSVKFYCRCI  8269

Query  8330  AIATPTLTWSHNNIELRQSVKFMKRYTGDDYYFIINRVKLDDRGEYIIRAENHYGSREEV  8389
             AIATPTLTWSHNNIELRQSVKFMKRY GDDYYFIINRVKLDDRGEYIIRAENHYGSREEV
Sbjct  8270  AIATPTLTWSHNNIELRQSVKFMKRYVGDDYYFIINRVKLDDRGEYIIRAENHYGSREEV  8329

Query  8390  VFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKL  8449
             VFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKL
Sbjct  8330  VFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKL  8389

Query  8450  LCCLSGKPVPTVKWYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKALNCHGT  8509
             LCCLSGKPVP V+WYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKA NCHGT
Sbjct  8390  LCCLSGKPVPNVRWYKDGRELSKYEYAMTHSDGVVTMEIIDCKPSDSGKYSCKATNCHGT  8449

Query  8510  DETECVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQPMKPAPTPIVTSRQFAPLSSQGTS  8569
             DET+CVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQP+KPAP PIVTSRQ+   S Q TS
Sbjct  8450  DETDCVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQPIKPAPLPIVTSRQYTSSSVQNTS  8509

Query  8570  KSSSNNTTGTITSSSGTQNSISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKP  8629
             +   +        S+   + ISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKP
Sbjct  8510  EPQGDKV----NVSNSNSSGISNKKKYASNSLQAPGSPSRSRSATKELILPPDDSLMCKP  8565

Query  8630  EFTKPLHDLTIRDGDQLILICHVKGDPEPQITWSKNGKSISSSDIMDLKYKNGIATLTIH  8689
             EFTKPLHDLTI DG+QLIL C+VKGDPEPQI+WSKNGKS+SSSDI+DL+YKNGIATLTI+
Sbjct  8566  EFTKPLHDLTIHDGEQLILTCYVKGDPEPQISWSKNGKSLSSSDILDLRYKNGIATLTIN  8625

Query  8690  EVFPEDEGVFTCTATNSICAVETKCKLTIMPLDKSSPKRKMIAGDKAPKIVSHLESRLVK  8749
             EVFPEDEGV TCTATNS+ AVETKCKLTI PLDK+  KRK+ AGD APKIVSHLESR V+
Sbjct  8626  EVFPEDEGVITCTATNSVGAVETKCKLTIQPLDKNINKRKVNAGDNAPKIVSHLESRFVR  8685

Query  8750  DGDAVTLACRIIGAENFDVVWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPEDSGTYTC  8809
             DGDAV LACRIIGA++FDVVWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPED GTYTC
Sbjct  8686  DGDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQYTNEANIYRLQIAEIFPEDGGTYTC  8745

Query  8810  EAFNDVGESFSTCTINVNVPGDEPKHPSFAKFPISVSILEGESTTFTCEIDSELLNLVWV  8869
             EAFND+GESFSTCTINV VPGDE K PSF KFP SVS+LEGE TTF CEIDSELLNLVW+
Sbjct  8746  EAFNDIGESFSTCTINVTVPGDETKQPSFVKFPTSVSVLEGEGTTFECEIDSELLNLVWL  8805

Query  8870  KDGKPVDETLSRYSFTKDENRYAFTVAKCNMDDVGQYQVKAVAKKGESTCAFSMNVHNAE  8929
             KDGKP+DETL RYSFTKD +RY+F VAKCNMDDVGQYQ KAV+ K ES CAFSMNVH AE
Sbjct  8806  KDGKPIDETLPRYSFTKDGHRYSFAVAKCNMDDVGQYQAKAVSGKAESICAFSMNVHTAE  8865


 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query  4     AEDFAPSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVE  63
             A D AP  +   +     DG+ +   C+++ +   D+ W  + NK         +I+P +
Sbjct  8668  AGDNAPKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHN-NK---------EIKPSK  8717

Query  64    DNKYT-----VVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFT-PADEPKEKQIDGF  117
             D +YT       L++ ++   D G Y  +A N  GE  ++  +N T P DE K+      
Sbjct  8718  DFQYTNEANIYRLQIAEIFPEDGGTYTCEAFNDIGESFSTCTINVTVPGDETKQ------  8771

Query  118   APTFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKES-SRHKLTVDKDVHSY  176
              P+F K P      +G+   FEC ++++    +VW  +G  + E+  R+  T  KD H Y
Sbjct  8772  -PSFVKFPTSVSVLEGEGTTFECEIDSELL-NLVWLKDGKPIDETLPRYSFT--KDGHRY  8827

Query  177   FATLEIQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEA  217
               +  +    ++D G+Y+  A +   ES    S+N  + E+
Sbjct  8828  --SFAVAKCNMDDVGQYQAKAVSGKAESICAFSMNVHTAES  8866


>Q7KQP6_DROME unnamed protein product
Length=8648

 Score = 15466 bits (40140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 7502/8723 (86%), Positives = 8061/8723 (92%), Gaps = 95/8723 (1%)

Query  223   AEGFKPTFTERPVIRQSEDGGNVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQ  282
             AE F P+F ++P + Q +DG  + FEC+ +  P P+I W   +  + +  R K  +    
Sbjct  4     AEDFAPSFVKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSDNKVVEDVRTKFKIQPVG  63

Query  283   KLYHMACLEISSVVSSDQGEYRAQAKNKHGSGVATINLNF----ESGSKKIPDGKSPRFP  338
             +  +   LE+  VV +D G Y+ +AKNK G   A+INLNF    E   K+I DG +P F 
Sbjct  64    ENKYTVVLELDDVVETDAGLYKVKAKNKSGEVSASINLNFTPADEPKEKQI-DGFAPTFA  122

Query  339   KKPTIRQEED--LLIMECVLEAHPVPDIVWYCTEKEISNNQRTKMTRKAISKD--SYILT  394
             KKP IRQEED   L+ EC + A P+P I+W+     +  ++R K+T   + KD  SY  T
Sbjct  123   KKPAIRQEEDGKRLLFECRVNADPIPAIIWFHNGAAVKESERHKIT---VDKDVHSYFAT  179

Query  395   LEIQNPTKEDGGNYRCNAINIYGESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTL  454
             LEI N T ED G Y+ NA N  GESNA I+LNF  ASDANGFAPSFIEKPRIIPNESGTL
Sbjct  180   LEILNVTVEDAGKYKVNAKNELGESNATISLNFDSASDANGFAPSFIEKPRIIPNESGTL  239

Query  455   ITMKCKCKAKPEPIVTWYRGQEIVEKSKKIKINTTVIADDTYELTLEIKDPGATDGGTYR  514
             ITMKCKCKAKPEP VTWYRGQ++VEKSKKIKINTTVIA+DTYELTLEIKDPGATDGGTYR
Sbjct  240   ITMKCKCKAKPEPTVTWYRGQDLVEKSKKIKINTTVIAEDTYELTLEIKDPGATDGGTYR  299

Query  515   CNVKNEYGESNANLNLNIEAEPDPEGEGPTFVEKPRIISENNGKLVIMECKVKADPKPDV  574
             CNVKNEYGESNANLNLNIEAEP+PEGEGPTF+EKPRI+SENNGKLVIMECKVKADPKPDV
Sbjct  300   CNVKNEYGESNANLNLNIEAEPEPEGEGPTFIEKPRIVSENNGKLVIMECKVKADPKPDV  359

Query  575   IWYRNGEVVKESNKIKTFIEQRGDQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTL  634
             IW+RNGEV+KESNKIKTFIEQRGDQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTL
Sbjct  360   IWFRNGEVIKESNKIKTFIEQRGDQYYIKLELLDPQLEDSGLYKCNIKNTLGELNANLTL  419

Query  635   NIEIVPVIKDKPKIIKIIKKRTVVIECTVASKFEPKCTWYKETNTVKESKRHVYIVEQTK  694
             NIEIVPVIKDKPKIIKIIKKRTVVIECTVASKFEPKCTWYKET+TVKESKRHVY VEQTK
Sbjct  420   NIEIVPVIKDKPKIIKIIKKRTVVIECTVASKFEPKCTWYKETSTVKESKRHVYQVEQTK  479

Query  695   DGEFAVKLEINNVDDSDKGAYKLVASNEKGEAVSQIVNLVDIPEEERKPSKPEISRKLVD  754
             +GEFAVKLEIN+V++SDKGAYKLVASNEKGEAVSQIVNLVDIPEEERKP KPEISRKL D
Sbjct  480   EGEFAVKLEINDVEESDKGAYKLVASNEKGEAVSQIVNLVDIPEEERKPCKPEISRKLAD  539

Query  755   QKVSESKTFELLISIAHSDRKCKIEWYKGSTLIRETKDITTTFDGTTARLTFSSARTEHT  814
             QKV+ESKTFELL+S++ +DRKCK+EWYKGST+IRETKDITTTFDGTTARLTFSSARTEHT
Sbjct  540   QKVAESKTFELLVSLSQTDRKCKVEWYKGSTVIRETKDITTTFDGTTARLTFSSARTEHT  599

Query  815   SNYKVVVTNEVGKDESSCKVTVEKSTKKKEGQPKSKTEKDTDQKEKEKEGEETPSDQPAI  874
             SNYKV+VTNEVGKDESSCK+TVEK  KKKE +PK K +   +++ ++KE EE  ++    
Sbjct  600   SNYKVIVTNEVGKDESSCKITVEKVAKKKEEKPKEKEKTKNEKEVEQKEMEEDKNESGQS  659

Query  875   STDTQAEEEL-HIKETDPTKKLTGNENSSENKNESSEANENQVNPPKSKHNKNNE--KDF  931
                T+    +  I E DP ++LT  E   + K ++ E  E+ V    S  ++  E  K  
Sbjct  660   VAQTEGRINIEQISEGDPKEELTVKEEILD-KRDTQEVKESSVELQDSAGHEVPEPKKAT  718

Query  932   SKPKHEEPKQNIGDKNDKNNKKQEKTS-----SDKPKENNKDPEKQQETQQIGLKKVERK  986
             S  K ++  Q   DK  K ++ + KT+     ++  K N ++ E+QQ T+QIGLKKV+RK
Sbjct  719   SDSKLDQSNQKNLDKKHKTDQSESKTNKNVSLAEPIKSNKQESEEQQATEQIGLKKVDRK  778

Query  987   GSIVSEKEEISSEVRRQSIFIEEEKIVADDKKVSSRRSSLAVEESKTDSRRSSVIEKKPL  1046
              SIVS KEEISS+VRR+S    +E+I  DDKK SSRRSSLAVEES T+SRRSS+I+KKPL
Sbjct  779   ASIVSVKEEISSDVRRKSTIKAKEEITVDDKKASSRRSSLAVEESNTESRRSSIIDKKPL  838

Query  1047  DQVDRKQLDANKNPQALKEEIPKLKPAEKRRTSKVVEEEKQVEELPKLRKTSISQVKEEP  1106
             +QVD K +DANKNPQ LKEEIP+LKPAEKRRTSKV+EE K  E LPKLRK SI+QVKEE 
Sbjct  839   EQVDNKPIDANKNPQPLKEEIPRLKPAEKRRTSKVIEEPKPDEGLPKLRKASIAQVKEEA  898

Query  1107  KPEVAKPKAKAKGKPKPKYDELPEIPDYERPQLEKYEKSEFTPSDFARDLEIPNKMEKPI  1166
             K   A PK KAK K KPKY+ELPEIPDYERPQLEKYEKS+FTPSDFARDLEIPNKMEKPI
Sbjct  899   K--PAAPKLKAKAKAKPKYEELPEIPDYERPQLEKYEKSDFTPSDFARDLEIPNKMEKPI  956

Query  1167  LDSGKKESEDPTQKKGMPRKAEIIEKPAENIKSLKIGKGKLPDEDDSRDGATLKPVIIEP  1226
             +DSGKKE     QK G+P+K +IIE                                   
Sbjct  957   IDSGKKEPAVLAQKNGIPKKTDIIE-----------------------------------  981

Query  1227  EDKSDAENKKLEQAEKPSVLDIIKQRRRSSIRNLMTKEPIQNESFLGVVLKPVIKDSKEQ  1286
                        + A++P  L + K            K P + +   G VLKPVI + +++
Sbjct  982   -----------QYADEPKGLKVGK-----------GKLPDEGDGRDGAVLKPVIIEPEKE  1019

Query  1287  TAPQQAIQLTKANATEQISSTREIKAQISDLKKPEALATLEDDYERPLLEKYKPVSIDKN  1346
                    +  +ANATEQ S T+ +KAQ++DLKKPE LATLED+YERP+LEKY P SIDK 
Sbjct  1020  ILDLGNKKNNQANATEQFSPTKAVKAQVADLKKPETLATLEDNYERPVLEKYDPFSIDKT  1079

Query  1347  KSETPTPAINIPDTKHPEVKLPLETTKEEKQKVPRMQPPAPGEPPKIEVIREKRPSLAPE  1406
             KSE  TP+I  PD + PEVKLP++ TKEEKQKVP+MQPPAPG+PPKIEVIREKRPSLAPE
Sbjct  1080  KSEKSTPSIITPDIRGPEVKLPVQETKEEKQKVPKMQPPAPGDPPKIEVIREKRPSLAPE  1139

Query  1407  PPSRRGSLIPPADTGRRPSLIINDEKKLRPGEVMDTRLLRPGEVGEGQRRRPSIDVRRPS  1466
             PPSRRGSLIPPADTGRRPSLIINDEKKLRPGEVMDTR           RRRPSIDVRRPS
Sbjct  1140  PPSRRGSLIPPADTGRRPSLIINDEKKLRPGEVMDTR-----------RRRPSIDVRRPS  1188

Query  1467  VQDLEDLINKPSTPLRDVGDGGPPSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKG  1526
             VQDLEDLINKPSTPLRDVGDGGPPSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKG
Sbjct  1189  VQDLEDLINKPSTPLRDVGDGGPPSIVDVQESYSVVEDSTAYLTVGVEGSPAPTFKFYKG  1248

Query  1527  VSEILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSG  1586
             VSEILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSG
Sbjct  1249  VSEILEGGRFKFLTDGQTNTITLCMRKCKPNDESKYKIVVSNIHGEDSAEMQLYVSDSSG  1308

Query  1587  MDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGK  1646
             MDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGK
Sbjct  1309  MDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKVESFLSPLIDQFAKEGK  1368

Query  1647  DKKVVFEARFSKPNCKPKWLFRKDEVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEI  1706
             DKKVVFEARFSKPNCKPKWLFRKDEVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEI
Sbjct  1369  DKKVVFEARFSKPNCKPKWLFRKDEVFTGSKFKFKQENDTYQLIITTPKVEDTGKYTIEI  1428

Query  1707  GGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQHETTLECSVSSSMANVHWFKDNTKLES  1766
             GGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQHETTLECSVSSSMANVHWFK+NTKLES
Sbjct  1429  GGVSSTAFLNVEEADPTYTFTKPLKKKLEGFTQHETTLECSVSSSMANVHWFKNNTKLES  1488

Query  1767  DDPRYLISKDINGNLKLIIKDSVVEDAGLYRCQLDKQPDKTECNLKITEYPYKFVKVLKS  1826
             DDPRYLISKDINGNLKLIIKDSV++DAGLYRCQLDKQPDKTECNLK+TEYPYKFVKVLKS
Sbjct  1489  DDPRYLISKDINGNLKLIIKDSVLDDAGLYRCQLDKQPDKTECNLKVTEYPYKFVKVLKS  1548

Query  1827  QQCIEKDTVTLACEIDDAMGEVQWFRNGEEIKPDKRIQILKDGRKRKLVIKDCKVTDAGL  1886
             QQCIEKDTVTLACEIDDAMGEVQW RNGEEIKPDKRIQI+KDGRKRKLVIKDCKVTDAG 
Sbjct  1549  QQCIEKDTVTLACEIDDAMGEVQWLRNGEEIKPDKRIQIVKDGRKRKLVIKDCKVTDAGQ  1608

Query  1887  FKCSTNADTTEAEIIINYQNRFNKKLKDTDAVERERLVLDVELQDQTAPCDWKLNGEPIV  1946
             FKC+TNADTTE+EIIINYQNRFNKKLKDT+AVERE+L+LD+ELQDQTAPCDWK NGEPIV
Sbjct  1609  FKCTTNADTTESEIIINYQNRFNKKLKDTEAVEREKLILDIELQDQTAPCDWKFNGEPIV  1668

Query  1947  PSERIEVKNLGGGKHQLIFNSLDMSNEGEITCESGQLSSKCKLSIRKGESRPNIDCPDTF  2006
             PSE IE+KN+GGGKHQLIF+SLDMSNEGEITCESGQLSSKCKLSIRKGESRPNIDCPD F
Sbjct  1669  PSESIEIKNMGGGKHQLIFSSLDMSNEGEITCESGQLSSKCKLSIRKGESRPNIDCPDKF  1728

Query  2007  AGPISAPVLVKVPFKVSGTKQTPIEAKLFKDGKPLPVKDVEVAVTDDNVTFKIKKPSRDL  2066
             +GPISAPVL++VPFKVSGTKQTP+EAKLFKDGKPLPVKDVEVAVTDD VTFKIKKPSRDL
Sbjct  1729  SGPISAPVLLEVPFKVSGTKQTPVEAKLFKDGKPLPVKDVEVAVTDDKVTFKIKKPSRDL  1788

Query  2067  SGPYQIKISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVVNFKQPADDGGTPIIN  2126
             SGPYQIKISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVV+F  P+DDGGTPI  
Sbjct  1789  SGPYQIKISNGQGEDTKDVQIICQDVPQPPQDVDITDVYQTSCVVSFNPPSDDGGTPITK  1848

Query  2127  YVIERQDLSKKQGWEPVAEVQPSEPCRKKIDDLVPKKQYRFRIRAVNAIGPSDPATFKNS  2186
             YVIERQDLSKK GWE VAEV PSEPC KKIDDL+PKKQYRFRIRAVNAIG SDPATFKN+
Sbjct  1849  YVIERQDLSKKHGWESVAEVLPSEPCLKKIDDLIPKKQYRFRIRAVNAIGQSDPATFKNT  1908

Query  2187  ILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAPDSDGGDPITAYIVEYKEKFSNDWVAGK  2246
             ILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAP++DGGDPITAYIVEYKEKFSNDWV+GK
Sbjct  1909  ILAKDPWDEPGKPKAVDLTDWDKDHADLKWEAPETDGGDPITAYIVEYKEKFSNDWVSGK  1968

Query  2247  EVDGDSRTATVDQLNEGQQYEFRVRAVNKAGPGEPSDKTKSIIAKCRFVKPFLVGDGLKN  2306
             EVDGD+RTATVD L EGQQYEFRVRAVN+AGPGEPSDKTKSIIAKCRFVKPF+VG+GLKN
Sbjct  1969  EVDGDARTATVDGLKEGQQYEFRVRAVNRAGPGEPSDKTKSIIAKCRFVKPFIVGEGLKN  2028

Query  2307  ITVKKGQTIRFDVKYDGEPEPTATWVKGTNNLNFDNQRICLDQLERNSSITIKKSVRKDT  2366
             +TVKKGQTIRFD+KYDGEPEP ATWVKGT+NL FDNQRICLDQLERNSSITIKKSVRKDT
Sbjct  2029  VTVKKGQTIRFDIKYDGEPEPAATWVKGTDNLKFDNQRICLDQLERNSSITIKKSVRKDT  2088

Query  2367  GKYKLVLSNSSGSIESEAQVVVLDRPLAPGGPFEPEEVRANHIKMKWNCPEDDGGCEITG  2426
             GKYKLVLSNSSG+IESEAQVVVLDRPL PGGPFEPEE+RA+HIKMKW  P+DDGGCEI+G
Sbjct  2089  GKYKLVLSNSSGTIESEAQVVVLDRPLPPGGPFEPEEIRASHIKMKWKRPDDDGGCEISG  2148

Query  2427  YALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKEGESDPLETSDAIV  2486
             YALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKEGES+PLET DAIV
Sbjct  2149  YALERMDEETGRWIPAGEVGPNETSFDFKGLTPNKKYKFRVKAINKEGESEPLETFDAIV  2208

Query  2487  AKNPYDPPSAPSQPVIDDYDNKSVVLKWKRPPSDGGRPITHYIVEIKDKFSPTWSEVKKT  2546
             A+NPYDPPS PSQPVIDDYDNKSV+LKWKRPPSDGGRPITHYIVEIKDKF+P+WSEV KT
Sbjct  2209  ARNPYDPPSPPSQPVIDDYDNKSVLLKWKRPPSDGGRPITHYIVEIKDKFAPSWSEVAKT  2268

Query  2547  EDPTPELTVEGLKESMVYQFRVRAVNKAGPSEPSQPTDNHICKYKNLKPQIDQSTFKRIV  2606
             +DP PE  VEGLKE MVYQFRVRAVNKAGPSEPSQPTDNH+CK+KNLKPQID+STFKR+ 
Sbjct  2269  DDPNPECNVEGLKEKMVYQFRVRAVNKAGPSEPSQPTDNHLCKHKNLKPQIDRSTFKRVT  2328

Query  2607  LKSGRTHKWSVDVIGEPVPELFWSWRDDIPLTNGDRIKIENVDYHTDFRITNVLRKDSGF  2666
             +KSGRTHKWSVDV+GEP+PEL WSWRDDIPLTNGDRIKIENVDYHTDF ITNVLRKDSGF
Sbjct  2329  IKSGRTHKWSVDVLGEPIPELHWSWRDDIPLTNGDRIKIENVDYHTDFSITNVLRKDSGF  2388

Query  2667  YTLKAENRNGIDRETVELVVLGKPSSPKGPLAVDDVTATGCKLQWKKPEDDGGVPIKEYV  2726
             YTLKAENRNGIDRETVELVVLGKPSSPKGPLAV DVTA+GCKLQWKKPEDDGGVPIKEYV
Sbjct  2389  YTLKAENRNGIDRETVELVVLGKPSSPKGPLAVSDVTASGCKLQWKKPEDDGGVPIKEYV  2448

Query  2727  VEKMDTSTGKWVRVGRSPGEKEPPSFDVTGLNPGSEYMFRVSAVNEEGESEPLTTLIGIV  2786
             VEKMDT+TGKWVRVGRSPGEKEPPSFDVTGL+ GSEYMFRVSAVNEEGESEPLTTL+G+V
Sbjct  2449  VEKMDTATGKWVRVGRSPGEKEPPSFDVTGLSLGSEYMFRVSAVNEEGESEPLTTLVGVV  2508

Query  2787  AKDPFDEPNKPGTPEVYDYDNQSVSLKWTPPNNDGGAPIQKYIIEKKDKNKPDWEKAAEI  2846
             AKDPFDEPNKPGTPEV DYDNQS+SLKW  PNNDGGAPIQKYIIEKK+KNK +WEKA EI
Sbjct  2509  AKDPFDEPNKPGTPEVTDYDNQSISLKWAAPNNDGGAPIQKYIIEKKNKNKTEWEKALEI  2568

Query  2847  PGDQLEANVGGLQEYGEYQFRVIAVNKAGLSPPSDSSVPQIVKYKKLKPRIDRSNLKPLL  2906
             PGDQLEA V GLQEYGEYQFRVIAVNKAGLSPPSD+SVPQIVKYKKLKPRIDRSNLKPLL
Sbjct  2569  PGDQLEATVAGLQEYGEYQFRVIAVNKAGLSPPSDASVPQIVKYKKLKPRIDRSNLKPLL  2628

Query  2907  IRAGKPVKYDVNVRGEPAPTITWYHNNFELKQEELPSNCEIKNIPYNTKISIINTMRKHT  2966
             IRAGKP++YDVNVRGEPAP ITWY N+ ELK EELPS+ EIKNIPYNTKISII T+RKHT
Sbjct  2629  IRAGKPIRYDVNVRGEPAPVITWYQNDKELKPEELPSSSEIKNIPYNTKISIIETVRKHT  2688

Query  2967  GVYKIKAINEHGEDEATVEVNILAPPGMPKGPLEVKDVTKDSCKLKWKKPEDDGGKPITA  3026
             G+YKI A+NEHG+DEATVEVNILAPP  P+GPL+VKDVTKDSCKLKWKKPEDDGGKPI+A
Sbjct  2689  GIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDVTKDSCKLKWKKPEDDGGKPISA  2748

Query  3027  YQVEKFDKKQGRWVPVGRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPLETDSSII  3086
             YQVEKFDKKQGRWVP+GRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPL++D SII
Sbjct  2749  YQVEKFDKKQGRWVPLGRTSANDTEFDVKGLQEGHEYQFRVKAINEEGESDPLDSDDSII  2808

Query  3087  AKNPYDLASKPGTPRIEDYNENMVILKWEAPKSDGGAPITGYIIEKKDRFSPVWDEILST  3146
             AKNPYD ASKPGTP I DYNE+MV LKWEAP+SDGGAPI+GYIIEKKD+FSP+WDEILST
Sbjct  2809  AKNPYDAASKPGTPNIVDYNEHMVKLKWEAPRSDGGAPISGYIIEKKDKFSPIWDEILST  2868

Query  3147  NTTAPEATVTNLVEGNVYQFRIRAVNKAGPSEPSDATQPHLAKPRNLKPSINREKMKPIK  3206
             NT+ PEATV  LVEGN+YQFR+RAVNKAG S+PSDAT+PHLAKPRNLKP INR+KMKPIK
Sbjct  2869  NTSVPEATVEGLVEGNIYQFRVRAVNKAGFSDPSDATEPHLAKPRNLKPYINRDKMKPIK  2928

Query  3207  VRAGQTVKFDVDVKGEPAPILTWFLKETQLTTTPQVRLENEDYNTKLTLLDSSRNQSGEY  3266
             VRAGQ VKFDVDVKGEPAP LTWFLKET+LT+T QVRLEN DYNTKLTLLD+ R QSG+Y
Sbjct  2929  VRAGQPVKFDVDVKGEPAPSLTWFLKETELTSTGQVRLENIDYNTKLTLLDTDRKQSGQY  2988

Query  3267  KLRAENINGVDEALVEVIILDKPSKPQGPLEVADIHKEGCKLNWKKPKDDGGIPITGYVV  3326
             KLRAENINGVDEA+VEVIILDKPSKP+GP+EV+DIHKEGCKL W+KPKDDGGIPITGYV+
Sbjct  2989  KLRAENINGVDEAVVEVIILDKPSKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGYVI  3048

Query  3327  EKMDVATGKWVPAGSVDPEKTDIEIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKN  3386
             EKMD ATGKWVPAGSVDPEK DIEIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKN
Sbjct  3049  EKMDTATGKWVPAGSVDPEKYDIEIKGLDPNHRYQFRVKAVNEEGESEPLETESAITAKN  3108

Query  3387  PFDVSAPPGLPEFEDWDEHHVKLKWEPPIRDGGSPITSYIIEVMDKDSGEFVKAVETDSP  3446
             PFDVSAPPGLPE EDWDEHHVKLKWEPPIRDGGSPIT+YIIEVMDKDSGEFVKAVETDSP
Sbjct  3109  PFDVSAPPGLPELEDWDEHHVKLKWEPPIRDGGSPITNYIIEVMDKDSGEFVKAVETDSP  3168

Query  3447  VCKGVVKKLEEGQQYKFRVRAVNKAGPSEPSEQTNWHIAKPRFLKPYIDRNNLKPVVVKT  3506
             VCKGVVKKLEEGQQYKFRVRAVNKAGPS+PSEQTNWH+AKPRFLKP+IDR NLKPV+VKT
Sbjct  3169  VCKGVVKKLEEGQQYKFRVRAVNKAGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKT  3228

Query  3507  GLSISLDINIRGEPAPKVEWFFNAMPLISNEESIKIDNVDYNTKFFVMRAQRSQSGKYII  3566
             GLSISLDINIRGEPAPKVEWFFN   + S+E S+KIDNVDYNTKFFVMRAQRSQSGKYII
Sbjct  3229  GLSISLDINIRGEPAPKVEWFFNNSSVTSDEHSVKIDNVDYNTKFFVMRAQRSQSGKYII  3288

Query  3567  KARNEVGEDEAELEVTVLGKPGKPKGPLHVNDITKHSCKLKWEKPDDDGGTPIDYYEIEK  3626
             KA NEVGEDEAELEVTVLGKPGKPKGPL VNDITKHSCKLKWEKPDDDGG+PIDYYEIEK
Sbjct  3289  KATNEVGEDEAELEVTVLGKPGKPKGPLQVNDITKHSCKLKWEKPDDDGGSPIDYYEIEK  3348

Query  3627  LDPHTGQWLPCGKSTEPEAKVIGLHEGKPYKFRVRAVNKEGESEDLETEKPIIAKNPFDE  3686
             LDPHTGQWLPCGKSTEPEAKVIGLHEGK YKFRVRAVNKEGESEDLETEKPIIAKNP+DE
Sbjct  3349  LDPHTGQWLPCGKSTEPEAKVIGLHEGKAYKFRVRAVNKEGESEDLETEKPIIAKNPYDE  3408

Query  3687  PEKPGRPNPTNWDKDFVDLAWDPPKNDGGAPIQKYIIQMRDKSGRAWVDAATVPGDKSNG  3746
             P++PG+P PTNWDKDFVDLAWDPPKNDGGAPIQKY+IQMRDKSGRAWVD+ATVPGDK NG
Sbjct  3409  PDRPGKPEPTNWDKDFVDLAWDPPKNDGGAPIQKYVIQMRDKSGRAWVDSATVPGDKCNG  3468

Query  3747  TVTGIEEGHEYEFRIVAVNKAGPSEPSDVSKSVVAKPRFLKPHIDRKNLQKKIMRSGQML  3806
             TVTG+EEGHEYEFRIVAVNKAGPS+PSDVSKSV+AKPRFLKPHIDRKNLQKKIMRSGQML
Sbjct  3469  TVTGVEEGHEYEFRIVAVNKAGPSDPSDVSKSVIAKPRFLKPHIDRKNLQKKIMRSGQML  3528

Query  3807  HMDAAVKAEPPAKITWTYNGTEIKTSDNLKIENEDYKTTFIIPKVKRVNRGKYVVTAKND  3866
             H+DA +KAEPPAK+TWTYN TEIKTSD++KIENEDYKTTFI+PKVKR +RG Y+VTAKND
Sbjct  3529  HIDALIKAEPPAKVTWTYNKTEIKTSDHIKIENEDYKTTFIMPKVKRADRGIYIVTAKND  3588

Query  3867  SGSDSVEVELEVVCKPSKPKGPLAVSEVTAESAHLKWDKPEDDGGEPIEQYIVERMDTET  3926
             SGSD+VEVELEV+CKPSKPKGPLAVS VTAE+ HLKW+KPEDDGG+PIEQY+VERMDTET
Sbjct  3589  SGSDTVEVELEVLCKPSKPKGPLAVSNVTAETLHLKWEKPEDDGGDPIEQYLVERMDTET  3648

Query  3927  GRWVPVLTTKIPEADITGLTEGKEYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPG  3986
             GRWVPVLTTK PEAD+TGLTEGKEYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPG
Sbjct  3649  GRWVPVLTTKTPEADVTGLTEGKEYLFRVKAVNSEGESEPLVTDIPTKAKNPFDAADTPG  3708

Query  3987  KPQISDWSASHCDLKWRAPEDDGGAPITGYLVEKKDPNTGKWQKALETNTPECKARVNDL  4046
             KPQI DWS +HCDLKWRAPEDDGGA ITGY+VE+KDPNTGKWQKALET+TP+CKARVNDL
Sbjct  3709  KPQIVDWSGNHCDLKWRAPEDDGGASITGYIVERKDPNTGKWQKALETSTPDCKARVNDL  3768

Query  4047  ITGKKYQFRVKAINKAGKSKPSEPSDQMTARDRFAPPKIDRTNIKDITIKAGQHIRYDIK  4106
             I G KYQFR+ A+NKAGKSKPSEPSDQMTA+DRFAPPKIDRTNIKDITIKAGQHIR+DIK
Sbjct  3769  IAGNKYQFRIMAVNKAGKSKPSEPSDQMTAKDRFAPPKIDRTNIKDITIKAGQHIRFDIK  3828

Query  4107  VSGEPPATKVWLHNKARIDNEDSDYNIDMESYRTKLAVPISKRFHSGKYTLKAENESGHD  4166
             VSGEPPATKVWLHNKAR++N+DS+YNIDMESYRTKL VPISKRFHSGKYTLKAENESG D
Sbjct  3829  VSGEPPATKVWLHNKARLENDDSNYNIDMESYRTKLTVPISKRFHSGKYTLKAENESGRD  3888

Query  4167  EASFEVIVLDKPGAPEGPLRITDVHKEGCKLKWNAPLDDGGLPIEHYIVEKMDVESGRWL  4226
             EASFEVIVLDKPG PEGPLR+TDVHKEGCKLKWNAPLDDGGLPI+HYI+EKMDVESGRWL
Sbjct  3889  EASFEVIVLDKPGPPEGPLRVTDVHKEGCKLKWNAPLDDGGLPIDHYIIEKMDVESGRWL  3948

Query  4227  PSGRFKEPFAELNNLEPGHEYKFRVLAVNTEGESEPLTGEQSIIAKNPFDEPGKPGTPEA  4286
             PSGRFKE FAELNNLEP HEYKFRVLAVNTEGESEPLTGEQS+IAKNPFDEPGKPGTPEA
Sbjct  3949  PSGRFKESFAELNNLEPSHEYKFRVLAVNTEGESEPLTGEQSVIAKNPFDEPGKPGTPEA  4008

Query  4287  VDWDKDHVDLVWRPPINDGGSPITGYIVEKREKGTDKWIKGTEVTAPRFGEECKASVPNL  4346
             VDWDKDHVDLVWRPPINDGGSPITGY+VEKREKGTDKWIKGTE+T P  GEECKA+VP L
Sbjct  4009  VDWDKDHVDLVWRPPINDGGSPITGYVVEKREKGTDKWIKGTEITIPCLGEECKATVPTL  4068

Query  4347  NENCEYEFRIKAINAAGPGEPSDASKSVITKPRKLAPKIDRKNIRTYNVKAGEIIFLDIN  4406
             NENCEYEFR+KAINAAGPGEPSDASK +ITKPRKLAPKIDRKNIRTYN K+GE IFLDIN
Sbjct  4069  NENCEYEFRVKAINAAGPGEPSDASKPIITKPRKLAPKIDRKNIRTYNFKSGEPIFLDIN  4128

Query  4407  VSGEPAPDVTWNQNNKSVQATSVSYIQDVPYNTKYINNNPERKDTGLYKISAHNLYGQDQ  4466
             +SGEPAPDVTWNQNNKSVQ TS S+I+++PYNTKYINNNPERKDTGLYKISAHN YGQDQ
Sbjct  4129  ISGEPAPDVTWNQNNKSVQTTSFSHIENLPYNTKYINNNPERKDTGLYKISAHNFYGQDQ  4188

Query  4467  VEFQINIITKPGKPEGPLEVSDIHKDGCKLKWKKPKDDGGEPIDSYIVEKFDPDTGIWLA  4526
             VEFQINIITKPGKPEGPLEVS++HKDGCKLKWKKPKDDGGEP++SY+VEKFDPDTGIWL 
Sbjct  4189  VEFQINIITKPGKPEGPLEVSEVHKDGCKLKWKKPKDDGGEPVESYLVEKFDPDTGIWLP  4248

Query  4527  VGKTDTPEYTVDSLVPGHEYKFRVKAVNKEGYSEPLETLGSIIAKDPFTAPSKPGVPEAT  4586
             VG++D PEY VD LVPGH+YKFRVKAVNKEG SEPLETLGSIIAKDPF+ P+KPGVPE T
Sbjct  4249  VGRSDGPEYNVDGLVPGHDYKFRVKAVNKEGESEPLETLGSIIAKDPFSVPTKPGVPEPT  4308

Query  4587  DWTANKVELAWPEPASDGGSPITGYIIEVKDKYSPLWEKALETVSPTPIATVQGLIEGNE  4646
             DWTANKVELAWPEPASDGGSPI GYI+EVKDKYSPLWEKALET SPTP ATVQGLIEGNE
Sbjct  4309  DWTANKVELAWPEPASDGGSPIQGYIVEVKDKYSPLWEKALETNSPTPTATVQGLIEGNE  4368

Query  4647  YQFRVIALNKGGQSEPSDASKIFIAKPRYLAPRIDRRNLRDISLSSGTALKLDANIIGEP  4706
             YQFRV+ALNKGG SEPSD SKIF AKPRYLAP+IDRRNLR+I+LSSGTALKLDANI GEP
Sbjct  4369  YQFRVVALNKGGLSEPSDPSKIFTAKPRYLAPKIDRRNLRNITLSSGTALKLDANITGEP  4428

Query  4707  VPKVEWKFSNYSLQSGKNVTIETPDYYTKLVIRPTQRNDSGEYLVIATNSSGKDSVLVNV  4766
              PKVEWK SNY LQSGKNVTIETPDYYTKLVIRPTQR+DSGEYLV ATN+SGKDSVLVNV
Sbjct  4429  APKVEWKLSNYHLQSGKNVTIETPDYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNV  4488

Query  4767  IITDKPTPPNGPLQISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKLDPETGCWIPTCRSS  4826
             +ITDKP+PPNGPLQISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKL+PETGCWIP+CRS+
Sbjct  4489  VITDKPSPPNGPLQISDVHKEGCHLKWKRPSDDGGTPIEYFQIDKLEPETGCWIPSCRST  4548

Query  4827  EPQVDVTGLTPGNEYKFRVSAVNSEGESQPLVGEETIIAKNPFDEPGKPENLKATDWDKD  4886
             EPQVDVTGL+PGNEYKFRVSAVN+EGESQPLVG+E+I+A+NPFDEPGKPENLKATDWDKD
Sbjct  4549  EPQVDVTGLSPGNEYKFRVSAVNAEGESQPLVGDESIVARNPFDEPGKPENLKATDWDKD  4608

Query  4887  HIDLAWTPPLTDGGSPICGYIVEKKDKYGKWEKTLDVPADQCKATIPDLVENQVYEFRVS  4946
             H+DLAWTPPL DGGSPI  YI+EK+DKYGKWE+ LDVPADQCKATIPDLVE Q Y+FRVS
Sbjct  4609  HVDLAWTPPLIDGGSPISCYIIEKQDKYGKWERALDVPADQCKATIPDLVEGQTYKFRVS  4668

Query  4947  AVNAAGPGEPSDATPPVIAKSRNKPPVIDRSNLIEIRIKAGQAFTFDCKVSGEPAPRTKW  5006
             AVNAAG GEPSD+TPP+IAK+RNKPP+IDRS+L+E+RIKAGQ+FTFDCKVSGEPAP+TKW
Sbjct  4669  AVNAAGTGEPSDSTPPIIAKARNKPPIIDRSSLVEVRIKAGQSFTFDCKVSGEPAPQTKW  4728

Query  5007  IFKKKDLYSKDNVKVTNVDYNTKLKVTSATRSDSGVYTVHAENANGEDCAEVKVTVIDIP  5066
             + KKK++YSKDNVKVTNVDYNTKLKV SATRSDSG+YTV AENANGED A+VKVTVID P
Sbjct  4729  LLKKKEVYSKDNVKVTNVDYNTKLKVNSATRSDSGIYTVFAENANGEDSADVKVTVIDKP  4788

Query  5067  SPPNGPLNIDEINSESCSLHWNPPDNDGGQPIDNYVVEKLDEATGRWVPGGETDGPITSL  5126
             +PPNGPL +DEINSESC+LHWNPPD+DGGQPIDNYVVEKLDE TGRW+P GETDGP+T+L
Sbjct  4789  APPNGPLKVDEINSESCTLHWNPPDDDGGQPIDNYVVEKLDETTGRWIPAGETDGPVTAL  4848

Query  5127  KVKGLTPGHKYKFRVRAKNRQGLSDPLTTLHAIEAKNPYDQPSKPGTPTIKDFDRDFVDL  5186
             KV GLTPGHKYKFRVRAKNRQG S+PLTT  AI AKNP+D P+KPGTPTIKDFD++FVDL
Sbjct  4849  KVGGLTPGHKYKFRVRAKNRQGTSEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDL  4908

Query  5187  EWSRPESDGGSVITGYIIEKRDKYSPDWEKCAEISDDITNAYVPDLIEGLKYEFRVRAVN  5246
             EW+RPE+DGGS ITGY++EKRDK+SPDWEKCAEISDDITNA+VPDLIEGLKYEFRVRAVN
Sbjct  4909  EWTRPEADGGSPITGYVVEKRDKFSPDWEKCAEISDDITNAHVPDLIEGLKYEFRVRAVN  4968

Query  5247  KAGPGSPSDPTEPHLARPKNMPPKIDRNFMSDIKIKAGNIFEFDVPVTGQPLPSKEWTHE  5306
             KAGPGSPSD TE H+ARPKN PPKIDRNFMSDIKIKAGN+FEFDVPVTG+PLPSK+WTHE
Sbjct  4969  KAGPGSPSDATETHVARPKNTPPKIDRNFMSDIKIKAGNVFEFDVPVTGEPLPSKDWTHE  5028

Query  5307  GNMVINTDRVKIVNDDDRTKIRILDSKRSDTGDYTLIARNINGIDRHTVRVSVLDVPSVP  5366
             GNM+INTDRVKI N DDRTKIRILD+KRSDTG YTL ARNING DRH V+V++LD PSVP
Sbjct  5029  GNMIINTDRVKISNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRHNVKVTILDAPSVP  5088

Query  5367  EGPLRNGDTTKNSIVLRWRPPKDDGGSEITHYIVEKMDNDAMRWVPVGECTDTETRADNL  5426
             EGPLRNGD +KNSIVLRWRPPKDDGGSEITHY+VEKMDN+AMRWVPVG+CTDTE RADNL
Sbjct  5089  EGPLRNGDVSKNSIVLRWRPPKDDGGSEITHYVVEKMDNEAMRWVPVGDCTDTEIRADNL  5148

Query  5427  IENHDYSFRVRAVNKQGQSQPLTTSQPITAKDPYSHPDKPGPPQATDWGKDFVDLEWAAP  5486
             IENHDYSFRVRAVNKQGQSQPLTTSQPITAKDPYSHPDKPG PQATDWGK FVDLEW+ P
Sbjct  5149  IENHDYSFRVRAVNKQGQSQPLTTSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTP  5208

Query  5487  KRDGGAPISSYIIQKRPKFGQWERAAVVPGENCKAHIPELTDGGEYEFRVIAVNQGGPSD  5546
             KRDGGAPISSYII+KRPKFGQWERAAVV G+NCKAH+PELT+GGEYEFRVIAVN+GGPSD
Sbjct  5209  KRDGGAPISSYIIEKRPKFGQWERAAVVLGDNCKAHVPELTNGGEYEFRVIAVNRGGPSD  5268

Query  5547  PSDPSASIICKPRFLAPFFDKSLLNDITIHAGKRLGWTLPIEASPRPSVKWLYNGKEIGS  5606
             PSDPS++IICKPRFLAPFFDKSLLNDIT+HAGKRLGWTLPIEASPRP + WLYNGKEIGS
Sbjct  5269  PSDPSSTIICKPRFLAPFFDKSLLNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGS  5328

Query  5607  NLRAETGIFQNELTFEIQSSLRSDEGRYTVILKNEHGTFDASAHATVLDRPSPPNGPLDI  5666
             N R E+G+FQNELTFEI SSLRSDEGRYT+ILKNEHG+FDASAHATVLDRPSPP GPLDI
Sbjct  5329  NSRGESGLFQNELTFEIVSSLRSDEGRYTLILKNEHGSFDASAHATVLDRPSPPKGPLDI  5388

Query  5667  TKITRDGCHLTWNIPDDDGGSPILHYIIEKMDLSRSTWTDAGMSTHTVHDVTRLVHRKEY  5726
             TKITRDGCHLTWN+PDDDGGSPILHYIIEKMDLSRSTW+DAGMSTH VHDVTRLVHRKEY
Sbjct  5389  TKITRDGCHLTWNVPDDDGGSPILHYIIEKMDLSRSTWSDAGMSTHIVHDVTRLVHRKEY  5448

Query  5727  LFRVKAVNAIGESDPLEAARSIIAKNEFDEPDSPGKPNITDWDRDHVDLQWASPKSDGGA  5786
             LFRVKAVNAIGESDPLEA  +IIAKNEFDEPD+PGKP ITDWDRDH+DLQWA PKSDGGA
Sbjct  5449  LFRVKAVNAIGESDPLEAVNTIIAKNEFDEPDAPGKPIITDWDRDHIDLQWAVPKSDGGA  5508

Query  5787  PIMEYIIQKKEKGSPYWTNVLHVPSNKTIATVPELTEGKEYEFRVIAVNQAGQSEPSEPS  5846
             PI EYIIQKKEKGSPYWTNV HVPSNK   T+PELTEG+EYEFRVIAVNQAGQSEPSEPS
Sbjct  5509  PISEYIIQKKEKGSPYWTNVRHVPSNKNTTTIPELTEGQEYEFRVIAVNQAGQSEPSEPS  5568

Query  5847  DMIMAKPRYLPPKILTPLSEIRLKCGLIFHTDIHFIGEPVPEATWTLNGCPLKSNEKSTI  5906
             DMIMAKPRYLPPKI+TPL+E+R+KCGLIFHTDIHFIGEP PEATWTLN  PL SN++STI
Sbjct  5569  DMIMAKPRYLPPKIITPLNEVRIKCGLIFHTDIHFIGEPAPEATWTLNSNPLLSNDRSTI  5628

Query  5907  TAIGHHTVVHTVNCQRSDSGIYHLLLRNSSGIDEGSFELIVLDRPGTPEGPMEYEEVTGN  5966
             T+IGHH+VVHTVNCQRSDSGIYHLLLRNSSGIDEGSFEL+VLDRPG PEGPMEYEE+T N
Sbjct  5629  TSIGHHSVVHTVNCQRSDSGIYHLLLRNSSGIDEGSFELVVLDRPGPPEGPMEYEEITAN  5688

Query  5967  SVTISWKPPKDNGGSEISSYIIEKRDLTHGGGWVPAINYVNAKYNHAMVPRLLEGTLYEF  6026
             SVTISWKPPKDNGGSEISSY+IEKRDLTHGGGWVPA+NYV+AKYNHA+VPRLLEGT+YE 
Sbjct  5689  SVTISWKPPKDNGGSEISSYVIEKRDLTHGGGWVPAVNYVSAKYNHAVVPRLLEGTMYEL  5748

Query  6027  RVMAENLQGRSDPLTSDQPVVAKNQYTVPGVPGKPELTDSDKDHISIKWKQPISNGGSPI  6086
             RVMAENLQGRSDPLTSDQPVVAK+QYTVPG PGKPELTDSDK+HI+IKWKQPISNGGSPI
Sbjct  5749  RVMAENLQGRSDPLTSDQPVVAKSQYTVPGAPGKPELTDSDKNHITIKWKQPISNGGSPI  5808

Query  6087  IGYDIERRDVNTGRWIKINGQPVATTEYQDDRVTPNHTYQYRISGVNAAGSGKASEPSNT  6146
             IGYDIERRDVNTGRWIKINGQPV T EYQDDRVT NH YQYRIS VNAAG+GK SEPS  
Sbjct  5809  IGYDIERRDVNTGRWIKINGQPVPTAEYQDDRVTSNHQYQYRISAVNAAGNGKTSEPSAI  5868

Query  6147  FDARPLREKPRLYLDSLLGRRVKVRAGEPVNLTIPIAGAPTPNIEWKRGDFKFEEGKRIS  6206
             F+ARPLREKPR Y D L+G+R+KVRAGEPVNL IPI+GAPTP IEWKRGD K EEGKRIS
Sbjct  5869  FNARPLREKPRFYFDGLIGKRIKVRAGEPVNLNIPISGAPTPTIEWKRGDLKLEEGKRIS  5928

Query  6207  YETNSERTIFRIDNSNREDSGKYTVTAFNEFGKDTADIEVIVVDKPSPPEGPLSYTETAP  6266
             YETNSERT+FRID+SNR DSGKYTVTA NEFGKDTADIEVIVVDKPSPPEGPLSYTETAP
Sbjct  5929  YETNSERTLFRIDDSNRRDSGKYTVTAANEFGKDTADIEVIVVDKPSPPEGPLSYTETAP  5988

Query  6267  DHISLKWNSPKDNGGSDITGYIIEFTEFGLDDWKPVPGYCSKTNNTVKGLVEGKKYIFRV  6326
             DHISL W SPKD+GGSDITGYIIEFTEFG+DDWKPVPG C  TN TVK LVEGKKY+FR+
Sbjct  5989  DHISLHWYSPKDDGGSDITGYIIEFTEFGVDDWKPVPGTCPNTNFTVKNLVEGKKYVFRI  6048

Query  6327  RAENIYGASEALEGKPVLAKSPFDPPGAPSQPKITVYTPNSATLEWHPPDYCGGKPITGY  6386
             RAENIYGASEALEGKPVLAKSPFDPPGAPSQP I+ YTPNSA LEWHPPD CGGKPITGY
Sbjct  6049  RAENIYGASEALEGKPVLAKSPFDPPGAPSQPTISAYTPNSANLEWHPPDDCGGKPITGY  6108

Query  6387  IVERRERGGEWIKCNNYPTPNTSYTVPDLRDGARYEFRIIAVNEAGPGQPSKPSDPMTAE  6446
             IVERRERGGEWIKCNNYPTPNTSYTV +LRDGARYEFR++AVNEAGPG PSKPSDPMTAE
Sbjct  6109  IVERRERGGEWIKCNNYPTPNTSYTVSNLRDGARYEFRVLAVNEAGPGHPSKPSDPMTAE  6168

Query  6447  HQRYRPDAPESPKPDRISRDNVTLSWRPPRNDGKSRIKGYFIEIRPKNEKDWKIVNDLPI  6506
             HQRYRPD PE PKPDRI+R+ VTLSWRPPR DGKSRIKGY++E+RPKN KDWK VND+PI
Sbjct  6169  HQRYRPDPPEPPKPDRITRNGVTLSWRPPRTDGKSRIKGYYVEMRPKNGKDWKTVNDIPI  6228

Query  6507  NSTVYTVPNLKEGEEYSFRVIAENEVGRSNPSKPSQPITIEEQPNKPCMELGGVRDIVCR  6566
             NSTVYTVP+LKEGEEYSFRV+AENEVGRS+PSKPSQPITIEEQPNKPCMELG VRDIVCR
Sbjct  6229  NSTVYTVPSLKEGEEYSFRVVAENEVGRSDPSKPSQPITIEEQPNKPCMELGKVRDIVCR  6288

Query  6567  AGDDFSIHVPYIAFPKPSAFWYSNDSVLDDDNRVHQHLTDEAASFVVKNSKRSDSGQYRL  6626
             AGDDFSIHVPY+AFPKP+AFWYSND++LDD+NRVH+HLTD+AAS VVKNSKR+DSGQYRL
Sbjct  6289  AGDDFSIHVPYLAFPKPNAFWYSNDNMLDDNNRVHKHLTDDAASVVVKNSKRADSGQYRL  6348

Query  6627  QLKNPSGFDTATINVSVLDRPSPPTHLRADEFAGDSLTLYWNPPNDDGGSPIQNYIIEKK  6686
             QLKN SGFDTATINV VLDRPSPPT LRADEF+GDSLTLYWNPPNDDGGS IQNYIIEKK
Sbjct  6349  QLKNTSGFDTATINVRVLDRPSPPTRLRADEFSGDSLTLYWNPPNDDGGSAIQNYIIEKK  6408

Query  6687  EARGSTWTKISSFCTVPFLRIRNLVINKEYDFRVLAENKCGQSDPANTSEPIRARHPFDV  6746
             EAR STW+K+SSFCTVPF+RIRNLV+NKEYDFRV+AENK GQSDPANTSEPI ARHPFD+
Sbjct  6409  EARSSTWSKVSSFCTVPFVRIRNLVLNKEYDFRVIAENKYGQSDPANTSEPILARHPFDI  6468

Query  6747  PNTPGIPHGIDSTEDSITIAWSKPKHDGGSPITGYVLEKRLLSDDKWTKAVNALCPDLTC  6806
             PNTPGIPHGIDSTEDSITIAW+KPKHDGGSPITGY++EKRLLSDDKWTKAV+ALCPDL+C
Sbjct  6469  PNTPGIPHGIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKWTKAVHALCPDLSC  6528

Query  6807  KIPNLIENAEYEFRVAAVNAAGQSAFSGSSDLIFCRRPPHSPKITSDLSIRDMTVIAGDE  6866
             KIPNLIENAEYEFRVAAVNAAGQSA+SGSSDLIFCRRPPH+PKITSDLSIRDMTVIAGDE
Sbjct  6529  KIPNLIENAEYEFRVAAVNAAGQSAYSGSSDLIFCRRPPHAPKITSDLSIRDMTVIAGDE  6588

Query  6867  FHITVPYHANPRPTPSWSINGIQVTPDERIKFVSDDYSSVYYNKSAKRCETGSYAITLTN  6926
             F ITVPYHA+PRPT SWS+NG++V P ERIKF S+DY+S+YYNKSAKR ETGSY ITLTN
Sbjct  6589  FRITVPYHASPRPTASWSLNGLEVIPGERIKFDSNDYASMYYNKSAKRDETGSYTITLTN  6648

Query  6927  NKGSDTASCHVTVVDRPGPPQGPLNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLDTS  6986
             NKGSDTASCHVTVVDRP PPQGPLNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLD S
Sbjct  6649  NKGSDTASCHVTVVDRPLPPQGPLNAYDITPDTCTLAWKTPLDDGGSPITNYVVEKLDNS  6708

Query  6987  GSWVKVSSFVRNIHYDVMGLEPQHKYYFRVRAENQYGLSDPLDISDPIVAKHQFTVPDEP  7046
             GSWVK+SSFVRN HYDVMGLEP +KY FRVRAENQYGLSDPLDI +PIVAKHQFTVPDEP
Sbjct  6709  GSWVKISSFVRNTHYDVMGLEPHYKYNFRVRAENQYGLSDPLDIIEPIVAKHQFTVPDEP  6768

Query  7047  GQPKVIDWDSGNVTLIWTRPAGDGGSRIQGYQIEYRDIVNDSSWNTYDYLIKDTKYQLYN  7106
             GQPKVIDWDSGNVTLIWTRP  DGGSRIQGYQIEYRDI+NDSSWN YDY+IKDTKYQLYN
Sbjct  6769  GQPKVIDWDSGNVTLIWTRPLSDGGSRIQGYQIEYRDILNDSSWNAYDYIIKDTKYQLYN  6828

Query  7107  LTNGSEYEFRIRAKNAAGLSKPSPPSLRFKLKGKFSVPSPPGTPQVTRVGKNYVDLKWEK  7166
             L NGSEYEFRI+AKNAAGLSKPS PSLRFKLKGKF+VPSPPG PQVTRVGKNYVDLKWEK
Sbjct  6829  LINGSEYEFRIKAKNAAGLSKPSSPSLRFKLKGKFTVPSPPGAPQVTRVGKNYVDLKWEK  6888

Query  7167  SLRDGGSRITSYIIERRDIGGAVWVKCNDYNVLDTEYTVINLIEMGDYEFRIFAVNSAGR  7226
              LRDGGSRIT YIIERRDIGGAVWVKCNDYNVLDTEYTV+NLIEMGDYEFR+FAVNSAGR
Sbjct  6889  PLRDGGSRITGYIIERRDIGGAVWVKCNDYNVLDTEYTVMNLIEMGDYEFRVFAVNSAGR  6948

Query  7227  SDPSLCTMPIRVCEVLGGEKPEWIKRLQDRVAPYGKDFTLQCAASGKPSPTARWLRNGKE  7286
             S+PSLCTMPI+VCEVLGG+KP+WI RLQD+VAP+GKD+TLQCAASGKPSPTARWLRNGKE
Sbjct  6949  SEPSLCTMPIKVCEVLGGKKPDWITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKE  7008

Query  7287  IQMGCGRFTCDNKDGLFRLHISNVQSGDDADYTCEAINSLGFVHTSGYLKIGSPPIINRC  7346
             IQM  GR TCD+KDG+FRLHISNVQ+GDD DYTCEA+NSLGFV+TSGYLKIGSPPIINRC
Sbjct  7009  IQMNGGRMTCDSKDGVFRLHISNVQTGDDGDYTCEAMNSLGFVNTSGYLKIGSPPIINRC  7068

Query  7347  PNELYLPEGDNTKIKVYYSGDQPLTVILRKNNEVISDSNDETHVKLNIFDDYVAICIRDI  7406
             P+EL LPEGDN+KIK++YSGDQPLTVIL+KNNEVI DSND+THVK+NIFDDYVAI IR+I
Sbjct  7069  PSELKLPEGDNSKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNIFDDYVAIYIRNI  7128

Query  7407  VKSDSGKYQIEFTNDSGSAIGQFDVYVTGLPTAPTGPLGISFINKNSCTLGWRLPSYDGG  7466
             VKSD G YQIEFTN+SGSA G+F V++TG+P+APTGP+GIS+INKNSC L WR PSYDGG
Sbjct  7129  VKSDGGPYQIEFTNESGSATGEFYVHITGMPSAPTGPMGISYINKNSCMLNWRPPSYDGG  7188

Query  7467  LKITHYVVERKDVKSPHWITVSSTCKDTTFSVQGLIENQEYIFRVMAVNENGMGPPLEGL  7526
             LK++HYV+ERKDV SPHWITVSSTCKDT F+VQGLIENQEYIFRVMAVNENGMGPPLEGL
Sbjct  7189  LKVSHYVIERKDVSSPHWITVSSTCKDTAFNVQGLIENQEYIFRVMAVNENGMGPPLEGL  7248

Query  7527  NPIRAKAPLDPPSPPGIPQITEIGGDFVHLEWSKPESDGGAHIQGYWIDKQEVGSNTWQR  7586
             NPIRAK P+DPPSPPG PQITEIGGDFVHLEW KPESDGGAHIQGYWIDK+EVGSNTWQR
Sbjct  7249  NPIRAKDPIDPPSPPGSPQITEIGGDFVHLEWEKPESDGGAHIQGYWIDKREVGSNTWQR  7308

Query  7587  VNVTICAANQINCVNLIEGRQYEFRIFAQNVAGISKESSASQVVKIIDPKGASPPLIVKP  7646
             VN TICAANQINC+NLIEGRQYEFRIFAQNVAG+S ESSASQ VKIIDP+ ASPPLIVKP
Sbjct  7309  VNATICAANQINCINLIEGRQYEFRIFAQNVAGLSTESSASQAVKIIDPQAASPPLIVKP  7368

Query  7647  LSDANCIQNHNAQFTCTISGVPKPTVTWYKGAREISNGARYHMYSEGENHFLNINDIFGE  7706
             L DANCIQNHNAQFTCTI+GVPKPT++WYKGAREISNGARYHMYSEG+NHFLNIND+FGE
Sbjct  7369  LRDANCIQNHNAQFTCTINGVPKPTISWYKGAREISNGARYHMYSEGDNHFLNINDVFGE  7428

Query  7707  DADEYVCRAVNKAGAKSTRAALAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKP  7766
             DADEYVCRAVNKAGAKSTRA LAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKP
Sbjct  7429  DADEYVCRAVNKAGAKSTRATLAIMTAPKLNVPPRFRDTAYFDKGENVVIKIPFTGFPKP  7488

Query  7767  RIHWVREGENIECGGHYTVETKERHAVLIIRDGSRMDSGPYRIAAENELGSDTAIIQVQI  7826
             RIHWVR+GENIE GGHYTVE KERHAVLIIRDGS +DSGPYRI AENELGSDTAIIQVQI
Sbjct  7489  RIHWVRDGENIESGGHYTVEVKERHAVLIIRDGSHLDSGPYRITAENELGSDTAIIQVQI  7548

Query  7827  SDRPDPPRFPLIESIGSDSLSLSWKAPVWDGGSDITNYYIERREHPLSSWIRVGNTRFTS  7886
             SDRPDPPRFPLIESIG++SLSLSWKAPVWDG SDITNYY+ERREHPLSSWIRVGNTRFTS
Sbjct  7549  SDRPDPPRFPLIESIGTESLSLSWKAPVWDGCSDITNYYVERREHPLSSWIRVGNTRFTS  7608

Query  7887  IAVCGLTSGKEYDFRISADNVYGRSEPSETSTLIKTKESTKKKPVERKWQIDTNGRKVRG  7946
             +AV GLT GKEYDFRI ADNVYGRS+ S+TSTLIKTKES KKKP+ERKW+ID NGRK+RG
Sbjct  7609  MAVSGLTPGKEYDFRIFADNVYGRSDASDTSTLIKTKESVKKKPIERKWEIDANGRKLRG  7668

Query  7947  TADGPIKDYDSYVFDIYSKFVPQPVEISQQSVYDKYDILEEIGTGAFGVVHRCRERSTGN  8006
              ADGP+KDYDSYVFDIYSKFVPQPVEISQQSVYD+YDILEEIGTGAFGVVHRCRERSTGN
Sbjct  7669  KADGPVKDYDSYVFDIYSKFVPQPVEISQQSVYDRYDILEEIGTGAFGVVHRCRERSTGN  7728

Query  8007  IFAAKFIPVSHSIEKDLIRREIDVMNQLHHQKLINLHDAFEDDDEMVLILEFLSGGELFE  8066
             IFAAKFIPVSHS+EKDLIRREID+MNQLHHQKLINLHDAFEDDDEM+LILEFLSGGELFE
Sbjct  7729  IFAAKFIPVSHSVEKDLIRREIDIMNQLHHQKLINLHDAFEDDDEMILILEFLSGGELFE  7788

Query  8067  RITAENYIMSEAEVINYMRQICEGIRHMHEKNIIHLDIKPENIMCQTRSSTNVKLIDFGL  8126
             RITAE Y+M+EAEVINYMRQICEGIRHMHE+NIIHLDIKPENIMCQTRSSTNVKLIDFGL
Sbjct  7789  RITAEGYVMTEAEVINYMRQICEGIRHMHEQNIIHLDIKPENIMCQTRSSTNVKLIDFGL  7848

Query  8127  ATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLAYVLLSGLSPFAGDNDVQ  8186
             ATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVL+YVLLSGLSPFAGDNDVQ
Sbjct  7849  ATRLDPNEVVKITTGTAEFAAPEIVNREPVGFYTDMWATGVLSYVLLSGLSPFAGDNDVQ  7908

Query  8187  TLKNVKSCDWDFDVESFKNISEEAKDFIRKLLVANKEKRMTAHECLLHPWLTGDHKGITQ  8246
             TLKNVK+CDWDFDVESFK ISEEAKDFIRKLLV NKEKRMTAHECLLHPWLTGDH  + Q
Sbjct  7909  TLKNVKACDWDFDVESFKYISEEAKDFIRKLLVRNKEKRMTAHECLLHPWLTGDHSAMKQ  7968

Query  8247  TINRDRYLAYREKLRKKYEDFERYLLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPR  8306
              INRDRYLAYREKLR+KYEDFER+LLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPR
Sbjct  7969  EINRDRYLAYREKLRRKYEDFERFLLPIGRLSEYSSLRKLLMEKYKIHDAVFDRRQAAPR  8028

Query  8307  FVIRPSSQFCYEGQSVKFYCRCIAIATPTLTWSHNNIELRQSVKFMKRYTGDDYYFIINR  8366
             FVIRPSSQFCYEGQSVKFYCRCIAIATPTLTWSHNNIELRQSVKFMKRY GDDYYFIINR
Sbjct  8029  FVIRPSSQFCYEGQSVKFYCRCIAIATPTLTWSHNNIELRQSVKFMKRYVGDDYYFIINR  8088

Query  8367  VKLDDRGEYIIRAENHYGSREEVVFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEES  8426
             VKLDDRGEYIIRAENHYGSREEVVFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEES
Sbjct  8089  VKLDDRGEYIIRAENHYGSREEVVFLNVQPLPKEQPRYRTESTPVRRREPLPYTFWQEES  8148

Query  8427  ETAPSFTFLLRPRVMQARDTCKLLCCLSGKPVPTVKWYKDGRELSKYEYAMTHSDGVVTM  8486
             ETAPSFTFLLRPRVMQARDTCKLLCCLSGKPVP V+WYKDGRELSKYEYAMTHSDGVVTM
Sbjct  8149  ETAPSFTFLLRPRVMQARDTCKLLCCLSGKPVPNVRWYKDGRELSKYEYAMTHSDGVVTM  8208

Query  8487  EIIDCKPSDSGKYSCKALNCHGTDETECVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQP  8546
             EIIDCKPSDSGKYSCKA NCHGTDET+CVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQP
Sbjct  8209  EIIDCKPSDSGKYSCKATNCHGTDETDCVVIVEGEWVTPEQAQLAHNFLYSGDRKYIEQP  8268

Query  8547  MKPAPTPIVTSRQFAPLSSQGTSKSSSNNTTGTITSSSGTQNSISNKKKYASNSLQAPGS  8606
             +KPAP PIVTSRQ+   S Q TS+   +        S+   + ISNKKKYASNSLQAPGS
Sbjct  8269  IKPAPLPIVTSRQYTSSSVQNTSEPQGDKV----NVSNSNSSGISNKKKYASNSLQAPGS  8324

Query  8607  PSRSRSATKELILPPDDSLMCKPEFTKPLHDLTIRDGDQLILICHVKGDPEPQITWSKNG  8666
             PSRSRSATKELILPPDDSLMCKPEFTKPLHDLTI DG+QLIL C+VKGDPEPQI+WSKNG
Sbjct  8325  PSRSRSATKELILPPDDSLMCKPEFTKPLHDLTIHDGEQLILTCYVKGDPEPQISWSKNG  8384

Query  8667  KSISSSDIMDLKYKNGIATLTIHEVFPEDEGVFTCTATNSICAVETKCKLTIMPLDKSSP  8726
             KS+SSSDI+DL+YKNGIATLTI+EVFPEDEGV TCTATNS+ AVETKCKLTI PLDK+  
Sbjct  8385  KSLSSSDILDLRYKNGIATLTINEVFPEDEGVITCTATNSVGAVETKCKLTIQPLDKNIN  8444

Query  8727  KRKMIAGDKAPKIVSHLESRLVKDGDAVTLACRIIGAENFDVVWLHNNKEIKPSKDFQYT  8786
             KRK+ AGD APKIVSHLESR V+DGDAV LACRIIGA++FDVVWLHNNKEIKPSKDFQYT
Sbjct  8445  KRKVNAGDNAPKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQYT  8504

Query  8787  NEANIYRLQIAEIFPEDSGTYTCEAFNDVGESFSTCTINVNVPGDEPKHPSFAKFPISVS  8846
             NEANIYRLQIAEIFPED GTYTCEAFND+GESFSTCTINV VPGDE K PSF KFP SVS
Sbjct  8505  NEANIYRLQIAEIFPEDGGTYTCEAFNDIGESFSTCTINVTVPGDETKQPSFVKFPTSVS  8564

Query  8847  ILEGESTTFTCEIDSELLNLVWVKDGKPVDETLSRYSFTKDENRYAFTVAKCNMDDVGQY  8906
             +LEGE TTF CEIDSELLNLVW+KDGKP+DETL RYSFTKD +RY+F VAKCNMDDVGQY
Sbjct  8565  VLEGEGTTFECEIDSELLNLVWLKDGKPIDETLPRYSFTKDGHRYSFAVAKCNMDDVGQY  8624

Query  8907  QVKAVAKKGESTCAFSMNVHNAE  8929
             Q KAV+ K ES CAFSMNVH AE
Sbjct  8625  QAKAVSGKAESICAFSMNVHTAE  8647


 Score = 572 bits (1475),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 326/635 (51%), Positives = 415/635 (65%), Gaps = 31/635 (5%)

Query  1    MGVAEDFAPSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQ  60
            MGVAEDFAPSF+KKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRS+NK+VED RTKFKIQ
Sbjct  1    MGVAEDFAPSFVKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSDNKVVEDVRTKFKIQ  60

Query  61   PVEDNKYTVVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPT  120
            PV +NKYTVVLELDDVVETDAGLYKVKA NKSGEVSASINLNFTPADEPKEKQIDGFAPT
Sbjct  61   PVGENKYTVVLELDDVVETDAGLYKVKAKNKSGEVSASINLNFTPADEPKEKQIDGFAPT  120

Query  121  FAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATL  180
            FAKKPAIRQEEDGKRLLFECRVNADP P I+WFHNGAAVKES RHK+TVDKDVHSYFATL
Sbjct  121  FAKKPAIRQEEDGKRLLFECRVNADPIPAIIWFHNGAAVKESERHKITVDKDVHSYFATL  180

Query  181  EIQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIRQSE  240
            EI NVTVEDAGKYKVNAKNELGESNATISLNFDS        A GF P+F E+P I  +E
Sbjct  181  EILNVTVEDAGKYKVNAKNELGESNATISLNFDS-----ASDANGFAPSFIEKPRIIPNE  235

Query  241  DGGNVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQ  300
             G  +T +C+C   P P +TW  G+ ++ KSK+ K++ T+  +  +   LEI    ++D 
Sbjct  236  SGTLITMKCKCKAKPEPTVTWYRGQDLVEKSKKIKINTTVIAEDTYELTLEIKDPGATDG  295

Query  301  GEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEED--LLIMECVLEA  358
            G YR   KN++G   A +NLN E+  +   +G +  F +KP I  E +  L+IMEC ++A
Sbjct  296  GTYRCNVKNEYGESNANLNLNIEAEPEPEGEGPT--FIEKPRIVSENNGKLVIMECKVKA  353

Query  359  HPVPDIVWYCTEKEI--SNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIY  416
             P PD++W+   + I  SN  +T + ++    D Y + LE+ +P  ED G Y+CN  N  
Sbjct  354  DPKPDVIWFRNGEVIKESNKIKTFIEQRG---DQYYIKLELLDPQLEDSGLYKCNIKNTL  410

Query  417  GESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCKCKAKPEPIVTWYRGQE  476
            GE NAN+ LN +         P   +KP+II       + ++C   +K EP  TWY+   
Sbjct  411  GELNANLTLNIE-------IVPVIKDKPKIIKIIKKRTVVIECTVASKFEPKCTWYKETS  463

Query  477  IVEKSKKIKINTTVIADDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEP  536
             V++SK+         +  + + LEI D   +D G Y+    NE GE+ + + +N+   P
Sbjct  464  TVKESKRHVYQVEQTKEGEFAVKLEINDVEESDKGAYKLVASNEKGEAVSQI-VNLVDIP  522

Query  537  DPEGEGPTFVEKPRIISEN----NGKLVIMECKVKADPKPDVIWYRNGEVVKESNKIKTF  592
            + E + P   E  R +++     +    ++    + D K  V WY+   V++E+  I T 
Sbjct  523  EEERK-PCKPEISRKLADQKVAESKTFELLVSLSQTDRKCKVEWYKGSTVIRETKDITTT  581

Query  593  IEQRGDQYYIKLELLDPQLEDSGLYKCNIKNTLGE  627
                 D    +L     + E +  YK  + N +G+
Sbjct  582  F----DGTTARLTFSSARTEHTSNYKVIVTNEVGK  612


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 125/320 (39%), Gaps = 23/320 (7%)

Query  9     PSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVEDNKYT  68
             P F K        DG +LI  C +   P+P I W ++   L   +    + +        
Sbjct  8347  PEFTKPLHDLTIHDGEQLILTCYVKGDPEPQISWSKNGKSLSSSDILDLRYK-----NGI  8401

Query  69    VVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKEKQ---IDGFAPTFAKKP  125
               L +++V   D G+    A N  G V     L   P D+   K+       AP      
Sbjct  8402  ATLTINEVFPEDEGVITCTATNSVGAVETKCKLTIQPLDKNINKRKVNAGDNAPKIVSHL  8461

Query  126   AIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNV  185
               R   DG  +   CR+       +VW HN   +K S   + T + +++     L+I  +
Sbjct  8462  ESRFVRDGDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQYTNEANIYR----LQIAEI  8517

Query  186   TVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIRQSEDGGNV  245
               ED G Y   A N++GES +T ++N       VP   E  +P+F + P      +G   
Sbjct  8518  FPEDGGTYTCEAFNDIGESFSTCTIN-----VTVP-GDETKQPSFVKFPTSVSVLEGEGT  8571

Query  246   TFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQGEYRA  305
             TFEC    +    +    G+ I     RY  S T D   Y  A   ++     D G+Y+A
Sbjct  8572  TFECEIDSELLNLVWLKDGKPIDETLPRY--SFTKDGHRYSFA---VAKCNMDDVGQYQA  8626

Query  306   QAKNKHGSGVATINLNFESG  325
             +A +     +   ++N  + 
Sbjct  8627  KAVSGKAESICAFSMNVHTA  8646


 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 125/319 (39%), Gaps = 26/319 (8%)

Query  119   PTFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFA  178
             P F K        DG++L+  C V  DP P I W  NG ++  S      +D    +  A
Sbjct  8347  PEFTKPLHDLTIHDGEQLILTCYVKGDPEPQISWSKNGKSLSSSD----ILDLRYKNGIA  8402

Query  179   TLEIQNVTVEDAGKYKVNAKNELGESNATISLN---FDSDEAPVPESAEGFKPTFTERPV  235
             TL I  V  ED G     A N +G       L     D +      +A    P       
Sbjct  8403  TLTINEVFPEDEGVITCTATNSVGAVETKCKLTIQPLDKNINKRKVNAGDNAPKIVSHLE  8462

Query  236   IRQSEDGGNVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSV  295
              R   DG  V   CR +G    ++ W H    +  SK ++   T +  +Y    L+I+ +
Sbjct  8463  SRFVRDGDAVNLACRIIGAQHFDVVWLHNNKEIKPSKDFQY--TNEANIYR---LQIAEI  8517

Query  296   VSSDQGEYRAQAKNKHGSGVATINLNFESGSKKIP--DGKSPRFPKKPTIRQ--EEDLLI  351
                D G Y  +A N  G   +T  +N       +P  + K P F K PT     E +   
Sbjct  8518  FPEDGGTYTCEAFNDIGESFSTCTINV-----TVPGDETKQPSFVKFPTSVSVLEGEGTT  8572

Query  352   MECVLEAHPVPDIVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCN  411
              EC +++  + ++VW    K I       + R + +KD +  +  +     +D G Y+  
Sbjct  8573  FECEIDSE-LLNLVWLKDGKPIDET----LPRYSFTKDGHRYSFAVAKCNMDDVGQYQAK  8627

Query  412   AINIYGESNANIALNFQGA  430
             A++   ES    ++N   A
Sbjct  8628  AVSGKAESICAFSMNVHTA  8646


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/220 (25%), Positives = 104/220 (47%), Gaps = 29/220 (13%)

Query  8731  IAGDKAPKIVSHLESRLVKDGDAVTLACRIIGAENFDVVWLHNNK----------EIKPS  8780
             +A D AP  V   +     DG+ +   C+++ +   D+ W  ++           +I+P 
Sbjct  3     VAEDFAPSFVKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSDNKVVEDVRTKFKIQPV  62

Query  8781  KDFQYTNEANIYRLQIAEIFPEDSGTYTCEAFNDVGESFSTCTINVNVPGDEPKH-----  8835
              + +YT       L++ ++   D+G Y  +A N  GE  ++  +N   P DEPK      
Sbjct  63    GENKYT-----VVLELDDVVETDAGLYKVKAKNKSGEVSASINLNF-TPADEPKEKQIDG  116

Query  8836  --PSFAKFPISVSILEGESTTFTCEIDSE-LLNLVWVKDGKPVDETLSRYSFTKDENRYA  8892
               P+FAK P      +G+   F C ++++ +  ++W  +G  V E+  R+  T D++ ++
Sbjct  117   FAPTFAKKPAIRQEEDGKRLLFECRVNADPIPAIIWFHNGAAVKES-ERHKITVDKDVHS  175

Query  8893  F----TVAKCNMDDVGQYQVKAVAKKGESTCAFSMNVHNA  8928
             +     +    ++D G+Y+V A  + GES    S+N  +A
Sbjct  176   YFATLEILNVTVEDAGKYKVNAKNELGESNATISLNFDSA  215


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 102/221 (46%), Gaps = 29/221 (13%)

Query  4     AEDFAPSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVE  63
             A D AP  +   +     DG+ +   C+++ +   D+ W  + NK         +I+P +
Sbjct  8450  AGDNAPKIVSHLESRFVRDGDAVNLACRIIGAQHFDVVWLHN-NK---------EIKPSK  8499

Query  64    DNKYT-----VVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFT-PADEPKEKQIDGF  117
             D +YT       L++ ++   D G Y  +A N  GE  ++  +N T P DE K+      
Sbjct  8500  DFQYTNEANIYRLQIAEIFPEDGGTYTCEAFNDIGESFSTCTINVTVPGDETKQ------  8553

Query  118   APTFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKES-SRHKLTVDKDVHSY  176
              P+F K P      +G+   FEC ++++    +VW  +G  + E+  R+  T  KD H Y
Sbjct  8554  -PSFVKFPTSVSVLEGEGTTFECEIDSE-LLNLVWLKDGKPIDETLPRYSFT--KDGHRY  8609

Query  177   FATLEIQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEA  217
               +  +    ++D G+Y+  A +   ES    S+N  + E+
Sbjct  8610  --SFAVAKCNMDDVGQYQAKAVSGKAESICAFSMNVHTAES  8648


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 61/221 (28%), Positives = 94/221 (43%), Gaps = 40/221 (18%)

Query  118   APTFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRH-KLTVDKDVHSY  176
             AP F  +P+ +   +G+ + F CR  A  +PT+ W HN   +++S +  K  V  D   Y
Sbjct  8026  APRFVIRPSSQFCYEGQSVKFYCRCIAIATPTLTWSHNNIELRQSVKFMKRYVGDDY--Y  8083

Query  177   FATLEIQNVTVEDAGKYKVNAKNELGESNATISLN----------FDSDEAPV-------  219
             F    I  V ++D G+Y + A+N  G     + LN          + ++  PV       
Sbjct  8084  FI---INRVKLDDRGEYIIRAENHYGSREEVVFLNVQPLPKEQPRYRTESTPVRRREPLP  8140

Query  220   -------PESAEGFKPTFTERPVIRQSEDGGNVTFECRCVGDPTPEITWSHGETILNKSK  272
                     E+A  F  TF  RP + Q+ D       C   G P P + W      L+K  
Sbjct  8141  YTFWQEESETAPSF--TFLLRPRVMQARD--TCKLLCCLSGKPVPNVRWYKDGRELSK--  8194

Query  273   RYKMSLTMDQKLYHMACLEISSVVSSDQGEYRAQAKNKHGS  313
              Y+ ++T    +  M   EI     SD G+Y  +A N HG+
Sbjct  8195  -YEYAMTHSDGVVTM---EIIDCKPSDSGKYSCKATNCHGT  8231


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 75/291 (26%), Positives = 111/291 (38%), Gaps = 42/291 (14%)

Query  138   FECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNA  197
             F C +N  P PTI W+     +   +R+ +  + D H     L I +V  EDA +Y   A
Sbjct  7382  FTCTINGVPKPTISWYKGAREISNGARYHMYSEGDNH----FLNINDVFGEDADEYVCRA  7437

Query  198   KNELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIRQS---EDGGNVTFECRCVGD  254
              N+ G  +   +L   +             P     P  R +   + G NV  +    G 
Sbjct  7438  VNKAGAKSTRATLAIMT------------APKLNVPPRFRDTAYFDKGENVVIKIPFTGF  7485

Query  255   PTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQGEYRAQAKNKHGSG  314
             P P I W      +     Y    T++ K  H A L I      D G YR  A+N+ GS 
Sbjct  7486  PKPRIHWVRDGENIESGGHY----TVEVKERH-AVLIIRDGSHLDSGPYRITAENELGSD  7540

Query  315   VATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPVPDIVWYCTEKE--  372
              A I +         PD   PRFP   +I  E   L  +  +      DI  Y  E+   
Sbjct  7541  TAIIQVQISDR----PD--PPRFPLIESIGTESLSLSWKAPV-WDGCSDITNYYVERREH  7593

Query  373   -ISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNAN  422
              +S+  R   TR          ++ +   T     ++R  A N+YG S+A+
Sbjct  7594  PLSSWIRVGNTR--------FTSMAVSGLTPGKEYDFRIFADNVYGRSDAS  7636


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 50/188 (27%), Positives = 80/188 (43%), Gaps = 24/188 (13%)

Query  28    FECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVEDNKYTVVLELDDVVETDAGLYKVK  87
             F C +   PKP I W++   ++   N  ++ +    DN +   L ++DV   DA  Y  +
Sbjct  7382  FTCTINGVPKPTISWYKGAREI--SNGARYHMYSEGDNHF---LNINDVFGEDADEYVCR  7436

Query  88    AMNKSGEVSASINLNFTPADEPKEKQIDGFAPTFAKKPAIRQE---EDGKRLLFECRVNA  144
             A+NK+G  S    L                AP     P  R     + G+ ++ +     
Sbjct  7437  AVNKAGAKSTRATLAIM------------TAPKLNVPPRFRDTAYFDKGENVVIKIPFTG  7484

Query  145   DPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKNELGES  204
              P P I W  +G  + ES  H     K+ H   A L I++ +  D+G Y++ A+NELG  
Sbjct  7485  FPKPRIHWVRDGENI-ESGGHYTVEVKERH---AVLIIRDGSHLDSGPYRITAENELGSD  7540

Query  205   NATISLNF  212
              A I +  
Sbjct  7541  TAIIQVQI  7548


 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 94/222 (42%), Gaps = 44/222 (20%)

Query  8     APSFLKKPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVEDNKY  67
             AP F+ +P      +G  + F C+ ++   P + W  S N +      KF  + V D+ Y
Sbjct  8026  APRFVIRPSSQFCYEGQSVKFYCRCIAIATPTLTW--SHNNIELRQSVKFMKRYVGDDYY  8083

Query  68    TVV--LELDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKE--------------  111
              ++  ++LD     D G Y ++A N  G     + LN  P   PKE              
Sbjct  8084  FIINRVKLD-----DRGEYIIRAENHYGSREEVVFLNVQPL--PKEQPRYRTESTPVRRR  8136

Query  112   --------KQIDGFAP--TFAKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKE  161
                     ++    AP  TF  +P + Q  D  +LL  C ++  P P + W+ +G   +E
Sbjct  8137  EPLPYTFWQEESETAPSFTFLLRPRVMQARDTCKLL--CCLSGKPVPNVRWYKDG---RE  8191

Query  162   SSRHKLTVDKDVHS-YFATLEIQNVTVEDAGKYKVNAKNELG  202
              S+++  +    HS    T+EI +    D+GKY   A N  G
Sbjct  8192  LSKYEYAM---THSDGVVTMEIIDCKPSDSGKYSCKATNCHG  8230


 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/272 (23%), Positives = 103/272 (38%), Gaps = 28/272 (10%)

Query  62    VEDNKYTVVLELDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPTF  121
             V D +YTV+    +++E     ++V A+N +G    S+        E     + G  P +
Sbjct  6920  VLDTEYTVM----NLIEMGDYEFRVFAVNSAGRSEPSLCTMPIKVCE----VLGGKKPDW  6971

Query  122   AKKPAIRQEEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLE  181
               +   +    GK    +C  +  PSPT  W  NG  ++ +   ++T D     +   L 
Sbjct  6972  ITRLQDKVAPFGKDYTLQCAASGKPSPTARWLRNGKEIQMNG-GRMTCDSKDGVF--RLH  7028

Query  182   IQNVTVEDAGKYKVNAKNELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIRQSED  241
             I NV   D G Y   A N LG  N +  L              G  P     P   +  +
Sbjct  7029  ISNVQTGDDGDYTCEAMNSLGFVNTSGYLKI------------GSPPIINRCPSELKLPE  7076

Query  242   GGNVTFECRCVGD-PTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQ  300
             G N   +    GD P   I   + E I + +    + + +         + I ++V SD 
Sbjct  7077  GDNSKIKIFYSGDQPLTVILKKNNEVICDSNDDTHVKVNI---FDDYVAIYIRNIVKSDG  7133

Query  301   GEYRAQAKNKHGSGVATINLNFESGSKKIPDG  332
             G Y+ +  N+ GS      ++  +G    P G
Sbjct  7134  GPYQIEFTNESGSATGEFYVHI-TGMPSAPTG  7164


 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 128/546 (23%), Positives = 201/546 (37%), Gaps = 98/546 (18%)

Query  39    DIEWFRSE-------NKLVEDNRTKF-----KIQPVEDNKYTVVLELDDVVETDAGLYKV  86
             D+EW R E          V + R KF     K   + D+       + D++E     ++V
Sbjct  4907  DLEWTRPEADGGSPITGYVVEKRDKFSPDWEKCAEISDD--ITNAHVPDLIEGLKYEFRV  4964

Query  87    KAMNKSGEVSASINLNFTPADEPKEK--QIDGFAPTFAKKPAIRQEEDGKRLLFECRVNA  144
             +A+NK+G  S S +   T    PK    +ID     F     I+    G    F+  V  
Sbjct  4965  RAVNKAGPGSPS-DATETHVARPKNTPPKIDR---NFMSDIKIKA---GNVFEFDVPVTG  5017

Query  145   DPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKNELGES  204
             +P P+  W H G  +  + R K++   D       + I +    D G Y + A+N  G  
Sbjct  5018  EPLPSKDWTHEGNMIINTDRVKISNFDD----RTKIRILDAKRSDTGVYTLTARNINGTD  5073

Query  205   NATISLNFDSDEAPVPESAEGFKPTFTERPVIRQ---SEDGGNVTFECRCVGDPTPEITW  261
                + +    D   VPE             V+R     +DGG+             EIT 
Sbjct  5074  RHNVKVTI-LDAPSVPEGPLRNGDVSKNSIVLRWRPPKDDGGS-------------EITH  5119

Query  262   SHGETILNKSKRY-KMSLTMDQKLYHMACLEISSVVSSDQGEYRAQAKNKHGSGVATINL  320
                E + N++ R+  +    D +      +   +++ +    +R +A NK G        
Sbjct  5120  YVVEKMDNEAMRWVPVGDCTDTE------IRADNLIENHDYSFRVRAVNKQGQSQPL---  5170

Query  321   NFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLE-AHPVPD----IVWYCTEKEISN  375
                + S+ I        P KP   Q  D       LE + P  D    I  Y  EK    
Sbjct  5171  ---TTSQPITAKDPYSHPDKPGQPQATDWGKHFVDLEWSTPKRDGGAPISSYIIEKRPKF  5227

Query  376   NQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNANIALNFQGASDANG  435
              Q     R A+         +   P   +GG Y              IA+N  G SD + 
Sbjct  5228  GQ---WERAAVVLGD---NCKAHVPELTNGGEYEFRV----------IAVNRGGPSDPSD  5271

Query  436   FAPSFIEKPRI------------IPNESGTLITMKCKCKAKPEPIVTW-YRGQEIVEKSK  482
              + + I KPR             I   +G  +      +A P P++TW Y G+EI   S+
Sbjct  5272  PSSTIICKPRFLAPFFDKSLLNDITVHAGKRLGWTLPIEASPRPLITWLYNGKEIGSNSR  5331

Query  483   KIKINTTVIADDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPDPEGEG  542
                  + +  +   ELT EI     +D G Y   +KNE+G  +A+ +  +   P P  +G
Sbjct  5332  G---ESGLFQN---ELTFEIVSSLRSDEGRYTLILKNEHGSFDASAHATVLDRPSPP-KG  5384

Query  543   PTFVEK  548
             P  + K
Sbjct  5385  PLDITK  5390


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/140 (26%), Positives = 69/140 (49%), Gaps = 12/140 (9%)

Query  73    LDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPTFAKKPAIRQE--  130
             ++D++  +   +++ A+NK+G+   S      P+D+   K  D FAP    +  I+    
Sbjct  3765  VNDLIAGNKYQFRIMAVNKAGKSKPS-----EPSDQMTAK--DRFAPPKIDRTNIKDITI  3817

Query  131   EDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDA  190
             + G+ + F+ +V+ +P  T VW HN A ++    +    + D+ SY   L +       +
Sbjct  3818  KAGQHIRFDIKVSGEPPATKVWLHNKARLENDDSN---YNIDMESYRTKLTVPISKRFHS  3874

Query  191   GKYKVNAKNELGESNATISL  210
             GKY + A+NE G   A+  +
Sbjct  3875  GKYTLKAENESGRDEASFEV  3894


 Score = 46.6 bits (109),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 34/128 (27%), Positives = 61/128 (48%), Gaps = 10/128 (8%)

Query  84    YKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPTFAKKPAIRQEEDGKRLLFECRVN  143
             ++V+A+NK+G    S   N+  A   K + +         KP I +   G  +  +  + 
Sbjct  3185  FRVRAVNKAGPSDPSEQTNWHVA---KPRFLKPHIDRVNLKPVIVKT--GLSISLDINIR  3239

Query  144   ADPSPTIVWFHNGAAVKESSRHKLTVDK-DVHSYFATLEIQNVTVEDAGKYKVNAKNELG  202
              +P+P + WF N ++V  S  H + +D  D ++ F  +  Q      +GKY + A NE+G
Sbjct  3240  GEPAPKVEWFFNNSSVT-SDEHSVKIDNVDYNTKFFVMRAQR---SQSGKYIIKATNEVG  3295

Query  203   ESNATISL  210
             E  A + +
Sbjct  3296  EDEAELEV  3303


 Score = 45.8 bits (107),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 93/429 (22%), Positives = 150/429 (35%), Gaps = 74/429 (17%)

Query  23    GNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVEDNKYTVVLELDDVVETDAG  82
             G    F+C++   P P  +W   + ++   +  K     V +  Y   L+++    +D+G
Sbjct  4709  GQSFTFDCKVSGEPAPQTKWLLKKKEVYSKDNVK-----VTNVDYNTKLKVNSATRSDSG  4763

Query  83    LYKVKAMNKSGEVSASINLNF----TPADEP-KEKQIDGFAPTFAKKPAIRQEEDGKRLL  137
             +Y V A N +GE SA + +       P + P K  +I+  + T    P    ++DG + +
Sbjct  4764  IYTVFAENANGEDSADVKVTVIDKPAPPNGPLKVDEINSESCTLHWNPP---DDDGGQPI  4820

Query  138   FECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNA  197
                 V      T  W   G               +       L++  +T     K++V A
Sbjct  4821  DNYVVEKLDETTGRWIPAG---------------ETDGPVTALKVGGLTPGHKYKFRVRA  4865

Query  198   KNELGES------NATISLN-FDSDEAPVPESAEGFKPTFTERPVIRQSEDGGNVTFECR  250
             KN  G S       A I+ N FD    P   + + F   F +    R   DGG+      
Sbjct  4866  KNRQGTSEPLTTAQAIIAKNPFDVPTKPGTPTIKDFDKEFVDLEWTRPEADGGS------  4919

Query  251   CVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEIS---------SVVSSDQG  301
                     IT   G  +    KR K S   ++      C EIS          ++   + 
Sbjct  4920  -------PIT---GYVV---EKRDKFSPDWEK------CAEISDDITNAHVPDLIEGLKY  4960

Query  302   EYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPV  361
             E+R +A NK G G  +          K    K  R        +  ++   +  +   P+
Sbjct  4961  EFRVRAVNKAGPGSPSDATETHVARPKNTPPKIDRNFMSDIKIKAGNVFEFDVPVTGEPL  5020

Query  362   PDIVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNA  421
             P   W      I N  R K     IS       + I +  + D G Y   A NI G    
Sbjct  5021  PSKDWTHEGNMIINTDRVK-----ISNFDDRTKIRILDAKRSDTGVYTLTARNINGTDRH  5075

Query  422   NIALNFQGA  430
             N+ +    A
Sbjct  5076  NVKVTILDA  5084


 Score = 44.3 bits (103),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 79/201 (39%), Gaps = 18/201 (9%)

Query  14    KPQLHQEDDGNRLIFECQLLSSPKPDIEWFRSENKLVEDNR-TKFKIQPVEDNKYTVVLE  72
             KP+L   D  +  I   Q +S+    I  +  E + V   R  K   QPV   +Y    +
Sbjct  5782  KPELTDSDKNHITIKWKQPISNGGSPIIGYDIERRDVNTGRWIKINGQPVPTAEY----Q  5837

Query  73    LDDVVETDAGLYKVKAMNKSGEVSAS---INLNFTPADEPKEKQIDGFAPTFAKKPAIRQ  129
              D V       Y++ A+N +G    S      N  P  E      DG      K+  +R 
Sbjct  5838  DDRVTSNHQYQYRISAVNAAGNGKTSEPSAIFNARPLREKPRFYFDGL---IGKRIKVRA  5894

Query  130   EEDGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVED  189
                G+ +     ++  P+PTI W      ++E  R    +  + +S      I +    D
Sbjct  5895  ---GEPVNLNIPISGAPTPTIEWKRGDLKLEEGKR----ISYETNSERTLFRIDDSNRRD  5947

Query  190   AGKYKVNAKNELGESNATISL  210
             +GKY V A NE G+  A I +
Sbjct  5948  SGKYTVTAANEFGKDTADIEV  5968


 Score = 42.7 bits (99),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 90/430 (21%), Positives = 155/430 (36%), Gaps = 81/430 (19%)

Query  142   VNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKNEL  201
             V   P+PT  ++   + + E  R K   D   ++   TL ++     D  KYK+   N  
Sbjct  1235  VEGSPAPTFKFYKGVSEILEGGRFKFLTDGQTNTI--TLCMRKCKPNDESKYKIVVSNIH  1292

Query  202   GESNATISL--------------------NFDSDEA--------------PVPESAEGFK  227
             GE +A + L                     +D DE               P  +  E   
Sbjct  1293  GEDSAEMQLYVSDSSGMDFRAMLKKRRYQKWDKDEQDPNWGDLKETEKPLPALKKVERKV  1352

Query  228   PTFTERPVIRQSEDGG---NVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKL  284
              +F   P+I Q    G    V FE R    P  +  W   +  +    ++K     D   
Sbjct  1353  ESFLS-PLIDQFAKEGKDKKVVFEAR-FSKPNCKPKWLFRKDEVFTGSKFKFKQENDT--  1408

Query  285   YHMACLEISSVVSSDQGEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFP-KKPTI  343
             Y +    I++    D G+Y  +     G   +T  LN E           P +   KP  
Sbjct  1409  YQLI---ITTPKVEDTGKYTIEI----GGVSSTAFLNVEEA--------DPTYTFTKPLK  1453

Query  344   RQEEDLLIMECVLE---AHPVPDIVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNP  400
             ++ E     E  LE   +  + ++ W+    ++ ++    +  K I+ +   L L I++ 
Sbjct  1454  KKLEGFTQHETTLECSVSSSMANVHWFKNNTKLESDDPRYLISKDINGN---LKLIIKDS  1510

Query  401   TKEDGGNYRCNAINIYGESNANIALNFQGASDANGFAPSFIEKPRIIPNESGTLITMKCK  460
               +D G YRC       ++  N+ +          +   F++  +         +T+ C+
Sbjct  1511  VLDDAGLYRCQLDKQPDKTECNLKV--------TEYPYKFVKVLKSQQCIEKDTVTLACE  1562

Query  461   C-KAKPEPIVTWYRGQEIVEKSKKIKINTTVIADDTYELTLEIKDPGATDGGTYRCNVKN  519
                A  E  V W R  E ++  K+I+     I  D  +  L IKD   TD G ++C    
Sbjct  1563  IDDAMGE--VQWLRNGEEIKPDKRIQ-----IVKDGRKRKLVIKDCKVTDAGQFKCTTNA  1615

Query  520   EYGESNANLN  529
             +  ES   +N
Sbjct  1616  DTTESEIIIN  1625


 Score = 42.0 bits (97),  Expect = 0.031, Method: Compositional matrix adjust.
 Identities = 86/413 (21%), Positives = 155/413 (38%), Gaps = 55/413 (13%)

Query  144   ADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKNELGE  203
             A P P   W+ N   + +++R    V K +    A++ ++N    D+G+Y++  KN  G 
Sbjct  6301  AFPKPNAFWYSNDNMLDDNNR----VHKHLTDDAASVVVKNSKRADSGQYRLQLKNTSGF  6356

Query  204   SNATISLN-FDSDEAPVPESAEGFKPTFTERPVIRQSEDGGNVTFECRCVGDPTPEITWS  262
               ATI++   D    P    A+ F            ++DGG+                  
Sbjct  6357  DTATINVRVLDRPSPPTRLRADEFSGDSLTLYWNPPNDDGGSAI----------------  6400

Query  263   HGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQGEYRAQAKNKHGSG--VATINL  320
                 I+ K +    + +       +  + I ++V + + ++R  A+NK+G      T   
Sbjct  6401  -QNYIIEKKEARSSTWSKVSSFCTVPFVRIRNLVLNKEYDFRVIAENKYGQSDPANTSEP  6459

Query  321   NFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPVPD-IVWYCTEKEISNNQRT  379
                     IP+  +P  P    I   ED + +      H     I  Y  EK + ++ + 
Sbjct  6460  ILARHPFDIPN--TPGIPH--GIDSTEDSITIAWTKPKHDGGSPITGYIIEKRLLSDDKW  6515

Query  380   KMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNANIALNFQGASDANGFAPS  439
                  A+  D   L+ +I N  +     +R  A+N  G+S       + G+SD   F   
Sbjct  6516  TKAVHALCPD---LSCKIPNLIENAEYEFRVAAVNAAGQS------AYSGSSDLI-FCRR  6565

Query  440   FIEKPRIIPNES--------GTLITMKCKCKAKPEPIVTW-YRGQEIVEKSKKIKINTTV  490
                 P+I  + S        G    +     A P P  +W   G E++   ++IK ++  
Sbjct  6566  PPHAPKITSDLSIRDMTVIAGDEFRITVPYHASPRPTASWSLNGLEVI-PGERIKFDSND  6624

Query  491   IADDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPDPEGEGP  543
              A   Y      K     + G+Y   + N  G   A+ ++ +   P P  +GP
Sbjct  6625  YASMYYN-----KSAKRDETGSYTITLTNNKGSDTASCHVTVVDRPLPP-QGP  6671


 Score = 41.2 bits (95),  Expect = 0.058, Method: Compositional matrix adjust.
 Identities = 91/494 (18%), Positives = 185/494 (37%), Gaps = 91/494 (18%)

Query  73    LDDVVETDAGLYKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPTFAK----KPAIR  128
             ++ +VE +   ++V+A+NK+G    S                D   P  AK    KP I 
Sbjct  2877  VEGLVEGNIYQFRVRAVNKAGFSDPS----------------DATEPHLAKPRNLKPYIN  2920

Query  129   QEE-------DGKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKL-TVDKDVHSYFATL  180
             +++        G+ + F+  V  +P+P++ WF     +  + + +L  +D     Y   L
Sbjct  2921  RDKMKPIKVRAGQPVKFDVDVKGEPAPSLTWFLKETELTSTGQVRLENID-----YNTKL  2975

Query  181   EIQNVTVEDAGKYKVNAKNELGESNATISLNF----DSDEAPVPES---AEGFKPTFTER  233
              + +   + +G+YK+ A+N  G   A + +         E P+  S    EG K  +   
Sbjct  2976  TLLDTDRKQSGQYKLRAENINGVDEAVVEVIILDKPSKPEGPIEVSDIHKEGCKLKW---  3032

Query  234   PVIRQSEDGGNVTFECRCVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEIS  293
                R+ +D G +      +            E +   + ++  + ++D + Y    +EI 
Sbjct  3033  ---RKPKDDGGIPITGYVI------------EKMDTATGKWVPAGSVDPEKYD---IEIK  3074

Query  294   SVVSSDQGEYRAQAKNKHGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIME  353
              +  + + ++R +A N+ G        +  +          P  P+     +    L  E
Sbjct  3075  GLDPNHRYQFRVKAVNEEGESEPLETESAITAKNPFDVSAPPGLPELEDWDEHHVKLKWE  3134

Query  354   CVLE--AHPVPDIVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCN  411
               +     P+ + +    +K+      +    KA+  DS +    ++   +     +R  
Sbjct  3135  PPIRDGGSPITNYIIEVMDKD------SGEFVKAVETDSPVCKGVVKKLEEGQQYKFRVR  3188

Query  412   AINIYGESNANIALNFQGASDANGFAPSFIE--------KPRIIPNESGTLITMKCKCKA  463
             A+N  G S+ +   N+  A       P F++        KP I+  ++G  I++    + 
Sbjct  3189  AVNKAGPSDPSEQTNWHVAK------PRFLKPHIDRVNLKPVIV--KTGLSISLDINIRG  3240

Query  464   KPEPIVTW-YRGQEIVEKSKKIKINTTVIADDTYELTLEIKDPGATDGGTYRCNVKNEYG  522
             +P P V W +    +      +KI+        Y     +     +  G Y     NE G
Sbjct  3241  EPAPKVEWFFNNSSVTSDEHSVKIDNV-----DYNTKFFVMRAQRSQSGKYIIKATNEVG  3295

Query  523   ESNANLNLNIEAEP  536
             E  A L + +  +P
Sbjct  3296  EDEAELEVTVLGKP  3309


 Score = 37.7 bits (86),  Expect = 0.65, Method: Compositional matrix adjust.
 Identities = 104/470 (22%), Positives = 174/470 (37%), Gaps = 64/470 (14%)

Query  84    YKVKAMNKSGEVSASINLNFTPADEPKEKQIDGFAPTFAKKPAIRQE--EDGKRLLFECR  141
             ++VKA+N +G    S       A +P   +    AP   +K  IR    + G+ +  +  
Sbjct  4076  FRVKAINAAGPGEPS------DASKPIITKPRKLAPKIDRK-NIRTYNFKSGEPIFLDIN  4128

Query  142   VNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKNEL  201
             ++ +P+P + W  N  +V+ +S   +    +   Y       N   +D G YK++A N  
Sbjct  4129  ISGEPAPDVTWNQNNKSVQTTSFSHI----ENLPYNTKYINNNPERKDTGLYKISAHNFY  4184

Query  202   GESNATISLNFDSD----EAPVPESAEGFKPTFTERPVIRQSEDGGNVTFECRCVG--DP  255
             G+      +N  +     E P+ E +E  K     +   ++ +D G    E   V   DP
Sbjct  4185  GQDQVEFQINIITKPGKPEGPL-EVSEVHKDGCKLK--WKKPKDDGGEPVESYLVEKFDP  4241

Query  256   TPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQGEYRAQAKNKHGSGV  315
                I    G +              D   Y+     +  +V     ++R +A NK G   
Sbjct  4242  DTGIWLPVGRS--------------DGPEYN-----VDGLVPGHDYKFRVKAVNKEGESE  4282

Query  316   ATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPVPD------IVWYCT  369
                 L    GS    D  S   P KP + +  D    +  L A P P       I  Y  
Sbjct  4283  PLETL----GSIIAKDPFS--VPTKPGVPEPTDWTANKVEL-AWPEPASDGGSPIQGYIV  4335

Query  370   EKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNANIALNFQG  429
             E +   ++ + +  KA+  +S   T  +Q   + +   +R  A+N  G S  +       
Sbjct  4336  EVK---DKYSPLWEKALETNSPTPTATVQGLIEGNEYQFRVVALNKGGLSEPSDPSKIFT  4392

Query  430   ASDANGFAPSFIEKP-RIIPNESGTLITMKCKCKAKPEPIVTWYRGQEIVEKSKKIKINT  488
             A      AP    +  R I   SGT + +      +P P V W      ++  K + I T
Sbjct  4393  AK-PRYLAPKIDRRNLRNITLSSGTALKLDANITGEPAPKVEWKLSNYHLQSGKNVTIET  4451

Query  489   TVIADDTYELTLEIKDPGATDGGTYRCNVKNEYGESNANLNLNIEAEPDP  538
                    Y   L I+    +D G Y     N  G+ +  +N+ I  +P P
Sbjct  4452  P-----DYYTKLVIRPTQRSDSGEYLVTATNTSGKDSVLVNVVITDKPSP  4496


 Score = 37.7 bits (86),  Expect = 0.66, Method: Compositional matrix adjust.
 Identities = 22/79 (28%), Positives = 44/79 (56%), Gaps = 5/79 (6%)

Query  23    GNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVEDNKYTVVLELDDVVETDAG  82
             G+        L+ PKP+  W+ ++N L ++NR     + + D+  +VV++  +    D+G
Sbjct  6290  GDDFSIHVPYLAFPKPNAFWYSNDNMLDDNNRVH---KHLTDDAASVVVK--NSKRADSG  6344

Query  83    LYKVKAMNKSGEVSASINL  101
              Y+++  N SG  +A+IN+
Sbjct  6345  QYRLQLKNTSGFDTATINV  6363


 Score = 36.2 bits (82),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 77/419 (18%), Positives = 146/419 (35%), Gaps = 55/419 (13%)

Query  23    GNRLIFECQLLSSPKPDIEWFRSENKLVEDNRTKFKIQPVEDNKYTVVLELDDVVETDAG  82
             G  + F+  +   P P + WF  E +L    + +     +E+  Y   L L D     +G
Sbjct  2932  GQPVKFDVDVKGEPAPSLTWFLKETELTSTGQVR-----LENIDYNTKLTLLDTDRKQSG  2986

Query  83    LYKVKAMNKSG--EVSASINLNFTPADEPKEKQIDGFAPTFAKKPAIRQEEDGKRLLFEC  140
              YK++A N +G  E    + +   P+      ++        K    + ++DG   +   
Sbjct  2987  QYKLRAENINGVDEAVVEVIILDKPSKPEGPIEVSDIHKEGCKLKWRKPKDDGGIPITGY  3046

Query  141   RVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKNE  200
              +    + T  W   G           +VD + +     +EI+ +      +++V A NE
Sbjct  3047  VIEKMDTATGKWVPAG-----------SVDPEKYD----IEIKGLDPNHRYQFRVKAVNE  3091

Query  201   LGESNATISLNFDSDEAPVPESAEGFKPTFTE----------RPVIRQSEDGGNVTFECR  250
              GES    + +  + + P   SA    P   +           P IR   DGG+      
Sbjct  3092  EGESEPLETESAITAKNPFDVSAPPGLPELEDWDEHHVKLKWEPPIR---DGGS------  3142

Query  251   CVGDPTPEITWSHGETILNKSKRYKMSLTMDQKLYHMACLEISSVVSSDQGEYRAQAKNK  310
                     IT    E +   S  +  ++  D  +       +  +    Q ++R +A NK
Sbjct  3143  -------PITNYIIEVMDKDSGEFVKAVETDSPVCKGV---VKKLEEGQQYKFRVRAVNK  3192

Query  311   HGSGVATINLNFESGSKKIPDGKSPRFPKKPTIRQEEDLLIMECVLEAHPVPDIVWYCTE  370
              G    +   N+     +       R   KP I +    + ++  +   P P + W+   
Sbjct  3193  AGPSDPSEQTNWHVAKPRFLKPHIDRVNLKPVIVKTGLSISLDINIRGEPAPKVEWFFNN  3252

Query  371   KEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNANIALNFQG  429
               +++++ +      I    Y     +    +   G Y   A N  GE  A + +   G
Sbjct  3253  SSVTSDEHS----VKIDNVDYNTKFFVMRAQRSQSGKYIIKATNEVGEDEAELEVTVLG  3307


 Score = 34.7 bits (78),  Expect = 5.1, Method: Compositional matrix adjust.
 Identities = 21/78 (27%), Positives = 33/78 (42%), Gaps = 4/78 (5%)

Query  133   GKRLLFECRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGK  192
             G+ L  +  + A+P   + W +N   +K S   K+    +   Y  T  +  V   D G 
Sbjct  3525  GQMLHIDALIKAEPPAKVTWTYNKTEIKTSDHIKI----ENEDYKTTFIMPKVKRADRGI  3580

Query  193   YKVNAKNELGESNATISL  210
             Y V AKN+ G     + L
Sbjct  3581  YIVTAKNDSGSDTVEVEL  3598


 Score = 34.7 bits (78),  Expect = 6.2, Method: Compositional matrix adjust.
 Identities = 79/422 (19%), Positives = 159/422 (38%), Gaps = 67/422 (16%)

Query  23    GNRLIFECQLLSSPKPDIEWFRSENKLV-EDNRTKFKIQPVEDNKYTVVLELDDVVETDA  81
             G  + ++  +   P P I W++++ +L  E+  +  +I+ +  N    ++E    V    
Sbjct  2632  GKPIRYDVNVRGEPAPVITWYQNDKELKPEELPSSSEIKNIPYNTKISIIE---TVRKHT  2688

Query  82    GLYKVKAMNKSGEVSASINLN-FTPADEPKEK-QIDGFAPTFAKKPAIRQEEDGKRLLFE  139
             G+YK+ A+N+ G+  A++ +N   P  +P+    +        K    + E+DG + +  
Sbjct  2689  GIYKIIAVNEHGQDEATVEVNILAPPSKPRGPLDVKDVTKDSCKLKWKKPEDDGGKPISA  2748

Query  140   CRVNADPSPTIVWFHNGAAVKESSRHKLTVDKDVHSYFATLEIQNVTVEDAGKYKVNAKN  199
              +V         W   G      +   +   ++ H Y               +++V A N
Sbjct  2749  YQVEKFDKKQGRWVPLGRTSANDTEFDVKGLQEGHEY---------------QFRVKAIN  2793

Query  200   ELGESNATISLNFDSDEAPVPESAEGFKPTFTERPVIRQSEDGGNVTFECRCVGDPTPEI  259
             E GES+       DSD++ + ++            ++  +E    + +E        P  
Sbjct  2794  EEGESDP-----LDSDDSIIAKNPYDAASKPGTPNIVDYNEHMVKLKWEAPRSDGGAP--  2846

Query  260   TWSHGETILNKSKRYKMSLTMDQKLYHMACL---EISSVVSSDQGEYRAQAKNKHGSGVA  316
                 G  I    K+ K S   D+ L     +    +  +V  +  ++R +A NK G    
Sbjct  2847  --ISGYII---EKKDKFSPIWDEILSTNTSVPEATVEGLVEGNIYQFRVRAVNKAG----  2897

Query  317   TINLNFESGSKKIPDGKSPRFPK----KPTIRQEEDLLI---------MECVLEAHPVPD  363
                  F   S    D   P   K    KP I +++   I          +  ++  P P 
Sbjct  2898  -----FSDPS----DATEPHLAKPRNLKPYINRDKMKPIKVRAGQPVKFDVDVKGEPAPS  2948

Query  364   IVWYCTEKEISNNQRTKMTRKAISKDSYILTLEIQNPTKEDGGNYRCNAINIYGESNANI  423
             + W+  E E+++  + ++         Y   L + +  ++  G Y+  A NI G   A +
Sbjct  2949  LTWFLKETELTSTGQVRL-----ENIDYNTKLTLLDTDRKQSGQYKLRAENINGVDEAVV  3003

Query  424   AL  425
              +
Sbjct  3004  EV  3005



Lambda      K        H
   0.315    0.133    0.376 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2622152742


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062578.2 uncharacterized protein LOC108102315 isoform X5
[Drosophila eugracilis]

Length=2897
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V483_DROME  unnamed protein product                                 4051    0.0  
X2J9E1_DROME  unnamed protein product                                 4040    0.0  
Q8IM87_DROME  unnamed protein product                                 4001    0.0  


>Q9V483_DROME unnamed protein product
Length=2874

 Score = 4051 bits (10505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2098/2938 (71%), Positives = 2336/2938 (80%), Gaps = 105/2938 (4%)

Query  1     MTHYARHEYFHNTQNDALASDTGISTYNHMNYGTQNIREYFIEPCNLSNQGPDDYSSEGQ  60
             MTHY RH+YFHNTQN AL+SDT   +Y+ ++Y TQ  REYF E   LSNQGP++ S    
Sbjct  1     MTHYVRHDYFHNTQNGALSSDTSRISYSQISYETQPSREYFSESYALSNQGPEECSRVSH  60

Query  61    YASDTIPTTVDKSNNSYINDYIEQFGAQEQHEAEEESFDNWNEN-STVTTPYEVEFVNQK  119
               SDT+ TTVD SNNSY  DY+E +GA  Q + EE+S DNWNEN S V   Y +   N  
Sbjct  61    LNSDTVLTTVDNSNNSYGYDYLECYGANIQCDPEEDSVDNWNENTSVVADQYGLGHNNLN  120

Query  120   RTSQKLLPKLPSNINGSASSKPCPPHMDINLKTEGMCIKREQRHGGCKAKAHECDRHFFP  179
              TS KLLPKLP+  NG  SS  C P MD+   T+GMCIK +  +G C AKAH+      P
Sbjct  121   CTSSKLLPKLPNIENGRGSSNACAPQMDVKFNTKGMCIKIDHSYGVCMAKAHDFVGRLSP  180

Query  180   GDDQNIYADNINGYTGFAFSSAFHNNVVSAAPLRTLAQTARSNFYLSQDFFELNADVDQA  239
              D QNI  +N+NGY G A+SS F +N +S+APLR L Q+ R + YL ++    NAD   A
Sbjct  181   SDYQNILGNNLNGYAGCAYSSTFLDNAMSSAPLRVLPQSPRCSSYLGRNIIGFNAD---A  237

Query  240   GELSQCDFAMGQTAAMDSGSGTYDVFENMSRPYTSMLPLGYSDFEECYYNIDNLSTYSDT  299
              +     F   QT AM S S TY+V+E M RPYTSMLPL YSD++E  YN DNLSTYSDT
Sbjct  238   AQRDGRGFDTDQTDAMGSESSTYEVYEKMQRPYTSMLPLDYSDYQEGCYNTDNLSTYSDT  297

Query  300   PQINNAQLNLQKQRKFSLMMAMTTASVIASGETRVPVLSKHSKKPTETRTDSLLGSSIIT  359
             P  NN QL  Q QRK SLMMAMTTASVIASGE RVPV SK SKK TE +TDS++G++I T
Sbjct  298   PPSNNTQLKRQMQRKISLMMAMTTASVIASGEIRVPVHSKQSKKSTEIQTDSIIGNTIST  357

Query  360   NAATRASERMLEPKCCGGIVTPGDTGAVASTPSVNTATISKTRKLPKVLPTPQNKLSLHT  419
             NAA R  +R L  + C  IV   D+G+V S PS     I+KTRKLPKVLPTP  K S H 
Sbjct  358   NAAARDLDRCLATESCEVIVDTRDSGSVTSFPSSAVTAITKTRKLPKVLPTPLCKSSRHP  417

Query  420   KTTGTEALN---FSNPIAEKIHRSKQLPKLPTSLSQTKPYSVPNSNFSTYCALEALSFNL  476
              T  T+AL+    S+P+ EK HR KQLPKLP SL Q+   +  NSN++T  A +AL FN 
Sbjct  418   ITIATDALSSSYTSDPLPEKSHRPKQLPKLPISLPQSNDRASLNSNWATPPAPDALPFNS  477

Query  477   LDNKSASPSPTEITVTTT-----SFPTVTSYEDSPKPFAYSYESKDPIEVFLSKSIEADP  531
              D+KSAS SPT  T  T      S+   T +  +     Y Y+SK+P  VF  KS+EA+ 
Sbjct  478   FDHKSAS-SPTPTTTITKDTETTSYLVETDFIGARHNALYQYDSKEPNIVFSDKSVEAEH  536

Query  532   APSF-------SIEKQCVSVELSNNIIQENSPPCHIPEISTANPDIKPDHCDSFIDSIFQ  584
             +P++       S +  C  V L +NI+Q  S  CH+PEI     DI+ +   S I+ I +
Sbjct  537   SPTWTPLSPIQSKQSPCPPVALPSNIMQNVSLTCHLPEIEATRSDIEREPESSSIEPILE  596

Query  585   NEKSPDSYINPESALFNISEYLKPYTLEKITFTGEKPNQITDAASISTTAHPSNGKLSGE  644
              EK  D Y  P SALFNISEYLKPYTL K   + EK N I +AAS STT  P N      
Sbjct  597   IEKLADPYSGPGSALFNISEYLKPYTLNKPILSEEKKNHIANAASTSTTT-PLN------  649

Query  645   INVLKSTLSSGDALVPYSNTCPTSCVNYKPLEVESGSNILMQTNLNTNPAEFIILPSSSC  704
                    ++S D    YSN   ++CVN++PL+VES  NI ++ N  TN AE ++ P  S 
Sbjct  650   -------ITSDDEFSSYSNKWTSTCVNFQPLDVESSLNISLKVNAGTNQAELLMTPLKSS  702

Query  705   IPALSLSSNLISDHLTDADIFPVIGFPPDKDVTVKDSFQNNAFTTTVYINNNEVVPVTKS  764
              P L +SSN  SD+            PPD           +AFTTTV +N+ E V V+ S
Sbjct  703   TP-LFISSNGTSDNFNLRK-----SSPPD-----------SAFTTTVNVNSFETVLVSGS  745

Query  765   QNATPT--------SEAPIISYSDYMKKFELPDLPQPIMILSEKLPVTQSVSGAVTADS-  815
             Q A+P+        S AP++SYSDYMK+FELP+LPQPIM LSE    TQS S  V  ++ 
Sbjct  746   QTASPSPSNLKSPPSIAPLLSYSDYMKQFELPELPQPIMDLSENDTATQSDSFNVINNTL  805

Query  816   ------EAEKELDVENRCSELLPSYFTKLFSEYNAPISSSEIRASPINDEIDN-SFYMKT  868
                    +  ++DVE++ S  LPSY ++ F   + P  S + +   I +++D+ S     
Sbjct  806   TNADNLNSYNQMDVESKSSLQLPSYSSESFDPCSVPSFSIKNKEYKIVEKLDSLSNVESV  865

Query  869   ESSIPITTTVCSAGPPSYFPENEAKEKNHLTFDDTFYDSFNVDIIELTASVAQVESENDL  928
             ES   + + V         P  E+   N + FDDTFYDSFNVDI ELTA V  V  E+ L
Sbjct  866   ESPKTLVSPVNPLNCSKLLPGTESIVSNDVAFDDTFYDSFNVDIKELTAFVDHVAPEDGL  925

Query  929   NNAPIESLNNSINIENETSFEFSIEKTLDTRDMNQNVSLGQGGYYRPSQAQQKPNVVASA  988
              N P           ++TS EFS +KT DT DMNQN+S G+ GYY+PSQAQQK +VVASA
Sbjct  926   YNFP----------NDKTSVEFSFDKTEDTIDMNQNLSSGECGYYKPSQAQQKASVVASA  975

Query  989   ATSVLDGISKGLKGGLDGVFSNVSSSVEATQTVNATRKAFSFNLASKLVPSVGGLLSSSN  1048
             A+SVLDGISKGLKGGLDGVFS VSS+V+ TQ+  ++++ FSFNLASK+VPSVGGLL+S++
Sbjct  976   ASSVLDGISKGLKGGLDGVFSGVSSTVDVTQSNPSSKRGFSFNLASKIVPSVGGLLTSTS  1035

Query  1049  SSSTKQTQAPKSVTSPTLI-TSVENDSTDSCTYETTISPPL-YKTAENHFYPATLPN-TL  1105
             S+S KQT    S T+PTLI  S EN S+ +  Y  T SP    K  E + Y AT+ N + 
Sbjct  1036  STSIKQT---GSETNPTLILISPENVSSRNSNYIPTTSPSCTQKNGEENLYSATVHNKST  1092

Query  1106  KGETHLNNVEMVETSSTLLENVCDNYYENYDETLLTDKMMNACMLDRRSEYGLIENSYSY  1165
             K  ++ N  E+ E SSTL+ NVCD+Y  +YDE +LT++M+N  MLD  SE+GLIENSYSY
Sbjct  1093  KSNSYYN--EVGEISSTLVRNVCDSYDNSYDEMILTNEMVNIGMLDSESEFGLIENSYSY  1150

Query  1166  HVSDEGQLATFNTQSTLLKDVPNESELGIENLKIKNNPTYWHEPMTKKGSTSSSGMLGSI  1225
              V D  Q+ + N+ +   ++V N    GIE    KN P   H+P TKK ST   GM GSI
Sbjct  1151  QVPDNEQIDSVNSYNNKTQNVTNN---GIEKANTKNKPVPLHDPPTKKASTV--GMFGSI  1205

Query  1226  LGKAAAAVQSATHAVNQGASTVVSVVGQKQTLLPATISIHDMDGISSTTTTIKRESNVD-  1284
             LGKAAAAVQSAT AVNQ AS+V SVV QK T++P T ++  +  + S     +  S+V+ 
Sbjct  1206  LGKAAAAVQSATQAVNQSASSVASVVAQKPTIVPRTNNVLLLSSVCSPNEIKRNSSSVEF  1265

Query  1285  ----SYQLTNEESLSSPYKNTIDEFENTNIKMQEYSTYIEKETFVNYQSNGNQHQFRNDS  1340
                  YQ+ + ESLSS Y NT  +++N+N+K+ E+ TY +   + +Y +NGNQ QF+ ++
Sbjct  1266  DSEYGYQMPDVESLSSHYANTGGDYDNSNMKIHEFGTYADDRPYADYHTNGNQSQFKEEA  1325

Query  1341  VLSEQSQVISNVSKALPTVPPSGSTGKKLPTVNGKSGLLIKQMPTEIYDDESDLDDLDVN  1400
             V+  + +VI+  +  LP  P   +TGKKLPTVNGKS LLIKQMPTE+YDDESD D+LDV+
Sbjct  1326  VIPGEPEVIN--TNILPIGP--QATGKKLPTVNGKSALLIKQMPTEVYDDESDTDELDVS  1381

Query  1401  PSIGKEPSYRIDGEQDDYYMDLQQTTPSNQINGYYEHVNNGYDYREDYFNEEDEYKYLEQ  1460
             PS GK PSY I  EQ+DYYMDLQQTTPS Q NG+YE VNNGYDYREDYFNEEDEYKYLEQ
Sbjct  1382  PSTGKVPSYSIYSEQEDYYMDLQQTTPSIQPNGFYEQVNNGYDYREDYFNEEDEYKYLEQ  1441

Query  1461  QREQEQH-EPKIKKYVKQTNSMLLTCQAQSSLDFIDEGQDDDFIYDSYHSEEDSGNYLDE  1519
             QREQE+H +PK KKY+KQ     ++     SLDFID GQDDDFIYD+YHSE+DSGNYL+ 
Sbjct  1442  QREQEEHNQPKNKKYLKQAK---ISKIQPPSLDFIDVGQDDDFIYDNYHSEDDSGNYLEG  1498

Query  1520  SSSGSVGPSEGRNLKMDTNGEVALTSTSIQIKSDSLAPIKNHIQKHDSLICQPTAKKTSF  1579
             SSSGSVGP EG  +K+D+N E +  S  +  KSDS  P  + +QKHD++I + T K T  
Sbjct  1499  SSSGSVGPIEGSIIKVDSNIEASFAS--LNKKSDSFTPTNDSLQKHDTVIGESTTKLTRL  1556

Query  1580  NEEKTCPDLDEREEDIHDQLSDLTDLNNLLPQKKKTLLRGETEEVVGGNMQMIRQPEITA  1639
               EK CPD+DE +E++ D +SDLTDL+ L+ QKKKTLLRGETEEVVGG+MQ++RQ EITA
Sbjct  1557  RTEKMCPDVDEEDENLSDHVSDLTDLSKLISQKKKTLLRGETEEVVGGHMQVLRQTEITA  1616

Query  1640  GQRWHWAYNKIIMQLNNGGGNGEVGIRNNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL  1699
              QRWHWAYNKIIMQLNNGGG GEVG+R NGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL
Sbjct  1617  RQRWHWAYNKIIMQLNNGGGPGEVGLRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL  1676

Query  1700  VLKTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPHNFLLWTATSP  1759
             VLKTMAATKRNAGLTSAVPRATLNDE+LKMHVYKKALQALIYPISSTTPHNFLLWTATSP
Sbjct  1677  VLKTMAATKRNAGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSP  1736

Query  1760  TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII  1819
             TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII
Sbjct  1737  TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII  1796

Query  1820  TAMKERMKQREREKPEIFELIRAVFSVEEKSHTGHMKAMKQSVLDGTSKWSAKIAITVIC  1879
             TAMK+RMKQREREKPEIFELIRAVFSVEEKSH GHMKA+KQSVLDGTSKWSAKIAITVIC
Sbjct  1797  TAMKDRMKQREREKPEIFELIRAVFSVEEKSHAGHMKAVKQSVLDGTSKWSAKIAITVIC  1856

Query  1880  AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD  1939
             AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD
Sbjct  1857  AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD  1916

Query  1940  EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV  1999
             EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV
Sbjct  1917  EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV  1976

Query  2000  EIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPTQKGDDAWKLYFDEIPEEIVDEF  2059
             EIKGEEKVAPYHVQYTCLHENLFHYLCEEN+GMVKLPTQKGDDAWKLYFDEIPEEIVDEF
Sbjct  1977  EIKGEEKVAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWKLYFDEIPEEIVDEF  2036

Query  2060  SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA  2119
             SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA
Sbjct  2037  SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA  2096

Query  2120  SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE  2179
             SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE
Sbjct  2097  SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE  2156

Query  2180  LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNETKRAPDDHEPKLDSVD  2239
             LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNE KRAPDDHEPKLDSVD
Sbjct  2157  LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVD  2216

Query  2240  FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR  2299
             FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR
Sbjct  2217  FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR  2276

Query  2300  LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG  2359
             LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG
Sbjct  2277  LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG  2336

Query  2360  AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMKRFAKTIV  2419
             AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYM+RFAKTIV
Sbjct  2337  AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIV  2396

Query  2420  KVLIAYADIVKIEFPDHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE  2479
             KVLIAYADIVK+EFP+HMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE
Sbjct  2397  KVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE  2456

Query  2480  LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE  2539
             LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE
Sbjct  2457  LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE  2516

Query  2540  ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK  2599
             ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK
Sbjct  2517  ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK  2576

Query  2600  HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV  2659
             HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV
Sbjct  2577  HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV  2636

Query  2660  ALDTIKQYFHAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFISSQIHEVDAEN  2719
             ALDTIKQYFHAGGNGLKKTFLEKS ELQSLRYALSLYTQMTDTLIKTFISSQ+HEVD EN
Sbjct  2637  ALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLEN  2696

Query  2720  SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK  2779
             SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK
Sbjct  2697  SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK  2756

Query  2780  KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK  2839
             KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK
Sbjct  2757  KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK  2816

Query  2840  DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDDVAKEFVKLKSEIRQEPTMGT  2897
             DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNND+VAKEFVKLKSEIRQEPTMGT
Sbjct  2817  DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTMGT  2874


>X2J9E1_DROME unnamed protein product
Length=2871

 Score = 4040 bits (10478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2095/2938 (71%), Positives = 2333/2938 (79%), Gaps = 108/2938 (4%)

Query  1     MTHYARHEYFHNTQNDALASDTGISTYNHMNYGTQNIREYFIEPCNLSNQGPDDYSSEGQ  60
             MTHY RH+YFHNTQN AL+SDT   +Y+ ++Y TQ  REYF E   LSNQGP++ S    
Sbjct  1     MTHYVRHDYFHNTQNGALSSDTSRISYSQISYETQPSREYFSESYALSNQGPEECSRVSH  60

Query  61    YASDTIPTTVDKSNNSYINDYIEQFGAQEQHEAEEESFDNWNEN-STVTTPYEVEFVNQK  119
               SDT+ TTVD SNNSY  DY+E +GA  Q + EE+S DNWNEN S V   Y +   N  
Sbjct  61    LNSDTVLTTVDNSNNSYGYDYLECYGANIQCDPEEDSVDNWNENTSVVADQYGLGHNNLN  120

Query  120   RTSQKLLPKLPSNINGSASSKPCPPHMDINLKTEGMCIKREQRHGGCKAKAHECDRHFFP  179
              TS KLLPKLP+  NG  SS  C P MD+   T+GMCIK +  +G C AKAH+      P
Sbjct  121   CTSSKLLPKLPNIENGRGSSNACAPQMDVKFNTKGMCIKIDHSYGVCMAKAHDFVGRLSP  180

Query  180   GDDQNIYADNINGYTGFAFSSAFHNNVVSAAPLRTLAQTARSNFYLSQDFFELNADVDQA  239
              D QNI  +N+NGY G A+SS F +N +S+APLR L Q+ R + YL ++    NAD   A
Sbjct  181   SDYQNILGNNLNGYAGCAYSSTFLDNAMSSAPLRVLPQSPRCSSYLGRNIIGFNAD---A  237

Query  240   GELSQCDFAMGQTAAMDSGSGTYDVFENMSRPYTSMLPLGYSDFEECYYNIDNLSTYSDT  299
              +     F   QT AM S S TY+V+E M RPYTSMLPL YSD++E  YN DNLSTYSDT
Sbjct  238   AQRDGRGFDTDQTDAMGSESSTYEVYEKMQRPYTSMLPLDYSDYQEGCYNTDNLSTYSDT  297

Query  300   PQINNAQLNLQKQRKFSLMMAMTTASVIASGETRVPVLSKHSKKPTETRTDSLLGSSIIT  359
             P  NN QL  Q QRK SLMMAMTTASVIASGE RVPV SK SKK TE +TDS++G++I T
Sbjct  298   PPSNNTQLKRQMQRKISLMMAMTTASVIASGEIRVPVHSKQSKKSTEIQTDSIIGNTIST  357

Query  360   NAATRASERMLEPKCCGGIVTPGDTGAVASTPSVNTATISKTRKLPKVLPTPQNKLSLHT  419
             NAA R  +R L  + C  IV   D+G+V S PS     I+KTRKLPKVLPTP  K S H 
Sbjct  358   NAAARDLDRCLATESCEVIVDTRDSGSVTSFPSSAVTAITKTRKLPKVLPTPLCKSSRHP  417

Query  420   KTTGTEALN---FSNPIAEKIHRSKQLPKLPTSLSQTKPYSVPNSNFSTYCALEALSFNL  476
              T  T+AL+    S+P+ EK HR KQLPKLP SL Q+   +  NSN++T  A +AL FN 
Sbjct  418   ITIATDALSSSYTSDPLPEKSHRPKQLPKLPISLPQSNDRASLNSNWATPPAPDALPFNS  477

Query  477   LDNKSASPSPTEITVTTT-----SFPTVTSYEDSPKPFAYSYESKDPIEVFLSKSIEADP  531
              D+KSAS SPT  T  T      S+   T +  +     Y Y+SK+P  VF  KS+EA+ 
Sbjct  478   FDHKSAS-SPTPTTTITKDTETTSYLVETDFIGARHNALYQYDSKEPNIVFSDKSVEAEH  536

Query  532   APSF-------SIEKQCVSVELSNNIIQENSPPCHIPEISTANPDIKPDHCDSFIDSIFQ  584
             +P++       S +  C  V L +NI+Q  S  CH+PEI     DI+ +   S I+ I +
Sbjct  537   SPTWTPLSPIQSKQSPCPPVALPSNIMQNVSLTCHLPEIEATRSDIEREPESSSIEPILE  596

Query  585   NEKSPDSYINPESALFNISEYLKPYTLEKITFTGEKPNQITDAASISTTAHPSNGKLSGE  644
              EK  D Y  P SALFNISEYLKPYTL K   + EK N I +AAS STT  P N      
Sbjct  597   IEKLADPYSGPGSALFNISEYLKPYTLNKPILSEEKKNHIANAASTSTTT-PLN------  649

Query  645   INVLKSTLSSGDALVPYSNTCPTSCVNYKPLEVESGSNILMQTNLNTNPAEFIILPSSSC  704
                    ++S D    YSN   ++CVN++PL+VES  NI ++ N  TN AE ++ P  S 
Sbjct  650   -------ITSDDEFSSYSNKWTSTCVNFQPLDVESSLNISLKVNAGTNQAELLMTPLKSS  702

Query  705   IPALSLSSNLISDHLTDADIFPVIGFPPDKDVTVKDSFQNNAFTTTVYINNNEVVPVTKS  764
              P L +SSN  SD+            PPD           +AFTTTV +N+ E V V+ S
Sbjct  703   TP-LFISSNGTSDNFNLRK-----SSPPD-----------SAFTTTVNVNSFETVLVSGS  745

Query  765   QNATPT--------SEAPIISYSDYMKKFELPDLPQPIMILSEKLPVTQSVSGAVTADS-  815
             Q A+P+        S AP++SYSDYMK+FELP+LPQPIM LSE    TQS S  V  ++ 
Sbjct  746   QTASPSPSNLKSPPSIAPLLSYSDYMKQFELPELPQPIMDLSENDTATQSDSFNVINNTL  805

Query  816   ------EAEKELDVENRCSELLPSYFTKLFSEYNAPISSSEIRASPINDEIDN-SFYMKT  868
                    +  ++DVE++ S  LPSY ++ F   + P  S + +   I +++D+ S     
Sbjct  806   TNADNLNSYNQMDVESKSSLQLPSYSSESFDPCSVPSFSIKNKEYKIVEKLDSLSNVESV  865

Query  869   ESSIPITTTVCSAGPPSYFPENEAKEKNHLTFDDTFYDSFNVDIIELTASVAQVESENDL  928
             ES   + + V         P  E+   N + FDDTFYDSFNVDI ELTA V  V  E+ L
Sbjct  866   ESPKTLVSPVNPLNCSKLLPGTESIVSNDVAFDDTFYDSFNVDIKELTAFVDHVAPEDGL  925

Query  929   NNAPIESLNNSINIENETSFEFSIEKTLDTRDMNQNVSLGQGGYYRPSQAQQKPNVVASA  988
              N P           ++TS EFS +KT DT DMNQN+S G+ GYY+PSQAQQK +VVASA
Sbjct  926   YNFP----------NDKTSVEFSFDKTEDTIDMNQNLSSGECGYYKPSQAQQKASVVASA  975

Query  989   ATSVLDGISKGLKGGLDGVFSNVSSSVEATQTVNATRKAFSFNLASKLVPSVGGLLSSSN  1048
             A+SVLDGISKGLKGGLDGVFS VSS+V+ TQ+  ++++ FSFNLASK+VPSVGGLL+S++
Sbjct  976   ASSVLDGISKGLKGGLDGVFSGVSSTVDVTQSNPSSKRGFSFNLASKIVPSVGGLLTSTS  1035

Query  1049  SSSTKQTQAPKSVTSPTLI-TSVENDSTDSCTYETTISPPL-YKTAENHFYPATLPN-TL  1105
             S+S KQT    S T+PTLI  S EN S+ +  Y  T SP    K  E + Y AT+ N + 
Sbjct  1036  STSIKQT---GSETNPTLILISPENVSSRNSNYIPTTSPSCTQKNGEENLYSATVHNKST  1092

Query  1106  KGETHLNNVEMVETSSTLLENVCDNYYENYDETLLTDKMMNACMLDRRSEYGLIENSYSY  1165
             K  ++ N  E+ E SSTL+ NVCD+Y  +YDE +LT++M+N  MLD  SE+GLIENSYSY
Sbjct  1093  KSNSYYN--EVGEISSTLVRNVCDSYDNSYDEMILTNEMVNIGMLDSESEFGLIENSYSY  1150

Query  1166  HVSDEGQLATFNTQSTLLKDVPNESELGIENLKIKNNPTYWHEPMTKKGSTSSSGMLGSI  1225
              V D  Q+ + N+ +   ++V N    GIE    KN P   H+P TKK ST   GM GSI
Sbjct  1151  QVPDNEQIDSVNSYNNKTQNVTNN---GIEKANTKNKPVPLHDPPTKKASTV--GMFGSI  1205

Query  1226  LGKAAAAVQSATHAVNQGASTVVSVVGQKQTLLPATISIHDMDGISSTTTTIKRESNVD-  1284
             LGKAAAAVQSAT AVNQ AS+V SVV QK T++P T ++  +  + S     +  S+V+ 
Sbjct  1206  LGKAAAAVQSATQAVNQSASSVASVVAQKPTIVPRTNNVLLLSSVCSPNEIKRNSSSVEF  1265

Query  1285  ----SYQLTNEESLSSPYKNTIDEFENTNIKMQEYSTYIEKETFVNYQSNGNQHQFRNDS  1340
                  YQ+ + ESLSS Y NT  +++N+N+K+ E+ TY +   + +Y +NGNQ QF+ ++
Sbjct  1266  DSEYGYQMPDVESLSSHYANTGGDYDNSNMKIHEFGTYADDRPYADYHTNGNQSQFKEEA  1325

Query  1341  VLSEQSQVISNVSKALPTVPPSGSTGKKLPTVNGKSGLLIKQMPTEIYDDESDLDDLDVN  1400
             V+  + +VI+  +  LP  P   +TGKKLPTVNGKS LLIKQMPTE+YDDESD D+LDV+
Sbjct  1326  VIPGEPEVIN--TNILPIGP--QATGKKLPTVNGKSALLIKQMPTEVYDDESDTDELDVS  1381

Query  1401  PSIGKEPSYRIDGEQDDYYMDLQQTTPSNQINGYYEHVNNGYDYREDYFNEEDEYKYLEQ  1460
             PS GK PSY I  EQ+DYYMDLQQTTPS Q NG+YE VNNGYDYREDYFNEEDEYKYLEQ
Sbjct  1382  PSTGKVPSYSIYSEQEDYYMDLQQTTPSIQPNGFYEQVNNGYDYREDYFNEEDEYKYLEQ  1441

Query  1461  QREQEQH-EPKIKKYVKQTNSMLLTCQAQSSLDFIDEGQDDDFIYDSYHSEEDSGNYLDE  1519
             QREQE+H +PK KKY+KQ     ++     SLDFID GQDDDFIYD+YHSE+DSGNYL+ 
Sbjct  1442  QREQEEHNQPKNKKYLKQAK---ISKIQPPSLDFIDVGQDDDFIYDNYHSEDDSGNYLEG  1498

Query  1520  SSSGSVGPSEGRNLKMDTNGEVALTSTSIQIKSDSLAPIKNHIQKHDSLICQPTAKKTSF  1579
             SSSGSVGP EG  +K+D+N E +  S  +  KSDS  P  + +QKHD++I + T K T  
Sbjct  1499  SSSGSVGPIEGSIIKVDSNIEASFAS--LNKKSDSFTPTNDSLQKHDTVIGESTTKLTRL  1556

Query  1580  NEEKTCPDLDEREEDIHDQLSDLTDLNNLLPQKKKTLLRGETEEVVGGNMQMIRQPEITA  1639
               EK CPD+DE +E++ D +SDLTDL+ L+ QKKKTLLRGETEEVVGG+MQ++RQ EITA
Sbjct  1557  RTEKMCPDVDEEDENLSDHVSDLTDLSKLISQKKKTLLRGETEEVVGGHMQVLRQTEITA  1616

Query  1640  GQRWHWAYNKIIMQLNNGGGNGEVGIRNNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL  1699
              QRWHWAYNKIIMQLNNGGG GEVG+R NGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL
Sbjct  1617  RQRWHWAYNKIIMQLNNGGGPGEVGLRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL  1676

Query  1700  VLKTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPHNFLLWTATSP  1759
                TMAATKRNAGLTSAVPRATLNDE+LKMHVYKKALQALIYPISSTTPHNFLLWTATSP
Sbjct  1677  ---TMAATKRNAGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSP  1733

Query  1760  TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII  1819
             TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII
Sbjct  1734  TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII  1793

Query  1820  TAMKERMKQREREKPEIFELIRAVFSVEEKSHTGHMKAMKQSVLDGTSKWSAKIAITVIC  1879
             TAMK+RMKQREREKPEIFELIRAVFSVEEKSH GHMKA+KQSVLDGTSKWSAKIAITVIC
Sbjct  1794  TAMKDRMKQREREKPEIFELIRAVFSVEEKSHAGHMKAVKQSVLDGTSKWSAKIAITVIC  1853

Query  1880  AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD  1939
             AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD
Sbjct  1854  AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD  1913

Query  1940  EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV  1999
             EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV
Sbjct  1914  EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV  1973

Query  2000  EIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPTQKGDDAWKLYFDEIPEEIVDEF  2059
             EIKGEEKVAPYHVQYTCLHENLFHYLCEEN+GMVKLPTQKGDDAWKLYFDEIPEEIVDEF
Sbjct  1974  EIKGEEKVAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWKLYFDEIPEEIVDEF  2033

Query  2060  SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA  2119
             SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA
Sbjct  2034  SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA  2093

Query  2120  SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE  2179
             SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE
Sbjct  2094  SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE  2153

Query  2180  LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNETKRAPDDHEPKLDSVD  2239
             LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNE KRAPDDHEPKLDSVD
Sbjct  2154  LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVD  2213

Query  2240  FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR  2299
             FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR
Sbjct  2214  FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR  2273

Query  2300  LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG  2359
             LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG
Sbjct  2274  LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG  2333

Query  2360  AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMKRFAKTIV  2419
             AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYM+RFAKTIV
Sbjct  2334  AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIV  2393

Query  2420  KVLIAYADIVKIEFPDHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE  2479
             KVLIAYADIVK+EFP+HMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE
Sbjct  2394  KVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE  2453

Query  2480  LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE  2539
             LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE
Sbjct  2454  LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE  2513

Query  2540  ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK  2599
             ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK
Sbjct  2514  ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK  2573

Query  2600  HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV  2659
             HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV
Sbjct  2574  HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV  2633

Query  2660  ALDTIKQYFHAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFISSQIHEVDAEN  2719
             ALDTIKQYFHAGGNGLKKTFLEKS ELQSLRYALSLYTQMTDTLIKTFISSQ+HEVD EN
Sbjct  2634  ALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLEN  2693

Query  2720  SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK  2779
             SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK
Sbjct  2694  SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK  2753

Query  2780  KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK  2839
             KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK
Sbjct  2754  KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK  2813

Query  2840  DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDDVAKEFVKLKSEIRQEPTMGT  2897
             DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNND+VAKEFVKLKSEIRQEPTMGT
Sbjct  2814  DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTMGT  2871


>Q8IM87_DROME unnamed protein product
Length=2871

 Score = 4001 bits (10377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2074/2938 (71%), Positives = 2320/2938 (79%), Gaps = 108/2938 (4%)

Query  1     MTHYARHEYFHNTQNDALASDTGISTYNHMNYGTQNIREYFIEPCNLSNQGPDDYSSEGQ  60
             MTHY RH+YFHNTQN AL+SDT   +Y+ ++Y TQ  REYF E   LSNQGP++ S    
Sbjct  1     MTHYVRHDYFHNTQNGALSSDTSRISYSQISYETQPSREYFSESYALSNQGPEECSRVSH  60

Query  61    YASDTIPTTVDKSNNSYINDYIEQFGAQEQHEAEEESFDNWNEN-STVTTPYEVEFVNQK  119
               SDT+ TTVD SNNSY  DY+E +GA  Q + EE+S DNWNEN S V   Y +   N  
Sbjct  61    LNSDTVLTTVDNSNNSYGYDYLECYGANIQCDPEEDSVDNWNENTSVVADQYGLGHNNLN  120

Query  120   RTSQKLLPKLPSNINGSASSKPCPPHMDINLKTEGMCIKREQRHGGCKAKAHECDRHFFP  179
              TS KLLPKLP+  NG  SS  C P MD+   T+GMCIK +  +G C AKAH+      P
Sbjct  121   CTSSKLLPKLPNIENGRGSSNACAPQMDVKFNTKGMCIKIDHSYGVCMAKAHDFVGRLSP  180

Query  180   GDDQNIYADNINGYTGFAFSSAFHNNVVSAAPLRTLAQTARSNFYLSQDFFELNADVDQA  239
              D QNI  +N+NGY G A+SS F +N +S+APLR L Q+ R + YL ++    NAD   A
Sbjct  181   SDYQNILGNNLNGYAGCAYSSTFLDNAMSSAPLRVLPQSPRCSSYLGRNIIGFNAD---A  237

Query  240   GELSQCDFAMGQTAAMDSGSGTYDVFENMSRPYTSMLPLGYSDFEECYYNIDNLSTYSDT  299
              +     F   QT AM S S TY+V+E M RPYTSMLPL YSD++E  YN DNLSTYSDT
Sbjct  238   AQRDGRGFDTDQTDAMGSESSTYEVYEKMQRPYTSMLPLDYSDYQEGCYNTDNLSTYSDT  297

Query  300   PQINNAQLNLQKQRKFSLMMAMTTASVIASGETRVPVLSKHSKKPTETRTDSLLGSSIIT  359
             P  NN QL  Q QRK SLMMAMTTASVIASGE RVPV SK SKK TE +TDS++G++I T
Sbjct  298   PPSNNTQLKRQMQRKISLMMAMTTASVIASGEIRVPVHSKQSKKSTEIQTDSIIGNTIST  357

Query  360   NAATRASERMLEPKCCGGIVTPGDTGAVASTPSVNTATISKTRKLPKVLPTPQNKLSLHT  419
             NAA R  +R L  + C  IV   D+G+V S PS     I+KTRKLPKVLPTP  K S H 
Sbjct  358   NAAARDLDRCLATESCEVIVDTRDSGSVTSFPSSAVTAITKTRKLPKVLPTPLCKSSRHP  417

Query  420   KTTGTEALN---FSNPIAEKIHRSKQLPKLPTSLSQTKPYSVPNSNFSTYCALEALSFNL  476
              T  T+AL+    S+P+ EK HR KQLPKLP SL Q+   +  NSN++T  A +AL FN 
Sbjct  418   ITIATDALSSSYTSDPLPEKSHRPKQLPKLPISLPQSNDRASLNSNWATPPAPDALPFNS  477

Query  477   LDNKSASPSPTEITVTTT-----SFPTVTSYEDSPKPFAYSYESKDPIEVFLSKSIEADP  531
              D+KSAS SPT  T  T      S+   T +  +     Y Y+SK+P  VF  KS+EA+ 
Sbjct  478   FDHKSAS-SPTPTTTITKDTETTSYLVETDFIGARHNALYQYDSKEPNIVFSDKSVEAEH  536

Query  532   APSF-------SIEKQCVSVELSNNIIQENSPPCHIPEISTANPDIKPDHCDSFIDSIFQ  584
             +P++       S +  C  V L +NI+Q  S  CH+PEI     DI+ +   S I+ I +
Sbjct  537   SPTWTPLSPIQSKQSPCPPVALPSNIMQNVSLTCHLPEIEATRSDIEREPESSSIEPILE  596

Query  585   NEKSPDSYINPESALFNISEYLKPYTLEKITFTGEKPNQITDAASISTTAHPSNGKLSGE  644
              EK  D Y  P SALFNISEYLKPYTL K   + EK N I +AAS STT  P N      
Sbjct  597   IEKLADPYSGPGSALFNISEYLKPYTLNKPILSEEKKNHIANAASTSTTT-PLN------  649

Query  645   INVLKSTLSSGDALVPYSNTCPTSCVNYKPLEVESGSNILMQTNLNTNPAEFIILPSSSC  704
                    ++S D    YSN   ++CVN++PL+VES  NI ++ N  TN AE ++ P  S 
Sbjct  650   -------ITSDDEFSSYSNKWTSTCVNFQPLDVESSLNISLKVNAGTNQAELLMTPLKSS  702

Query  705   IPALSLSSNLISDHLTDADIFPVIGFPPDKDVTVKDSFQNNAFTTTVYINNNEVVPVTKS  764
              P L +SSN  SD+            PPD           +AFTTTV +N+ E V V+ S
Sbjct  703   TP-LFISSNGTSDNFNLRK-----SSPPD-----------SAFTTTVNVNSFETVLVSGS  745

Query  765   QNATPT--------SEAPIISYSDYMKKFELPDLPQPIMILSEKLPVTQSVSGAVTADS-  815
             Q A+P+        S AP++SYSDYMK+FELP+LPQPIM LSE    TQS S  V  ++ 
Sbjct  746   QTASPSPSNLKSPPSIAPLLSYSDYMKQFELPELPQPIMDLSENDTATQSDSFNVINNTL  805

Query  816   ------EAEKELDVENRCSELLPSYFTKLFSEYNAPISSSEIRASPINDEIDN-SFYMKT  868
                    +  ++DVE++ S  LPSY ++ F   + P  S + +   I +++D+ S     
Sbjct  806   TNADNLNSYNQMDVESKSSLQLPSYSSESFDPCSVPSFSIKNKEYKIVEKLDSLSNVESV  865

Query  869   ESSIPITTTVCSAGPPSYFPENEAKEKNHLTFDDTFYDSFNVDIIELTASVAQVESENDL  928
             ES   + + V         P  E+   N + FDDTFYDSFNVDI ELTA V  V  E+ L
Sbjct  866   ESPKTLVSPVNPLNCSKLLPGTESIVSNDVAFDDTFYDSFNVDIKELTAFVDHVAPEDGL  925

Query  929   NNAPIESLNNSINIENETSFEFSIEKTLDTRDMNQNVSLGQGGYYRPSQAQQKPNVVASA  988
              N P           ++TS EFS +KT DT DMNQN+S G+ GYY+PSQAQQK +VVASA
Sbjct  926   YNFP----------NDKTSVEFSFDKTEDTIDMNQNLSSGECGYYKPSQAQQKASVVASA  975

Query  989   ATSVLDGISKGLKGGLDGVFSNVSSSVEATQTVNATRKAFSFNLASKLVPSVGGLLSSSN  1048
             A+SVLDGISKGLKGGLDGVFS VSS+V+ TQ+  ++++ FSFNLASK+VPSVGGLL+S++
Sbjct  976   ASSVLDGISKGLKGGLDGVFSGVSSTVDVTQSNPSSKRGFSFNLASKIVPSVGGLLTSTS  1035

Query  1049  SSSTKQTQAPKSVTSPTLI-TSVENDSTDSCTYETTISPPL-YKTAENHFYPATLPN-TL  1105
             S+S KQT    S T+PTLI  S EN S+ +  Y  T SP    K  E + Y AT+ N + 
Sbjct  1036  STSIKQT---GSETNPTLILISPENVSSRNSNYIPTTSPSCTQKNGEENLYSATVHNKST  1092

Query  1106  KGETHLNNVEMVETSSTLLENVCDNYYENYDETLLTDKMMNACMLDRRSEYGLIENSYSY  1165
             K  ++ N  E+ E SSTL+ NVCD+Y  +YDE +LT++M+N  MLD  SE+GLIENSYSY
Sbjct  1093  KSNSYYN--EVGEISSTLVRNVCDSYDNSYDEMILTNEMVNIGMLDSESEFGLIENSYSY  1150

Query  1166  HVSDEGQLATFNTQSTLLKDVPNESELGIENLKIKNNPTYWHEPMTKKGSTSSSGMLGSI  1225
              V D  Q+ + N+ +   ++V N    GIE    KN P   H+P TKK ST   GM GSI
Sbjct  1151  QVPDNEQIDSVNSYNNKTQNVTNN---GIEKANTKNKPVPLHDPPTKKASTV--GMFGSI  1205

Query  1226  LGKAAAAVQSATHAVNQGASTVVSVVGQKQTLLPATISIHDMDGISSTTTTIKRESNVD-  1284
             LGKAAAAVQSAT AVNQ AS+V SVV QK T++P T ++  +  + S     +  S+V+ 
Sbjct  1206  LGKAAAAVQSATQAVNQSASSVASVVAQKPTIVPRTNNVLLLSSVCSPNEIKRNSSSVEF  1265

Query  1285  ----SYQLTNEESLSSPYKNTIDEFENTNIKMQEYSTYIEKETFVNYQSNGNQHQFRNDS  1340
                  YQ+ + ESLSS Y NT  +++N+N+K+ E+ TY +   + +Y +NGNQ QF+ ++
Sbjct  1266  DSEYGYQMPDVESLSSHYANTGGDYDNSNMKIHEFGTYADDRPYADYHTNGNQSQFKEEA  1325

Query  1341  VLSEQSQVISNVSKALPTVPPSGSTGKKLPTVNGKSGLLIKQMPTEIYDDESDLDDLDVN  1400
             V+  + +VI+  +  LP  P   +TGKKLPTVNGKS LLIKQMPTE+YDDESD D+LDV+
Sbjct  1326  VIPGEPEVIN--TNILPIGP--QATGKKLPTVNGKSALLIKQMPTEVYDDESDTDELDVS  1381

Query  1401  PSIGKEPSYRIDGEQDDYYMDLQQTTPSNQINGYYEHVNNGYDYREDYFNEEDEYKYLEQ  1460
             PS GK PSY I  EQ+DYYMDLQQTTPS Q NG+YE VNNGYDYREDYFNEEDEYKYLEQ
Sbjct  1382  PSTGKVPSYSIYSEQEDYYMDLQQTTPSIQPNGFYEQVNNGYDYREDYFNEEDEYKYLEQ  1441

Query  1461  QREQEQH-EPKIKKYVKQTNSMLLTCQAQSSLDFIDEGQDDDFIYDSYHSEEDSGNYLDE  1519
             QREQE+H +PK KKY+KQ     ++     SLDFID GQDDDFIYD+YHSE+DSGNYL+ 
Sbjct  1442  QREQEEHNQPKNKKYLKQAK---ISKIQPPSLDFIDVGQDDDFIYDNYHSEDDSGNYLEG  1498

Query  1520  SSSGSVGPSEGRNLKMDTNGEVALTSTSIQIKSDSLAPIKNHIQKHDSLICQPTAKKTSF  1579
             SSSGSVGP EG  +K+D+N E +  S  +  KSDS  P  + +QKHD++I + T K T  
Sbjct  1499  SSSGSVGPIEGSIIKVDSNIEASFAS--LNKKSDSFTPTNDSLQKHDTVIGESTTKLTRL  1556

Query  1580  NEEKTCPDLDEREEDIHDQLSDLTDLNNLLPQKKKTLLRGETEEVVGGNMQMIRQPEITA  1639
               EK CPD+DE +E++ D +SDLTDL+ L+ QKKKTLLRGETEEVVGG+MQ++RQ EITA
Sbjct  1557  RTEKMCPDVDEEDENLSDHVSDLTDLSKLISQKKKTLLRGETEEVVGGHMQVLRQTEITA  1616

Query  1640  GQRWHWAYNKIIMQLNNGGGNGEVGIRNNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL  1699
              QRWHWAYNKIIMQLNNGGG GEVG+R NGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL
Sbjct  1617  RQRWHWAYNKIIMQLNNGGGPGEVGLRTNGHPGDNPFYSNIDSMPDIRPRRKSIPLVSEL  1676

Query  1700  VLKTMAATKRNAGLTSAVPRATLNDEELKMHVYKKALQALIYPISSTTPHNFLLWTATSP  1759
                TMAATKRNAGLTSAVPRATLNDE+LKMHVYKKALQALIYPISSTTPHNFLLWTATSP
Sbjct  1677  ---TMAATKRNAGLTSAVPRATLNDEDLKMHVYKKALQALIYPISSTTPHNFLLWTATSP  1733

Query  1760  TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII  1819
             TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII
Sbjct  1734  TYCYECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKSSKHGAEDKANSII  1793

Query  1820  TAMKERMKQREREKPEIFELIRAVFSVEEKSHTGHMKAMKQSVLDGTSKWSAKIAITVIC  1879
             TAMK+RMKQREREKPEIFELIR  F V+  +H   ++  + + ++GTSKWS K+ ITVIC
Sbjct  1794  TAMKDRMKQREREKPEIFELIRMTFGVDPDTHIDSLEQAEHATVEGTSKWSCKLTITVIC  1853

Query  1880  AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD  1939
             AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD
Sbjct  1854  AQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVRVWD  1913

Query  1940  EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV  1999
             EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV
Sbjct  1914  EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHISV  1973

Query  2000  EIKGEEKVAPYHVQYTCLHENLFHYLCEENSGMVKLPTQKGDDAWKLYFDEIPEEIVDEF  2059
             EIKGEEKVAPYHVQYTCLHENLFHYLCEEN+GMVKLPTQKGDDAWKLYFDEIPEEIVDEF
Sbjct  1974  EIKGEEKVAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWKLYFDEIPEEIVDEF  2033

Query  2060  SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA  2119
             SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA
Sbjct  2034  SMRYGIENIYQAMTHFHCLSAKYLCPGVPAVMSTLLANINAYYAHTTASSAVSASDRFAA  2093

Query  2120  SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE  2179
             SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE
Sbjct  2094  SNFGKEKFVKLLDQLHNSLRIDLSMYRNNFPASSPEKLMDLKSTVDLLTSITFFRMKVQE  2153

Query  2180  LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNETKRAPDDHEPKLDSVD  2239
             LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNE KRAPDDHEPKLDSVD
Sbjct  2154  LSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPDDHEPKLDSVD  2213

Query  2240  FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR  2299
             FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR
Sbjct  2214  FWHKLIALIVSVIDEDKNSYGTVLNQFPQELNIGQLSASSMWHLFAVDMKYALEEHEQHR  2273

Query  2300  LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG  2359
             LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG
Sbjct  2274  LCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVPDYPAWFEPFVMQWLNENDDVSLEYLHG  2333

Query  2360  AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMKRFAKTIV  2419
             AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYM+RFAKTIV
Sbjct  2334  AFKRDKKDGFQKSSEHALFSNSVVDVFTQLTQCFDVVSKLECPDPEIWKRYMRRFAKTIV  2393

Query  2420  KVLIAYADIVKIEFPDHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE  2479
             KVLIAYADIVK+EFP+HMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE
Sbjct  2394  KVLIAYADIVKLEFPEHMKDERIACILMNNIQQLRVQLEKMFESMGGDKLEEDAANILKE  2453

Query  2480  LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE  2539
             LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE
Sbjct  2454  LQQNLNSALDDLASQFAISLEPRITQSVRELGDMLLSIKGGSGTLAAGNLAAQRNAVAVE  2513

Query  2540  ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK  2599
             ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK
Sbjct  2514  ADEVLRPLMDLLDGSLTLYAQSCEKTVLKRLLKELWKIVMRILEKTIVLPPMTDKTMMFK  2573

Query  2600  HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV  2659
             HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV
Sbjct  2574  HLTDNAKNLASNAKIEDMGRLFKSHMAGKQDVKSALSGVMDISKEVEKNLSPKQCAVLDV  2633

Query  2660  ALDTIKQYFHAGGNGLKKTFLEKSSELQSLRYALSLYTQMTDTLIKTFISSQIHEVDAEN  2719
             ALDTIKQYFHAGGNGLKKTFLEKS ELQSLRYALSLYTQMTDTLIKTFISSQ+HEVD EN
Sbjct  2634  ALDTIKQYFHAGGNGLKKTFLEKSPELQSLRYALSLYTQMTDTLIKTFISSQVHEVDLEN  2693

Query  2720  SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK  2779
             SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK
Sbjct  2694  SEESVGEISVQIDLFSHPGTGEHKVNVKVVAANDLKWQIPSGMFRPFVDINLIGPHLQEK  2753

Query  2780  KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK  2839
             KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK
Sbjct  2754  KRKFATKSKSNNWSPKYNESFSFTIGNEEQLDFFELHICVKDYCFARDDRLVGVAVIPLK  2813

Query  2840  DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDDVAKEFVKLKSEIRQEPTMGT  2897
             DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNND+VAKEFVKLKSEIRQEPTMGT
Sbjct  2814  DISEKGSVACWLPLMRRIEMDETGWTILRILSQRNNDEVAKEFVKLKSEIRQEPTMGT  2871



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 39348673730


Query= XP_017062579.1 GIGYF family protein Gyf isoform X1 [Drosophila
eugracilis]

Length=1599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GGYF1_DROME  unnamed protein product                                  2069    0.0  
Q0E8J3_DROME  unnamed protein product                                 40.0    0.023
M9PBJ1_DROME  unnamed protein product                                 39.7    0.029


>GGYF1_DROME unnamed protein product
Length=1574

 Score = 2069 bits (5361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1126/1597 (71%), Positives = 1292/1597 (81%), Gaps = 43/1597 (3%)

Query  23    MTDSMKFGPEWLRNMSAEPSGSPSIYNVGSGGLNASVAPHNLGNNTTPPTSRNLFPEYRY  82
             MTDSMKFGPEWLRNMSAEPSGSPS YNVG+   N S+  HNLGNNT    SRNLFPEYRY
Sbjct  1     MTDSMKFGPEWLRNMSAEPSGSPSTYNVGNAAQNNSIGGHNLGNNTAASASRNLFPEYRY  60

Query  83    GREEMLSLFDRNCMLPQILPSFKKLFVEKVQYPLALTPSSEEDNNQNPPGNSSRPAWLQR  142
             GREEMLSLFDRNC+LPQILPSFKKLFVEKVQ PLALTPSSEED NQN  GN+SRPAWLQR
Sbjct  61    GREEMLSLFDRNCLLPQILPSFKKLFVEKVQCPLALTPSSEEDINQNSLGNNSRPAWLQR  120

Query  143   SSGGFSNSCRGTGRGGTSDRGRMRGKSLYHPIYQRPSSLYDEGLSVISSKADRAWSDRNG  202
             S  GF ++ RG+GRGGT DRGRMRGKS YHPIYQRPS LYDE LSVIS KA+R WSDRNG
Sbjct  121   SPSGFGSASRGSGRGGTVDRGRMRGKSAYHPIYQRPSGLYDESLSVIS-KAERTWSDRNG  179

Query  203   TGDSAVANTSTSGTGGLDWNATPSSSPRKDFSGHHRNMENWRRGRNDDGSGDGLIASGSI  262
             TGDSA   TSTSG+G LDWN TPSSSPRKD+S +HRN+ENWRR RN+DGSGDG  +SGS+
Sbjct  180   TGDSAATTTSTSGSGALDWNGTPSSSPRKDYSNNHRNLENWRRTRNEDGSGDGPSSSGSM  239

Query  263   SGNETAGWRSGGVGGSTS--FGTNSHRWGRSTSWRDDDANIDNPNSLQRSVSTVVTLGAD  320
             SG + AGWRSG VGGST+  FGTNSHRWGRSTSWRD+D ++DN  SLQRS+STV TL  D
Sbjct  240   SGPDIAGWRSGVVGGSTNAGFGTNSHRWGRSTSWRDEDPSVDNAASLQRSISTVATLSTD  299

Query  321   RERTGNSKGSGTGAGEAVGSTSNSSVRLASLKAPQLWTINNAGGPDVDDNLPEWAMETPS  380
             R  TGN+KGSG GA E VGS S+   RL+S K  QLWT+NNA G D D+NLPEWA+E PS
Sbjct  300   R--TGNNKGSGIGAAEGVGSISHP--RLSSSKISQLWTVNNAAGVDADENLPEWAIENPS  355

Query  381   ELGGSFDASGAFHGESDLPNNKSSHNTMNSKNIITDPDVVKPETEHLVDEDSSNDNTSKV  440
             +LGGSFDASGAFHG++DL   KSSHNT+ +K++ +  DV +P+++ L D DS ND T + 
Sbjct  356   KLGGSFDASGAFHGDTDLKPIKSSHNTLKTKSLDSYDDVKRPKSKDLSDPDSGNDITPET  415

Query  441   ALPKDLN----HEVKDSNISVINSTSKIEIIQGDISDRIKEVANEVEKLIMEDDNS-SAD  495
             +L KD N     E  +S++S I+ST+  E+I GDISDRIKEVA+EVEKLIM+DD+  S++
Sbjct  416   SLTKDTNTTAVQEEVESSLSPISSTTTKEVIHGDISDRIKEVADEVEKLIMDDDHKISSN  475

Query  496   QSQLKSESSRFACVLPSLADIELSMNPNSGSGTTLRSQARLTMPIPIATTLADSAHPSRQ  555
             QSQ ++    F   LP +ADIE+++ P   S T +  QA  TMPI I  T+ D A PS  
Sbjct  476   QSQHQNHDG-FTAALPRMADIEINVKP---SVTAVHRQAPSTMPIQITPTITDVAPPS--  529

Query  556   HQVVPFSEHITMQHHALHHQPHFSMLPAPQMINPSLNELWFYRDPQANVQGPFSAMEMSE  615
             H VV FS+H TMQHH +HH P F M+P P +I P+LNELWFYRDPQANVQGPFSA+EM+E
Sbjct  530   HAVVSFSDHETMQHHNMHHLPQFPMIPTPHIITPNLNELWFYRDPQANVQGPFSAVEMTE  589

Query  616   WYRAGYFNENLFVRRFPDTRFRPLGELIKFCHGNMPFTHSHLLPSPMDLENLPVGQIPTA  675
             WYRAGYFNENLFVRR+ D RFRPLGELIKFCHGNMPFTHSHLLPSP++LEN+PVGQIP  
Sbjct  590   WYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLPSPIELENIPVGQIPAP  649

Query  676   LPTVLPVTPHKPTPLAISLSVVEQHLQEQRDEQLKANVTAAAESLSAAIKGNSGGNNIST  735
             L   L +TPHKP+P+ I+LSVVEQ LQ+QRDEQLKANVTA AE+L AAIKG+ GGN+I  
Sbjct  650   LTASLSITPHKPSPIPIALSVVEQQLQQQRDEQLKANVTATAEALRAAIKGSFGGNSIGN  709

Query  736   TSNMLTIRFQMLQDQYLQHQEYQILAELSKNEGFRRLSAIEREAIVRQKVQQLVLPEYLS  795
             TS++LT+RFQMLQDQY+QHQEYQILAELSKNE F+RLSA+E+E +VR+KVQ L LPEYL 
Sbjct  710   TSHLLTMRFQMLQDQYIQHQEYQILAELSKNECFQRLSAVEQETVVRRKVQLLGLPEYLI  769

Query  796   SLNALSNSLSVLNPVAGRQLYSAVAEHAKKDQQNMFSNSTEQQRSVGNLLDANNFILNAQ  855
             SLN LSNSLSVLNPVAGRQLY AV EHAKKDQQ++F+N TEQQRSVGNLLDANNFILNAQ
Sbjct  770   SLNGLSNSLSVLNPVAGRQLYRAVVEHAKKDQQHIFAN-TEQQRSVGNLLDANNFILNAQ  828

Query  856   IMNQQAQPVVPPLATSVDCVMQSGSAADINKV-ELPRNDINLINEYNLRMLLRGQPTCTQ  914
             IM QQ+Q  V PL +SVDC+MQ G+AAD+NK  E+PRN+++LINEYNLRMLLRGQPT TQ
Sbjct  829   IMIQQSQQEVGPLVSSVDCIMQGGTAADLNKPNEIPRNELDLINEYNLRMLLRGQPTSTQ  888

Query  915   QLQSPHPNSVNENLSGEDLITETKLLEGQNLMIPMWLP--SNKQ----QQWLGMTSAKVS  968
             Q      NS  ENL G D +TET+LLE QNLMIP+WLP  +NKQ    QQW  M++A  S
Sbjct  889   QQPPALTNSATENLPGVDFLTETQLLERQNLMIPIWLPPNNNKQQETDQQWAEMSNADAS  948

Query  969   LWEVGNLNEEKIEEQGLLIQKNPETCFADAVHPVQSPPLSPVGSGDNLNNGPSIELDQEQ  1028
             LWE  NLNEE+ E+Q LLIQK+ E CFAD    V+   L  V SG+ +N+    ELDQ  
Sbjct  949   LWETANLNEERNEDQQLLIQKSSEACFADTEKDVKIAQLFQVQSGNVVNHTALEELDQS-  1007

Query  1029  VSDHPKDSHNQKVVKSFVSDVEQYHDEEQHPQLQQLKQTNK----LKQNVAQSIIKH-NN  1083
                + K SHNQK+VKS VSD++Q H+EE +    Q+KQ NK     KQN AQS +K  NN
Sbjct  1008  -PQNLKGSHNQKIVKSLVSDIQQNHNEELNSHQHQVKQANKQNLNTKQNAAQSALKPINN  1066

Query  1084  EDDRKREQTEEKKRQREERKRQQLDEEKRRAVLESEERARQLLEEKERQQQIQAQRRKAL  1143
             E+DRKREQTEEKKRQREERKRQQL+++KRRA+ ESEE+ RQ+ EEKERQQQIQAQRRKAL
Sbjct  1067  ENDRKREQTEEKKRQREERKRQQLEDDKRRALNESEEQTRQIQEEKERQQQIQAQRRKAL  1126

Query  1144  LGNAQSQSVQSGITGTSGSTENNKNDAVKTSEAQASIRLPGTSVAPWSVQSPKTNSTAPG  1203
             LGN  S SVQ+G++GT  S ++ KND  KT+E Q S RLP TSVAPWS Q   +  +APG
Sbjct  1127  LGNVHSLSVQNGMSGTLASAQSKKNDDAKTAEPQVSSRLPSTSVAPWSFQLQNSMRSAPG  1186

Query  1204  LAEIQKAERRERRADQQRHQELLDKQVRANAAAAAEANDALLKWQAAPPLAPVMSLADIQ  1263
             LAEIQKAERRERRADQQRHQELLDKQ+RANAAAAAEANDALLKWQ+ P  APVMSLA+IQ
Sbjct  1187  LAEIQKAERRERRADQQRHQELLDKQLRANAAAAAEANDALLKWQSTPASAPVMSLAEIQ  1246

Query  1264  AEEAKRLATDLVDQQRRRELEQHQHSSLPSAVVAGSGTSNIWGSSNRAWSGSAAPPSMPF  1323
             AEEA+RLA DLVD+QRRRELE HQ + L SAV+  S TSNIWG++N+AWS SAA  S+  
Sbjct  1247  AEEARRLANDLVDRQRRRELEHHQQAPLSSAVLVTSATSNIWGNANKAWSSSAA-QSLSL  1305

Query  1324  RSSTGTGLWDEPKGPGTNQTTYGSGSSNSSTVTAAAVLAGGLNSANKTTLQTQNKLPAPF  1383
             ++S+GTGLWDEP   G+N    GSG+S +S+VTAAAVLAGGLNSANK+TLQ QNK  A F
Sbjct  1306  KTSSGTGLWDEPNPLGSN----GSGTSGTSSVTAAAVLAGGLNSANKSTLQAQNKSSALF  1361

Query  1384  VSPRNLRKSQTLPAIHNPGKAIKNGSGQQQDKPKCSHARV-GLKVGNSIEDKDRERKSNV  1442
              SPRNLRKSQTLPA+ NP K+ KNG GQ+ +K K +  R  G  V  SIE+KDRERK N 
Sbjct  1362  ASPRNLRKSQTLPALSNPEKSNKNGPGQRPEKQKLAQTRSKGAAV--SIEEKDRERKLNA  1419

Query  1443  KSQVQPGAMDQAFSKVNEYENEFTSWCIKSLDNMSAKVDVPTFVAFLQDLEAPYEVKDYV  1502
             KS  Q  + DQA SKVNEYENEFTSWCIKSLDNMSAKVDVPTFVAFLQDLEAPYEVKDYV
Sbjct  1420  KS--QQSSTDQAISKVNEYENEFTSWCIKSLDNMSAKVDVPTFVAFLQDLEAPYEVKDYV  1477

Query  1503  RIYLGEGKESLDFAKQFLERRSKYKSLQRAQNAHNDDMCKPAPAITPSANDYTDHKNKQK  1562
             RIYLG+GK+SLDFAKQFLERRSKYKSLQRAQ AHNDDMCKPAPAITPSANDY D KNKQK
Sbjct  1478  RIYLGDGKDSLDFAKQFLERRSKYKSLQRAQKAHNDDMCKPAPAITPSANDYADSKNKQK  1537

Query  1563  KVKKNKMTKMDARILGFSVTAAEGRINVGVRDYVEGP  1599
             K+KKNKMTKMDARILGFSVTAAEGRINVG+RDYVEGP
Sbjct  1538  KIKKNKMTKMDARILGFSVTAAEGRINVGIRDYVEGP  1574


>Q0E8J3_DROME unnamed protein product
Length=3640

 Score = 40.0 bits (92),  Expect = 0.023, Method: Compositional matrix adjust.
 Identities = 55/214 (26%), Positives = 94/214 (44%), Gaps = 32/214 (15%)

Query  1073  NVAQSIIKHNNEDDRKREQTEEKKRQREERKRQQLDE-EKRRAVLESEERARQLLEEKER  1131
             N+ QS IK   + +  +E+ ++++RQ+E+R+R   D+ E+ +A+ E+E + R     +E 
Sbjct  1154  NIFQSFIKLKMDINVVQERLKQEQRQKEQRERDARDQAEREKAIKEAEAKERL---HREE  1210

Query  1132  QQQIQAQRRKALLGNAQSQSVQSGITGTSGSTENNKNDAVKTSEAQASIRLPGTSVAPWS  1191
             Q +++ QR++A +  AQ +     +          +  AV+  EA+              
Sbjct  1211  QSRLENQRQQAAIEQAQRELAARELAL--------REQAVREEEAR--------------  1248

Query  1192  VQSPKTNSTAPGLAEIQKAERRERRADQQRHQELLDKQVRANAAAAAEANDALLKWQAAP  1251
             +Q+ +  +T   LA  Q A   E R    R     +++VR       E      + +   
Sbjct  1249  LQAIREQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIR  1308

Query  1252  PLAPVMSL----ADIQAEEAKRLAT--DLVDQQR  1279
                   S     A IQ EE  RL T  D VDQQR
Sbjct  1309  RENESRSKREEEARIQREEITRLQTLRDQVDQQR  1342


>M9PBJ1_DROME unnamed protein product
Length=3664

 Score = 39.7 bits (91),  Expect = 0.029, Method: Compositional matrix adjust.
 Identities = 55/214 (26%), Positives = 94/214 (44%), Gaps = 32/214 (15%)

Query  1073  NVAQSIIKHNNEDDRKREQTEEKKRQREERKRQQLDE-EKRRAVLESEERARQLLEEKER  1131
             N+ QS IK   + +  +E+ ++++RQ+E+R+R   D+ E+ +A+ E+E + R     +E 
Sbjct  1178  NIFQSFIKLKMDINVVQERLKQEQRQKEQRERDARDQAEREKAIKEAEAKERL---HREE  1234

Query  1132  QQQIQAQRRKALLGNAQSQSVQSGITGTSGSTENNKNDAVKTSEAQASIRLPGTSVAPWS  1191
             Q +++ QR++A +  AQ +     +          +  AV+  EA+              
Sbjct  1235  QSRLENQRQQAAIEQAQRELAARELAL--------REQAVREEEAR--------------  1272

Query  1192  VQSPKTNSTAPGLAEIQKAERRERRADQQRHQELLDKQVRANAAAAAEANDALLKWQAAP  1251
             +Q+ +  +T   LA  Q A   E R    R     +++VR       E      + +   
Sbjct  1273  LQAIREQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIR  1332

Query  1252  PLAPVMSL----ADIQAEEAKRLAT--DLVDQQR  1279
                   S     A IQ EE  RL T  D VDQQR
Sbjct  1333  RENESRSKREEEARIQREEITRLQTLRDQVDQQR  1366



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 39348673730


Query= XP_017062580.1 GIGYF family protein Gyf isoform X2 [Drosophila
eugracilis]

Length=1577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GGYF1_DROME  unnamed protein product                                  2070    0.0  
Q0E8J3_DROME  unnamed protein product                                 39.7    0.027
M9PBJ1_DROME  unnamed protein product                                 39.7    0.028


>GGYF1_DROME unnamed protein product
Length=1574

 Score = 2070 bits (5363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1126/1597 (71%), Positives = 1292/1597 (81%), Gaps = 43/1597 (3%)

Query  1     MTDSMKFGPEWLRNMSAEPSGSPSIYNVGSGGLNASVAPHNLGNNTTPPTSRNLFPEYRY  60
             MTDSMKFGPEWLRNMSAEPSGSPS YNVG+   N S+  HNLGNNT    SRNLFPEYRY
Sbjct  1     MTDSMKFGPEWLRNMSAEPSGSPSTYNVGNAAQNNSIGGHNLGNNTAASASRNLFPEYRY  60

Query  61    GREEMLSLFDRNCMLPQILPSFKKLFVEKVQYPLALTPSSEEDNNQNPPGNSSRPAWLQR  120
             GREEMLSLFDRNC+LPQILPSFKKLFVEKVQ PLALTPSSEED NQN  GN+SRPAWLQR
Sbjct  61    GREEMLSLFDRNCLLPQILPSFKKLFVEKVQCPLALTPSSEEDINQNSLGNNSRPAWLQR  120

Query  121   SSGGFSNSCRGTGRGGTSDRGRMRGKSLYHPIYQRPSSLYDEGLSVISSKADRAWSDRNG  180
             S  GF ++ RG+GRGGT DRGRMRGKS YHPIYQRPS LYDE LSVIS KA+R WSDRNG
Sbjct  121   SPSGFGSASRGSGRGGTVDRGRMRGKSAYHPIYQRPSGLYDESLSVIS-KAERTWSDRNG  179

Query  181   TGDSAVANTSTSGTGGLDWNATPSSSPRKDFSGHHRNMENWRRGRNDDGSGDGLIASGSI  240
             TGDSA   TSTSG+G LDWN TPSSSPRKD+S +HRN+ENWRR RN+DGSGDG  +SGS+
Sbjct  180   TGDSAATTTSTSGSGALDWNGTPSSSPRKDYSNNHRNLENWRRTRNEDGSGDGPSSSGSM  239

Query  241   SGNETAGWRSGGVGGSTS--FGTNSHRWGRSTSWRDDDANIDNPNSLQRSVSTVVTLGAD  298
             SG + AGWRSG VGGST+  FGTNSHRWGRSTSWRD+D ++DN  SLQRS+STV TL  D
Sbjct  240   SGPDIAGWRSGVVGGSTNAGFGTNSHRWGRSTSWRDEDPSVDNAASLQRSISTVATLSTD  299

Query  299   RERTGNSKGSGTGAGEAVGSTSNSSVRLASLKAPQLWTINNAGGPDVDDNLPEWAMETPS  358
             R  TGN+KGSG GA E VGS S+   RL+S K  QLWT+NNA G D D+NLPEWA+E PS
Sbjct  300   R--TGNNKGSGIGAAEGVGSISHP--RLSSSKISQLWTVNNAAGVDADENLPEWAIENPS  355

Query  359   ELGGSFDASGAFHGESDLPNNKSSHNTMNSKNIITDPDVVKPETEHLVDEDSSNDNTSKV  418
             +LGGSFDASGAFHG++DL   KSSHNT+ +K++ +  DV +P+++ L D DS ND T + 
Sbjct  356   KLGGSFDASGAFHGDTDLKPIKSSHNTLKTKSLDSYDDVKRPKSKDLSDPDSGNDITPET  415

Query  419   ALPKDLN----HEVKDSNISVINSTSKIEIIQGDISDRIKEVANEVEKLIMEDDNS-SAD  473
             +L KD N     E  +S++S I+ST+  E+I GDISDRIKEVA+EVEKLIM+DD+  S++
Sbjct  416   SLTKDTNTTAVQEEVESSLSPISSTTTKEVIHGDISDRIKEVADEVEKLIMDDDHKISSN  475

Query  474   QSQLKSESSRFACVLPSLADIELSMNPNSGSGTTLRSQARLTMPIPIATTLADSAHPSRQ  533
             QSQ ++    F   LP +ADIE+++ P   S T +  QA  TMPI I  T+ D A PS  
Sbjct  476   QSQHQNHDG-FTAALPRMADIEINVKP---SVTAVHRQAPSTMPIQITPTITDVAPPS--  529

Query  534   HQVVPFSEHITMQHHALHHQPHFSMLPAPQMINPSLNELWFYRDPQANVQGPFSAMEMSE  593
             H VV FS+H TMQHH +HH P F M+P P +I P+LNELWFYRDPQANVQGPFSA+EM+E
Sbjct  530   HAVVSFSDHETMQHHNMHHLPQFPMIPTPHIITPNLNELWFYRDPQANVQGPFSAVEMTE  589

Query  594   WYRAGYFNENLFVRRFPDTRFRPLGELIKFCHGNMPFTHSHLLPSPMDLENLPVGQIPTA  653
             WYRAGYFNENLFVRR+ D RFRPLGELIKFCHGNMPFTHSHLLPSP++LEN+PVGQIP  
Sbjct  590   WYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFTHSHLLPSPIELENIPVGQIPAP  649

Query  654   LPTVLPVTPHKPTPLAISLSVVEQHLQEQRDEQLKANVTAAAESLSAAIKGNSGGNNIST  713
             L   L +TPHKP+P+ I+LSVVEQ LQ+QRDEQLKANVTA AE+L AAIKG+ GGN+I  
Sbjct  650   LTASLSITPHKPSPIPIALSVVEQQLQQQRDEQLKANVTATAEALRAAIKGSFGGNSIGN  709

Query  714   TSNMLTIRFQMLQDQYLQHQEYQILAELSKNEGFRRLSAIEREAIVRQKVQQLVLPEYLS  773
             TS++LT+RFQMLQDQY+QHQEYQILAELSKNE F+RLSA+E+E +VR+KVQ L LPEYL 
Sbjct  710   TSHLLTMRFQMLQDQYIQHQEYQILAELSKNECFQRLSAVEQETVVRRKVQLLGLPEYLI  769

Query  774   SLNALSNSLSVLNPVAGRQLYSAVAEHAKKDQQNMFSNSTEQQRSVGNLLDANNFILNAQ  833
             SLN LSNSLSVLNPVAGRQLY AV EHAKKDQQ++F+N TEQQRSVGNLLDANNFILNAQ
Sbjct  770   SLNGLSNSLSVLNPVAGRQLYRAVVEHAKKDQQHIFAN-TEQQRSVGNLLDANNFILNAQ  828

Query  834   IMNQQAQPVVPPLATSVDCVMQSGSAADINKV-ELPRNDINLINEYNLRMLLRGQPTCTQ  892
             IM QQ+Q  V PL +SVDC+MQ G+AAD+NK  E+PRN+++LINEYNLRMLLRGQPT TQ
Sbjct  829   IMIQQSQQEVGPLVSSVDCIMQGGTAADLNKPNEIPRNELDLINEYNLRMLLRGQPTSTQ  888

Query  893   QLQSPHPNSVNENLSGEDLITETKLLEGQNLMIPMWLP--SNKQ----QQWLGMTSAKVS  946
             Q      NS  ENL G D +TET+LLE QNLMIP+WLP  +NKQ    QQW  M++A  S
Sbjct  889   QQPPALTNSATENLPGVDFLTETQLLERQNLMIPIWLPPNNNKQQETDQQWAEMSNADAS  948

Query  947   LWEVGNLNEEKIEEQGLLIQKNPETCFADAVHPVQSPPLSPVGSGDNLNNGPSIELDQEQ  1006
             LWE  NLNEE+ E+Q LLIQK+ E CFAD    V+   L  V SG+ +N+    ELDQ  
Sbjct  949   LWETANLNEERNEDQQLLIQKSSEACFADTEKDVKIAQLFQVQSGNVVNHTALEELDQS-  1007

Query  1007  VSDHPKDSHNQKVVKSFVSDVEQYHDEEQHPQLQQLKQTNK----LKQNVAQSIIK-HNN  1061
                + K SHNQK+VKS VSD++Q H+EE +    Q+KQ NK     KQN AQS +K  NN
Sbjct  1008  -PQNLKGSHNQKIVKSLVSDIQQNHNEELNSHQHQVKQANKQNLNTKQNAAQSALKPINN  1066

Query  1062  EDDRKREQTEEKKRQREERKRQQLDEEKRRAVLESEERARQLLEEKERQQQIQAQRRKAL  1121
             E+DRKREQTEEKKRQREERKRQQL+++KRRA+ ESEE+ RQ+ EEKERQQQIQAQRRKAL
Sbjct  1067  ENDRKREQTEEKKRQREERKRQQLEDDKRRALNESEEQTRQIQEEKERQQQIQAQRRKAL  1126

Query  1122  LGNAQSQSVQSGITGTSGSTENNKNDAVKTSEAQASIRLPGTSVAPWSVQSPKTNSTAPG  1181
             LGN  S SVQ+G++GT  S ++ KND  KT+E Q S RLP TSVAPWS Q   +  +APG
Sbjct  1127  LGNVHSLSVQNGMSGTLASAQSKKNDDAKTAEPQVSSRLPSTSVAPWSFQLQNSMRSAPG  1186

Query  1182  LAEIQKAERRERRADQQRHQELLDKQVRANAAAAAEANDALLKWQAAPPLAPVMSLADIQ  1241
             LAEIQKAERRERRADQQRHQELLDKQ+RANAAAAAEANDALLKWQ+ P  APVMSLA+IQ
Sbjct  1187  LAEIQKAERRERRADQQRHQELLDKQLRANAAAAAEANDALLKWQSTPASAPVMSLAEIQ  1246

Query  1242  AEEAKRLATDLVDQQRRRELEQHQHSSLPSAVVAGSGTSNIWGSSNRAWSGSAAPPSMPF  1301
             AEEA+RLA DLVD+QRRRELE HQ + L SAV+  S TSNIWG++N+AWS SAA  S+  
Sbjct  1247  AEEARRLANDLVDRQRRRELEHHQQAPLSSAVLVTSATSNIWGNANKAWSSSAA-QSLSL  1305

Query  1302  RSSTGTGLWDEPKGPGTNQTTYGSGSSNSSTVTAAAVLAGGLNSANKTTLQTQNKLPAPF  1361
             ++S+GTGLWDEP   G+N    GSG+S +S+VTAAAVLAGGLNSANK+TLQ QNK  A F
Sbjct  1306  KTSSGTGLWDEPNPLGSN----GSGTSGTSSVTAAAVLAGGLNSANKSTLQAQNKSSALF  1361

Query  1362  VSPRNLRKSQTLPAIHNPGKAIKNGSGQQQDKPKCSHARV-GLKVGNSIEDKDRERKSNV  1420
              SPRNLRKSQTLPA+ NP K+ KNG GQ+ +K K +  R  G  V  SIE+KDRERK N 
Sbjct  1362  ASPRNLRKSQTLPALSNPEKSNKNGPGQRPEKQKLAQTRSKGAAV--SIEEKDRERKLNA  1419

Query  1421  KSQVQPGAMDQAFSKVNEYENEFTSWCIKSLDNMSAKVDVPTFVAFLQDLEAPYEVKDYV  1480
             KS  Q  + DQA SKVNEYENEFTSWCIKSLDNMSAKVDVPTFVAFLQDLEAPYEVKDYV
Sbjct  1420  KS--QQSSTDQAISKVNEYENEFTSWCIKSLDNMSAKVDVPTFVAFLQDLEAPYEVKDYV  1477

Query  1481  RIYLGEGKESLDFAKQFLERRSKYKSLQRAQNAHNDDMCKPAPAITPSANDYTDHKNKQK  1540
             RIYLG+GK+SLDFAKQFLERRSKYKSLQRAQ AHNDDMCKPAPAITPSANDY D KNKQK
Sbjct  1478  RIYLGDGKDSLDFAKQFLERRSKYKSLQRAQKAHNDDMCKPAPAITPSANDYADSKNKQK  1537

Query  1541  KVKKNKMTKMDARILGFSVTAAEGRINVGVRDYVEGP  1577
             K+KKNKMTKMDARILGFSVTAAEGRINVG+RDYVEGP
Sbjct  1538  KIKKNKMTKMDARILGFSVTAAEGRINVGIRDYVEGP  1574


>Q0E8J3_DROME unnamed protein product
Length=3640

 Score = 39.7 bits (91),  Expect = 0.027, Method: Compositional matrix adjust.
 Identities = 55/214 (26%), Positives = 94/214 (44%), Gaps = 32/214 (15%)

Query  1051  NVAQSIIKHNNEDDRKREQTEEKKRQREERKRQQLDE-EKRRAVLESEERARQLLEEKER  1109
             N+ QS IK   + +  +E+ ++++RQ+E+R+R   D+ E+ +A+ E+E + R     +E 
Sbjct  1154  NIFQSFIKLKMDINVVQERLKQEQRQKEQRERDARDQAEREKAIKEAEAKERL---HREE  1210

Query  1110  QQQIQAQRRKALLGNAQSQSVQSGITGTSGSTENNKNDAVKTSEAQASIRLPGTSVAPWS  1169
             Q +++ QR++A +  AQ +     +          +  AV+  EA+              
Sbjct  1211  QSRLENQRQQAAIEQAQRELAARELAL--------REQAVREEEAR--------------  1248

Query  1170  VQSPKTNSTAPGLAEIQKAERRERRADQQRHQELLDKQVRANAAAAAEANDALLKWQAAP  1229
             +Q+ +  +T   LA  Q A   E R    R     +++VR       E      + +   
Sbjct  1249  LQAIREQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIR  1308

Query  1230  PLAPVMSL----ADIQAEEAKRLAT--DLVDQQR  1257
                   S     A IQ EE  RL T  D VDQQR
Sbjct  1309  RENESRSKREEEARIQREEITRLQTLRDQVDQQR  1342


>M9PBJ1_DROME unnamed protein product
Length=3664

 Score = 39.7 bits (91),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 55/214 (26%), Positives = 94/214 (44%), Gaps = 32/214 (15%)

Query  1051  NVAQSIIKHNNEDDRKREQTEEKKRQREERKRQQLDE-EKRRAVLESEERARQLLEEKER  1109
             N+ QS IK   + +  +E+ ++++RQ+E+R+R   D+ E+ +A+ E+E + R     +E 
Sbjct  1178  NIFQSFIKLKMDINVVQERLKQEQRQKEQRERDARDQAEREKAIKEAEAKERL---HREE  1234

Query  1110  QQQIQAQRRKALLGNAQSQSVQSGITGTSGSTENNKNDAVKTSEAQASIRLPGTSVAPWS  1169
             Q +++ QR++A +  AQ +     +          +  AV+  EA+              
Sbjct  1235  QSRLENQRQQAAIEQAQRELAARELAL--------REQAVREEEAR--------------  1272

Query  1170  VQSPKTNSTAPGLAEIQKAERRERRADQQRHQELLDKQVRANAAAAAEANDALLKWQAAP  1229
             +Q+ +  +T   LA  Q A   E R    R     +++VR       E      + +   
Sbjct  1273  LQAIREQATREQLAREQAAREEELRIQSLRDIARREEEVRLQNIRDEETRIRREEEERIR  1332

Query  1230  PLAPVMSL----ADIQAEEAKRLAT--DLVDQQR  1257
                   S     A IQ EE  RL T  D VDQQR
Sbjct  1333  RENESRSKREEEARIQREEITRLQTLRDQVDQQR  1366



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 39348673730


Query= XP_017062583.2 uncharacterized protein LOC108102315 isoform X14
[Drosophila eugracilis]

Length=1676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IM86_DROME  unnamed protein product                                 1480    0.0  
H9XVP2_DROME  unnamed protein product                                 1479    0.0  
O96960_DROME  unnamed protein product                                 247     9e-66


>Q8IM86_DROME unnamed protein product
Length=3183

 Score = 1480 bits (3832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 935/1726 (54%), Positives = 1155/1726 (67%), Gaps = 119/1726 (7%)

Query  1     MNTSLKPVPEDPEKKILFRKQELKTNTEDKLIFAENALKSQIQIKEQLRQQQQPIMYTSS  60
             MNTS   V  D EKK    K+ELK NT++KLIFAENALKSQI+IKEQLR QQQ  +Y SS
Sbjct  2     MNTSQLQVTGDTEKKSQLLKKELKINTQEKLIFAENALKSQIKIKEQLRLQQQSTIYASS  61

Query  61    SNCPAGAP-VRAESLIQS-ANRPDYPLKINSVRTPNQKQLSNMQPTIRKSPTFLDSSFSS  118
                 + A  VRA  L Q   N   + +  +  +     Q+  MQP + KSP  LD S+ S
Sbjct  62    LLSSSAAGSVRAPLLSQGHLNSIQHNMDFDLAKA----QIPEMQPPMSKSPNGLDFSYLS  117

Query  119   Y--LNTNGSMISIKSEQQLSEIYNSQQHSDYIISDYMDKIATRISLLETELKFAWRALDL  176
             Y  +NTN SMISIKSEQQL + YNS+QHSDYIISDYMDKIATRISLLETELKFAWRALDL
Sbjct  118   YPSINTNESMISIKSEQQLCQSYNSEQHSDYIISDYMDKIATRISLLETELKFAWRALDL  177

Query  177   LSTEYGKIWVRLEKLENISIEQQSVVSNLMDLIGATNHEQQKGNIDVLEFPSFRDENKLL  236
             LSTEYGKIW+RLEKLENISIEQQSVV NL+DLIGA+  E QK +I+ ++ P ++DE++LL
Sbjct  178   LSTEYGKIWIRLEKLENISIEQQSVVGNLVDLIGASKKELQKVDIERMKVPLYQDEDQLL  237

Query  237   PLVIKDTLGLDIVLEAEPSNPDFEKELRFRDHDHTSVSKLAQVRDSDLFFNSACAFGVHD  296
             PL ++DTL +DI    + SN DF+K L F +H+ T V+K  Q   S+   NSA A    D
Sbjct  238   PLEMEDTLDIDI----QSSNRDFDKNLTFENHEKTFVTKHTQATKSEDLMNSAYAI---D  290

Query  297   PYLHFEDDALNRQSLNIEQMKMVLEKPDEPNSKCFQSDIEVSRKESSIQLYSDSDVQFYE  356
              + +FE+   N ++L+I  +K   EK  EP  K  QSD E + KES  +LYSDSD+  YE
Sbjct  291   SHPNFENIDFNGKNLDIGIIKFGFEKGYEPKQKGNQSDFE-AYKESRTKLYSDSDLMLYE  349

Query  357   KQHFLANNARTELMKEFINGRRVLNEISESSGVSSKGSNISQHKRGSKNDQSFM-DFDGD  415
             +Q FLAN+AR ELMKEF+NGRRVLNEIS SSG  SK S   + K   K  +  + + D  
Sbjct  350   RQQFLANSARAELMKEFLNGRRVLNEISASSGALSKSS--EKDKNLVKPREPLLSEIDDT  407

Query  416   NIRQTSNELDNLIEDVKFFRLTASKTSEGGIQVLPIEDTGGTEISANVNEINESFYKKLN  475
              +R+++ EL +   +  FF++ ASKT EGG QVLPIEDTGGTE  AN+NE++ESFYK LN
Sbjct  408   YVRRSTCELVSPSSN-NFFQIAASKTGEGGNQVLPIEDTGGTESPANINEVDESFYKNLN  466

Query  476   EAYRDNDLSNEIFKVDALLYQSEVAHEEQSIPTIRGHSASSSVLRTPDERDITDGQSFET  535
             EAYRDN+LS+EIFKVDALL+QSE  H+   I  IR  S SS VL       IT  Q  +T
Sbjct  467   EAYRDNELSSEIFKVDALLHQSEATHDH--ISFIRNQSTSSPVLNNQRVNAITGTQPLQT  524

Query  536   AETSLTK---QSKNKESRRYRKKKHHKNEMDMINKLKCILTQAHSSHIINGDTKELDTDL  592
             A+  L     Q  NKE R++RKKKHH NEMDMINKLKCIL QA S+ II  D +EL + L
Sbjct  525   AKACLVTEPNQHLNKEPRKHRKKKHHTNEMDMINKLKCILAQAQSTEIIKRDIEELGSKL  584

Query  593   VD-IVTGTGTEQEEVGSENIHNGLKNQRSISRITNFNDDIRIILDSMTETLLQEINKIPG  651
              D  V  T TE          N   N  S S +    DDIR +L+++ +TLL EINKI G
Sbjct  585   SDACVKQTETE----------NKSDNHISTSYL---KDDIRKMLNNVIQTLLGEINKIKG  631

Query  652   LQSLSASHISQLRKTVWAEEKFFQKLSQVDKKLTLLLLNPITVTEELQRLHITNTNEMFV  711
             LQSLSA+ +SQL+  VW+EE+FFQK+S VDKKLTLLLLNP+TVTEELQRL I+NTNE FV
Sbjct  632   LQSLSATQLSQLQNAVWSEERFFQKISLVDKKLTLLLLNPLTVTEELQRLCISNTNEKFV  691

Query  712   LVMKKFKRNIDTLKKLVGSSLNDFKIVKTCASRFSPKSLDSSFKSNVCSLSAHLLRNNSD  771
             LV+KK K+NIDTLKKLVGSSL+DFKI  + A+  +  SL+ S  SN  S SAHLLRNNS+
Sbjct  692   LVIKKLKKNIDTLKKLVGSSLDDFKIDNSHANMTTFHSLNPSHNSNDSSFSAHLLRNNSN  751

Query  772   LDEQLKILETQEIEINRKKKIDEIVSELNENAHKTFNPYIENESNYSYTNSKEDFRRSTT  831
             LDEQLKILETQEIEI+RKKKIDEIVS L+E  + TFNP +E +S +S TNS ++    + 
Sbjct  752   LDEQLKILETQEIEIHRKKKIDEIVSGLSEETY-TFNPDMEYKSQHSCTNSTDNIIGFSK  810

Query  832   NIYNEDEYIKSLKKSLERHNSMIFLLHLQNPEKNKVSSDINFTQMDLNRASLSPPPPAPN  891
             NIYNEDEYIKSL+KSLERHNSMIFLLHLQNPEK+KV +DIN  QMD NRASLSPPPPAP 
Sbjct  811   NIYNEDEYIKSLRKSLERHNSMIFLLHLQNPEKHKVLADINDAQMDSNRASLSPPPPAPT  870

Query  892   DNFSFNETVNQFCGEIDSHKNAKSESRLSSMNCWEPNSPIAVGMQHSN--FNNIIEKRGK  949
             D    N+ +NQ   +    +N KS+S LSSM+ W  NS ++VG+Q+ +   NNI+E    
Sbjct  871   DTVYLNDAINQITYQ---QRNGKSDSGLSSMSGWSANSQVSVGLQNYDPACNNILE-NCS  926

Query  950   KRIQAYPPLPVA-SSDFRSLPATYDKMNTSKDNDYVITEENLNYIQELSKNLPICSAYEN  1008
             +R+Q Y   P+A +S+F S P ++++  T+   ++VI EENLNYI ELSKNLPICSAYEN
Sbjct  927   ERLQTYHSFPLAENSNFHSFPLSHEQAQTTNQTEFVILEENLNYIYELSKNLPICSAYEN  986

Query  1009  KSIFD-----TNSDSVETFPTVDEILHWDHVNEKDKNNVSMEQLNTTIMPDLLSAQIRKS  1063
             KSIFD      +S+ +  F TVDE+L WD +NE DK N S ++LN+ +MPDLL+AQI   
Sbjct  987   KSIFDMKYEICDSNEIGKFSTVDEMLEWDQLNEPDKQNFSGKRLNSNLMPDLLTAQI---  1043

Query  1064  ATINPPSFRKKYQN--ANGGNVESLEDKNFSRSSHTE---LNKDCKTTPNKPNLTDRLVF  1118
                 P S  K  +N   N   V   E+K   R S  E    N   +    +P LTD+LVF
Sbjct  1044  ----PNSISKHNKNTSVNIEYVRQKENKGMDRRSIIEPNIYNGKSEDQICRPCLTDKLVF  1099

Query  1119  YPSYNSIADYNSITNLDYVGEQNQITDITDSQYLPNLEVPPVHLDFTANTNSEAHLCVSE  1178
             YPS NSI D+NS  + + + +Q+Q   I +       + P  +LD+T+ T S+A   V  
Sbjct  1100  YPSSNSITDHNSSHDFNCLSQQDQTRIIKEFGSAHLNQDPTNYLDYTSGTYSKAPPEVLT  1159

Query  1179  KKTSQQELGLNHR---IHIKKHHHSY-----------AKSPKVWKKLNNILTDNLKLKRM  1224
              +T+   L  NH    +    +  SY           AK  KVWK+LN IL DNLKLKR+
Sbjct  1160  HETNSSHLEFNHESESLFNSPNTSSYCKQKFVPGTSPAKPSKVWKRLNTILADNLKLKRV  1219

Query  1225  SKFNRSQSLPGDVQSQGNQSQGRGQAGSCPSISRKPPNASERQINLSKRVQKLPMR----  1280
             SKFNRS SLPGDVQSQG Q Q RGQAGSCP I ++  N +   + LSKR+QKLP+R    
Sbjct  1220  SKFNRSLSLPGDVQSQGLQRQPRGQAGSCPFIHKR-SNLAGSPVQLSKRIQKLPIRFIGR  1278

Query  1281  -----IVRRLSHPNTTDLLDPADHEPCSSDTGVYTNYLSSKMNNLMQKAKTYKRHNFVLR  1335
                   VRR S P++   LD A  +  SS+ G+    +SSKM+ LMQKAKTYKRH+FVLR
Sbjct  1279  AKGVPFVRRSSSPDSAVSLDSAADKRFSSEKGLKKKTISSKMSGLMQKAKTYKRHSFVLR  1338

Query  1336  RGCNLPNTELDTPDFTSSDNGKSSTFKGKIVINNYEDGVD--KNLNDQNDYGIKKVLS--  1391
             RGCN+ ++EL+ PDF SS N  SS    +I++N   +  D  ++ N +N    K VL   
Sbjct  1339  RGCNMSDSELEMPDFVSSGNDNSSISTREILLNQSIEVEDEQEDFNYKNRCDSKSVLGGS  1398

Query  1392  -----GNELNNLFPVVGDLKKTQSPISVAGSTAIHISEPANNKEIVN----IKNGTIKMP  1442
                  GN  NNLFP+VGDLKK QSP+ +A  T I    P+   E  N    IKN  I+MP
Sbjct  1399  IEKLNGNLTNNLFPIVGDLKKIQSPLPLAVLTEI----PSYKDEYSNKSDSIKNSPIEMP  1454

Query  1443  EIFLETTSQSCLQNLNSVYTDDIGDESILRNSVNIDVNVPTLNIFKTIGEVGDIAITTFL  1502
             +I LET   +C Q LN  ++DD  D++IL NS    VN PT +I KT+ +  +  +T   
Sbjct  1455  KILLET---ACNQELNLAHSDDDVDKNILANSAKDYVNAPTFSILKTVEDASEPTMTPLH  1511

Query  1503  TTTTTATTTIACRSLSSSGGLLVTQQCLDLPNKYEYGSRDDDDNRSQHSSRTLSSSRRQS  1562
             TTTTT +      SL+ +  L VTQQCLDLPN   +GSR+DDDNRSQHS+RTLSSSRRQS
Sbjct  1512  TTTTTNS------SLNVTSALWVTQQCLDLPNYPGWGSREDDDNRSQHSARTLSSSRRQS  1565

Query  1563  TEDSIDTDDEYFYYELRQLEEQEQQRTESSGITSSERLEDNEVLFSQIGLLLQNDT----  1618
             TEDSIDTDDEYFYYELRQLEEQE+QR  +S I S ER  DN+VLFSQIG LLQND     
Sbjct  1566  TEDSIDTDDEYFYYELRQLEEQEKQRAHNSAIPSCERQNDNDVLFSQIGQLLQNDVNGGD  1625

Query  1619  -FRSFDVCNDVEDNMNYSPSESVKLRMSEVFGELKSVVKLHPEVKN  1663
              FR  + CND ED + +SPSESVKLRMSEVF ELKSVV L+P V N
Sbjct  1626  GFRHSNGCNDGEDAIIFSPSESVKLRMSEVFKELKSVVSLNPSVNN  1671


>H9XVP2_DROME unnamed protein product
Length=3186

 Score = 1479 bits (3829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 935/1726 (54%), Positives = 1155/1726 (67%), Gaps = 119/1726 (7%)

Query  1     MNTSLKPVPEDPEKKILFRKQELKTNTEDKLIFAENALKSQIQIKEQLRQQQQPIMYTSS  60
             MNTS   V  D EKK    K+ELK NT++KLIFAENALKSQI+IKEQLR QQQ  +Y SS
Sbjct  2     MNTSQLQVTGDTEKKSQLLKKELKINTQEKLIFAENALKSQIKIKEQLRLQQQSTIYASS  61

Query  61    SNCPAGAP-VRAESLIQS-ANRPDYPLKINSVRTPNQKQLSNMQPTIRKSPTFLDSSFSS  118
                 + A  VRA  L Q   N   + +  +  +     Q+  MQP + KSP  LD S+ S
Sbjct  62    LLSSSAAGSVRAPLLSQGHLNSIQHNMDFDLAKA----QIPEMQPPMSKSPNGLDFSYLS  117

Query  119   Y--LNTNGSMISIKSEQQLSEIYNSQQHSDYIISDYMDKIATRISLLETELKFAWRALDL  176
             Y  +NTN SMISIKSEQQL + YNS+QHSDYIISDYMDKIATRISLLETELKFAWRALDL
Sbjct  118   YPSINTNESMISIKSEQQLCQSYNSEQHSDYIISDYMDKIATRISLLETELKFAWRALDL  177

Query  177   LSTEYGKIWVRLEKLENISIEQQSVVSNLMDLIGATNHEQQKGNIDVLEFPSFRDENKLL  236
             LSTEYGKIW+RLEKLENISIEQQSVV NL+DLIGA+  E QK +I+ ++ P ++DE++LL
Sbjct  178   LSTEYGKIWIRLEKLENISIEQQSVVGNLVDLIGASKKELQKVDIERMKVPLYQDEDQLL  237

Query  237   PLVIKDTLGLDIVLEAEPSNPDFEKELRFRDHDHTSVSKLAQVRDSDLFFNSACAFGVHD  296
             PL ++DTL +DI    + SN DF+K L F +H+ T V+K  Q   S+   NSA A    D
Sbjct  238   PLEMEDTLDIDI----QSSNRDFDKNLTFENHEKTFVTKHTQATKSEDLMNSAYAI---D  290

Query  297   PYLHFEDDALNRQSLNIEQMKMVLEKPDEPNSKCFQSDIEVSRKESSIQLYSDSDVQFYE  356
              + +FE+   N ++L+I  +K   EK  EP  K  QSD E + KES  +LYSDSD+  YE
Sbjct  291   SHPNFENIDFNGKNLDIGIIKFGFEKGYEPKQKGNQSDFE-AYKESRTKLYSDSDLMLYE  349

Query  357   KQHFLANNARTELMKEFINGRRVLNEISESSGVSSKGSNISQHKRGSKNDQSFM-DFDGD  415
             +Q FLAN+AR ELMKEF+NGRRVLNEIS SSG  SK S   + K   K  +  + + D  
Sbjct  350   RQQFLANSARAELMKEFLNGRRVLNEISASSGALSKSS--EKDKNLVKPREPLLSEIDDT  407

Query  416   NIRQTSNELDNLIEDVKFFRLTASKTSEGGIQVLPIEDTGGTEISANVNEINESFYKKLN  475
              +R+++ EL +   +  FF++ ASKT EGG QVLPIEDTGGTE  AN+NE++ESFYK LN
Sbjct  408   YVRRSTCELVSPSSN-NFFQIAASKTGEGGNQVLPIEDTGGTESPANINEVDESFYKNLN  466

Query  476   EAYRDNDLSNEIFKVDALLYQSEVAHEEQSIPTIRGHSASSSVLRTPDERDITDGQSFET  535
             EAYRDN+LS+EIFKVDALL+QSE  H+   I  IR  S SS VL       IT  Q  +T
Sbjct  467   EAYRDNELSSEIFKVDALLHQSEATHDH--ISFIRNQSTSSPVLNNQRVNAITGTQPLQT  524

Query  536   AETSLTK---QSKNKESRRYRKKKHHKNEMDMINKLKCILTQAHSSHIINGDTKELDTDL  592
             A+  L     Q  NKE R++RKKKHH NEMDMINKLKCIL QA S+ II  D +EL + L
Sbjct  525   AKACLVTEPNQHLNKEPRKHRKKKHHTNEMDMINKLKCILAQAQSTEIIKRDIEELGSKL  584

Query  593   VD-IVTGTGTEQEEVGSENIHNGLKNQRSISRITNFNDDIRIILDSMTETLLQEINKIPG  651
              D  V  T TE          N   N  S S +    DDIR +L+++ +TLL EINKI G
Sbjct  585   SDACVKQTETE----------NKSDNHISTSYL---KDDIRKMLNNVIQTLLGEINKIKG  631

Query  652   LQSLSASHISQLRKTVWAEEKFFQKLSQVDKKLTLLLLNPITVTEELQRLHITNTNEMFV  711
             LQSLSA+ +SQL+  VW+EE+FFQK+S VDKKLTLLLLNP+TVTEELQRL I+NTNE FV
Sbjct  632   LQSLSATQLSQLQNAVWSEERFFQKISLVDKKLTLLLLNPLTVTEELQRLCISNTNEKFV  691

Query  712   LVMKKFKRNIDTLKKLVGSSLNDFKIVKTCASRFSPKSLDSSFKSNVCSLSAHLLRNNSD  771
             LV+KK K+NIDTLKKLVGSSL+DFKI  + A+  +  SL+ S  SN  S SAHLLRNNS+
Sbjct  692   LVIKKLKKNIDTLKKLVGSSLDDFKIDNSHANMTTFHSLNPSHNSNDSSFSAHLLRNNSN  751

Query  772   LDEQLKILETQEIEINRKKKIDEIVSELNENAHKTFNPYIENESNYSYTNSKEDFRRSTT  831
             LDEQLKILETQEIEI+RKKKIDEIVS L+E  + TFNP +E +S +S TNS ++    + 
Sbjct  752   LDEQLKILETQEIEIHRKKKIDEIVSGLSEETY-TFNPDMEYKSQHSCTNSTDNIIGFSK  810

Query  832   NIYNEDEYIKSLKKSLERHNSMIFLLHLQNPEKNKVSSDINFTQMDLNRASLSPPPPAPN  891
             NIYNEDEYIKSL+KSLERHNSMIFLLHLQNPEK+KV +DIN  QMD NRASLSPPPPAP 
Sbjct  811   NIYNEDEYIKSLRKSLERHNSMIFLLHLQNPEKHKVLADINDAQMDSNRASLSPPPPAPT  870

Query  892   DNFSFNETVNQFCGEIDSHKNAKSESRLSSMNCWEPNSPIAVGMQHSN--FNNIIEKRGK  949
             D    N+ +NQ   +    +N KS+S LSSM+ W  NS ++VG+Q+ +   NNI+E    
Sbjct  871   DTVYLNDAINQITYQ---QRNGKSDSGLSSMSGWSANSQVSVGLQNYDPACNNILE-NCS  926

Query  950   KRIQAYPPLPVA-SSDFRSLPATYDKMNTSKDNDYVITEENLNYIQELSKNLPICSAYEN  1008
             +R+Q Y   P+A +S+F S P ++++  T+   ++VI EENLNYI ELSKNLPICSAYEN
Sbjct  927   ERLQTYHSFPLAENSNFHSFPLSHEQAQTTNQTEFVILEENLNYIYELSKNLPICSAYEN  986

Query  1009  KSIFD-----TNSDSVETFPTVDEILHWDHVNEKDKNNVSMEQLNTTIMPDLLSAQIRKS  1063
             KSIFD      +S+ +  F TVDE+L WD +NE DK N S ++LN+ +MPDLL+AQI   
Sbjct  987   KSIFDMKYEICDSNEIGKFSTVDEMLEWDQLNEPDKQNFSGKRLNSNLMPDLLTAQI---  1043

Query  1064  ATINPPSFRKKYQN--ANGGNVESLEDKNFSRSSHTE---LNKDCKTTPNKPNLTDRLVF  1118
                 P S  K  +N   N   V   E+K   R S  E    N   +    +P LTD+LVF
Sbjct  1044  ----PNSISKHNKNTSVNIEYVRQKENKGMDRRSIIEPNIYNGKSEDQICRPCLTDKLVF  1099

Query  1119  YPSYNSIADYNSITNLDYVGEQNQITDITDSQYLPNLEVPPVHLDFTANTNSEAHLCVSE  1178
             YPS NSI D+NS  + + + +Q+Q   I +       + P  +LD+T+ T S+A   V  
Sbjct  1100  YPSSNSITDHNSSHDFNCLSQQDQTRIIKEFGSAHLNQDPTNYLDYTSGTYSKAPPEVLT  1159

Query  1179  KKTSQQELGLNHR---IHIKKHHHSY-----------AKSPKVWKKLNNILTDNLKLKRM  1224
              +T+   L  NH    +    +  SY           AK  KVWK+LN IL DNLKLKR+
Sbjct  1160  HETNSSHLEFNHESESLFNSPNTSSYCKQKFVPGTSPAKPSKVWKRLNTILADNLKLKRV  1219

Query  1225  SKFNRSQSLPGDVQSQGNQSQGRGQAGSCPSISRKPPNASERQINLSKRVQKLPMR----  1280
             SKFNRS SLPGDVQSQG Q Q RGQAGSCP I ++  N +   + LSKR+QKLP+R    
Sbjct  1220  SKFNRSLSLPGDVQSQGLQRQPRGQAGSCPFIHKR-SNLAGSPVQLSKRIQKLPIRFIGR  1278

Query  1281  -----IVRRLSHPNTTDLLDPADHEPCSSDTGVYTNYLSSKMNNLMQKAKTYKRHNFVLR  1335
                   VRR S P++   LD A  +  SS+ G+    +SSKM+ LMQKAKTYKRH+FVLR
Sbjct  1279  AKGVPFVRRSSSPDSAVSLDSAADKRFSSEKGLKKKTISSKMSGLMQKAKTYKRHSFVLR  1338

Query  1336  RGCNLPNTELDTPDFTSSDNGKSSTFKGKIVINNYEDGVD--KNLNDQNDYGIKKVLS--  1391
             RGCN+ ++EL+ PDF SS N  SS    +I++N   +  D  ++ N +N    K VL   
Sbjct  1339  RGCNMSDSELEMPDFVSSGNDNSSISTREILLNQSIEVEDEQEDFNYKNRCDSKSVLGGS  1398

Query  1392  -----GNELNNLFPVVGDLKKTQSPISVAGSTAIHISEPANNKEIVN----IKNGTIKMP  1442
                  GN  NNLFP+VGDLKK QSP+ +A  T I    P+   E  N    IKN  I+MP
Sbjct  1399  IEKLNGNLTNNLFPIVGDLKKIQSPLPLAVLTEI----PSYKDEYSNKSDSIKNSPIEMP  1454

Query  1443  EIFLETTSQSCLQNLNSVYTDDIGDESILRNSVNIDVNVPTLNIFKTIGEVGDIAITTFL  1502
             +I LET   +C Q LN  ++DD  D++IL NS    VN PT +I KT+ +  +  +T   
Sbjct  1455  KILLET---ACNQELNLAHSDDDVDKNILANSAKDYVNAPTFSILKTVEDASEPTMTPLH  1511

Query  1503  TTTTTATTTIACRSLSSSGGLLVTQQCLDLPNKYEYGSRDDDDNRSQHSSRTLSSSRRQS  1562
             TTTTT +      SL+ +  L VTQQCLDLPN   +GSR+DDDNRSQHS+RTLSSSRRQS
Sbjct  1512  TTTTTNS------SLNVTSALWVTQQCLDLPNYPGWGSREDDDNRSQHSARTLSSSRRQS  1565

Query  1563  TEDSIDTDDEYFYYELRQLEEQEQQRTESSGITSSERLEDNEVLFSQIGLLLQNDT----  1618
             TEDSIDTDDEYFYYELRQLEEQE+QR  +S I S ER  DN+VLFSQIG LLQND     
Sbjct  1566  TEDSIDTDDEYFYYELRQLEEQEKQRAHNSAIPSCERQNDNDVLFSQIGQLLQNDVNGGD  1625

Query  1619  -FRSFDVCNDVEDNMNYSPSESVKLRMSEVFGELKSVVKLHPEVKN  1663
              FR  + CND ED + +SPSESVKLRMSEVF ELKSVV L+P V N
Sbjct  1626  GFRHSNGCNDGEDAIIFSPSESVKLRMSEVFKELKSVVSLNPSVNN  1671


>O96960_DROME unnamed protein product
Length=1724

 Score = 247 bits (631),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 143/234 (61%), Positives = 168/234 (72%), Gaps = 14/234 (6%)

Query  1435  KNGTIKMPEIFLETTSQSCLQNLNSVYTDDIGDESILRNSVNIDVNVPTLNIFKTIGEVG  1494
             KN  I+MP+I LET   +C Q LN  ++DD  D++IL NS    VN PT +I KT+ +  
Sbjct  11    KNSPIEMPKILLET---ACNQELNLAHSDDDVDKNILANSAKDYVNAPTFSILKTVEDAS  67

Query  1495  DIAITTFLTTTTTATTTIACRSLSSSGGLLVTQQCLDLPNKYEYGSRDDDDNRSQHSSRT  1554
             +  +T   TTTTT +      SL+ +  L VTQQCLDLPN   +GSR+DDDNRSQHS+RT
Sbjct  68    EPTMTPLHTTTTTNS------SLNVTSALWVTQQCLDLPNYPGWGSREDDDNRSQHSART  121

Query  1555  LSSSRRQSTEDSIDTDDEYFYYELRQLEEQEQQRTESSGITSSERLEDNEVLFSQIGLLL  1614
             LSSSRRQSTEDSIDTDDEYFYYELRQLEEQE+QR  +S I S ER  DN+VLFSQIG LL
Sbjct  122   LSSSRRQSTEDSIDTDDEYFYYELRQLEEQEKQRAHNSAIPSCERQNDNDVLFSQIGQLL  181

Query  1615  QNDT-----FRSFDVCNDVEDNMNYSPSESVKLRMSEVFGELKSVVKLHPEVKN  1663
             QND      FR  + CND ED + +SPSESVKLRMSEVF ELKSVV L+P V N
Sbjct  182   QNDVNGGDGFRHSNGCNDGEDAIIFSPSESVKLRMSEVFKELKSVVSLNPSVNN  235



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 39348673730


Query= XP_017062584.1 plasma membrane calcium-transporting ATPase 2 isoform
X1 [Drosophila eugracilis]

Length=1254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DP9_DROME  unnamed protein product                                 2406    0.0  
Q59DQ0_DROME  unnamed protein product                                 2250    0.0  
E6EK17_DROME  unnamed protein product                                 2245    0.0  


>Q59DP9_DROME unnamed protein product
Length=1255

 Score = 2406 bits (6235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1185/1259 (94%), Positives = 1215/1259 (97%), Gaps = 9/1259 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK-AKRANKQKSLTGESDV  299
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK AKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  300   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  359
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  539
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  540   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  659
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  959
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1020  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1079
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1139
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1139

Query  1140  RTAMQIPVGGGYPLYNFNLLS----KHQQQQQPKPSLPAQQNVSPAMLPPDISYIDEDPL  1195
             RT + + VGGG+PLYNFNLL+    KHQQQQ+PK     Q NVS  M+ PDISYIDEDP 
Sbjct  1140  RTGIPVAVGGGHPLYNFNLLNPNYIKHQQQQEPKLPPQTQLNVSSGMMSPDISYIDEDPQ  1199

Query  1196  QHQRSLNNGLTQPNPSISTNISAPALSQRFSEIAHSLPQQIRYNNIESKHSNGQNETRI  1254
             Q QR+L+NGLT    S+ +N+  P+ +Q FS+IA +L Q+IR  NIE+KHSNGQNETRI
Sbjct  1200  QQQRTLHNGLTSQRSSMPSNV--PSSNQSFSKIAQTLQQKIR-GNIETKHSNGQNETRI  1255


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2250 bits (5831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1137 (96%), Positives = 1113/1137 (98%), Gaps = 5/1137 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK-AKRANKQKSLTGESDV  299
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK AKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  300   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  359
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  539
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  540   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  659
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  959
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1020  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1079
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSL  1136
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ+RV+ AFR   + L+ R   H+  SL
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFR---QGLDARYGDHTNTSL  1133


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2245 bits (5818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1141 (96%), Positives = 1113/1141 (98%), Gaps = 9/1141 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK-AKRANKQKSLTGESDV  299
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK AKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  300   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  359
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  539
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  540   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  659
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  959
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1020  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1079
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----LRVIRAFRSTLEDLNERRSMHSLHS  1135
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    +RV+ AFR   + L+ R   H+  S
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIRVVNAFR---QGLDARYGDHTNTS  1136

Query  1136  L  1136
             L
Sbjct  1137  L  1137



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 39348673730


Query= XP_017062585.1 plasma membrane calcium-transporting ATPase 2 isoform
X2 [Drosophila eugracilis]

Length=1243
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DP9_DROME  unnamed protein product                                 2382    0.0  
Q59DQ0_DROME  unnamed protein product                                 2227    0.0  
E6EK15_DROME  unnamed protein product                                 2222    0.0  


>Q59DP9_DROME unnamed protein product
Length=1255

 Score = 2382 bits (6172),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1175/1259 (93%), Positives = 1204/1259 (96%), Gaps = 20/1259 (2%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK------------GESDV  288
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK            GE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  289   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  348
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  349   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  408
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  409   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  468
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  469   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  528
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  529   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  588
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  589   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  648
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  649   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  708
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  709   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  768
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  769   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  828
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  829   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  888
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  889   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  948
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  949   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1008
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1009  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1068
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1069  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1128
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1139

Query  1129  RTAMQIPVGGGYPLYNFNLLS----KHQQQQQPKPSLPAQQNVSPAMLPPDISYIDEDPL  1184
             RT + + VGGG+PLYNFNLL+    KHQQQQ+PK     Q NVS  M+ PDISYIDEDP 
Sbjct  1140  RTGIPVAVGGGHPLYNFNLLNPNYIKHQQQQEPKLPPQTQLNVSSGMMSPDISYIDEDPQ  1199

Query  1185  QHQRSLNNGLTQPNPSISTNISAPALSQRFSEIAHSLPQQIRYNNIESKHSNGQNETRI  1243
             Q QR+L+NGLT    S+ +N+  P+ +Q FS+IA +L Q+IR  NIE+KHSNGQNETRI
Sbjct  1200  QQQRTLHNGLTSQRSSMPSNV--PSSNQSFSKIAQTLQQKIR-GNIETKHSNGQNETRI  1255


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2227 bits (5770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1085/1137 (95%), Positives = 1102/1137 (97%), Gaps = 16/1137 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK------------GESDV  288
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK            GE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  289   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  348
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  349   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  408
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  409   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  468
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  469   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  528
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  529   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  588
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  589   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  648
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  649   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  708
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  709   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  768
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  769   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  828
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  829   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  888
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  889   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  948
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  949   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1008
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1009  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1068
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1069  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSL  1125
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ+RV+ AFR   + L+ R   H+  SL
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFR---QGLDARYGDHTNTSL  1133


>E6EK15_DROME unnamed protein product
Length=1194

 Score = 2222 bits (5758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1085/1148 (95%), Positives = 1102/1148 (96%), Gaps = 27/1148 (2%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGESDVRPQIKGSQTPTQ  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGE+D R QIKGSQ P+Q
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGENDGRSQIKGSQAPSQ  300

Query  301   RQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVL  360
             R+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVL
Sbjct  301   RETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVL  359

Query  361   TVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSV  420
             TVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSV
Sbjct  360   TVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSV  419

Query  421   KKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIP  480
             KKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIP
Sbjct  420   KKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIP  479

Query  481   QHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQGLGVKYQSIREEI  540
             QHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQGLGVKYQSIR+EI
Sbjct  480   QHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLGVKYQSIRDEI  539

Query  541   TEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRD  600
             TEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRD
Sbjct  540   TEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRD  599

Query  601   MQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDDEENIMTNLTCLC  660
             MQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDDEENIMTNLTCLC
Sbjct  600   MQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLC  659

Query  661   VVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKE  720
             VVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKE
Sbjct  660   VVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKE  719

Query  721   FNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDG  780
             FNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDG
Sbjct  720   FNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDG  779

Query  781   TNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQF  840
             TNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQF
Sbjct  780   TNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQF  839

Query  841   QLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYG  900
             QLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYG
Sbjct  840   QLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYG  899

Query  901   RTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNAGPTQHFTIIFNT  960
             RTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNAGPTQHFTIIFNT
Sbjct  900   RTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNAGPTQHFTIIFNT  959

Query  961   FVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALSL  1020
             FVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKAL+L
Sbjct  960   FVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTL  1019

Query  1021  DQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHLGEERFDSIDSDK  1080
             DQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+LGEERFDSIDSDK
Sbjct  1020  DQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNLGEERFDSIDSDK  1079

Query  1081  KPRAGQILWIRGLTRLQTQ-----------------------LRVIRAFRSTLEDLNERR  1117
             KPRAGQILWIRGLTRLQTQ                       +RV+ AFR   + L+ R 
Sbjct  1080  KPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNAFR---QGLDARY  1136

Query  1118  SMHSLHSL  1125
               H+  SL
Sbjct  1137  GDHTNTSL  1144



Lambda      K        H
   0.313    0.129    0.370 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 39348673730


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062586.1 plasma membrane calcium-transporting ATPase 2 isoform
X3 [Drosophila eugracilis]

Length=1255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DP9_DROME  unnamed protein product                                 2413    0.0  
Q59DQ0_DROME  unnamed protein product                                 2257    0.0  
E6EK17_DROME  unnamed protein product                                 2251    0.0  


>Q59DP9_DROME unnamed protein product
Length=1255

 Score = 2413 bits (6253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1186/1259 (94%), Positives = 1216/1259 (97%), Gaps = 8/1259 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1139

Query  1141  RTAMQIPVGGGYPLYNFNLLS----KHQQQQQPKPSLPAQQNVSPAMLPPDISYIDEDPL  1196
             RT + + VGGG+PLYNFNLL+    KHQQQQ+PK     Q NVS  M+ PDISYIDEDP 
Sbjct  1140  RTGIPVAVGGGHPLYNFNLLNPNYIKHQQQQEPKLPPQTQLNVSSGMMSPDISYIDEDPQ  1199

Query  1197  QHQRSLNNGLTQPNPSISTNISAPALSQRFSEIAHSLPQQIRYNNIESKHSNGQNETRI  1255
             Q QR+L+NGLT    S+ +N+  P+ +Q FS+IA +L Q+IR  NIE+KHSNGQNETRI
Sbjct  1200  QQQRTLHNGLTSQRSSMPSNV--PSSNQSFSKIAQTLQQKIR-GNIETKHSNGQNETRI  1255


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2257 bits (5849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/1137 (96%), Positives = 1114/1137 (98%), Gaps = 4/1137 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSL  1137
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ+RV+ AFR   + L+ R   H+  SL
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFR---QGLDARYGDHTNTSL  1133


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2251 bits (5834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/1141 (96%), Positives = 1114/1141 (98%), Gaps = 8/1141 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----LRVIRAFRSTLEDLNERRSMHSLHS  1136
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    +RV+ AFR   + L+ R   H+  S
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIRVVNAFR---QGLDARYGDHTNTS  1136

Query  1137  L  1137
             L
Sbjct  1137  L  1137



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062587.1 plasma membrane calcium-transporting ATPase 2 isoform
X3 [Drosophila eugracilis]

Length=1255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DP9_DROME  unnamed protein product                                 2413    0.0  
Q59DQ0_DROME  unnamed protein product                                 2257    0.0  
E6EK17_DROME  unnamed protein product                                 2251    0.0  


>Q59DP9_DROME unnamed protein product
Length=1255

 Score = 2413 bits (6253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1186/1259 (94%), Positives = 1216/1259 (97%), Gaps = 8/1259 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1139

Query  1141  RTAMQIPVGGGYPLYNFNLLS----KHQQQQQPKPSLPAQQNVSPAMLPPDISYIDEDPL  1196
             RT + + VGGG+PLYNFNLL+    KHQQQQ+PK     Q NVS  M+ PDISYIDEDP 
Sbjct  1140  RTGIPVAVGGGHPLYNFNLLNPNYIKHQQQQEPKLPPQTQLNVSSGMMSPDISYIDEDPQ  1199

Query  1197  QHQRSLNNGLTQPNPSISTNISAPALSQRFSEIAHSLPQQIRYNNIESKHSNGQNETRI  1255
             Q QR+L+NGLT    S+ +N+  P+ +Q FS+IA +L Q+IR  NIE+KHSNGQNETRI
Sbjct  1200  QQQRTLHNGLTSQRSSMPSNV--PSSNQSFSKIAQTLQQKIR-GNIETKHSNGQNETRI  1255


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2257 bits (5849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/1137 (96%), Positives = 1114/1137 (98%), Gaps = 4/1137 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSL  1137
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ+RV+ AFR   + L+ R   H+  SL
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFR---QGLDARYGDHTNTSL  1133


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2251 bits (5834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/1141 (96%), Positives = 1114/1141 (98%), Gaps = 8/1141 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----LRVIRAFRSTLEDLNERRSMHSLHS  1136
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    +RV+ AFR   + L+ R   H+  S
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIRVVNAFR---QGLDARYGDHTNTS  1136

Query  1137  L  1137
             L
Sbjct  1137  L  1137



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062588.1 plasma membrane calcium-transporting ATPase 2 isoform
X3 [Drosophila eugracilis]

Length=1255
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DP9_DROME  unnamed protein product                                 2413    0.0  
Q59DQ0_DROME  unnamed protein product                                 2257    0.0  
E6EK17_DROME  unnamed protein product                                 2251    0.0  


>Q59DP9_DROME unnamed protein product
Length=1255

 Score = 2413 bits (6253),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1186/1259 (94%), Positives = 1216/1259 (97%), Gaps = 8/1259 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSLRSP  1139

Query  1141  RTAMQIPVGGGYPLYNFNLLS----KHQQQQQPKPSLPAQQNVSPAMLPPDISYIDEDPL  1196
             RT + + VGGG+PLYNFNLL+    KHQQQQ+PK     Q NVS  M+ PDISYIDEDP 
Sbjct  1140  RTGIPVAVGGGHPLYNFNLLNPNYIKHQQQQEPKLPPQTQLNVSSGMMSPDISYIDEDPQ  1199

Query  1197  QHQRSLNNGLTQPNPSISTNISAPALSQRFSEIAHSLPQQIRYNNIESKHSNGQNETRI  1255
             Q QR+L+NGLT    S+ +N+  P+ +Q FS+IA +L Q+IR  NIE+KHSNGQNETRI
Sbjct  1200  QQQRTLHNGLTSQRSSMPSNV--PSSNQSFSKIAQTLQQKIR-GNIETKHSNGQNETRI  1255


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2257 bits (5849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/1137 (96%), Positives = 1114/1137 (98%), Gaps = 4/1137 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLRVIRAFRSTLEDLNERRSMHSLHSL  1137
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ+RV+ AFR   + L+ R   H+  SL
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFR---QGLDARYGDHTNTSL  1133


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2251 bits (5834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/1141 (96%), Positives = 1114/1141 (98%), Gaps = 8/1141 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----LRVIRAFRSTLEDLNERRSMHSLHS  1136
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    +RV+ AFR   + L+ R   H+  S
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIRVVNAFR---QGLDARYGDHTNTS  1136

Query  1137  L  1137
             L
Sbjct  1137  L  1137



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062589.1 plasma membrane calcium-transporting ATPase 2 isoform
X4 [Drosophila eugracilis]

Length=1211
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E6EK18_DROME  unnamed protein product                                 2446    0.0  
Q9V4C7_DROME  unnamed protein product                                 2433    0.0  
E6EK15_DROME  unnamed protein product                                 2399    0.0  


>E6EK18_DROME unnamed protein product
Length=1210

 Score = 2446 bits (6340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1186/1211 (98%), Positives = 1199/1211 (99%), Gaps = 1/1211 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR  1139

Query  1141  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1200
             VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER
Sbjct  1140  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1199

Query  1201  LSSHSHTETAV  1211
             LSSHSHTETAV
Sbjct  1200  LSSHSHTETAV  1210


>Q9V4C7_DROME unnamed protein product
Length=1206

 Score = 2433 bits (6305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1182/1211 (98%), Positives = 1195/1211 (99%), Gaps = 5/1211 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    VIGGELQERLIPVPYSKSNTDQAIR
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----VIGGELQERLIPVPYSKSNTDQAIR  1135

Query  1141  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1200
             VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER
Sbjct  1136  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1195

Query  1201  LSSHSHTETAV  1211
             LSSHSHTETAV
Sbjct  1196  LSSHSHTETAV  1206


>E6EK15_DROME unnamed protein product
Length=1194

 Score = 2399 bits (6218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1211 (97%), Positives = 1183/1211 (98%), Gaps = 17/1211 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK            GE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK------------GENDG  288

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  289   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  347

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  348   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  407

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  408   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  467

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  468   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  527

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  528   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  587

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  588   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  647

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  648   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  707

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  708   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  767

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  768   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  827

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  828   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  887

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  888   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  947

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  948   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1007

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1008  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1067

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    VIGGELQERLIPVPYSKSNTDQAIR
Sbjct  1068  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----VIGGELQERLIPVPYSKSNTDQAIR  1123

Query  1141  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1200
             VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER
Sbjct  1124  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1183

Query  1201  LSSHSHTETAV  1211
             LSSHSHTETAV
Sbjct  1184  LSSHSHTETAV  1194



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062590.1 plasma membrane calcium-transporting ATPase 2 isoform
X5 [Drosophila eugracilis]

Length=1207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4C7_DROME  unnamed protein product                                 2439    0.0  
E6EK18_DROME  unnamed protein product                                 2433    0.0  
E6EK15_DROME  unnamed protein product                                 2405    0.0  


>Q9V4C7_DROME unnamed protein product
Length=1206

 Score = 2439 bits (6321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1182/1207 (98%), Positives = 1195/1207 (99%), Gaps = 1/1207 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1139

Query  1141  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1200
             FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH
Sbjct  1140  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1199

Query  1201  SHTETAV  1207
             SHTETAV
Sbjct  1200  SHTETAV  1206


>E6EK18_DROME unnamed protein product
Length=1210

 Score = 2433 bits (6305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1182/1211 (98%), Positives = 1195/1211 (99%), Gaps = 5/1211 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----VIGGELQERLIPVPYSKSNTDQAIR  1136
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    VIGGELQERLIPVPYSKSNTDQAIR
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR  1139

Query  1137  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1196
             VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER
Sbjct  1140  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1199

Query  1197  LSSHSHTETAV  1207
             LSSHSHTETAV
Sbjct  1200  LSSHSHTETAV  1210


>E6EK15_DROME unnamed protein product
Length=1194

 Score = 2405 bits (6233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1207 (97%), Positives = 1183/1207 (98%), Gaps = 13/1207 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK            GE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK------------GENDG  288

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  289   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  347

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  348   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  407

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  408   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  467

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  468   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  527

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  528   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  587

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  588   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  647

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  648   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  707

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  708   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  767

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  768   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  827

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  828   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  887

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  888   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  947

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  948   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1007

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1008  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1067

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA
Sbjct  1068  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1127

Query  1141  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1200
             FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH
Sbjct  1128  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1187

Query  1201  SHTETAV  1207
             SHTETAV
Sbjct  1188  SHTETAV  1194



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062591.1 plasma membrane calcium-transporting ATPase 2 isoform
X6 [Drosophila eugracilis]

Length=1195
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E6EK15_DROME  unnamed protein product                                 2414    0.0  
Q9V4C7_DROME  unnamed protein product                                 2405    0.0  
E6EK18_DROME  unnamed protein product                                 2399    0.0  


>E6EK15_DROME unnamed protein product
Length=1194

 Score = 2414 bits (6257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1195 (98%), Positives = 1183/1195 (99%), Gaps = 1/1195 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGESDVRPQIKGSQTPTQ  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGE+D R QIKGSQ P+Q
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKGENDGRSQIKGSQAPSQ  300

Query  301   RQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVL  360
             R+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVL
Sbjct  301   RETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAIQIGYAGSTIAVL  359

Query  361   TVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSV  420
             TVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSV
Sbjct  360   TVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGLPLAVTLSLAYSV  419

Query  421   KKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIP  480
             KKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIP
Sbjct  420   KKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEKLCKVLPTLSDIP  479

Query  481   QHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQGLGVKYQSIREEI  540
             QHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQGLGVKYQSIR+EI
Sbjct  480   QHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQGLGVKYQSIRDEI  539

Query  541   TEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRD  600
             TEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRD
Sbjct  540   TEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIYGHEGTLEKFTRD  599

Query  601   MQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDDEENIMTNLTCLC  660
             MQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDDEENIMTNLTCLC
Sbjct  600   MQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDDEENIMTNLTCLC  659

Query  661   VVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKE  720
             VVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKE
Sbjct  660   VVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILRPNDDFLILEGKE  719

Query  721   FNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDG  780
             FNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDG
Sbjct  720   FNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVSENREVVAVTGDG  779

Query  781   TNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQF  840
             TNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQF
Sbjct  780   TNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGRNVYDSIAKFLQF  839

Query  841   QLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYG  900
             QLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYG
Sbjct  840   QLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEFPTPDLLLRKPYG  899

Query  901   RTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNAGPTQHFTIIFNT  960
             RTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNAGPTQHFTIIFNT
Sbjct  900   RTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNAGPTQHFTIIFNT  959

Query  961   FVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALSL  1020
             FVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKAL+L
Sbjct  960   FVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQYGKMAFSTKALTL  1019

Query  1021  DQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHLGEERFDSIDSDK  1080
             DQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+LGEERFDSIDSDK
Sbjct  1020  DQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNLGEERFDSIDSDK  1079

Query  1081  KPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNAFRQGLDARYGDH  1140
             KPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNAFRQGLDARYGDH
Sbjct  1080  KPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNAFRQGLDARYGDH  1139

Query  1141  TNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV  1195
             TNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV
Sbjct  1140  TNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV  1194


>Q9V4C7_DROME unnamed protein product
Length=1206

 Score = 2405 bits (6233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1207 (97%), Positives = 1183/1207 (98%), Gaps = 13/1207 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK------------GESDV  288
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK            GE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  289   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  348
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  349   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  408
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  409   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  468
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  469   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  528
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  529   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  588
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  589   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  648
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  649   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  708
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  709   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  768
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  769   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  828
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  829   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  888
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  889   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  948
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  949   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1008
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1009  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1068
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1069  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1128
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1139

Query  1129  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1188
             FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH
Sbjct  1140  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1199

Query  1189  SHTETAV  1195
             SHTETAV
Sbjct  1200  SHTETAV  1206


>E6EK18_DROME unnamed protein product
Length=1210

 Score = 2399 bits (6216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1171/1211 (97%), Positives = 1183/1211 (98%), Gaps = 17/1211 (1%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK------------GESDV  288
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKK            GE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  289   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  348
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  349   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  408
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  409   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  468
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  469   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  528
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  529   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  588
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  589   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  648
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  649   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  708
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  709   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  768
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  769   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  828
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  829   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  888
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  889   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  948
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  949   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1008
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1009  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1068
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1069  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----VIGGELQERLIPVPYSKSNTDQAIR  1124
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    VIGGELQERLIPVPYSKSNTDQAIR
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPVIGGELQERLIPVPYSKSNTDQAIR  1139

Query  1125  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1184
             VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER
Sbjct  1140  VVNAFRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVER  1199

Query  1185  LSSHSHTETAV  1195
             LSSHSHTETAV
Sbjct  1200  LSSHSHTETAV  1210



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062592.1 plasma membrane calcium-transporting ATPase 2 isoform
X7 [Drosophila eugracilis]

Length=1184
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DQ0_DROME  unnamed protein product                                 2390    0.0  
E6EK17_DROME  unnamed protein product                                 2383    0.0  
Q9V4C7_DROME  unnamed protein product                                 2379    0.0  


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2390 bits (6193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1159/1184 (98%), Positives = 1172/1184 (99%), Gaps = 1/1184 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFRQGLDARYGDHTNTSLAEVLRK  1140
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFRQGLDARYGDHTNTSLAEVLRK
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQIRVVNAFRQGLDARYGDHTNTSLAEVLRK  1139

Query  1141  QTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV  1184
             QTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV
Sbjct  1140  QTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV  1183


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2383 bits (6177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1159/1188 (98%), Positives = 1172/1188 (99%), Gaps = 5/1188 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ----IRVVNAFRQGLDARYGDHTNTSLAE  1136
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ    IRVVNAFRQGLDARYGDHTNTSLAE
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIRVVNAFRQGLDARYGDHTNTSLAE  1139

Query  1137  VLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV  1184
             VLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV
Sbjct  1140  VLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSHSHTETAV  1187


>Q9V4C7_DROME unnamed protein product
Length=1206

 Score = 2379 bits (6166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1159/1207 (96%), Positives = 1172/1207 (97%), Gaps = 24/1207 (2%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ-----------------------IRVVNA  1117
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ                       IRVVNA
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVIGGELQERLIPVPYSKSNTDQAIRVVNA  1139

Query  1118  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1177
             FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH
Sbjct  1140  FRQGLDARYGDHTNTSLAEVLRKQTSLSKRLSETSSIEYADNIPDELTIPEIDVERLSSH  1199

Query  1178  SHTETAV  1184
             SHTETAV
Sbjct  1200  SHTETAV  1206



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062593.1 plasma membrane calcium-transporting ATPase 3 isoform
X8 [Drosophila eugracilis]

Length=1130
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4C7_DROME  unnamed protein product                                 2246    0.0  
E6EK17_DROME  unnamed protein product                                 2246    0.0  
Q59DQ0_DROME  unnamed protein product                                 2245    0.0  


>Q9V4C7_DROME unnamed protein product
Length=1206

 Score = 2246 bits (5819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1086/1113 (98%), Positives = 1100/1113 (99%), Gaps = 1/1113 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQYV  1113
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ +
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQVI  1112


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2246 bits (5819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1086/1111 (98%), Positives = 1099/1111 (99%), Gaps = 1/1111 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ  1111
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ  1110


>Q59DQ0_DROME unnamed protein product
Length=1183

 Score = 2245 bits (5818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1086/1111 (98%), Positives = 1099/1111 (99%), Gaps = 1/1111 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ  1111
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ  1110



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


Query= XP_017062594.1 plasma membrane calcium-transporting ATPase 3 isoform
X9 [Drosophila eugracilis]

Length=1121
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q59DP8_DROME  unnamed protein product                                 2256    0.0  
E6EK17_DROME  unnamed protein product                                 2247    0.0  
E6EK18_DROME  unnamed protein product                                 2244    0.0  


>Q59DP8_DROME unnamed protein product
Length=1120

 Score = 2256 bits (5845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1095/1121 (98%), Positives = 1108/1121 (99%), Gaps = 1/1121 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQPAEPIRETEV  1121
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ AEPIRETEV
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQLAEPIRETEV  1120


>E6EK17_DROME unnamed protein product
Length=1187

 Score = 2247 bits (5823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1089/1117 (97%), Positives = 1103/1117 (99%), Gaps = 1/1117 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQPAEPIR  1117
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ + PIR
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPIR  1116


>E6EK18_DROME unnamed protein product
Length=1210

 Score = 2244 bits (5815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1087/1116 (97%), Positives = 1102/1116 (99%), Gaps = 1/1116 (0%)

Query  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKISEFGGIHELCKKLYTSPNEGLSGSKAD  60
             MATIDGRPAQYGISLKQLRELMEHRGREGVMKI+E GGIHELCKKLYTSPNEGLSGSKAD
Sbjct  1     MATIDGRPAQYGISLKQLRELMEHRGREGVMKIAENGGIHELCKKLYTSPNEGLSGSKAD  60

Query  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120
             EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL
Sbjct  61    EEHRRETFGSNVIPPKPPKTFLTLVWEALQDVTLIILEVAALVSLGLSFYKPADEDAPVL  120

Query  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180
             QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ
Sbjct  121   QEEEEHHGWIEGLAILISVIVVVIVTAFNDYSKERQFRGLQNRIEGEHKFSVIRGGEVCQ  180

Query  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGSDIDPMVLSGT  240
             ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKG D+DPMVLSGT
Sbjct  181   ISVGDILVGDIAQVKYGDLLPADGCLIQSNDLKVDESSLTGESDHVKKGPDVDPMVLSGT  240

Query  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKSLTGESDV  300
             HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQK+LTGE+D 
Sbjct  241   HVMEGSGKMVVTAVGVNSQAGIIFTLLGAAVDEQEAEIKKMKKEAKRANKQKNLTGENDG  300

Query  301   RPQIKGSQTPTQRQTVASEGTKSESEGNHVPQSSSTSAAAETGHKKEKSVLQAKLTKLAI  360
             R QIKGSQ P+QR+TV SE TKSESEGNH+PQSSS S AAETGHKKEKSVLQAKLTKLAI
Sbjct  301   RSQIKGSQAPSQRETVTSEITKSESEGNHLPQSSS-SGAAETGHKKEKSVLQAKLTKLAI  359

Query  361   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  420
             QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL
Sbjct  360   QIGYAGSTIAVLTVIILIIQFCIKTFVIDEKPWKNTYANNLVKHLIIGVTVLVVAVPEGL  419

Query  421   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  480
             PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK
Sbjct  420   PLAVTLSLAYSVKKMMKDNNLVRHLDACETMGNATAICSDKTGTLTTNRMTVVQSYICEK  479

Query  481   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGQNPGDLPIQVGNKTECALLGFVQG  540
             LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAG NPGDLPIQVGNKTECALLGFVQG
Sbjct  480   LCKVLPTLSDIPQHVGNLITMGISVNSAYTSNIMAGHNPGDLPIQVGNKTECALLGFVQG  539

Query  541   LGVKYQSIREEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  600
             LGVKYQSIR+EITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY
Sbjct  540   LGVKYQSIRDEITEDKFTRVYTFNSVRKSMGTVIPRPNGGYRLYTKGASEIIMKKCAFIY  599

Query  601   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDCEPNWDD  660
             GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHID EPNWDD
Sbjct  600   GHEGTLEKFTRDMQERLIREVIEPMACDGLRTISVAYRDFVPGKAAINEVHIDGEPNWDD  659

Query  661   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  720
             EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR
Sbjct  660   EENIMTNLTCLCVVGIEDPVRPEVPDAIRKCQRAGITVRMVTGDNINTARSIASKCGILR  719

Query  721   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  780
             PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS
Sbjct  720   PNDDFLILEGKEFNRRIRDSNGDIQQHLIDKVWPKLRVLARSSPTDKYTLVKGIIDSTVS  779

Query  781   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  840
             ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR
Sbjct  780   ENREVVAVTGDGTNDGPALKKADVGFAMGIAGTDVAKEASDIILTDDNFSSIVKAVMWGR  839

Query  841   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  900
             NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF
Sbjct  840   NVYDSIAKFLQFQLTVNVVAVIVAFIGACAVQDSPLKAVQMLWVNLIMDTLASLALATEF  899

Query  901   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLVIIFGLLFVGDLILDIESGRGQELNA  960
             PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQL+IIFGLLFVGD+ILDIESGRGQELNA
Sbjct  900   PTPDLLLRKPYGRTKPLISRTMMKNILGQALYQLIIIFGLLFVGDVILDIESGRGQELNA  959

Query  961   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1020
             GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY
Sbjct  960   GPTQHFTIIFNTFVMMTLFNEINARKIHGQRNVIEGLLTNPIFYTIWIFTMISQVLIIQY  1019

Query  1021  GKMAFSTKALSLDQWLWCIFFGVGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDAMHL  1080
             GKMAFSTKAL+LDQWLWCIFFG+GTLVWGQLITSVPTRKLPKILSWGRGHPEEYTD M+L
Sbjct  1020  GKMAFSTKALTLDQWLWCIFFGIGTLVWGQLITSVPTRKLPKILSWGRGHPEEYTDGMNL  1079

Query  1081  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQPAEPI  1116
             GEERFDSIDSDKKPRAGQILWIRGLTRLQTQ + P+
Sbjct  1080  GEERFDSIDSDKKPRAGQILWIRGLTRLQTQISVPV  1115



Lambda      K        H
   0.318    0.135    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 16340126362


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062595.1 zinc transporter ZIP9-B [Drosophila eugracilis]

Length=295
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ZPT71_CAEEL  unnamed protein product                                  52.4    2e-07
CSUP_DROME  unnamed protein product                                   36.6    0.022
A0A1I7U4N8_9PELO  unnamed protein product                             36.6    0.022


>ZPT71_CAEEL unnamed protein product
Length=393

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 99/248 (40%), Gaps = 46/248 (19%)

Query  36   LKCVTVLGAGLLVGTALTVIIPEGIQSLYMGSGQRKQLIPGQEH---QDYSQT--IGLSL  90
            LK +   GAG L+G AL  IIP  +                +EH    D+S    +G  +
Sbjct  115  LKILLAFGAGGLLGDALLHIIPHSLSPHDHSHDHHDHNHSHKEHDHSHDHSNQLRVGTFV  174

Query  91   VLGFVFMMLVD--------------------------ISQRKSNAGSQKKND--------  116
            + G +  M+V+                          +++       +KK          
Sbjct  175  IAGILVFMMVEQLVRIIKGGHCHSHENGHIVADEHRHLNEHDHEHSEEKKQQVEGLKDVK  234

Query  117  ATLTLGLV---VHAAADGVALGAAATTSHQDVEIIIFLAIMLHKAPAAFGLVTFLLHEKV  173
            A+  L LV   VH   DG+A+GA+ +     +  I  L ++LH+ P   G    L+    
Sbjct  235  ASAYLNLVADFVHNVTDGLAIGASFSAG-NTLGWITTLTVLLHELPHEVGDFAILVQSGF  293

Query  174  DRKKIRRHLCVFSLSAPLLTILTYFGIGQEQKETLNSVNATGIAMLFSAGTFLYVATVHV  233
             + +  R   V +L A    +   F +      +LN+   T   M F+AG F+Y+ATV V
Sbjct  294  SKYQAIRLQAVTALGAITGCV---FSLLVSNPGSLNNDADTSAIMPFTAGGFIYIATVSV  350

Query  234  LPELTKGG  241
            +PEL + G
Sbjct  351  VPELLESG  358


>CSUP_DROME unnamed protein product
Length=449

 Score = 36.6 bits (83),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 62/140 (44%), Gaps = 13/140 (9%)

Query  102  ISQRKSNAGSQKKNDATLTLGLVV---HAAADGVALGAAATTSHQDVEIIIFLAIMLHKA  158
            I  +K  A  + + + +  L L     H   DG+A+GA+    +  + I+  + I+LH+ 
Sbjct  288  IKSKKPEAEPEGEVEISGYLNLAADFAHNFTDGLAIGASYLAGNS-IGIVTTITILLHEV  346

Query  159  PAAFGLVTFLLHEKVDRKKIRRHLCVFSLSAPLLTILTYFGIGQEQKETLNSVNATGIAM  218
            P   G    L+     R+K        ++   L+T L                + +   +
Sbjct  347  PHEIGDFAILIKSGCSRRK--------AMLLQLVTALGALAGTALALLGAGGGDGSAPWV  398

Query  219  L-FSAGTFLYVATVHVLPEL  237
            L F+AG F+Y+ATV VLPEL
Sbjct  399  LPFTAGGFIYIATVSVLPEL  418


>A0A1I7U4N8_9PELO unnamed protein product
Length=445

 Score = 36.6 bits (83),  Expect = 0.022, Method: Compositional matrix adjust.
 Identities = 33/115 (29%), Positives = 56/115 (49%), Gaps = 10/115 (9%)

Query  126  HAAADGVALGA---AATTSHQDVEIIIFLAIMLHKAPAAFGLVTFLLHEKVDRKKIRRHL  182
            H   DG+A+GA   A TT    V ++  + +++H+ P   G    L+     +KK     
Sbjct  308  HNFTDGLAIGASFIAGTT----VGVVTMITVLVHEVPHEIGDFAILIQSGYSKKKAMLIQ  363

Query  183  CVFSLSAPLLTILTYFGIGQEQKETLNSVNATGIAMLFSAGTFLYVATVHVLPEL  237
             V +L A    +++   +     + L    A+   + F+AG F+Y+ATV V+PEL
Sbjct  364  LVTALGALSGCVIS---LLATDADALADAAASSWVLPFTAGGFIYIATVSVIPEL  415



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062597.1 RING finger protein 11 isoform X1 [Drosophila
eugracilis]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T089_DROME  unnamed protein product                                 57.0    4e-10
Q9VHI7_DROME  unnamed protein product                                 56.6    6e-10
Q9VI20_DROME  unnamed protein product                                 56.2    7e-10


>Q8T089_DROME unnamed protein product
Length=352

 Score = 57.0 bits (136),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query  76   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  132
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  30   MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  89

Query  133  PSCLEPV  139
            P C   V
Sbjct  90   PICKRKV  96


>Q9VHI7_DROME unnamed protein product
Length=380

 Score = 56.6 bits (135),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query  71   AKRIGLMQHLPIGTYDGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRSL  130
            A+RI  + ++ I   + + K   +C IC  +F +DE VR LPC H+YH NCI  WL    
Sbjct  231  AQRINEIPNVQINAEEVNRKI--QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHS  288

Query  131  TCPSC  135
            TCP C
Sbjct  289  TCPIC  293


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 56.2 bits (134),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 3/63 (5%)

Query  76   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  132
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  214  MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  273

Query  133  PSC  135
            P C
Sbjct  274  PIC  276



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062598.1 RING finger protein 11 isoform X1 [Drosophila
eugracilis]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T089_DROME  unnamed protein product                                 57.0    4e-10
Q9VHI7_DROME  unnamed protein product                                 56.6    6e-10
Q9VI20_DROME  unnamed protein product                                 56.2    7e-10


>Q8T089_DROME unnamed protein product
Length=352

 Score = 57.0 bits (136),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query  76   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  132
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  30   MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  89

Query  133  PSCLEPV  139
            P C   V
Sbjct  90   PICKRKV  96


>Q9VHI7_DROME unnamed protein product
Length=380

 Score = 56.6 bits (135),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query  71   AKRIGLMQHLPIGTYDGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRSL  130
            A+RI  + ++ I   + + K   +C IC  +F +DE VR LPC H+YH NCI  WL    
Sbjct  231  AQRINEIPNVQINAEEVNRKI--QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHS  288

Query  131  TCPSC  135
            TCP C
Sbjct  289  TCPIC  293


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 56.2 bits (134),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 3/63 (5%)

Query  76   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  132
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  214  MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  273

Query  133  PSC  135
            P C
Sbjct  274  PIC  276



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062599.1 RING finger protein 11 isoform X1 [Drosophila
eugracilis]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T089_DROME  unnamed protein product                                 57.0    4e-10
Q9VHI7_DROME  unnamed protein product                                 56.6    6e-10
Q9VI20_DROME  unnamed protein product                                 56.2    7e-10


>Q8T089_DROME unnamed protein product
Length=352

 Score = 57.0 bits (136),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query  76   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  132
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  30   MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  89

Query  133  PSCLEPV  139
            P C   V
Sbjct  90   PICKRKV  96


>Q9VHI7_DROME unnamed protein product
Length=380

 Score = 56.6 bits (135),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query  71   AKRIGLMQHLPIGTYDGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRSL  130
            A+RI  + ++ I   + + K   +C IC  +F +DE VR LPC H+YH NCI  WL    
Sbjct  231  AQRINEIPNVQINAEEVNRKI--QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHS  288

Query  131  TCPSC  135
            TCP C
Sbjct  289  TCPIC  293


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 56.2 bits (134),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 3/63 (5%)

Query  76   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  132
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  214  MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  273

Query  133  PSC  135
            P C
Sbjct  274  PIC  276



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062600.1 RING finger protein 11 isoform X2 [Drosophila
eugracilis]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T089_DROME  unnamed protein product                                 56.6    4e-10
Q9VHI7_DROME  unnamed protein product                                 56.6    5e-10
Q9VI20_DROME  unnamed protein product                                 56.2    7e-10


>Q8T089_DROME unnamed protein product
Length=352

 Score = 56.6 bits (135),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query  75   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  131
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  30   MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  89

Query  132  PSCLEPV  138
            P C   V
Sbjct  90   PICKRKV  96


>Q9VHI7_DROME unnamed protein product
Length=380

 Score = 56.6 bits (135),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query  70   AKRIGLMQHLPIGTYDGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRSL  129
            A+RI  + ++ I   + + K   +C IC  +F +DE VR LPC H+YH NCI  WL    
Sbjct  231  AQRINEIPNVQINAEEVNRKI--QCSICWDDFKIDETVRKLPCSHLYHENCIVPWLNLHS  288

Query  130  TCPSC  134
            TCP C
Sbjct  289  TCPIC  293


>Q9VI20_DROME unnamed protein product
Length=536

 Score = 56.2 bits (134),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/63 (40%), Positives = 38/63 (60%), Gaps = 3/63 (5%)

Query  75   LMQHLPIGTY--DGSSKKARECVICMAEFCVDEAVRYLPCMHIYHVNCIDDWLLRS-LTC  131
            +++ LP+  Y  + ++ K   CVIC+ +F  D+ +R LPC H YH +CID WL  +   C
Sbjct  214  MLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC  273

Query  132  PSC  134
            P C
Sbjct  274  PIC  276



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062601.1 protein BCL9 homolog [Drosophila eugracilis]

Length=1499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BCL9_DROME  unnamed protein product                                   1926    0.0  
D6W4T8_DROME  unnamed protein product                                 36.2    0.26 
A8JV09_DROME  unnamed protein product                                 36.2    0.26 


>BCL9_DROME unnamed protein product
Length=1469

 Score = 1926 bits (4989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1074/1520 (71%), Positives = 1226/1520 (81%), Gaps = 72/1520 (5%)

Query  1     MLSTTTSRSPAQAQSRPNADAP-TSASETNSGKGIGNGVVGTSRNSPKTLKSEAFPSLSP  59
             MLSTT  RSP Q Q +PN+DA  TSAS +N G  IGNG    SR+SPKTL SE F +LSP
Sbjct  1     MLSTTMPRSPTQQQPQPNSDASSTSASGSNPGAAIGNGDSAASRSSPKTLNSEPFSTLSP  60

Query  60    DQMKAMPEEGADQKVLSHSDKAVGTPTSGNGGGGNIMADAQASQSSLGTIVGTPMLRQNS  119
             DQ+K  PEEG ++  LS SDKA    T G  G GN + + Q             MLRQNS
Sbjct  61    DQIKLTPEEGTEKSGLSTSDKAA---TGGAPGSGNNLPEGQT------------MLRQNS  105

Query  120   SSSINSCLVPSPNNTSEHSNSSSG-------QVIDCDDHAKKKKSNVKDDDVVSTGKSSS  172
             +S+INSCLV SP N+SEHSNSS+        Q++DCD+ +KK K +VKD++      SS+
Sbjct  106   TSTINSCLVASPQNSSEHSNSSNVSATVGLTQMVDCDEQSKKNKCSVKDEEAE---ISSN  162

Query  173   KSKGLTTGTGSGTGPTSGLPLSIAIKEEPADVLTSLANIKKEESEIHSPNMSPVGFGSIG  232
             K+KG   G G  TG TS    S+ +KEEP DVL SL N+KKEE E HSP MSPVGFGSIG
Sbjct  163   KAKGQAAGGGCETGSTS----SLTVKEEPTDVLGSLVNMKKEERENHSPTMSPVGFGSIG  218

Query  233   NAQDSSATPVKIERNTTDSITEKK-PALVLNNDEMGMEGVSCNLLNPDIISESLNDPPIS  291
             NAQD+SATPVKIER + DS TEKK  +L +NNDEM MEG  CN LNPD I+ESLN+P IS
Sbjct  219   NAQDNSATPVKIERISNDSTTEKKGSSLTMNNDEMSMEG--CNQLNPDFINESLNNPAIS  276

Query  292   SILAIGLNATHVSGVGPGPG--VGAGVGNLLTGNGNGTSSGASNCLDYMQQQNHIFVFST  349
             SIL        VSGVGP PG  VGAG GNLLT N NG SSG+SNCLDYMQQQNHIFVFST
Sbjct  277   SIL--------VSGVGPIPGIGVGAGTGNLLTANANGISSGSSNCLDYMQQQNHIFVFST  328

Query  350   QLANKGAESVLSGQFQTIIAYHCTQPATKNFLEDFFMKNPLKMNKLQRHNALGMPWLGTG  409
             QLANKGAESVLSGQFQTIIAYHCTQPATK+FLEDFFMKNPLK+NKLQRHN++GMPW+G G
Sbjct  329   QLANKGAESVLSGQFQTIIAYHCTQPATKSFLEDFFMKNPLKINKLQRHNSVGMPWIGMG  388

Query  410   PGGSNVSSPLSKITHQQTHSKPIGLLKNQFSQNENSKRSTVN--SSSFIDQSDPLVNENE  467
               G    +P++KIT QQ H+K +GLLK QF+Q+ENSKRSTV+  S+SF+DQSDP+ NE E
Sbjct  389   QVGLTPPNPVAKITQQQPHTKTVGLLKPQFNQHENSKRSTVSAPSNSFVDQSDPMGNETE  448

Query  468   LMCWESGPGSSGASVTAQSSQS-IDGISSSNESQAIKILEAAGVDLGQVTKESDSGLVHE  526
             LMCWE G  SS  S + Q+S++ +D IS+S+ESQAIKILEAAGVDLGQVTK SD GL  E
Sbjct  449   LMCWEGG--SSNTSRSGQNSRNHVDSISTSSESQAIKILEAAGVDLGQVTKGSDPGLTTE  506

Query  527   NNIVSLQGVKVPDENLTPQQRQHREEQLAKIKKMNQFLFPENESSVGPSVSSQLSKIPGE  586
             NNIVSLQGVKVPDENLTPQQRQHREEQLAKIKKMNQFLFPENE+SVG +VSSQ++KIPG+
Sbjct  507   NNIVSLQGVKVPDENLTPQQRQHREEQLAKIKKMNQFLFPENENSVGANVSSQITKIPGD  566

Query  587   LMMGTQSGGGT-VVNSQMLQMHLPGSGKSELLAATTSGLAEEGVLPGDVISDMGAVMACN  645
             LMMG   GGG  ++N  M Q+H+PG+ KSELL+AT+SGL+E+ + PGDVISDMGAV+ CN
Sbjct  567   LMMGMSGGGGGSIINPTMRQLHMPGNAKSELLSATSSGLSEDVMHPGDVISDMGAVIGCN  626

Query  646   S-QKGNLQCGSGVGAGPVPGTNAGSINANMHCSSSGPPNGSMMGSSTDILSSFGTTSCNI  704
             + QK ++QCGSGVG   V GT A  +N NMHCSSSG PNG+MMGSSTD+L+SFG TSCN 
Sbjct  627   NNQKTSVQCGSGVGV--VTGTTAAGVNVNMHCSSSGAPNGNMMGSSTDMLASFGNTSCN-  683

Query  705   NVIGSVPDMSKELSNQDTLSHSHQGGVAQMEWSKIQQQFFEERLKAGKTRQSVGSVVPLQ  764
              VIG+ PDMSKE+ NQD+ +HSHQGGVAQMEWSKIQ QFFEERLK GK RQ  G+VVP Q
Sbjct  684   -VIGTAPDMSKEVLNQDSRTHSHQGGVAQMEWSKIQHQFFEERLKGGKPRQVTGTVVPQQ  742

Query  765   QTSSGNGGVSASSQVRSLQGPPPPYHSTQRSASVPIATQSPNPSSPNNLSLPSPRTTGAS  824
             QT SG+GG S ++QVR LQGPPPPYHS QRSASVPIATQSPNPSSPNNLSLPSPRTT A 
Sbjct  743   QTPSGSGGNSLNNQVRPLQGPPPPYHSIQRSASVPIATQSPNPSSPNNLSLPSPRTTAAV  802

Query  825   LGLPTHSPSMDSTTSLSGSAPPAITTASLSGTTGVLSANKNCFQSETPSPSNQNRNRNSG  884
             +GLPT+SPSMD T SLSGS P A T+   +GTT VLSANKNCFQ++TPSPSNQNR+RN+G
Sbjct  803   MGLPTNSPSMDGTGSLSGSVPQANTSTVQAGTTTVLSANKNCFQADTPSPSNQNRSRNTG  862

Query  885   SSGVLTHNLNSNPSTPLSHLSPKDLEPFVQSSAGDNIKSRRPSPQGQQSPGSGFLEANVE  944
             SS VLTHNL+SNPSTPLSHLSPK+ E F QSSAGDN+KSRRPSPQGQ+SP +  +EAN +
Sbjct  863   SSSVLTHNLSSNPSTPLSHLSPKEFESFGQSSAGDNMKSRRPSPQGQRSPVNSLIEANKD  922

Query  945   ARFSASSPGVIFNAHQHMQSNTNSGLSSYKVGTSNIQMERQVPTQGGSVQFNRRCDNIPL  1004
              RF+ASSPG  FN H HMQSN+NS L++YK+G++NIQMERQ   QGGSVQF+RR DNIPL
Sbjct  923   VRFAASSPG--FNPHPHMQSNSNSALNAYKMGSTNIQMERQASAQGGSVQFSRRSDNIPL  980

Query  1005  NPNSGNRPPPNKMTQNFDPISSLAQMSQQLTSCVSSLGSPAGTGGMTMMGGPGSADINID  1064
             NPNSGNRPPPNKMTQNFDPISSLAQMSQQLTSCVSS+GSPAGTGGMTMMGGPG +DINI+
Sbjct  981   NPNSGNRPPPNKMTQNFDPISSLAQMSQQLTSCVSSMGSPAGTGGMTMMGGPGPSDINIE  1040

Query  1065  HGMISGLEGHGMDAINQNNCHPMNVVMNSMGQKIINSKMCAPGSLNGPPGFNSNSPN-VL  1123
             HG+ISGL+G G+D INQNNCH MNVVMNSMG +++N KMC  G  NGPPGFN NSPN  L
Sbjct  1041  HGIISGLDGSGIDTINQNNCHSMNVVMNSMGPRMLNPKMCVAGGPNGPPGFNPNSPNGGL  1100

Query  1124  RETPLGSGPVSGPGSANASNFQGIVQPGPRMMSRMPVNFGSNFNPNIQVKASTPNTIQYM  1183
             RE  +G    SG GSAN+SNFQG+V PG RMM RMPVNFGSNFNPNIQVKASTPNTIQYM
Sbjct  1101  RENSIG----SGCGSANSSNFQGVVPPGARMMGRMPVNFGSNFNPNIQVKASTPNTIQYM  1156

Query  1184  PVRPQNANNNNNNGGGNVRMPPSLEFLQRYANPQMAPVGNGSSICAPTVGEGGQGM---M  1240
             PVR QNANNNNNNG  NVRMPPSLEFLQRYANPQM  VGNGS IC P+  +G  GM   M
Sbjct  1157  PVRAQNANNNNNNGANNVRMPPSLEFLQRYANPQMGAVGNGSPICPPSASDGTPGMPGLM  1216

Query  1241  VGSGSGAILINSPGEQHQNKISNNPVTGNGINFFQNCNQIAIMDEEGGL-SHDVPINIGQ  1299
              G G+G +L+NS GEQHQNKI+NNP   NGINFFQNCNQ++I+DEEGGL  HD  +NIGQ
Sbjct  1217  AGPGAGGMLMNSSGEQHQNKITNNPGASNGINFFQNCNQMSIVDEEGGLPGHDGSMNIGQ  1276

Query  1300  PSLIRGMRPHAMRPHAMGPRMQASTNRQIQFAHASDGLDCVGDPTAFFNNANCNSGAPPM  1359
             PS+IRGMRPHAMRP+ MG RM    NRQIQFA +SDG+DCVGDP++FF NA+CNS  P M
Sbjct  1277  PSMIRGMRPHAMRPNVMGARM-PPVNRQIQFAQSSDGIDCVGDPSSFFTNASCNSAGPHM  1335

Query  1360  FVSSQQSNQAKPQQLKNMPSGMCQSQTVLGVIPAVAQGHLHLQSQGQGQSQSQPLIGPSN  1419
             F S+QQ+NQ K Q +KN+PSGMCQ+Q+ L    AVAQG + L   GQG +Q Q LIGP+N
Sbjct  1336  FGSAQQANQPKTQHIKNIPSGMCQNQSGL----AVAQGQIQL--HGQGHAQGQSLIGPTN  1389

Query  1420  NSLVSAAGNVGHSNGVSAINFVGPSSNDLKYAQQYHSFQQQLYATNTRSQQQQQMHQQHQ  1479
             N+L+S AG+V  +NGVS INFVGPSS DLKYAQQYHSFQQQLYATNTRSQQQQ MHQQHQ
Sbjct  1390  NNLMSTAGSVSATNGVSGINFVGPSSTDLKYAQQYHSFQQQLYATNTRSQQQQHMHQQHQ  1449

Query  1480  GNMITMPPNLSPNPAFFVNK  1499
              NMITMPPNLSPNP FFVNK
Sbjct  1450  SNMITMPPNLSPNPTFFVNK  1469


>D6W4T8_DROME unnamed protein product
Length=1266

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  785  PPPPYHSTQRSASVPIATQSPNPSSPNNLSLPSPRTTGASLGLPTHSPSMDSTTS  839
            PP P   T RS S+P A+ S   SS  N   P PRTT AS   P   P   S+T+
Sbjct  541  PPKPMPRTSRSNSLPEASDSAGESSSTNTPRPRPRTTAASAYKPRLGPKPFSSTT  595


>A8JV09_DROME unnamed protein product
Length=1255

 Score = 36.2 bits (82),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 28/55 (51%), Gaps = 0/55 (0%)

Query  785  PPPPYHSTQRSASVPIATQSPNPSSPNNLSLPSPRTTGASLGLPTHSPSMDSTTS  839
            PP P   T RS S+P A+ S   SS  N   P PRTT AS   P   P   S+T+
Sbjct  541  PPKPMPRTSRSNSLPEASDSAGESSSTNTPRPRPRTTAASAYKPRLGPKPFSSTT  595



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062603.1 host cell factor isoform X1 [Drosophila eugracilis]

Length=1496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HCF_DROME  unnamed protein product                                    2158    0.0   
G5EC23_CAEEL  unnamed protein product                                 407     4e-124
Q54CD2_DICDI  unnamed protein product                                 105     9e-23 


>HCF_DROME unnamed protein product
Length=1500

 Score = 2158 bits (5592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1122/1521 (74%), Positives = 1249/1521 (82%), Gaps = 46/1521 (3%)

Query  1     MECSGLGGTSISSGGRLSASDDLNINRIHQTGDHSCDNQISMDVEENIECPVTNNLSGFR  60
             ME S     + SSG R+SASD LN   I Q  +HS  N+ISMD++      + +NL+GFR
Sbjct  1     MEGSDFVDPAFSSGERISASD-LNSEHIIQAENHSFANRISMDMDVPDGHQLDSNLTGFR  59

Query  61    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  120
             WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV
Sbjct  60    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  119

Query  121   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPRL  180
             PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSG SPCPRL
Sbjct  120   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRL  179

Query  181   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGESP  240
             GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG+SP
Sbjct  180   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSP  239

Query  241   PPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSKPRMLGEAPLPRSL  300
             PPRESHTGISFA+  +GNLNLLIYGGMSGCRLGDLWLL+TDSMTWSKP+  GEAPLPRSL
Sbjct  240   PPRESHTGISFATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSL  299

Query  301   HSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWNNVTLDTVEENV  360
             HSSTMI NKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETM+W NVTLDTVEENV
Sbjct  300   HSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENV  359

Query  361   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLYAVKVALVRAS  420
             PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ  VCCKDLWYLEVSKPLYAVKVALVRAS
Sbjct  360   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ--VCCKDLWYLEVSKPLYAVKVALVRAS  417

Query  421   THALELSWSATTFAAAYVLQIQKIEQPPNTISKPVSQNIVQQGTTTPAESSGTNVAENCS  480
             THALELSW+ATTFAAAYVLQIQKIEQP NT SK +S NIVQQGT T AE+SG N++ N S
Sbjct  418   THALELSWTATTFAAAYVLQIQKIEQPLNTSSKLLSNNIVQQGTPTSAETSGINISANRS  477

Query  481   ESALTPGIVATSAVLNLEKNAIQTDG---------SGNVLLQTFSPPSSPTTRVKKKFIS  531
              SAL  G+ ATS VL LEK ++Q  G         S N LLQ+ S PSSP +R  K  +S
Sbjct  478   GSALGLGVEATSTVLKLEKESLQLSGCQPETNVQPSVNDLLQSMSQPSSPASRADKDPLS  537

Query  532   SIG---TNFTTSAASAQPQISVISSTAKV-ASTTASSSSTVSSLLQKFRPTVTAVRSPTT  587
             S G    N +TS AS  PQISVISSTA V  + TAS S  ++S+LQKFRP VTAVR+ TT
Sbjct  538   SGGGTTFNLSTSVASVHPQISVISSTAAVTGNDTASPSGAINSILQKFRPVVTAVRTSTT  597

Query  588   NTVTGVTSVADPLALRVPTAMATNVVLNSAASSTGLRIVPSVTASQTLRLAPAQPGVISS  647
               V+  TS +DPL++RVP+ M+ NVVL+S++S+  LRIVPSVTAS +LR+A +Q    + 
Sbjct  598   TAVSIATSTSDPLSVRVPSTMSANVVLSSSSST--LRIVPSVTASHSLRIASSQASGNNC  655

Query  648   GSSAAVNILKAAPSTAVLQSQTSASGTKSIGGKQYFIQKPLTLAPNVQLQFVKTSSGGMT  707
              SS+A+NILK A     +QSQ ++S T SIGGKQYFIQKPLTLAPNVQLQFVKT SGGMT
Sbjct  656   RSSSAINILKTALPNVAVQSQPTSSTTTSIGGKQYFIQKPLTLAPNVQLQFVKT-SGGMT  714

Query  708   VQTLPKVNLNVPKGSSPHGIPIASQQLVSGSNQNQGSVIPGNQLQKPIVSGNVLKLVSPH  767
             VQTLPKVN    KG+ PHGI IA+  L SG  Q QGS +PG+Q+QKPIVSGNVLKLVSPH
Sbjct  715   VQTLPKVNFTASKGTPPHGISIANPHLASGITQIQGSTVPGSQIQKPIVSGNVLKLVSPH  774

Query  768   TVASGKLIMKNSNILQMGKVTPNVIGGKPAFVITNKQGAQLGNQQIIIVTTGSGVRTVPS  827
             T+A GKLIMKNSNILQMGKVTPNV+GGKPAFVITNKQG  LGNQQIIIVTTG  VR+VP+
Sbjct  775   TMAGGKLIMKNSNILQMGKVTPNVMGGKPAFVITNKQGTPLGNQQIIIVTTGGNVRSVPT  834

Query  828   TTVMTSAGGTTSGTNIVSIVSSTSTTSSPLQTISGQRTLISNQSGVKMLRNTSSVQTSTP  887
             +TVMTSAGG+ SGTNIVSIV+STSTT SPLQ +SGQ+TLISNQSGVKMLRN SSVQ S+ 
Sbjct  835   STVMTSAGGSASGTNIVSIVNSTSTTPSPLQALSGQKTLISNQSGVKMLRNISSVQASSS  894

Query  888   VAIGQKPSGTHIHQKTALYIGGKAVTVMSANTSMPTSGNISNKVMLLPGASSTNSVVSTT  947
             +A GQK SGT IHQKTALYIGGKAVTVMS NTSM  SG   NKVM+LPG SS NS  +TT
Sbjct  895   MAFGQKQSGTPIHQKTALYIGGKAVTVMSTNTSMAASG---NKVMVLPGTSSNNSPATTT  951

Query  948   NLNARKSFVFNTGGSPRAVTLATKSVSAKIISPTQSMKETMPESIIPVVSMKDTESIDDI  1007
              L+ARKSFVFN GGSPR VTLATKS++AK I  +Q + ET   S   V ++KDT+ +DDI
Sbjct  952   ALSARKSFVFNAGGSPRTVTLATKSINAKSIPQSQPVTETNNHS---VATIKDTDPMDDI  1008

Query  1008  IEQLDGAGDLLKLATSAVQHRDEEEINDDNATSSSLPPPILTGLDITAPSRALNAIVEGH  1067
             IEQLDGAGDLLKL+ S  QH  EE  N+    +SS    + TG D   PSRA N IV  H
Sbjct  1009  IEQLDGAGDLLKLSESEGQHGSEENENNGENATSSSASALFTGGDTAGPSRAQNPIVMEH  1068

Query  1068  HVDILEDVSGVSSTTGARETI-----------MERVENDNMESMVKSKPASDNCQQPTTL  1116
              VDI+EDVSGVSSTT   ET            M   END+++SM +    SD+C QPTT 
Sbjct  1069  PVDIIEDVSGVSSTTDVNETAIVSGDTIESLKMSEKENDDVKSMGEKSILSDDCHQPTTS  1128

Query  1117  ETEAAAILTTIKSAEVLVLGSTELSKDPGVFSVES-SDDQNEDPKIKQGHETPLFTTSQN  1175
             ETEAA ILTTIKSAE LVL + E+ KD    ++ S  ++Q+E+ K KQ  E+   + SQN
Sbjct  1129  ETEAATILTTIKSAEALVLETAEIRKDHTGCTIGSLKENQDENKKFKQRQES---SPSQN  1185

Query  1176  PQQYQNVDGSHLDALASAAVLQAATADATPLATAGLAMKELIERPESEIQIRSNNVGDNQ  1235
               Q+QNVDGS L+ALASAA+LQAAT+D     T  LA+KELIERPESE   RS+N+ + Q
Sbjct  1186  IHQFQNVDGSQLEALASAALLQAATSD-----TTALALKELIERPESETNTRSSNIAEIQ  1240

Query  1236  QTNIQSTSASVVFPNKSQVENQKWHTVGVFKDLSHTVTTYIDSNFISDALLNNIDVDNLP  1295
             Q N+QST A VV PN SQ ENQKWHTVGVFKDLSHTVT+YIDSN ISD+  + IDVDNLP
Sbjct  1241  QNNVQSTLA-VVVPNTSQNENQKWHTVGVFKDLSHTVTSYIDSNCISDSFFDGIDVDNLP  1299

Query  1296  DLSKFPRTNLDPGTAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG  1355
             D SKFPRTNL+PGTAYRFRLSAIN+CGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG
Sbjct  1300  DFSKFPRTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG  1359

Query  1356  AHLTWEPPPAQKTKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLS  1415
             AHLTWEPPPAQKTKEIIEYSVYLAVKP AKD+AL+TPQLAFVRVYVG+ANQCTVPNASLS
Sbjct  1360  AHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLS  1419

Query  1416  NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPSSTKLQMPSSSTNLKRIQERSTIG  1475
             NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDP++ K   P+ + NLKR  E+STIG
Sbjct  1420  NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPAAAKQHTPTVTPNLKRGPEKSTIG  1479

Query  1476  TNSVSNSFCSPHKRGRNGLHE  1496
             +++++N+FCSPHKRGRNGLH+
Sbjct  1480  SSNIANTFCSPHKRGRNGLHD  1500


>G5EC23_CAEEL unnamed protein product
Length=782

 Score = 407 bits (1045),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 263/391 (67%), Gaps = 16/391 (4%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGD  119
            RW+ V   TGP P+PRHGHRA+ +KEL+V+FGGGNEG++DELH YNT   +W  P   GD
Sbjct  29   RWRIVQQSTGPNPKPRHGHRAVVLKELIVIFGGGNEGMIDELHAYNTQKREWTAPQCCGD  88

Query  120  VPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPR  179
            VP   AA+G +  G +++ FGGM EYGKY+N+LYELQ+T+WEWR++ P    +G  PCPR
Sbjct  89   VPTPAAAFGAISLGNKIYRFGGMTEYGKYTNDLYELQSTRWEWRRLNPRVHSNGHLPCPR  148

Query  180  LGHSF--TMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG  237
            +GHSF  +   +K ++FGGL+N+ +DPK N+P YL+DLY+++  G    +  W      G
Sbjct  149  IGHSFVVSQKSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINLSG--PQHLIWEKLNATG  206

Query  238  ESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSK-----PRMLG  292
              P  RESHT + +   K     +++YGGM+G RLGDLW L+ +++ W++     PR  G
Sbjct  207  PGPISRESHTAVIYE--KDSISRMVVYGGMNGVRLGDLWYLNLNTLHWTEIKFDDPRT-G  263

Query  293  EAPLPRSLHSSTMIANKMYVFGGWVPLVINDS-KSTTEREWKCTNTLAVLDLETMSWNNV  351
              P+PRSLHSS +I +KM+V+GGWVPL+ + S +  TE+EWKCT++L   ++    W  +
Sbjct  264  IPPMPRSLHSSVLIGDKMFVYGGWVPLLEHASTEQQTEKEWKCTSSLGCWNITEDRWVPL  323

Query  352  TLDTVEEN-VPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLY  410
             L   +E+ +PR RAGHCA  +  R+Y+WSGRDGYRKAW+NQ  VCC+D+W L+   P  
Sbjct  324  HLYCSDEDTIPRGRAGHCAAAVGDRMYIWSGRDGYRKAWSNQ--VCCRDMWLLDTILPEQ  381

Query  411  AVKVALVRASTHALELSWSATTFAAAYVLQI  441
              KV L RA  ++LE+SW     A+ Y LQI
Sbjct  382  PGKVQLGRAGFNSLEISWPIVQGASGYFLQI  412


 Score = 176 bits (446),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 124/203 (61%), Gaps = 17/203 (8%)

Query  1259  WHTVGVFKDLSHTVTTYID----------SNFISDALLNNIDVDNLPDLSKFPRTNLDPG  1308
             W  VG+    +  VT Y +          ++ I       ++        K P  N   G
Sbjct  553   WFDVGIIDKATINVTHYFNDRQQSLEKQLNDLIDHNAFKCVNDSVFTTEDKIPLIN---G  609

Query  1309  TAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQK-  1367
              +YRFR+SAIN  G+G W E +S KTC+PG+P APS+I+I+K   EGA LTWEPP     
Sbjct  610   QSYRFRVSAINGLGKGAWSETASCKTCVPGYPSAPSSIRITKS-HEGAQLTWEPPSNTNI  668

Query  1368  TKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLSNAHVDCSNKPAI  1427
             + +IIEYSVYLAVK  + + A +  QLAF+RVY G    C V  ++L  A VD +NKPAI
Sbjct  669   SGKIIEYSVYLAVKNQSANSADS--QLAFMRVYCGPQADCQVLQSNLGTAFVDQTNKPAI  726

Query  1428  IFRIAARNQKGYGPATQVRWLQD  1450
             IFRIAARN+KGYGPATQVRWLQD
Sbjct  727   IFRIAARNEKGYGPATQVRWLQD  749


>Q54CD2_DICDI unnamed protein product
Length=716

 Score = 105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 143/346 (41%), Gaps = 49/346 (14%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGG-----NEGIV----DELHVYNTVTNQ  110
             W ++  P G QP  R GH +  +K  M VFGGG     N   +    + LHVY+  +N 
Sbjct  2    EWIKI-QPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALEPNNLHVYDFTSNT  60

Query  111  WYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESP  170
            W +    G  P+    +     G ++F+ GG   YG  +N  Y+  +        +    
Sbjct  61   WSIQSTMGTPPSIRYGHTATEVGDKIFIIGG---YG--TNMFYDDVSIFDTVTNTWSTPI  115

Query  171  DSGSSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKW  230
              G  P  R  H+ T+VG  IF+F G             K  N+LY LDT        +W
Sbjct  116  CGGQRPSARYAHTATLVGTNIFVFAGCYEN---------KCFNELYCLDTIQY-----QW  161

Query  231  IVPKTYGESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRL-GDLWLLDTDSMTWSKPR  289
             +  T G  P  R  HT      T      L ++GG  G     DL++ + DS  W++  
Sbjct  162  SLVVTSGSPPQQRSYHT------TNLIGRKLYVFGGHLGNSYHNDLYVFNLDSKVWTQGI  215

Query  290  MLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWN  349
             LG+     + HSS +I N++++FGG      ND +        C +TL  L++E M W 
Sbjct  216  TLGKFETGIAYHSSAIINNQLFIFGG------NDGRV-------CYDTLWKLNIENMEWE  262

Query  350  NVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRV  395
             +         P       +V     L ++ G + Y   +++  ++
Sbjct  263  KLAFKDSSHKPPSRHKHTLSVSHDLSLILYGGMEFYPNCYDDFYKL  308


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 66/142 (46%), Gaps = 8/142 (6%)

Query  59   FRWKRVLNPTGPQPRPRHGHRAINIKELMVVFGG--GNEGIVDELHVYNTVTNQWYVPVL  116
            ++W  V+  +G  P+ R  H    I   + VFGG  GN    ++L+V+N  +  W   + 
Sbjct  159  YQWSLVVT-SGSPPQQRSYHTTNLIGRKLYVFGGHLGNS-YHNDLYVFNLDSKVWTQGIT  216

Query  117  KGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSP  176
             G    G A +   +   ++F+FGG      Y + L++L     EW K+     DS   P
Sbjct  217  LGKFETGIAYHSSAIINNQLFIFGGNDGRVCY-DTLWKLNIENMEWEKL--AFKDSSHKP  273

Query  177  CPRLGHSFTMVGE-KIFLFGGL  197
              R  H+ ++  +  + L+GG+
Sbjct  274  PSRHKHTLSVSHDLSLILYGGM  295


 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query  283  MTWSKPRMLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLD  342
            M W K +  G  P  R  H+ST++ NKMYVFGG      N +    E      N L V D
Sbjct  1    MEWIKIQPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALE-----PNNLHVYD  55

Query  343  LETMSWNNVTLDTVEENVPRARAGHCAVGIQSRLYVWSG  381
              + +W   ++ +     P  R GH A  +  ++++  G
Sbjct  56   FTSNTW---SIQSTMGTPPSIRYGHTATEVGDKIFIIGG  91



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062604.1 host cell factor isoform X1 [Drosophila eugracilis]

Length=1496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HCF_DROME  unnamed protein product                                    2158    0.0   
G5EC23_CAEEL  unnamed protein product                                 407     4e-124
Q54CD2_DICDI  unnamed protein product                                 105     9e-23 


>HCF_DROME unnamed protein product
Length=1500

 Score = 2158 bits (5592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1122/1521 (74%), Positives = 1249/1521 (82%), Gaps = 46/1521 (3%)

Query  1     MECSGLGGTSISSGGRLSASDDLNINRIHQTGDHSCDNQISMDVEENIECPVTNNLSGFR  60
             ME S     + SSG R+SASD LN   I Q  +HS  N+ISMD++      + +NL+GFR
Sbjct  1     MEGSDFVDPAFSSGERISASD-LNSEHIIQAENHSFANRISMDMDVPDGHQLDSNLTGFR  59

Query  61    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  120
             WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV
Sbjct  60    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  119

Query  121   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPRL  180
             PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSG SPCPRL
Sbjct  120   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRL  179

Query  181   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGESP  240
             GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG+SP
Sbjct  180   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSP  239

Query  241   PPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSKPRMLGEAPLPRSL  300
             PPRESHTGISFA+  +GNLNLLIYGGMSGCRLGDLWLL+TDSMTWSKP+  GEAPLPRSL
Sbjct  240   PPRESHTGISFATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSL  299

Query  301   HSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWNNVTLDTVEENV  360
             HSSTMI NKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETM+W NVTLDTVEENV
Sbjct  300   HSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENV  359

Query  361   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLYAVKVALVRAS  420
             PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ  VCCKDLWYLEVSKPLYAVKVALVRAS
Sbjct  360   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ--VCCKDLWYLEVSKPLYAVKVALVRAS  417

Query  421   THALELSWSATTFAAAYVLQIQKIEQPPNTISKPVSQNIVQQGTTTPAESSGTNVAENCS  480
             THALELSW+ATTFAAAYVLQIQKIEQP NT SK +S NIVQQGT T AE+SG N++ N S
Sbjct  418   THALELSWTATTFAAAYVLQIQKIEQPLNTSSKLLSNNIVQQGTPTSAETSGINISANRS  477

Query  481   ESALTPGIVATSAVLNLEKNAIQTDG---------SGNVLLQTFSPPSSPTTRVKKKFIS  531
              SAL  G+ ATS VL LEK ++Q  G         S N LLQ+ S PSSP +R  K  +S
Sbjct  478   GSALGLGVEATSTVLKLEKESLQLSGCQPETNVQPSVNDLLQSMSQPSSPASRADKDPLS  537

Query  532   SIG---TNFTTSAASAQPQISVISSTAKV-ASTTASSSSTVSSLLQKFRPTVTAVRSPTT  587
             S G    N +TS AS  PQISVISSTA V  + TAS S  ++S+LQKFRP VTAVR+ TT
Sbjct  538   SGGGTTFNLSTSVASVHPQISVISSTAAVTGNDTASPSGAINSILQKFRPVVTAVRTSTT  597

Query  588   NTVTGVTSVADPLALRVPTAMATNVVLNSAASSTGLRIVPSVTASQTLRLAPAQPGVISS  647
               V+  TS +DPL++RVP+ M+ NVVL+S++S+  LRIVPSVTAS +LR+A +Q    + 
Sbjct  598   TAVSIATSTSDPLSVRVPSTMSANVVLSSSSST--LRIVPSVTASHSLRIASSQASGNNC  655

Query  648   GSSAAVNILKAAPSTAVLQSQTSASGTKSIGGKQYFIQKPLTLAPNVQLQFVKTSSGGMT  707
              SS+A+NILK A     +QSQ ++S T SIGGKQYFIQKPLTLAPNVQLQFVKT SGGMT
Sbjct  656   RSSSAINILKTALPNVAVQSQPTSSTTTSIGGKQYFIQKPLTLAPNVQLQFVKT-SGGMT  714

Query  708   VQTLPKVNLNVPKGSSPHGIPIASQQLVSGSNQNQGSVIPGNQLQKPIVSGNVLKLVSPH  767
             VQTLPKVN    KG+ PHGI IA+  L SG  Q QGS +PG+Q+QKPIVSGNVLKLVSPH
Sbjct  715   VQTLPKVNFTASKGTPPHGISIANPHLASGITQIQGSTVPGSQIQKPIVSGNVLKLVSPH  774

Query  768   TVASGKLIMKNSNILQMGKVTPNVIGGKPAFVITNKQGAQLGNQQIIIVTTGSGVRTVPS  827
             T+A GKLIMKNSNILQMGKVTPNV+GGKPAFVITNKQG  LGNQQIIIVTTG  VR+VP+
Sbjct  775   TMAGGKLIMKNSNILQMGKVTPNVMGGKPAFVITNKQGTPLGNQQIIIVTTGGNVRSVPT  834

Query  828   TTVMTSAGGTTSGTNIVSIVSSTSTTSSPLQTISGQRTLISNQSGVKMLRNTSSVQTSTP  887
             +TVMTSAGG+ SGTNIVSIV+STSTT SPLQ +SGQ+TLISNQSGVKMLRN SSVQ S+ 
Sbjct  835   STVMTSAGGSASGTNIVSIVNSTSTTPSPLQALSGQKTLISNQSGVKMLRNISSVQASSS  894

Query  888   VAIGQKPSGTHIHQKTALYIGGKAVTVMSANTSMPTSGNISNKVMLLPGASSTNSVVSTT  947
             +A GQK SGT IHQKTALYIGGKAVTVMS NTSM  SG   NKVM+LPG SS NS  +TT
Sbjct  895   MAFGQKQSGTPIHQKTALYIGGKAVTVMSTNTSMAASG---NKVMVLPGTSSNNSPATTT  951

Query  948   NLNARKSFVFNTGGSPRAVTLATKSVSAKIISPTQSMKETMPESIIPVVSMKDTESIDDI  1007
              L+ARKSFVFN GGSPR VTLATKS++AK I  +Q + ET   S   V ++KDT+ +DDI
Sbjct  952   ALSARKSFVFNAGGSPRTVTLATKSINAKSIPQSQPVTETNNHS---VATIKDTDPMDDI  1008

Query  1008  IEQLDGAGDLLKLATSAVQHRDEEEINDDNATSSSLPPPILTGLDITAPSRALNAIVEGH  1067
             IEQLDGAGDLLKL+ S  QH  EE  N+    +SS    + TG D   PSRA N IV  H
Sbjct  1009  IEQLDGAGDLLKLSESEGQHGSEENENNGENATSSSASALFTGGDTAGPSRAQNPIVMEH  1068

Query  1068  HVDILEDVSGVSSTTGARETI-----------MERVENDNMESMVKSKPASDNCQQPTTL  1116
              VDI+EDVSGVSSTT   ET            M   END+++SM +    SD+C QPTT 
Sbjct  1069  PVDIIEDVSGVSSTTDVNETAIVSGDTIESLKMSEKENDDVKSMGEKSILSDDCHQPTTS  1128

Query  1117  ETEAAAILTTIKSAEVLVLGSTELSKDPGVFSVES-SDDQNEDPKIKQGHETPLFTTSQN  1175
             ETEAA ILTTIKSAE LVL + E+ KD    ++ S  ++Q+E+ K KQ  E+   + SQN
Sbjct  1129  ETEAATILTTIKSAEALVLETAEIRKDHTGCTIGSLKENQDENKKFKQRQES---SPSQN  1185

Query  1176  PQQYQNVDGSHLDALASAAVLQAATADATPLATAGLAMKELIERPESEIQIRSNNVGDNQ  1235
               Q+QNVDGS L+ALASAA+LQAAT+D     T  LA+KELIERPESE   RS+N+ + Q
Sbjct  1186  IHQFQNVDGSQLEALASAALLQAATSD-----TTALALKELIERPESETNTRSSNIAEIQ  1240

Query  1236  QTNIQSTSASVVFPNKSQVENQKWHTVGVFKDLSHTVTTYIDSNFISDALLNNIDVDNLP  1295
             Q N+QST A VV PN SQ ENQKWHTVGVFKDLSHTVT+YIDSN ISD+  + IDVDNLP
Sbjct  1241  QNNVQSTLA-VVVPNTSQNENQKWHTVGVFKDLSHTVTSYIDSNCISDSFFDGIDVDNLP  1299

Query  1296  DLSKFPRTNLDPGTAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG  1355
             D SKFPRTNL+PGTAYRFRLSAIN+CGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG
Sbjct  1300  DFSKFPRTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG  1359

Query  1356  AHLTWEPPPAQKTKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLS  1415
             AHLTWEPPPAQKTKEIIEYSVYLAVKP AKD+AL+TPQLAFVRVYVG+ANQCTVPNASLS
Sbjct  1360  AHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLS  1419

Query  1416  NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPSSTKLQMPSSSTNLKRIQERSTIG  1475
             NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDP++ K   P+ + NLKR  E+STIG
Sbjct  1420  NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPAAAKQHTPTVTPNLKRGPEKSTIG  1479

Query  1476  TNSVSNSFCSPHKRGRNGLHE  1496
             +++++N+FCSPHKRGRNGLH+
Sbjct  1480  SSNIANTFCSPHKRGRNGLHD  1500


>G5EC23_CAEEL unnamed protein product
Length=782

 Score = 407 bits (1045),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 263/391 (67%), Gaps = 16/391 (4%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGD  119
            RW+ V   TGP P+PRHGHRA+ +KEL+V+FGGGNEG++DELH YNT   +W  P   GD
Sbjct  29   RWRIVQQSTGPNPKPRHGHRAVVLKELIVIFGGGNEGMIDELHAYNTQKREWTAPQCCGD  88

Query  120  VPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPR  179
            VP   AA+G +  G +++ FGGM EYGKY+N+LYELQ+T+WEWR++ P    +G  PCPR
Sbjct  89   VPTPAAAFGAISLGNKIYRFGGMTEYGKYTNDLYELQSTRWEWRRLNPRVHSNGHLPCPR  148

Query  180  LGHSF--TMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG  237
            +GHSF  +   +K ++FGGL+N+ +DPK N+P YL+DLY+++  G    +  W      G
Sbjct  149  IGHSFVVSQKSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINLSG--PQHLIWEKLNATG  206

Query  238  ESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSK-----PRMLG  292
              P  RESHT + +   K     +++YGGM+G RLGDLW L+ +++ W++     PR  G
Sbjct  207  PGPISRESHTAVIYE--KDSISRMVVYGGMNGVRLGDLWYLNLNTLHWTEIKFDDPRT-G  263

Query  293  EAPLPRSLHSSTMIANKMYVFGGWVPLVINDS-KSTTEREWKCTNTLAVLDLETMSWNNV  351
              P+PRSLHSS +I +KM+V+GGWVPL+ + S +  TE+EWKCT++L   ++    W  +
Sbjct  264  IPPMPRSLHSSVLIGDKMFVYGGWVPLLEHASTEQQTEKEWKCTSSLGCWNITEDRWVPL  323

Query  352  TLDTVEEN-VPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLY  410
             L   +E+ +PR RAGHCA  +  R+Y+WSGRDGYRKAW+NQ  VCC+D+W L+   P  
Sbjct  324  HLYCSDEDTIPRGRAGHCAAAVGDRMYIWSGRDGYRKAWSNQ--VCCRDMWLLDTILPEQ  381

Query  411  AVKVALVRASTHALELSWSATTFAAAYVLQI  441
              KV L RA  ++LE+SW     A+ Y LQI
Sbjct  382  PGKVQLGRAGFNSLEISWPIVQGASGYFLQI  412


 Score = 176 bits (446),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 124/203 (61%), Gaps = 17/203 (8%)

Query  1259  WHTVGVFKDLSHTVTTYID----------SNFISDALLNNIDVDNLPDLSKFPRTNLDPG  1308
             W  VG+    +  VT Y +          ++ I       ++        K P  N   G
Sbjct  553   WFDVGIIDKATINVTHYFNDRQQSLEKQLNDLIDHNAFKCVNDSVFTTEDKIPLIN---G  609

Query  1309  TAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQK-  1367
              +YRFR+SAIN  G+G W E +S KTC+PG+P APS+I+I+K   EGA LTWEPP     
Sbjct  610   QSYRFRVSAINGLGKGAWSETASCKTCVPGYPSAPSSIRITKS-HEGAQLTWEPPSNTNI  668

Query  1368  TKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLSNAHVDCSNKPAI  1427
             + +IIEYSVYLAVK  + + A +  QLAF+RVY G    C V  ++L  A VD +NKPAI
Sbjct  669   SGKIIEYSVYLAVKNQSANSADS--QLAFMRVYCGPQADCQVLQSNLGTAFVDQTNKPAI  726

Query  1428  IFRIAARNQKGYGPATQVRWLQD  1450
             IFRIAARN+KGYGPATQVRWLQD
Sbjct  727   IFRIAARNEKGYGPATQVRWLQD  749


>Q54CD2_DICDI unnamed protein product
Length=716

 Score = 105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 143/346 (41%), Gaps = 49/346 (14%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGG-----NEGIV----DELHVYNTVTNQ  110
             W ++  P G QP  R GH +  +K  M VFGGG     N   +    + LHVY+  +N 
Sbjct  2    EWIKI-QPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALEPNNLHVYDFTSNT  60

Query  111  WYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESP  170
            W +    G  P+    +     G ++F+ GG   YG  +N  Y+  +        +    
Sbjct  61   WSIQSTMGTPPSIRYGHTATEVGDKIFIIGG---YG--TNMFYDDVSIFDTVTNTWSTPI  115

Query  171  DSGSSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKW  230
              G  P  R  H+ T+VG  IF+F G             K  N+LY LDT        +W
Sbjct  116  CGGQRPSARYAHTATLVGTNIFVFAGCYEN---------KCFNELYCLDTIQY-----QW  161

Query  231  IVPKTYGESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRL-GDLWLLDTDSMTWSKPR  289
             +  T G  P  R  HT      T      L ++GG  G     DL++ + DS  W++  
Sbjct  162  SLVVTSGSPPQQRSYHT------TNLIGRKLYVFGGHLGNSYHNDLYVFNLDSKVWTQGI  215

Query  290  MLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWN  349
             LG+     + HSS +I N++++FGG      ND +        C +TL  L++E M W 
Sbjct  216  TLGKFETGIAYHSSAIINNQLFIFGG------NDGRV-------CYDTLWKLNIENMEWE  262

Query  350  NVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRV  395
             +         P       +V     L ++ G + Y   +++  ++
Sbjct  263  KLAFKDSSHKPPSRHKHTLSVSHDLSLILYGGMEFYPNCYDDFYKL  308


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 66/142 (46%), Gaps = 8/142 (6%)

Query  59   FRWKRVLNPTGPQPRPRHGHRAINIKELMVVFGG--GNEGIVDELHVYNTVTNQWYVPVL  116
            ++W  V+  +G  P+ R  H    I   + VFGG  GN    ++L+V+N  +  W   + 
Sbjct  159  YQWSLVVT-SGSPPQQRSYHTTNLIGRKLYVFGGHLGNS-YHNDLYVFNLDSKVWTQGIT  216

Query  117  KGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSP  176
             G    G A +   +   ++F+FGG      Y + L++L     EW K+     DS   P
Sbjct  217  LGKFETGIAYHSSAIINNQLFIFGGNDGRVCY-DTLWKLNIENMEWEKL--AFKDSSHKP  273

Query  177  CPRLGHSFTMVGE-KIFLFGGL  197
              R  H+ ++  +  + L+GG+
Sbjct  274  PSRHKHTLSVSHDLSLILYGGM  295


 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query  283  MTWSKPRMLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLD  342
            M W K +  G  P  R  H+ST++ NKMYVFGG      N +    E      N L V D
Sbjct  1    MEWIKIQPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALE-----PNNLHVYD  55

Query  343  LETMSWNNVTLDTVEENVPRARAGHCAVGIQSRLYVWSG  381
              + +W   ++ +     P  R GH A  +  ++++  G
Sbjct  56   FTSNTW---SIQSTMGTPPSIRYGHTATEVGDKIFIIGG  91



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062605.1 host cell factor isoform X1 [Drosophila eugracilis]

Length=1496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HCF_DROME  unnamed protein product                                    2158    0.0   
G5EC23_CAEEL  unnamed protein product                                 407     4e-124
Q54CD2_DICDI  unnamed protein product                                 105     9e-23 


>HCF_DROME unnamed protein product
Length=1500

 Score = 2158 bits (5592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1122/1521 (74%), Positives = 1249/1521 (82%), Gaps = 46/1521 (3%)

Query  1     MECSGLGGTSISSGGRLSASDDLNINRIHQTGDHSCDNQISMDVEENIECPVTNNLSGFR  60
             ME S     + SSG R+SASD LN   I Q  +HS  N+ISMD++      + +NL+GFR
Sbjct  1     MEGSDFVDPAFSSGERISASD-LNSEHIIQAENHSFANRISMDMDVPDGHQLDSNLTGFR  59

Query  61    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  120
             WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV
Sbjct  60    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  119

Query  121   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPRL  180
             PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSG SPCPRL
Sbjct  120   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRL  179

Query  181   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGESP  240
             GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG+SP
Sbjct  180   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSP  239

Query  241   PPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSKPRMLGEAPLPRSL  300
             PPRESHTGISFA+  +GNLNLLIYGGMSGCRLGDLWLL+TDSMTWSKP+  GEAPLPRSL
Sbjct  240   PPRESHTGISFATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSL  299

Query  301   HSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWNNVTLDTVEENV  360
             HSSTMI NKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETM+W NVTLDTVEENV
Sbjct  300   HSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENV  359

Query  361   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLYAVKVALVRAS  420
             PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ  VCCKDLWYLEVSKPLYAVKVALVRAS
Sbjct  360   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQ--VCCKDLWYLEVSKPLYAVKVALVRAS  417

Query  421   THALELSWSATTFAAAYVLQIQKIEQPPNTISKPVSQNIVQQGTTTPAESSGTNVAENCS  480
             THALELSW+ATTFAAAYVLQIQKIEQP NT SK +S NIVQQGT T AE+SG N++ N S
Sbjct  418   THALELSWTATTFAAAYVLQIQKIEQPLNTSSKLLSNNIVQQGTPTSAETSGINISANRS  477

Query  481   ESALTPGIVATSAVLNLEKNAIQTDG---------SGNVLLQTFSPPSSPTTRVKKKFIS  531
              SAL  G+ ATS VL LEK ++Q  G         S N LLQ+ S PSSP +R  K  +S
Sbjct  478   GSALGLGVEATSTVLKLEKESLQLSGCQPETNVQPSVNDLLQSMSQPSSPASRADKDPLS  537

Query  532   SIG---TNFTTSAASAQPQISVISSTAKV-ASTTASSSSTVSSLLQKFRPTVTAVRSPTT  587
             S G    N +TS AS  PQISVISSTA V  + TAS S  ++S+LQKFRP VTAVR+ TT
Sbjct  538   SGGGTTFNLSTSVASVHPQISVISSTAAVTGNDTASPSGAINSILQKFRPVVTAVRTSTT  597

Query  588   NTVTGVTSVADPLALRVPTAMATNVVLNSAASSTGLRIVPSVTASQTLRLAPAQPGVISS  647
               V+  TS +DPL++RVP+ M+ NVVL+S++S+  LRIVPSVTAS +LR+A +Q    + 
Sbjct  598   TAVSIATSTSDPLSVRVPSTMSANVVLSSSSST--LRIVPSVTASHSLRIASSQASGNNC  655

Query  648   GSSAAVNILKAAPSTAVLQSQTSASGTKSIGGKQYFIQKPLTLAPNVQLQFVKTSSGGMT  707
              SS+A+NILK A     +QSQ ++S T SIGGKQYFIQKPLTLAPNVQLQFVKT SGGMT
Sbjct  656   RSSSAINILKTALPNVAVQSQPTSSTTTSIGGKQYFIQKPLTLAPNVQLQFVKT-SGGMT  714

Query  708   VQTLPKVNLNVPKGSSPHGIPIASQQLVSGSNQNQGSVIPGNQLQKPIVSGNVLKLVSPH  767
             VQTLPKVN    KG+ PHGI IA+  L SG  Q QGS +PG+Q+QKPIVSGNVLKLVSPH
Sbjct  715   VQTLPKVNFTASKGTPPHGISIANPHLASGITQIQGSTVPGSQIQKPIVSGNVLKLVSPH  774

Query  768   TVASGKLIMKNSNILQMGKVTPNVIGGKPAFVITNKQGAQLGNQQIIIVTTGSGVRTVPS  827
             T+A GKLIMKNSNILQMGKVTPNV+GGKPAFVITNKQG  LGNQQIIIVTTG  VR+VP+
Sbjct  775   TMAGGKLIMKNSNILQMGKVTPNVMGGKPAFVITNKQGTPLGNQQIIIVTTGGNVRSVPT  834

Query  828   TTVMTSAGGTTSGTNIVSIVSSTSTTSSPLQTISGQRTLISNQSGVKMLRNTSSVQTSTP  887
             +TVMTSAGG+ SGTNIVSIV+STSTT SPLQ +SGQ+TLISNQSGVKMLRN SSVQ S+ 
Sbjct  835   STVMTSAGGSASGTNIVSIVNSTSTTPSPLQALSGQKTLISNQSGVKMLRNISSVQASSS  894

Query  888   VAIGQKPSGTHIHQKTALYIGGKAVTVMSANTSMPTSGNISNKVMLLPGASSTNSVVSTT  947
             +A GQK SGT IHQKTALYIGGKAVTVMS NTSM  SG   NKVM+LPG SS NS  +TT
Sbjct  895   MAFGQKQSGTPIHQKTALYIGGKAVTVMSTNTSMAASG---NKVMVLPGTSSNNSPATTT  951

Query  948   NLNARKSFVFNTGGSPRAVTLATKSVSAKIISPTQSMKETMPESIIPVVSMKDTESIDDI  1007
              L+ARKSFVFN GGSPR VTLATKS++AK I  +Q + ET   S   V ++KDT+ +DDI
Sbjct  952   ALSARKSFVFNAGGSPRTVTLATKSINAKSIPQSQPVTETNNHS---VATIKDTDPMDDI  1008

Query  1008  IEQLDGAGDLLKLATSAVQHRDEEEINDDNATSSSLPPPILTGLDITAPSRALNAIVEGH  1067
             IEQLDGAGDLLKL+ S  QH  EE  N+    +SS    + TG D   PSRA N IV  H
Sbjct  1009  IEQLDGAGDLLKLSESEGQHGSEENENNGENATSSSASALFTGGDTAGPSRAQNPIVMEH  1068

Query  1068  HVDILEDVSGVSSTTGARETI-----------MERVENDNMESMVKSKPASDNCQQPTTL  1116
              VDI+EDVSGVSSTT   ET            M   END+++SM +    SD+C QPTT 
Sbjct  1069  PVDIIEDVSGVSSTTDVNETAIVSGDTIESLKMSEKENDDVKSMGEKSILSDDCHQPTTS  1128

Query  1117  ETEAAAILTTIKSAEVLVLGSTELSKDPGVFSVES-SDDQNEDPKIKQGHETPLFTTSQN  1175
             ETEAA ILTTIKSAE LVL + E+ KD    ++ S  ++Q+E+ K KQ  E+   + SQN
Sbjct  1129  ETEAATILTTIKSAEALVLETAEIRKDHTGCTIGSLKENQDENKKFKQRQES---SPSQN  1185

Query  1176  PQQYQNVDGSHLDALASAAVLQAATADATPLATAGLAMKELIERPESEIQIRSNNVGDNQ  1235
               Q+QNVDGS L+ALASAA+LQAAT+D     T  LA+KELIERPESE   RS+N+ + Q
Sbjct  1186  IHQFQNVDGSQLEALASAALLQAATSD-----TTALALKELIERPESETNTRSSNIAEIQ  1240

Query  1236  QTNIQSTSASVVFPNKSQVENQKWHTVGVFKDLSHTVTTYIDSNFISDALLNNIDVDNLP  1295
             Q N+QST A VV PN SQ ENQKWHTVGVFKDLSHTVT+YIDSN ISD+  + IDVDNLP
Sbjct  1241  QNNVQSTLA-VVVPNTSQNENQKWHTVGVFKDLSHTVTSYIDSNCISDSFFDGIDVDNLP  1299

Query  1296  DLSKFPRTNLDPGTAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG  1355
             D SKFPRTNL+PGTAYRFRLSAIN+CGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG
Sbjct  1300  DFSKFPRTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEG  1359

Query  1356  AHLTWEPPPAQKTKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLS  1415
             AHLTWEPPPAQKTKEIIEYSVYLAVKP AKD+AL+TPQLAFVRVYVG+ANQCTVPNASLS
Sbjct  1360  AHLTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLS  1419

Query  1416  NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPSSTKLQMPSSSTNLKRIQERSTIG  1475
             NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDP++ K   P+ + NLKR  E+STIG
Sbjct  1420  NAHVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPAAAKQHTPTVTPNLKRGPEKSTIG  1479

Query  1476  TNSVSNSFCSPHKRGRNGLHE  1496
             +++++N+FCSPHKRGRNGLH+
Sbjct  1480  SSNIANTFCSPHKRGRNGLHD  1500


>G5EC23_CAEEL unnamed protein product
Length=782

 Score = 407 bits (1045),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 188/391 (48%), Positives = 263/391 (67%), Gaps = 16/391 (4%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGD  119
            RW+ V   TGP P+PRHGHRA+ +KEL+V+FGGGNEG++DELH YNT   +W  P   GD
Sbjct  29   RWRIVQQSTGPNPKPRHGHRAVVLKELIVIFGGGNEGMIDELHAYNTQKREWTAPQCCGD  88

Query  120  VPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPR  179
            VP   AA+G +  G +++ FGGM EYGKY+N+LYELQ+T+WEWR++ P    +G  PCPR
Sbjct  89   VPTPAAAFGAISLGNKIYRFGGMTEYGKYTNDLYELQSTRWEWRRLNPRVHSNGHLPCPR  148

Query  180  LGHSF--TMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG  237
            +GHSF  +   +K ++FGGL+N+ +DPK N+P YL+DLY+++  G    +  W      G
Sbjct  149  IGHSFVVSQKSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINLSG--PQHLIWEKLNATG  206

Query  238  ESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSK-----PRMLG  292
              P  RESHT + +   K     +++YGGM+G RLGDLW L+ +++ W++     PR  G
Sbjct  207  PGPISRESHTAVIYE--KDSISRMVVYGGMNGVRLGDLWYLNLNTLHWTEIKFDDPRT-G  263

Query  293  EAPLPRSLHSSTMIANKMYVFGGWVPLVINDS-KSTTEREWKCTNTLAVLDLETMSWNNV  351
              P+PRSLHSS +I +KM+V+GGWVPL+ + S +  TE+EWKCT++L   ++    W  +
Sbjct  264  IPPMPRSLHSSVLIGDKMFVYGGWVPLLEHASTEQQTEKEWKCTSSLGCWNITEDRWVPL  323

Query  352  TLDTVEEN-VPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRVCCKDLWYLEVSKPLY  410
             L   +E+ +PR RAGHCA  +  R+Y+WSGRDGYRKAW+NQ  VCC+D+W L+   P  
Sbjct  324  HLYCSDEDTIPRGRAGHCAAAVGDRMYIWSGRDGYRKAWSNQ--VCCRDMWLLDTILPEQ  381

Query  411  AVKVALVRASTHALELSWSATTFAAAYVLQI  441
              KV L RA  ++LE+SW     A+ Y LQI
Sbjct  382  PGKVQLGRAGFNSLEISWPIVQGASGYFLQI  412


 Score = 176 bits (446),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 124/203 (61%), Gaps = 17/203 (8%)

Query  1259  WHTVGVFKDLSHTVTTYID----------SNFISDALLNNIDVDNLPDLSKFPRTNLDPG  1308
             W  VG+    +  VT Y +          ++ I       ++        K P  N   G
Sbjct  553   WFDVGIIDKATINVTHYFNDRQQSLEKQLNDLIDHNAFKCVNDSVFTTEDKIPLIN---G  609

Query  1309  TAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQK-  1367
              +YRFR+SAIN  G+G W E +S KTC+PG+P APS+I+I+K   EGA LTWEPP     
Sbjct  610   QSYRFRVSAINGLGKGAWSETASCKTCVPGYPSAPSSIRITKS-HEGAQLTWEPPSNTNI  668

Query  1368  TKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLSNAHVDCSNKPAI  1427
             + +IIEYSVYLAVK  + + A +  QLAF+RVY G    C V  ++L  A VD +NKPAI
Sbjct  669   SGKIIEYSVYLAVKNQSANSADS--QLAFMRVYCGPQADCQVLQSNLGTAFVDQTNKPAI  726

Query  1428  IFRIAARNQKGYGPATQVRWLQD  1450
             IFRIAARN+KGYGPATQVRWLQD
Sbjct  727   IFRIAARNEKGYGPATQVRWLQD  749


>Q54CD2_DICDI unnamed protein product
Length=716

 Score = 105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 91/346 (26%), Positives = 143/346 (41%), Gaps = 49/346 (14%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGG-----NEGIV----DELHVYNTVTNQ  110
             W ++  P G QP  R GH +  +K  M VFGGG     N   +    + LHVY+  +N 
Sbjct  2    EWIKI-QPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALEPNNLHVYDFTSNT  60

Query  111  WYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESP  170
            W +    G  P+    +     G ++F+ GG   YG  +N  Y+  +        +    
Sbjct  61   WSIQSTMGTPPSIRYGHTATEVGDKIFIIGG---YG--TNMFYDDVSIFDTVTNTWSTPI  115

Query  171  DSGSSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKW  230
              G  P  R  H+ T+VG  IF+F G             K  N+LY LDT        +W
Sbjct  116  CGGQRPSARYAHTATLVGTNIFVFAGCYEN---------KCFNELYCLDTIQY-----QW  161

Query  231  IVPKTYGESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRL-GDLWLLDTDSMTWSKPR  289
             +  T G  P  R  HT      T      L ++GG  G     DL++ + DS  W++  
Sbjct  162  SLVVTSGSPPQQRSYHT------TNLIGRKLYVFGGHLGNSYHNDLYVFNLDSKVWTQGI  215

Query  290  MLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWN  349
             LG+     + HSS +I N++++FGG      ND +        C +TL  L++E M W 
Sbjct  216  TLGKFETGIAYHSSAIINNQLFIFGG------NDGRV-------CYDTLWKLNIENMEWE  262

Query  350  NVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVRV  395
             +         P       +V     L ++ G + Y   +++  ++
Sbjct  263  KLAFKDSSHKPPSRHKHTLSVSHDLSLILYGGMEFYPNCYDDFYKL  308


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 66/142 (46%), Gaps = 8/142 (6%)

Query  59   FRWKRVLNPTGPQPRPRHGHRAINIKELMVVFGG--GNEGIVDELHVYNTVTNQWYVPVL  116
            ++W  V+  +G  P+ R  H    I   + VFGG  GN    ++L+V+N  +  W   + 
Sbjct  159  YQWSLVVT-SGSPPQQRSYHTTNLIGRKLYVFGGHLGNS-YHNDLYVFNLDSKVWTQGIT  216

Query  117  KGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSP  176
             G    G A +   +   ++F+FGG      Y + L++L     EW K+     DS   P
Sbjct  217  LGKFETGIAYHSSAIINNQLFIFGGNDGRVCY-DTLWKLNIENMEWEKL--AFKDSSHKP  273

Query  177  CPRLGHSFTMVGE-KIFLFGGL  197
              R  H+ ++  +  + L+GG+
Sbjct  274  PSRHKHTLSVSHDLSLILYGGM  295


 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query  283  MTWSKPRMLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLD  342
            M W K +  G  P  R  H+ST++ NKMYVFGG      N +    E      N L V D
Sbjct  1    MEWIKIQPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALE-----PNNLHVYD  55

Query  343  LETMSWNNVTLDTVEENVPRARAGHCAVGIQSRLYVWSG  381
              + +W   ++ +     P  R GH A  +  ++++  G
Sbjct  56   FTSNTW---SIQSTMGTPPSIRYGHTATEVGDKIFIIGG  91



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062606.1 host cell factor isoform X2 [Drosophila eugracilis]

Length=1494
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HCF_DROME  unnamed protein product                                    2163    0.0   
G5EC23_CAEEL  unnamed protein product                                 412     5e-126
Q54CD2_DICDI  unnamed protein product                                 105     9e-23 


>HCF_DROME unnamed protein product
Length=1500

 Score = 2163 bits (5605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1122/1519 (74%), Positives = 1249/1519 (82%), Gaps = 44/1519 (3%)

Query  1     MECSGLGGTSISSGGRLSASDDLNINRIHQTGDHSCDNQISMDVEENIECPVTNNLSGFR  60
             ME S     + SSG R+SASD LN   I Q  +HS  N+ISMD++      + +NL+GFR
Sbjct  1     MEGSDFVDPAFSSGERISASD-LNSEHIIQAENHSFANRISMDMDVPDGHQLDSNLTGFR  59

Query  61    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  120
             WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV
Sbjct  60    WKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGDV  119

Query  121   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPRL  180
             PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSG SPCPRL
Sbjct  120   PNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGLSPCPRL  179

Query  181   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGESP  240
             GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG+SP
Sbjct  180   GHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYGDSP  239

Query  241   PPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSKPRMLGEAPLPRSL  300
             PPRESHTGISFA+  +GNLNLLIYGGMSGCRLGDLWLL+TDSMTWSKP+  GEAPLPRSL
Sbjct  240   PPRESHTGISFATKSNGNLNLLIYGGMSGCRLGDLWLLETDSMTWSKPKTSGEAPLPRSL  299

Query  301   HSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWNNVTLDTVEENV  360
             HSSTMI NKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETM+W NVTLDTVEENV
Sbjct  300   HSSTMIGNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENVTLDTVEENV  359

Query  361   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTH  420
             PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTH
Sbjct  360   PRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAVKVALVRASTH  419

Query  421   ALELSWSATTFAAAYVLQIQKIEQPPNTISKPVSQNIVQQGTTTPAESSGTNVAENCSES  480
             ALELSW+ATTFAAAYVLQIQKIEQP NT SK +S NIVQQGT T AE+SG N++ N S S
Sbjct  420   ALELSWTATTFAAAYVLQIQKIEQPLNTSSKLLSNNIVQQGTPTSAETSGINISANRSGS  479

Query  481   ALTPGIVATSAVLNLEKNAIQTDG---------SGNVLLQTFSPPSSPTTRVKKKFISSI  531
             AL  G+ ATS VL LEK ++Q  G         S N LLQ+ S PSSP +R  K  +SS 
Sbjct  480   ALGLGVEATSTVLKLEKESLQLSGCQPETNVQPSVNDLLQSMSQPSSPASRADKDPLSSG  539

Query  532   G---TNFTTSAASAQPQISVISSTAKV-ASTTASSSSTVSSLLQKFRPTVTAVRSPTTNT  587
             G    N +TS AS  PQISVISSTA V  + TAS S  ++S+LQKFRP VTAVR+ TT  
Sbjct  540   GGTTFNLSTSVASVHPQISVISSTAAVTGNDTASPSGAINSILQKFRPVVTAVRTSTTTA  599

Query  588   VTGVTSVADPLALRVPTAMATNVVLNSAASSTGLRIVPSVTASQTLRLAPAQPGVISSGS  647
             V+  TS +DPL++RVP+ M+ NVVL+S++S+  LRIVPSVTAS +LR+A +Q    +  S
Sbjct  600   VSIATSTSDPLSVRVPSTMSANVVLSSSSST--LRIVPSVTASHSLRIASSQASGNNCRS  657

Query  648   SAAVNILKAAPSTAVLQSQTSASGTKSIGGKQYFIQKPLTLAPNVQLQFVKTSSGGMTVQ  707
             S+A+NILK A     +QSQ ++S T SIGGKQYFIQKPLTLAPNVQLQFVKT SGGMTVQ
Sbjct  658   SSAINILKTALPNVAVQSQPTSSTTTSIGGKQYFIQKPLTLAPNVQLQFVKT-SGGMTVQ  716

Query  708   TLPKVNLNVPKGSSPHGIPIASQQLVSGSNQNQGSVIPGNQLQKPIVSGNVLKLVSPHTV  767
             TLPKVN    KG+ PHGI IA+  L SG  Q QGS +PG+Q+QKPIVSGNVLKLVSPHT+
Sbjct  717   TLPKVNFTASKGTPPHGISIANPHLASGITQIQGSTVPGSQIQKPIVSGNVLKLVSPHTM  776

Query  768   ASGKLIMKNSNILQMGKVTPNVIGGKPAFVITNKQGAQLGNQQIIIVTTGSGVRTVPSTT  827
             A GKLIMKNSNILQMGKVTPNV+GGKPAFVITNKQG  LGNQQIIIVTTG  VR+VP++T
Sbjct  777   AGGKLIMKNSNILQMGKVTPNVMGGKPAFVITNKQGTPLGNQQIIIVTTGGNVRSVPTST  836

Query  828   VMTSAGGTTSGTNIVSIVSSTSTTSSPLQTISGQRTLISNQSGVKMLRNTSSVQTSTPVA  887
             VMTSAGG+ SGTNIVSIV+STSTT SPLQ +SGQ+TLISNQSGVKMLRN SSVQ S+ +A
Sbjct  837   VMTSAGGSASGTNIVSIVNSTSTTPSPLQALSGQKTLISNQSGVKMLRNISSVQASSSMA  896

Query  888   IGQKPSGTHIHQKTALYIGGKAVTVMSANTSMPTSGNISNKVMLLPGASSTNSVVSTTNL  947
              GQK SGT IHQKTALYIGGKAVTVMS NTSM  SG   NKVM+LPG SS NS  +TT L
Sbjct  897   FGQKQSGTPIHQKTALYIGGKAVTVMSTNTSMAASG---NKVMVLPGTSSNNSPATTTAL  953

Query  948   NARKSFVFNTGGSPRAVTLATKSVSAKIISPTQSMKETMPESIIPVVSMKDTESIDDIIE  1007
             +ARKSFVFN GGSPR VTLATKS++AK I  +Q + ET   S   V ++KDT+ +DDIIE
Sbjct  954   SARKSFVFNAGGSPRTVTLATKSINAKSIPQSQPVTETNNHS---VATIKDTDPMDDIIE  1010

Query  1008  QLDGAGDLLKLATSAVQHRDEEEINDDNATSSSLPPPILTGLDITAPSRALNAIVEGHHV  1067
             QLDGAGDLLKL+ S  QH  EE  N+    +SS    + TG D   PSRA N IV  H V
Sbjct  1011  QLDGAGDLLKLSESEGQHGSEENENNGENATSSSASALFTGGDTAGPSRAQNPIVMEHPV  1070

Query  1068  DILEDVSGVSSTTGARETI-----------MERVENDNMESMVKSKPASDNCQQPTTLET  1116
             DI+EDVSGVSSTT   ET            M   END+++SM +    SD+C QPTT ET
Sbjct  1071  DIIEDVSGVSSTTDVNETAIVSGDTIESLKMSEKENDDVKSMGEKSILSDDCHQPTTSET  1130

Query  1117  EAAAILTTIKSAEVLVLGSTELSKDPGVFSVES-SDDQNEDPKIKQGHETPLFTTSQNPQ  1175
             EAA ILTTIKSAE LVL + E+ KD    ++ S  ++Q+E+ K KQ  E+   + SQN  
Sbjct  1131  EAATILTTIKSAEALVLETAEIRKDHTGCTIGSLKENQDENKKFKQRQES---SPSQNIH  1187

Query  1176  QYQNVDGSHLDALASAAVLQAATADATPLATAGLAMKELIERPESEIQIRSNNVGDNQQT  1235
             Q+QNVDGS L+ALASAA+LQAAT+D     T  LA+KELIERPESE   RS+N+ + QQ 
Sbjct  1188  QFQNVDGSQLEALASAALLQAATSD-----TTALALKELIERPESETNTRSSNIAEIQQN  1242

Query  1236  NIQSTSASVVFPNKSQVENQKWHTVGVFKDLSHTVTTYIDSNFISDALLNNIDVDNLPDL  1295
             N+QST A VV PN SQ ENQKWHTVGVFKDLSHTVT+YIDSN ISD+  + IDVDNLPD 
Sbjct  1243  NVQSTLA-VVVPNTSQNENQKWHTVGVFKDLSHTVTSYIDSNCISDSFFDGIDVDNLPDF  1301

Query  1296  SKFPRTNLDPGTAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAH  1355
             SKFPRTNL+PGTAYRFRLSAIN+CGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAH
Sbjct  1302  SKFPRTNLEPGTAYRFRLSAINSCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAH  1361

Query  1356  LTWEPPPAQKTKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLSNA  1415
             LTWEPPPAQKTKEIIEYSVYLAVKP AKD+AL+TPQLAFVRVYVG+ANQCTVPNASLSNA
Sbjct  1362  LTWEPPPAQKTKEIIEYSVYLAVKPTAKDKALSTPQLAFVRVYVGAANQCTVPNASLSNA  1421

Query  1416  HVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPSSTKLQMPSSSTNLKRIQERSTIGTN  1475
             HVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDP++ K   P+ + NLKR  E+STIG++
Sbjct  1422  HVDCSNKPAIIFRIAARNQKGYGPATQVRWLQDPAAAKQHTPTVTPNLKRGPEKSTIGSS  1481

Query  1476  SVSNSFCSPHKRGRNGLHE  1494
             +++N+FCSPHKRGRNGLH+
Sbjct  1482  NIANTFCSPHKRGRNGLHD  1500


>G5EC23_CAEEL unnamed protein product
Length=782

 Score = 412 bits (1058),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 263/389 (68%), Gaps = 14/389 (4%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGGNEGIVDELHVYNTVTNQWYVPVLKGD  119
            RW+ V   TGP P+PRHGHRA+ +KEL+V+FGGGNEG++DELH YNT   +W  P   GD
Sbjct  29   RWRIVQQSTGPNPKPRHGHRAVVLKELIVIFGGGNEGMIDELHAYNTQKREWTAPQCCGD  88

Query  120  VPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSPCPR  179
            VP   AA+G +  G +++ FGGM EYGKY+N+LYELQ+T+WEWR++ P    +G  PCPR
Sbjct  89   VPTPAAAFGAISLGNKIYRFGGMTEYGKYTNDLYELQSTRWEWRRLNPRVHSNGHLPCPR  148

Query  180  LGHSF--TMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPKTYG  237
            +GHSF  +   +K ++FGGL+N+ +DPK N+P YL+DLY+++  G    +  W      G
Sbjct  149  IGHSFVVSQKSQKAYVFGGLSNDLNDPKRNVPHYLDDLYVINLSG--PQHLIWEKLNATG  206

Query  238  ESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRLGDLWLLDTDSMTWSK-----PRMLG  292
              P  RESHT + +   K     +++YGGM+G RLGDLW L+ +++ W++     PR  G
Sbjct  207  PGPISRESHTAVIYE--KDSISRMVVYGGMNGVRLGDLWYLNLNTLHWTEIKFDDPRT-G  263

Query  293  EAPLPRSLHSSTMIANKMYVFGGWVPLVINDS-KSTTEREWKCTNTLAVLDLETMSWNNV  351
              P+PRSLHSS +I +KM+V+GGWVPL+ + S +  TE+EWKCT++L   ++    W  +
Sbjct  264  IPPMPRSLHSSVLIGDKMFVYGGWVPLLEHASTEQQTEKEWKCTSSLGCWNITEDRWVPL  323

Query  352  TLDTVEEN-VPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEVSKPLYAV  410
             L   +E+ +PR RAGHCA  +  R+Y+WSGRDGYRKAW+NQVCC+D+W L+   P    
Sbjct  324  HLYCSDEDTIPRGRAGHCAAAVGDRMYIWSGRDGYRKAWSNQVCCRDMWLLDTILPEQPG  383

Query  411  KVALVRASTHALELSWSATTFAAAYVLQI  439
            KV L RA  ++LE+SW     A+ Y LQI
Sbjct  384  KVQLGRAGFNSLEISWPIVQGASGYFLQI  412


 Score = 176 bits (445),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 124/203 (61%), Gaps = 17/203 (8%)

Query  1257  WHTVGVFKDLSHTVTTYID----------SNFISDALLNNIDVDNLPDLSKFPRTNLDPG  1306
             W  VG+    +  VT Y +          ++ I       ++        K P  N   G
Sbjct  553   WFDVGIIDKATINVTHYFNDRQQSLEKQLNDLIDHNAFKCVNDSVFTTEDKIPLIN---G  609

Query  1307  TAYRFRLSAINTCGRGEWGEISSFKTCLPGFPGAPSAIKISKDVKEGAHLTWEPPPAQK-  1365
              +YRFR+SAIN  G+G W E +S KTC+PG+P APS+I+I+K   EGA LTWEPP     
Sbjct  610   QSYRFRVSAINGLGKGAWSETASCKTCVPGYPSAPSSIRITKS-HEGAQLTWEPPSNTNI  668

Query  1366  TKEIIEYSVYLAVKPAAKDRALATPQLAFVRVYVGSANQCTVPNASLSNAHVDCSNKPAI  1425
             + +IIEYSVYLAVK  + + A +  QLAF+RVY G    C V  ++L  A VD +NKPAI
Sbjct  669   SGKIIEYSVYLAVKNQSANSADS--QLAFMRVYCGPQADCQVLQSNLGTAFVDQTNKPAI  726

Query  1426  IFRIAARNQKGYGPATQVRWLQD  1448
             IFRIAARN+KGYGPATQVRWLQD
Sbjct  727   IFRIAARNEKGYGPATQVRWLQD  749


>Q54CD2_DICDI unnamed protein product
Length=716

 Score = 105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 94/354 (27%), Positives = 143/354 (40%), Gaps = 55/354 (16%)

Query  60   RWKRVLNPTGPQPRPRHGHRAINIKELMVVFGGG-----NEGIV----DELHVYNTVTNQ  110
             W ++  P G QP  R GH +  +K  M VFGGG     N   +    + LHVY+  +N 
Sbjct  2    EWIKI-QPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALEPNNLHVYDFTSNT  60

Query  111  WYVPVLKGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESP  170
            W +    G  P+    +     G ++F+ GG   YG  +N  Y+  +        +    
Sbjct  61   WSIQSTMGTPPSIRYGHTATEVGDKIFIIGG---YG--TNMFYDDVSIFDTVTNTWSTPI  115

Query  171  DSGSSPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKW  230
              G  P  R  H+ T+VG  IF+F G             K  N+LY LDT        +W
Sbjct  116  CGGQRPSARYAHTATLVGTNIFVFAGCYEN---------KCFNELYCLDTIQY-----QW  161

Query  231  IVPKTYGESPPPRESHTGISFASTKSGNLNLLIYGGMSGCRL-GDLWLLDTDSMTWSKPR  289
             +  T G  P  R  HT      T      L ++GG  G     DL++ + DS  W++  
Sbjct  162  SLVVTSGSPPQQRSYHT------TNLIGRKLYVFGGHLGNSYHNDLYVFNLDSKVWTQGI  215

Query  290  MLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMSWN  349
             LG+     + HSS +I N++++FGG      ND +        C +TL  L++E M W 
Sbjct  216  TLGKFETGIAYHSSAIINNQLFIFGG------NDGRV-------CYDTLWKLNIENMEWE  262

Query  350  NVTLDTVEENVPRARAGHCAVGIQSRLYVWSGRDGYRKAWNNQVCCKDLWYLEV  403
             +         P       +V     L ++ G + Y        C  D + L +
Sbjct  263  KLAFKDSSHKPPSRHKHTLSVSHDLSLILYGGMEFYPN------CYDDFYKLSI  310


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/142 (27%), Positives = 66/142 (46%), Gaps = 8/142 (6%)

Query  59   FRWKRVLNPTGPQPRPRHGHRAINIKELMVVFGG--GNEGIVDELHVYNTVTNQWYVPVL  116
            ++W  V+  +G  P+ R  H    I   + VFGG  GN    ++L+V+N  +  W   + 
Sbjct  159  YQWSLVVT-SGSPPQQRSYHTTNLIGRKLYVFGGHLGNS-YHNDLYVFNLDSKVWTQGIT  216

Query  117  KGDVPNGCAAYGFVVEGTRMFVFGGMIEYGKYSNELYELQATKWEWRKMYPESPDSGSSP  176
             G    G A +   +   ++F+FGG      Y + L++L     EW K+     DS   P
Sbjct  217  LGKFETGIAYHSSAIINNQLFIFGGNDGRVCY-DTLWKLNIENMEWEKL--AFKDSSHKP  273

Query  177  CPRLGHSFTMVGE-KIFLFGGL  197
              R  H+ ++  +  + L+GG+
Sbjct  274  PSRHKHTLSVSHDLSLILYGGM  295


 Score = 45.4 bits (106),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 8/99 (8%)

Query  283  MTWSKPRMLGEAPLPRSLHSSTMIANKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLD  342
            M W K +  G  P  R  H+ST++ NKMYVFGG      N +    E      N L V D
Sbjct  1    MEWIKIQPKGLQPPKRGGHTSTIVKNKMYVFGGGSYQPPNANSLALE-----PNNLHVYD  55

Query  343  LETMSWNNVTLDTVEENVPRARAGHCAVGIQSRLYVWSG  381
              + +W   ++ +     P  R GH A  +  ++++  G
Sbjct  56   FTSNTW---SIQSTMGTPPSIRYGHTATEVGDKIFIIGG  91



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062607.1 zinc finger protein GLI2 isoform X1 [Drosophila
eugracilis]

Length=1126
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7KQN5_DROME  unnamed protein product                                 1499    0.0  
Q9V4C9_DROME  unnamed protein product                                 1471    0.0  
Q7K3X3_DROME  unnamed protein product                                 1463    0.0  


>Q7KQN5_DROME unnamed protein product
Length=1150

 Score = 1499 bits (3880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 848/1162 (73%), Positives = 932/1162 (80%), Gaps = 48/1162 (4%)

Query  1     MKLRCFGQVQTTRSCQPRVKFRVRSNRPVGLLDQSRPVSRENNIGILVKKLFRMFKMDGA  60
             MKLRCF Q QT+ S  PR  FRV S+ P     +  P S +  IG L+     MFKMD A
Sbjct  1     MKLRCFNQAQTSHSWHPRSVFRVVSSCPPDRKKRPSPASWQICIGHLLTNYLGMFKMDSA  60

Query  61    DFWQQARAPFGLQTALHQYNSPPNQQPQHHPTVHHSISQEHELLAEVHSGVPIMGSGPVN  120
             DFWQQARAPFGLQTALHQY+SPPNQQP  H  +HHS+ QE+E LA V    P  GSG V 
Sbjct  61    DFWQQARAPFGLQTALHQYSSPPNQQPISHHALHHSVPQENEQLAGVQPEGPAAGSGVVG  120

Query  121   SSSSIVLSSPHPHLG-KVESSHILQQHPEQQSYVGDSFRGSQSPQLSSHHLLFNAAAAAA  179
             ++SS+ +S  +  +G K ESSHI QQH EQQSY  DSFRG+QSPQLSSHHLLFNAAAAAA
Sbjct  121   NNSSMAISGTNSTVGSKAESSHIPQQHSEQQSYGSDSFRGTQSPQLSSHHLLFNAAAAAA  180

Query  180   AAAHLKSTAMQNNLSPIADQTPNSLRNYGHSSLNALCGIKPKQEMDARATPQSIDECRQP  239
             AA HLKSTAMQNNLSPI DQ  N+LRNYG  SLNALCGIKPKQEMDA+   Q +DEC  P
Sbjct  181   AAVHLKSTAMQNNLSPIGDQVQNNLRNYGQGSLNALCGIKPKQEMDAKTPLQPLDECPHP  240

Query  240   LAHPQAQPLYGGDFYDVGEAQAREASEAEGRAMTIEIRECNTES-DELKSNLQTHQQQTA  298
             L   QAQ  YGGD+YDV + QARE SE  GRA+ I +   +T S D+ +S+  +HQ    
Sbjct  241   LVQAQAQSQYGGDYYDVADPQAREISE--GRALIIGLGAPSTVSTDDAQSSAPSHQLAGT  298

Query  299   GQASQAPQYKSMSPGTGGSSNSGALTGPRPGATMINKTLSQGQQSPQNCTTPSAGSTTPD  358
             G+A Q  Q K MSPGT GSSN GA  G R   T I+KT SQGQQSPQ+ TTPS GSTTPD
Sbjct  299   GRALQTHQCKPMSPGTVGSSNLGA--GRRSAPTTISKTFSQGQQSPQHSTTPSGGSTTPD  356

Query  359   IKYNNDKMTSEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLG  418
             IKYNNDKM +EIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLG
Sbjct  357   IKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLG  416

Query  419   THGVTGTTNLVGNITPGSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRF  478
             THGVTG+ NL G+ITP SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRF
Sbjct  417   THGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRF  476

Query  479   KQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNIC  538
             KQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNIC
Sbjct  477   KQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNIC  536

Query  539   GKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHV  598
             GKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHV
Sbjct  537   GKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHV  596

Query  599   HKEKNTAPGGSALSHFNDLNQDATGSESGNGTGTTNEQISAQCTSESNCAQSSQLTTAGC  658
             HKEK+  PGGSA S F++LNQ  TG  +GNGTG++NEQI+ QCT+ESN  Q+    T G 
Sbjct  597   HKEKSPPPGGSASSQFSELNQIVTG--NGNGTGSSNEQIATQCTTESNSHQA----TVG-  649

Query  659   SNFIDSYLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVF  718
             S+ IDS+LGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVF
Sbjct  650   SSLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVF  709

Query  719   THENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSATGNRIGIVDA  778
             THENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASS    RIGI DA
Sbjct  710   THENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSGASTRIGIADA  769

Query  779   GNVLPMGAHNSEGSISKCPSPSANSECSSNGRLTSSTTSDQDQDVEHGL---SENESSNQ  835
             GNVLP GAHNS+GS SKCPSPSANSECSSNGRL+SSTTSDQDQD++HGL     +  +N 
Sbjct  770   GNVLPTGAHNSDGSNSKCPSPSANSECSSNGRLSSSTTSDQDQDIDHGLSENENSNQNNI  829

Query  836   NNVTSLNNNNCTSNNSSSNKIAELRLPGSGQYPIDADLHVANRMSLMAAAAAAVAASRPQ  895
              + T+ NNN  ++NN+SS+K+AELRLPG+GQY +DA+LHVANRMSLMAAAAAAVAASRPQ
Sbjct  830   GSSTNNNNNCTSNNNASSHKMAELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQ  889

Query  896   DGVEASAVPSAAVQAAVVNLAAAMRMNNPTSNGPSPYQQHHGDHTHSHHSH---------  946
             DGV+ SAVPSAAVQAAVVNLAAAMRMNN +SNG +PYQQHH DHT +H +H         
Sbjct  890   DGVDTSAVPSAAVQAAVVNLAAAMRMNN-SSNGATPYQQHHADHTQAHQTHILQHAHPHH  948

Query  947   --PHHHQQNQQQQLPHLLVHTHPSNSNSRSQRSPNLNVPNLQNESS----AMNINVHMMR  1000
                    Q+QQQQL HLLVHTHPSNSNSRSQ SPN+NVP+LQNES+    AMN+NVHMMR
Sbjct  949   HQQQQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAMNMNVHMMR  1008

Query  1001  GGLDPDQNQGGIHDIDVL------HQQQQHHQTSNFSQHAAAPTNLQTPSHPQAHHTSHH  1054
             G LDPD + GG+H I+VL      H    HH TSN+ QHA  PTN  T  HPQ H T+HH
Sbjct  1009  GSLDPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVTPTNQHTHPHPQTHQTAHH  1068

Query  1055  HSDSDTALRMHQAEVILRSHSEAAFRLATASGPGPGVK--SDNNN--------ASVMPSN  1104
             H+  +TALRMHQAE ILRSH+EAAFRLAT SGP  GVK  +D N         A      
Sbjct  1069  HTSPETALRMHQAEAILRSHTEAAFRLATGSGPDTGVKCEADQNQLNSNNAGNAGGNSGG  1128

Query  1105  NDHQHRFHSQSHQQEHQMPSNS  1126
             N  QHRFH+ S+ QE+Q PS+S
Sbjct  1129  NSQQHRFHASSNHQENQRPSDS  1150


>Q9V4C9_DROME unnamed protein product
Length=1140

 Score = 1471 bits (3807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 838/1162 (72%), Positives = 922/1162 (79%), Gaps = 58/1162 (5%)

Query  1     MKLRCFGQVQTTRSCQPRVKFRVRSNRPVGLLDQSRPVSRENNIGILVKKLFRMFKMDGA  60
             MKLRCF Q QT+ S  PR  FRV S+ P     +  P S +  IG L+     MFKMD A
Sbjct  1     MKLRCFNQAQTSHSWHPRSVFRVVSSCPPDRKKRPSPASWQICIGHLLTNYLGMFKMDSA  60

Query  61    DFWQQARAPFGLQTALHQYNSPPNQQPQHHPTVHHSISQEHELLAEVHSGVPIMGSGPVN  120
             DFWQQARAPFGLQTALHQY+SPPNQQP  H  +HHS+ QE+E LA V    P  GSG V 
Sbjct  61    DFWQQARAPFGLQTALHQYSSPPNQQPISHHALHHSVPQENEQLAGVQPEGPAAGSGVVG  120

Query  121   SSSSIVLSSPHPHLG-KVESSHILQQHPEQQSYVGDSFRGSQSPQLSSHHLLFNAAAAAA  179
             ++SS+ +S  +  +G K ESSHI QQH EQQSY  DSFRG+QSPQLSSHHLLFNAAAAAA
Sbjct  121   NNSSMAISGTNSTVGSKAESSHIPQQHSEQQSYGSDSFRGTQSPQLSSHHLLFNAAAAAA  180

Query  180   AAAHLKSTAMQNNLSPIADQTPNSLRNYGHSSLNALCGIKPKQEMDARATPQSIDECRQP  239
             AA HLKSTAMQNNLSPI DQ  N+LRNYG  SLNALCGIKPKQEMDA+   Q +DEC  P
Sbjct  181   AAVHLKSTAMQNNLSPIGDQVQNNLRNYGQGSLNALCGIKPKQEMDAKTPLQPLDECPHP  240

Query  240   LAHPQAQPLYGGDFYDVGEAQAREASEAEGRAMTIEIRECNTES-DELKSNLQTHQQQTA  298
             L   QAQ  YGGD+YDV + QARE SE  GRA+ I +   +T S D+ +S+  +HQ    
Sbjct  241   LVQAQAQSQYGGDYYDVADPQAREISE--GRALIIGLGAPSTVSTDDAQSSAPSHQLAGT  298

Query  299   GQASQAPQYKSMSPGTGGSSNSGALTGPRPGATMINKTLSQGQQSPQNCTTPSAGSTTPD  358
             G+A Q  Q K MSPGT GSSN GA  G R   T I+KT SQGQQSPQ+ TTPS GSTTPD
Sbjct  299   GRALQTHQCKPMSPGTVGSSNLGA--GRRSAPTTISKTFSQGQQSPQHSTTPSGGSTTPD  356

Query  359   IKYNNDKMTSEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLG  418
             IKYNNDKM +EIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLG
Sbjct  357   IKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLG  416

Query  419   THGVTGTTNLVGNITPGSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRF  478
             THGVTG+ NL G+ITP SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRF
Sbjct  417   THGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRF  476

Query  479   KQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNIC  538
             KQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNIC
Sbjct  477   KQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNIC  536

Query  539   GKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHV  598
             GKGFATESSLRTHTSK          QHAALIGGPNATSCPVCHKLFLGTEALVDHMKHV
Sbjct  537   GKGFATESSLRTHTSK----------QHAALIGGPNATSCPVCHKLFLGTEALVDHMKHV  586

Query  599   HKEKNTAPGGSALSHFNDLNQDATGSESGNGTGTTNEQISAQCTSESNCAQSSQLTTAGC  658
             HKEK+  PGGSA S F++LNQ  TG  +GNGTG++NEQI+ QCT+ESN  Q+    T G 
Sbjct  587   HKEKSPPPGGSASSQFSELNQIVTG--NGNGTGSSNEQIATQCTTESNSHQA----TVG-  639

Query  659   SNFIDSYLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVF  718
             S+ IDS+LGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVF
Sbjct  640   SSLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVF  699

Query  719   THENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSATGNRIGIVDA  778
             THENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASS    RIGI DA
Sbjct  700   THENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSGASTRIGIADA  759

Query  779   GNVLPMGAHNSEGSISKCPSPSANSECSSNGRLTSSTTSDQDQDVEHGL---SENESSNQ  835
             GNVLP GAHNS+GS SKCPSPSANSECSSNGRL+SSTTSDQDQD++HGL     +  +N 
Sbjct  760   GNVLPTGAHNSDGSNSKCPSPSANSECSSNGRLSSSTTSDQDQDIDHGLSENENSNQNNI  819

Query  836   NNVTSLNNNNCTSNNSSSNKIAELRLPGSGQYPIDADLHVANRMSLMAAAAAAVAASRPQ  895
              + T+ NNN  ++NN+SS+K+AELRLPG+GQY +DA+LHVANRMSLMAAAAAAVAASRPQ
Sbjct  820   GSSTNNNNNCTSNNNASSHKMAELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQ  879

Query  896   DGVEASAVPSAAVQAAVVNLAAAMRMNNPTSNGPSPYQQHHGDHTHSHHSH---------  946
             DGV+ SAVPSAAVQAAVVNLAAAMRMNN +SNG +PYQQHH DHT +H +H         
Sbjct  880   DGVDTSAVPSAAVQAAVVNLAAAMRMNN-SSNGATPYQQHHADHTQAHQTHILQHAHPHH  938

Query  947   --PHHHQQNQQQQLPHLLVHTHPSNSNSRSQRSPNLNVPNLQNESS----AMNINVHMMR  1000
                    Q+QQQQL HLLVHTHPSNSNSRSQ SPN+NVP+LQNES+    AMN+NVHMMR
Sbjct  939   HQQQQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAMNMNVHMMR  998

Query  1001  GGLDPDQNQGGIHDIDVL------HQQQQHHQTSNFSQHAAAPTNLQTPSHPQAHHTSHH  1054
             G LDPD + GG+H I+VL      H    HH TSN+ QHA  PTN  T  HPQ H T+HH
Sbjct  999   GSLDPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVTPTNQHTHPHPQTHQTAHH  1058

Query  1055  HSDSDTALRMHQAEVILRSHSEAAFRLATASGPGPGVK--SDNNN--------ASVMPSN  1104
             H+  +TALRMHQAE ILRSH+EAAFRLAT SGP  GVK  +D N         A      
Sbjct  1059  HTSPETALRMHQAEAILRSHTEAAFRLATGSGPDTGVKCEADQNQLNSNNAGNAGGNSGG  1118

Query  1105  NDHQHRFHSQSHQQEHQMPSNS  1126
             N  QHRFH+ S+ QE+Q PS+S
Sbjct  1119  NSQQHRFHASSNHQENQRPSDS  1140


>Q7K3X3_DROME unnamed protein product
Length=1097

 Score = 1463 bits (3787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 826/1109 (74%), Positives = 905/1109 (82%), Gaps = 48/1109 (4%)

Query  54    MFKMDGADFWQQARAPFGLQTALHQYNSPPNQQPQHHPTVHHSISQEHELLAEVHSGVPI  113
             MFKMD ADFWQQARAPFGLQTALHQY+SPPNQQP  H  +HHS+ QE+E LA V    P 
Sbjct  1     MFKMDSADFWQQARAPFGLQTALHQYSSPPNQQPISHHALHHSVPQENEQLAGVQPEGPA  60

Query  114   MGSGPVNSSSSIVLSSPHPHLG-KVESSHILQQHPEQQSYVGDSFRGSQSPQLSSHHLLF  172
              GSG V ++SS+ +S  +  +G K ESSHI QQH EQQSY  DSFRG+QSPQLSSHHLLF
Sbjct  61    AGSGVVGNNSSMAISGTNSTVGSKAESSHIPQQHSEQQSYGSDSFRGTQSPQLSSHHLLF  120

Query  173   NAAAAAAAAAHLKSTAMQNNLSPIADQTPNSLRNYGHSSLNALCGIKPKQEMDARATPQS  232
             NAAAAAAAA HLKSTAMQNNLSPI DQ  N+LRNYG  SLNALCGIKPKQEMDA+   Q 
Sbjct  121   NAAAAAAAAVHLKSTAMQNNLSPIGDQVQNNLRNYGQGSLNALCGIKPKQEMDAKTPLQP  180

Query  233   IDECRQPLAHPQAQPLYGGDFYDVGEAQAREASEAEGRAMTIEIRECNTES-DELKSNLQ  291
             +DEC  PL   QAQ  YGGD+YDV + QARE SE  GRA+ I +   +T S D+ +S+  
Sbjct  181   LDECPHPLVQAQAQSQYGGDYYDVADPQAREISE--GRALIIGLGAPSTVSTDDAQSSAP  238

Query  292   THQQQTAGQASQAPQYKSMSPGTGGSSNSGALTGPRPGATMINKTLSQGQQSPQNCTTPS  351
             +HQ    G+A Q  Q K MSPGT GSSN GA  G R   T I+KT SQGQQSPQ+ TTPS
Sbjct  239   SHQLAGTGRALQTHQCKPMSPGTVGSSNLGA--GRRSAPTTISKTFSQGQQSPQHSTTPS  296

Query  352   AGSTTPDIKYNNDKMTSEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQ  411
              GSTTPDIKYNNDKM +EIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQ
Sbjct  297   GGSTTPDIKYNNDKMANEIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQ  356

Query  412   IPRVGLGTHGVTGTTNLVGNITPGSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKC  471
             IPRVGLGTHGVTG+ NL G+ITP SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKC
Sbjct  357   IPRVGLGTHGVTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKC  416

Query  472   SYCDRRFKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNR  531
             SYCDRRFKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNR
Sbjct  417   SYCDRRFKQLSHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNR  476

Query  532   PFHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEAL  591
             PFHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEAL
Sbjct  477   PFHCNICGKGFATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEAL  536

Query  592   VDHMKHVHKEKNTAPGGSALSHFNDLNQDATGSESGNGTGTTNEQISAQCTSESNCAQSS  651
             VDHMKHVHKEK+  PGGSA S F++LNQ  TG  +GNGTG++NEQI+ QCT+ESN  Q+ 
Sbjct  537   VDHMKHVHKEKSPPPGGSASSQFSELNQIVTG--NGNGTGSSNEQIATQCTTESNSHQA-  593

Query  652   QLTTAGCSNFIDSYLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPC  711
                T G S+ IDS+LGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPC
Sbjct  594   ---TVG-SSLIDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPC  649

Query  712   SVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSATGN  771
             SVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASS    
Sbjct  650   SVCQAVFTHENGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSGAST  709

Query  772   RIGIVDAGNVLPMGAHNSEGSISKCPSPSANSECSSNGRLTSSTTSDQDQDVEHGL---S  828
             RIGI DAGNVLP GAHNS+GS SKCPSPSANSECSSNGRL+SSTTSDQDQD++HGL    
Sbjct  710   RIGIADAGNVLPTGAHNSDGSNSKCPSPSANSECSSNGRLSSSTTSDQDQDIDHGLSENE  769

Query  829   ENESSNQNNVTSLNNNNCTSNNSSSNKIAELRLPGSGQYPIDADLHVANRMSLMAAAAAA  888
              +  +N  + T+ NNN  ++NN+SS+K+AELRLPG+GQY +DA+LHVANRMSLMAAAAAA
Sbjct  770   NSNQNNIGSSTNNNNNCTSNNNASSHKMAELRLPGTGQYTMDAELHVANRMSLMAAAAAA  829

Query  889   VAASRPQDGVEASAVPSAAVQAAVVNLAAAMRMNNPTSNGPSPYQQHHGDHTHSHHSH--  946
             VAASRPQDGV+ SAVPSAAVQAAVVNLAAAMRMNN +SNG +PYQQHH DHT +H +H  
Sbjct  830   VAASRPQDGVDTSAVPSAAVQAAVVNLAAAMRMNN-SSNGATPYQQHHADHTQAHQTHIL  888

Query  947   ---------PHHHQQNQQQQLPHLLVHTHPSNSNSRSQRSPNLNVPNLQNESS----AMN  993
                           Q+QQQQL HLLVHTHPSNSNSRSQ SPN+NVP+LQNES+    AMN
Sbjct  889   QHAHPHHHQQQQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAMN  948

Query  994   INVHMMRGGLDPDQNQGGIHDIDVL------HQQQQHHQTSNFSQHAAAPTNLQTPSHPQ  1047
             +NVHMMRG LDPD + GG+H I+VL      H    HH TSN+ QHA  PTN  T  HPQ
Sbjct  949   MNVHMMRGSLDPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVTPTNQHTHPHPQ  1008

Query  1048  AHHTSHHHSDSDTALRMHQAEVILRSHSEAAFRLATASGPGPGVK--SDNNN--------  1097
              H T+HHH+  +TALRMHQAE ILRSH+EAAFRLAT SGP  GVK  +D N         
Sbjct  1009  THQTAHHHTSPETALRMHQAEAILRSHTEAAFRLATGSGPDTGVKCEADQNQLNSNNAGN  1068

Query  1098  ASVMPSNNDHQHRFHSQSHQQEHQMPSNS  1126
             A      N  QHRFH+ S+ QE+Q PS+S
Sbjct  1069  AGGNSGGNSQQHRFHASSNHQENQRPSDS  1097



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


Query= XP_017062608.1 uncharacterized protein LOC108102327 isoform X2
[Drosophila eugracilis]

Length=765
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H9XVN7_DROME  unnamed protein product                                 1108    0.0  
Q7K3X3_DROME  unnamed protein product                                 1092    0.0  
Q7KQN5_DROME  unnamed protein product                                 1090    0.0  


>H9XVN7_DROME unnamed protein product
Length=791

 Score = 1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 623/799 (78%), Positives = 676/799 (85%), Gaps = 42/799 (5%)

Query  1    MTLDCEQEHDLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHG  60
            MTLDCE+EHDLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHG
Sbjct  1    MTLDCEKEHDLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHG  60

Query  61   VTGTTNLVGNITPGSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQL  120
            VTG+ NL G+ITP SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQL
Sbjct  61   VTGSANLGGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQL  120

Query  121  SHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKG  180
            SHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKG
Sbjct  121  SHVQQHTRLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKG  180

Query  181  FATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKE  240
            FATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKE
Sbjct  181  FATESSLRTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKE  240

Query  241  KNTAPGGSALSHFNDLNQDATGSESGNGTGTTNEQISAQCTSESNCAQSSQLTTAGCSNF  300
            K+  PGGSA S F++LNQ  TG  +GNGTG++NEQI+ QCT+ESN  Q+    T G S+ 
Sbjct  241  KSPPPGGSASSQFSELNQIVTG--NGNGTGSSNEQIATQCTTESNSHQA----TVG-SSL  293

Query  301  IDSYLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHE  360
            IDS+LGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHE
Sbjct  294  IDSFLGKRRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHE  353

Query  361  NGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSATGNRIGIVDAGNV  420
            NGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASS    RIGI DAGNV
Sbjct  354  NGLLTHMESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSGASTRIGIADAGNV  413

Query  421  LPMGAHNSEGSISKCPSPSANSECSSNGRLTSSTTSDQDQDVEHGL---SENESSNQNNV  477
            LP GAHNS+GS SKCPSPSANSECSSNGRL+SSTTSDQDQD++HGL     +  +N  + 
Sbjct  414  LPTGAHNSDGSNSKCPSPSANSECSSNGRLSSSTTSDQDQDIDHGLSENENSNQNNIGSS  473

Query  478  TSLNNNNCTSNNSSSNKIAELRLPGSGQYPIDADLHVANRMSLMAAAAAAVAASRPQDGV  537
            T+ NNN  ++NN+SS+K+AELRLPG+GQY +DA+LHVANRMSLMAAAAAAVAASRPQDGV
Sbjct  474  TNNNNNCTSNNNASSHKMAELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQDGV  533

Query  538  EASAVPSAAVQAAVVNLAAAMRMNNPTSNGPSPYQQHHGDHTHSHHSH-----------P  586
            + SAVPSAAVQAAVVNLAAAMRMNN +SNG +PYQQHH DHT +H +H            
Sbjct  534  DTSAVPSAAVQAAVVNLAAAMRMNN-SSNGATPYQQHHADHTQAHQTHILQHAHPHHHQQ  592

Query  587  HHHQQNQQQQLPHLLVHTHPSNSNSRSQRSPNLNVPNLQNESS----AMNINVHMMRGGL  642
                Q+QQQQL HLLVHTHPSNSNSRSQ SPN+NVP+LQNES+    AMN+NVHMMRG L
Sbjct  593  QQAPQHQQQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAMNMNVHMMRGSL  652

Query  643  DPDQNQGGIHDIDVL------HQQQQHHQTSNFSQHAAAPTNLQTPSHPQAHHTSHHHSD  696
            DPD + GG+H I+VL      H    HH TSN+ QHA  PTN  T  HPQ H T+HHH+ 
Sbjct  653  DPDPSLGGMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVTPTNQHTHPHPQTHQTAHHHTS  712

Query  697  SDTALRMHQAEVILRSHSEAAFRLATASGPGPGVK--SDNNN--------ASVMPSNNDH  746
             +TALRMHQAE ILRSH+EAAFRLAT SGP  GVK  +D N         A      N  
Sbjct  713  PETALRMHQAEAILRSHTEAAFRLATGSGPDTGVKCEADQNQLNSNNAGNAGGNSGGNSQ  772

Query  747  QHRFHSQSHQQEHQMPSNS  765
            QHRFH+ S+ QE+Q PS+S
Sbjct  773  QHRFHASSNHQENQRPSDS  791


>Q7K3X3_DROME unnamed protein product
Length=1097

 Score = 1092 bits (2825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/792 (78%), Positives = 667/792 (84%), Gaps = 42/792 (5%)

Query  8     EHDLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTGTTNL  67
             E  LQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTG+ NL
Sbjct  314   EIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTGSANL  373

Query  68    VGNITPGSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHT  127
              G+ITP SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHT
Sbjct  374   GGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHT  433

Query  128   RLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSL  187
             RLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSL
Sbjct  434   RLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSL  493

Query  188   RTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKNTAPGG  247
             RTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEK+  PGG
Sbjct  494   RTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGG  553

Query  248   SALSHFNDLNQDATGSESGNGTGTTNEQISAQCTSESNCAQSSQLTTAGCSNFIDSYLGK  307
             SA S F++LNQ  TG  +GNGTG++NEQI+ QCT+ESN  Q+    T G S+ IDS+LGK
Sbjct  554   SASSQFSELNQIVTG--NGNGTGSSNEQIATQCTTESNSHQA----TVG-SSLIDSFLGK  606

Query  308   RRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHM  367
             RRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHM
Sbjct  607   RRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHM  666

Query  368   ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSATGNRIGIVDAGNVLPMGAHN  427
             ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASS    RIGI DAGNVLP GAHN
Sbjct  667   ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSGASTRIGIADAGNVLPTGAHN  726

Query  428   SEGSISKCPSPSANSECSSNGRLTSSTTSDQDQDVEHGL---SENESSNQNNVTSLNNNN  484
             S+GS SKCPSPSANSECSSNGRL+SSTTSDQDQD++HGL     +  +N  + T+ NNN 
Sbjct  727   SDGSNSKCPSPSANSECSSNGRLSSSTTSDQDQDIDHGLSENENSNQNNIGSSTNNNNNC  786

Query  485   CTSNNSSSNKIAELRLPGSGQYPIDADLHVANRMSLMAAAAAAVAASRPQDGVEASAVPS  544
              ++NN+SS+K+AELRLPG+GQY +DA+LHVANRMSLMAAAAAAVAASRPQDGV+ SAVPS
Sbjct  787   TSNNNASSHKMAELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQDGVDTSAVPS  846

Query  545   AAVQAAVVNLAAAMRMNNPTSNGPSPYQQHHGDHTHSHHSH-----------PHHHQQNQ  593
             AAVQAAVVNLAAAMRMNN +SNG +PYQQHH DHT +H +H                Q+Q
Sbjct  847   AAVQAAVVNLAAAMRMNN-SSNGATPYQQHHADHTQAHQTHILQHAHPHHHQQQQAPQHQ  905

Query  594   QQQLPHLLVHTHPSNSNSRSQRSPNLNVPNLQNESS----AMNINVHMMRGGLDPDQNQG  649
             QQQL HLLVHTHPSNSNSRSQ SPN+NVP+LQNES+    AMN+NVHMMRG LDPD + G
Sbjct  906   QQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAMNMNVHMMRGSLDPDPSLG  965

Query  650   GIHDIDVL------HQQQQHHQTSNFSQHAAAPTNLQTPSHPQAHHTSHHHSDSDTALRM  703
             G+H I+VL      H    HH TSN+ QHA  PTN  T  HPQ H T+HHH+  +TALRM
Sbjct  966   GMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVTPTNQHTHPHPQTHQTAHHHTSPETALRM  1025

Query  704   HQAEVILRSHSEAAFRLATASGPGPGVK--SDNNN--------ASVMPSNNDHQHRFHSQ  753
             HQAE ILRSH+EAAFRLAT SGP  GVK  +D N         A      N  QHRFH+ 
Sbjct  1026  HQAEAILRSHTEAAFRLATGSGPDTGVKCEADQNQLNSNNAGNAGGNSGGNSQQHRFHAS  1085

Query  754   SHQQEHQMPSNS  765
             S+ QE+Q PS+S
Sbjct  1086  SNHQENQRPSDS  1097


>Q7KQN5_DROME unnamed protein product
Length=1150

 Score = 1090 bits (2820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 615/792 (78%), Positives = 667/792 (84%), Gaps = 42/792 (5%)

Query  8     EHDLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTGTTNL  67
             E  LQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTG+ NL
Sbjct  367   EIQLQLSRSSSAAAISERTLEECWSTLQRLFMHKSAMQQIQQQIPRVGLGTHGVTGSANL  426

Query  68    VGNITPGSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHT  127
              G+ITP SDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHT
Sbjct  427   GGSITPSSDTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHT  486

Query  128   RLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSL  187
             RLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSL
Sbjct  487   RLHTGERPYKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSL  546

Query  188   RTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKNTAPGG  247
             RTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEK+  PGG
Sbjct  547   RTHTSKELQLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGG  606

Query  248   SALSHFNDLNQDATGSESGNGTGTTNEQISAQCTSESNCAQSSQLTTAGCSNFIDSYLGK  307
             SA S F++LNQ  TG  +GNGTG++NEQI+ QCT+ESN  Q+    T G S+ IDS+LGK
Sbjct  607   SASSQFSELNQIVTG--NGNGTGSSNEQIATQCTTESNSHQA----TVG-SSLIDSFLGK  659

Query  308   RRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHM  367
             RRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHM
Sbjct  660   RRTANHPCPVCGKHYVNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHM  719

Query  368   ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSATGNRIGIVDAGNVLPMGAHN  427
             ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASS    RIGI DAGNVLP GAHN
Sbjct  720   ESMRMDPKHQFAAQYVLSRAAAEQRERESLLAVTLAASSGASTRIGIADAGNVLPTGAHN  779

Query  428   SEGSISKCPSPSANSECSSNGRLTSSTTSDQDQDVEHGL---SENESSNQNNVTSLNNNN  484
             S+GS SKCPSPSANSECSSNGRL+SSTTSDQDQD++HGL     +  +N  + T+ NNN 
Sbjct  780   SDGSNSKCPSPSANSECSSNGRLSSSTTSDQDQDIDHGLSENENSNQNNIGSSTNNNNNC  839

Query  485   CTSNNSSSNKIAELRLPGSGQYPIDADLHVANRMSLMAAAAAAVAASRPQDGVEASAVPS  544
              ++NN+SS+K+AELRLPG+GQY +DA+LHVANRMSLMAAAAAAVAASRPQDGV+ SAVPS
Sbjct  840   TSNNNASSHKMAELRLPGTGQYTMDAELHVANRMSLMAAAAAAVAASRPQDGVDTSAVPS  899

Query  545   AAVQAAVVNLAAAMRMNNPTSNGPSPYQQHHGDHTHSHHSH-----------PHHHQQNQ  593
             AAVQAAVVNLAAAMRMNN +SNG +PYQQHH DHT +H +H                Q+Q
Sbjct  900   AAVQAAVVNLAAAMRMNN-SSNGATPYQQHHADHTQAHQTHILQHAHPHHHQQQQAPQHQ  958

Query  594   QQQLPHLLVHTHPSNSNSRSQRSPNLNVPNLQNESS----AMNINVHMMRGGLDPDQNQG  649
             QQQL HLLVHTHPSNSNSRSQ SPN+NVP+LQNES+    AMN+NVHMMRG LDPD + G
Sbjct  959   QQQLSHLLVHTHPSNSNSRSQSSPNINVPSLQNESTAASIAMNMNVHMMRGSLDPDPSLG  1018

Query  650   GIHDIDVL------HQQQQHHQTSNFSQHAAAPTNLQTPSHPQAHHTSHHHSDSDTALRM  703
             G+H I+VL      H    HH TSN+ QHA  PTN  T  HPQ H T+HHH+  +TALRM
Sbjct  1019  GMHGIEVLHQHQQQHHHHHHHHTSNYPQHAVTPTNQHTHPHPQTHQTAHHHTSPETALRM  1078

Query  704   HQAEVILRSHSEAAFRLATASGPGPGVK--SDNNN--------ASVMPSNNDHQHRFHSQ  753
             HQAE ILRSH+EAAFRLAT SGP  GVK  +D N         A      N  QHRFH+ 
Sbjct  1079  HQAEAILRSHTEAAFRLATGSGPDTGVKCEADQNQLNSNNAGNAGGNSGGNSQQHRFHAS  1138

Query  754   SHQQEHQMPSNS  765
             S+ QE+Q PS+S
Sbjct  1139  SNHQENQRPSDS  1150



Lambda      K        H
   0.322    0.138    0.381 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2822367538


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062609.2 glutamate receptor ionotropic, kainate 1 isoform X3
[Drosophila eugracilis]

Length=910
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q0KIF2_DROME  unnamed protein product                                 970     0.0  
A0A023GQ97_DROME  unnamed protein product                             965     0.0  
Q9V4E9_DROME  unnamed protein product                                 711     0.0  


>Q0KIF2_DROME unnamed protein product
Length=899

 Score = 970 bits (2507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/893 (54%), Positives = 628/893 (70%), Gaps = 42/893 (5%)

Query  27   YIIFSTLIIANALPPVIRVGAIFAEDERESSVESAFKYAIYRINKEKTLLPNTQLVYDIE  86
            +++F  L     +PP++R+GAIF+      + E AF+YAI+R+N +K+LLP T + Y +E
Sbjct  7    FLLFQFLSYGLGVPPLVRIGAIFSNQPGMYNSELAFRYAIHRLNMDKSLLPETTVDYYVE  66

Query  87   YVPRDDSFRTTKKVCRQLEAGVQAIFGPTDALLAGHVQSICEAYDIPHIEVRIDLENNSK  146
            YV R DSF T +KVC+ +  GVQA+F PTD++LA H+ SIC+A DIP+I        ++ 
Sbjct  67   YVNRFDSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIG------RSAH  120

Query  147  ELSINLYPSYTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMYIRQASP  206
            + SIN+YPS  L+  A+ D++ YLNWT+  I++E++ G+ NL   S     E+++RQ S 
Sbjct  121  DFSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINLHQLSRSFHGEVHMRQVSR  180

Query  207  ESYRQVLRAIRQKEIYKIIVDTNPSHIKTFFRSILQLQMNDHRYHYMFTTFDLETYDLED  266
            +SY   L   + KEI+ II+DTN + I    ++ILQ QMN+++YHY+FT+FDLETYDLED
Sbjct  181  DSYVSALNEFKGKEIHNIIIDTNSNGISILLKNILQQQMNEYKYHYLFTSFDLETYDLED  240

Query  267  FRYNSVNITAFRLVDVNSKRYLEVIDQMQKLQHNGLE------NINGIPYIQTESALMFD  320
            F+YN VNIT+FRLVD       +++  +    H+  +      +I     +++E ALMFD
Sbjct  241  FKYNFVNITSFRLVDTADVGVKQILKDIGLYSHHIFKKPYLNLHIKKSTILESEPALMFD  300

Query  321  SVYAFASGLHFLNLDGPPNFSIKNLSCTSDQTWENGLLLYNHINTAITDGLTGNINFVEG  380
            SVY FA GL    L+   + ++ N+SC  + +W+ GL L N++N     GLTG I F +G
Sbjct  301  SVYVFAIGLQ--TLEQSHSLTLLNISCEEENSWDGGLSLINYLNAVEWKGLTGPIQFKDG  358

Query  381  RRNNFKLDILKLKQEKIQKVGYWHPVSGVNISDPTAFYDSNIANITLVVMTREERPYVMV  440
            +R  FKLD++KLKQ  I KVG W P   +NI++P+ F+D+   N+TLVV+T  E PYVM+
Sbjct  359  QRVQFKLDLIKLKQHSIVKVGEWTPHGHLNITEPSMFFDAGSMNVTLVVITILETPYVMM  418

Query  441  KEEKNLTGNIRFEGFCIDLLKAIAQQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELME  500
               KN TGN RF GFC+D+L+ I+++VGF Y ++LVPD  YG   PET  WNG+V +LM+
Sbjct  419  HYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMK  478

Query  501  RRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYV  560
             +ADLAV SMTI YARESVIDFTKPFMNLGI ILFKVPTS+PTRLFSFMNPLAIEIW+YV
Sbjct  479  YKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYV  538

Query  561  LAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSVSNSFWFITGTFLRQGSGIN  620
            L AY LVS  ++++ + SP EWK  + C  E   + NQFS+++SFWF  GTF++Q   I 
Sbjct  539  LIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIY  598

Query  621  PKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESATDLAEQTEISYGTLEG  680
            P+A STRI+   W FF LII++SYTANLAAFLT ERMI+PIE+A DLA QTEISYGTL+ 
Sbjct  599  PRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDS  658

Query  681  GSTMTFFRDSKIGVYQKMWRYMENRKSAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQ  740
            GSTMTFFRDS I  Y+K+WR M+N+K + F  TYEDGIKRV +G+YAFLMESTMLDY VQ
Sbjct  659  GSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQ  718

Query  741  RDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCN  800
            RDCNLTQIGGLLD+KGYGIATPKGSPWRDKISLAILELQE+G IQ+LYDKWWKNT + C 
Sbjct  719  RDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCT  778

Query  801  RDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWN-----------------  843
            R + SK+SKAN+LG+E+IGGVFVVL+ G+ +A VVA FEF +N                 
Sbjct  779  RKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWYNFRYNYEATPSQSVVNNK  838

Query  844  --------SRKNMNIENQSLCSEMAQELRFAMHCHGSKTQHRPR-KRSCLKCT  887
                    S +N    ++S   E+A+ELR+A  C     Q RP   R+C KCT
Sbjct  839  YNQDGILESERNYTPPDRSFWIEIAEELRYASWCMNK--QKRPALTRTCSKCT  889


>A0A023GQ97_DROME unnamed protein product
Length=898

 Score = 965 bits (2494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/893 (54%), Positives = 627/893 (70%), Gaps = 43/893 (5%)

Query  27   YIIFSTLIIANALPPVIRVGAIFAEDERESSVESAFKYAIYRINKEKTLLPNTQLVYDIE  86
            +++F  L     +PP++R+GAIF+      + E AF+YAI+R+N +K+LLP T + Y +E
Sbjct  7    FLLFQFLSYGLGVPPLVRIGAIFSNQPGMYNSELAFRYAIHRLNMDKSLLPETTVDYYVE  66

Query  87   YVPRDDSFRTTKKVCRQLEAGVQAIFGPTDALLAGHVQSICEAYDIPHIEVRIDLENNSK  146
            YV R DSF T +KVC+ +  GVQA+F PTD++LA H+ SIC+A DIP+I        ++ 
Sbjct  67   YVNRFDSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIG------RSAH  120

Query  147  ELSINLYPSYTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMYIRQASP  206
            + SIN+YPS  L+  A+ D++ YLNWT+  I++E++ G+ NL   S     E+++RQ S 
Sbjct  121  DFSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINLHQLSRSFHGEVHMRQVSR  180

Query  207  ESYRQVLRAIRQKEIYKIIVDTNPSHIKTFFRSILQLQMNDHRYHYMFTTFDLETYDLED  266
            +SY   L   + KEI+ II+DTN + I    ++ILQ QMN+++YHY+FT+FDLETYDLED
Sbjct  181  DSYVSALNEFKGKEIHNIIIDTNSNGISILLKNILQQQMNEYKYHYLFTSFDLETYDLED  240

Query  267  FRYNSVNITAFRLVDVNSKRYLEVIDQMQKLQHNGLE------NINGIPYIQTESALMFD  320
            F+YN VNIT+FRLVD       +++  +    H+  +      +I     +++E ALMFD
Sbjct  241  FKYNFVNITSFRLVDTADVGVKQILKDIGLYSHHIFKKPYLNLHIKKSTILESEPALMFD  300

Query  321  SVYAFASGLHFLNLDGPPNFSIKNLSCTSDQTWENGLLLYNHINTAITDGLTGNINFVEG  380
            SVY FA GL    L+   + ++ N+SC  + +W+ GL L N++N     GLTG I F +G
Sbjct  301  SVYVFAIGLQ--TLEQSHSLTLLNISCEEENSWDGGLSLINYLNAVEWKGLTGPIQFKDG  358

Query  381  RRNNFKLDILKLKQEKIQKVGYWHPVSGVNISDPTAFYDSNIANITLVVMTREERPYVMV  440
            +R  FKLD++KLKQ  I KVG W P   +NI++P+ F+D+   N+TLVV+T  E PYVM+
Sbjct  359  QRVQFKLDLIKLKQHSIVKVGEWTPHGHLNITEPSMFFDAGSMNVTLVVITILETPYVMM  418

Query  441  KEEKNLTGNIRFEGFCIDLLKAIAQQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELME  500
               KN TGN RF GFC+D+L+ I+++VGF Y ++LVPD  YG   PET  WNG+V +LM 
Sbjct  419  HYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLM-  477

Query  501  RRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYV  560
            + ADLAV SMTI YARESVIDFTKPFMNLGI ILFKVPTS+PTRLFSFMNPLAIEIW+YV
Sbjct  478  KYADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYV  537

Query  561  LAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSVSNSFWFITGTFLRQGSGIN  620
            L AY LVS  ++++ + SP EWK  + C  E   + NQFS+++SFWF  GTF++Q   I 
Sbjct  538  LIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIY  597

Query  621  PKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESATDLAEQTEISYGTLEG  680
            P+A STRI+   W FF LII++SYTANLAAFLT ERMI+PIE+A DLA QTEISYGTL+ 
Sbjct  598  PRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDS  657

Query  681  GSTMTFFRDSKIGVYQKMWRYMENRKSAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQ  740
            GSTMTFFRDS I  Y+K+WR M+N+K + F  TYEDGIKRV +G+YAFLMESTMLDY VQ
Sbjct  658  GSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQ  717

Query  741  RDCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCN  800
            RDCNLTQIGGLLD+KGYGIATPKGSPWRDKISLAILELQE+G IQ+LYDKWWKNT + C 
Sbjct  718  RDCNLTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWKNTDETCT  777

Query  801  RDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWN-----------------  843
            R + SK+SKAN+LG+E+IGGVFVVL+ G+ +A VVA FEF +N                 
Sbjct  778  RKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFEFWYNFRYNYEATPSQSVVNNK  837

Query  844  --------SRKNMNIENQSLCSEMAQELRFAMHCHGSKTQHRPR-KRSCLKCT  887
                    S +N    ++S   E+A+ELR+A  C     Q RP   R+C KCT
Sbjct  838  YNQDGILESERNYTPPDRSFWIEIAEELRYASWCMNK--QKRPALTRTCSKCT  888


>Q9V4E9_DROME unnamed protein product
Length=669

 Score = 711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/668 (52%), Positives = 469/668 (70%), Gaps = 14/668 (2%)

Query  27   YIIFSTLIIANALPPVIRVGAIFAEDERESSVESAFKYAIYRINKEKTLLPNTQLVYDIE  86
            +++F  L     +PP++R+GAIF+      + E AF+YAI+R+N +K+LLP T + Y +E
Sbjct  7    FLLFQFLSYGLGVPPLVRIGAIFSNQPGMYNSELAFRYAIHRLNMDKSLLPETTVDYYVE  66

Query  87   YVPRDDSFRTTKKVCRQLEAGVQAIFGPTDALLAGHVQSICEAYDIPHIEVRIDLENNSK  146
            YV R DSF T +KVC+ +  GVQA+F PTD++LA H+ SIC+A DIP+I        ++ 
Sbjct  67   YVNRFDSFETVQKVCKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIG------RSAH  120

Query  147  ELSINLYPSYTLLTLAYRDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAEMYIRQASP  206
            + SIN+YPS  L+  A+ D++ YLNWT+  I++E++ G+ NL   S     E+++RQ S 
Sbjct  121  DFSINVYPSKQLVNYAFNDVIQYLNWTRFGILHEKENGIINLHQLSRSFHGEVHMRQVSR  180

Query  207  ESYRQVLRAIRQKEIYKIIVDTNPSHIKTFFRSILQLQMNDHRYHYMFTTFDLETYDLED  266
            +SY   L   + KEI+ II+DTN + I    ++ILQ QMN+++YHY+FT+FDLETYDLED
Sbjct  181  DSYVSALNEFKGKEIHNIIIDTNSNGISILLKNILQQQMNEYKYHYLFTSFDLETYDLED  240

Query  267  FRYNSVNITAFRLVDVNSKRYLEVIDQMQKLQHNGLE------NINGIPYIQTESALMFD  320
            F+YN VNIT+FRLVD       +++  +    H+  +      +I     +++E ALMFD
Sbjct  241  FKYNFVNITSFRLVDTADVGVKQILKDIGLYSHHIFKKPYLNLHIKKSTILESEPALMFD  300

Query  321  SVYAFASGLHFLNLDGPPNFSIKNLSCTSDQTWENGLLLYNHINTAITDGLTGNINFVEG  380
            SVY FA GL    L+   + ++ N+SC  + +W+ GL L N++N     GLTG I F +G
Sbjct  301  SVYVFAIGLQ--TLEQSHSLTLLNISCEEENSWDGGLSLINYLNAVEWKGLTGPIQFKDG  358

Query  381  RRNNFKLDILKLKQEKIQKVGYWHPVSGVNISDPTAFYDSNIANITLVVMTREERPYVMV  440
            +R  FKLD++KLKQ  I KVG W P   +NI++P+ F+D+   N+TLVV+T  E PYVM+
Sbjct  359  QRVQFKLDLIKLKQHSIVKVGEWTPHGHLNITEPSMFFDAGSMNVTLVVITILETPYVMM  418

Query  441  KEEKNLTGNIRFEGFCIDLLKAIAQQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELME  500
               KN TGN RF GFC+D+L+ I+++VGF Y ++LVPD  YG   PET  WNG+V +LM+
Sbjct  419  HYGKNFTGNERFYGFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMK  478

Query  501  RRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYV  560
             +ADLAV SMTI YARESVIDFTKPFMNLGI ILFKVPTS+PTRLFSFMNPLAIEIW+YV
Sbjct  479  YKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYV  538

Query  561  LAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSVSNSFWFITGTFLRQGSGIN  620
            L AY LVS  ++++ + SP EWK  + C  E   + NQFS+++SFWF  GTF++Q   I 
Sbjct  539  LIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIY  598

Query  621  PKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESATDLAEQTEISYGTLEG  680
            P+A STRI+   W FF LII++SYTANLAAFLT ERMI+PIE+A DLA QTEISYGTL+ 
Sbjct  599  PRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDS  658

Query  681  GSTMTFFR  688
            GSTMTFFR
Sbjct  659  GSTMTFFR  666



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062610.1 osmotic avoidance abnormal protein 3 isoform X1
[Drosophila eugracilis]

Length=679
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM3_CAEEL  unnamed protein product                                   451     1e-149
KRP95_STRPU  unnamed protein product                                  382     8e-123
Q19633_CAEEL  unnamed protein product                                 377     3e-120


>OSM3_CAEEL unnamed protein product
Length=699

 Score = 451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 263/609 (43%), Positives = 357/609 (59%), Gaps = 36/609 (6%)

Query  1    MSENIKVVVRCRPMNQSENEKKRENIVEINEYSVSVANPSASLTQKKMFTFDSVYNTITK  60
            M+E+++V VRCRP NQ E +      V +   +V   N +A     K FTFD  Y   + 
Sbjct  1    MAESVRVAVRCRPFNQREKDLNTTLCVGMTP-NVGQVNLNAPDGAAKDFTFDGAYFMDST  59

Query  61   TDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDGNL-NNSGIIHKCFDHIFE  119
             + IYN++ + LVE+ IEGYNGT+FAYGQTG GKT +MQG   +    G+I + FDHIF 
Sbjct  60   GEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFT  119

Query  120  TISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHPVI  179
              +   NV++L   SYLEIYNE +RDLL  +   ++    +KE P  GV V  L+ H   
Sbjct  120  ATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKL---EIKEQPDRGVYVAGLSMHVCH  176

Query  180  NTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRRGK  239
            +   C   ++ G  NR   ATLMN+ SSRSH+IFT+ +E              G IR GK
Sbjct  177  DVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVE---------GMTETGSIRMGK  227

Query  240  LSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLTRL  299
            L+LVDLAGSERQSKTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+KH+P+RDSKLTRL
Sbjct  228  LNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRL  287

Query  300  LQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQYQN  359
            LQDSLGGNTKT+MI+C+SPS  +YDETLSTLRYA+RAKNI NKPTINEDPKDA LR+YQ 
Sbjct  288  LQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQE  347

Query  360  EILHLKRMLEETQQKSHYRNNDKI----------KSNELPMANLNDKYFNSKEHVDIIRS  409
            EI  LK M++           D            +  E  M +L  +Y   +     ++ 
Sbjct  348  EIARLKSMVQPGAVGVGAPAQDAFSIEEERKKLREEFEEAMNDLRGEYEREQTSKAELQ-  406

Query  410  IQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGGERVNDLGLKEKHK  469
                    K L+S+      ++    +    +A  +I  ++   IGGE   +  LK+K  
Sbjct  407  --------KDLESLRADYERANANLDNLNPEEAAKKIQQLQDQFIGGEEAGNTQLKQKRM  458

Query  470  AQKCAAQRHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKCKEKIKMLEMEV  529
             Q   A+     +A AL+  K  D  LLQ  Y+   ++++     + K  +K K  E E+
Sbjct  459  KQLKEAETKTQKLAAALNVHK--DDPLLQ-VYSTTQEKLDAVTSQLEKEVKKSKGYEREI  515

Query  530  SDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPETVMQNSSWNED  589
             DL+ EF+LDR DYLD IR   + ++   Q++ K  P+ +K+      + + + + WNED
Sbjct  516  EDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNVDRIKKEAVWNED  575

Query  590  LKTWRIPEI  598
               W +PE+
Sbjct  576  ESRWILPEM  584


>KRP95_STRPU unnamed protein product
Length=742

 Score = 382 bits (982),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 203/372 (55%), Positives = 260/372 (70%), Gaps = 12/372 (3%)

Query  2    SENIKVVVRCRPMNQSENEKKRENIVEINEYS--VSVANPSASLTQK-KMFTFDSVYNTI  58
            +E +KVVVRCRPMN  E  +  + IVE++     V V NP     +  K FTFD+VY+  
Sbjct  6    AETVKVVVRCRPMNSKEISQGHKRIVEMDNKRGLVEVTNPKGPPGEPNKSFTFDTVYDWN  65

Query  59   TKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNSGIIHKCFDHI  117
            +K   +Y+E   SLVES ++G+NGTIFAYGQTG GKT TM+G   N    G+I   F+HI
Sbjct  66   SKQIDLYDETFRSLVESVLQGFNGTIFAYGQTGTGKTFTMEGVRSNPELRGVIPNSFEHI  125

Query  118  FETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHP  177
            F  I+   N ++L   SYLEIY E IRDLL  ++  R+    LKE P  GV V  L++  
Sbjct  126  FTHIARTQNQQFLVRASYLEIYQEEIRDLLAKDQKKRL---DLKERPDTGVYVKDLSSFV  182

Query  178  VINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRR  237
              +  +  + +++GN NR   +T MNE SSRSH IF IT+E S     V  EN+   IR 
Sbjct  183  TKSVKEIEHVMTVGNNNRSVGSTNMNEHSSRSHAIFIITIECSEL--GVDGENH---IRV  237

Query  238  GKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLT  297
            GKL+LVDLAGSERQ+KTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+ H+P+RDSKLT
Sbjct  238  GKLNLVDLAGSERQAKTGATGDRLKEATKINLSLSALGNVISALVDGKSSHIPYRDSKLT  297

Query  298  RLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQY  357
            RLLQDSLGGN KT+M++ + P+  ++DET++TLRYA+RAKNI NKP INEDPKDA LR++
Sbjct  298  RLLQDSLGGNAKTVMVANMGPASYNFDETITTLRYANRAKNIKNKPKINEDPKDALLREF  357

Query  358  QNEILHLKRMLE  369
            Q EI  LK+ L+
Sbjct  358  QEEISRLKQALD  369


>Q19633_CAEEL unnamed protein product
Length=782

 Score = 377 bits (968),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 246/642 (38%), Positives = 352/642 (55%), Gaps = 50/642 (8%)

Query  3    ENIKVVVRCRPMNQSENEKKRENIVEINEY--SVSVANPSASLTQKKMFTFDSVYNTITK  60
            E +KV+VRCRP++  E       IV +      + + NP       K FTFD++Y+  + 
Sbjct  12   ETVKVIVRCRPLSSQEIANNYSKIVHMRPQRGQIELKNPKEQDEPSKDFTFDAIYDENST  71

Query  61   TDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNSGIIHKCFDHIFE  119
               +Y E    LV+S + GYN TIFAYGQTG GKTHTM+G   +    G+I+KC DHIFE
Sbjct  72   QSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFE  131

Query  120  TISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHPVI  179
             ++ + N  YL   SYLEIY E +RDLL    N ++    +KE P  GV V  LT+    
Sbjct  132  HMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKL---EIKERPDGGVYVKDLTSKLTR  188

Query  180  NTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRRGK  239
               + +  +  GN +R    T MNE SSRSH IF IT+E      S   E+    I  G+
Sbjct  189  TVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVE-----CSRIGEDGESHITVGR  243

Query  240  LSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLTRL  299
            L+LVDLAGSERQSKTGA GER KEA+KINLSLSALGNVIS+LVD K+ H+P+RDSKLTRL
Sbjct  244  LNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRL  303

Query  300  LQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQYQN  359
            LQDSLGGN+KT+M++CI P+  +++ETL TLRYA+RAKNI N+P INEDPKDA LR++Q 
Sbjct  304  LQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINEDPKDALLREFQE  363

Query  360  EILHLKRMLEETQQKSHYRNNDKIKSNELPMANLNDKYFNSKEHVDIIRSIQDIGVSVKT  419
            EI  L+  L+  Q+K+  R+       +   A L D     ++   +I+  +D     + 
Sbjct  364  EIEMLREQLK--QRKTRSRDGATQSFYDAERAKLEDDIEAIQKDDSLIKHEKD-----RL  416

Query  420  LKSISTKPSVSSVQAADDMQLQARSRIDFIK-RTLIGGERVNDLG--LKEKH-----KAQ  471
            ++ I  K  +   +  +  Q +   RI  I+ R ++G E    L    KE+H     K +
Sbjct  417  IREIQEKHDLLEKERIE--QARVAERIANIQSRLIVGSEEDGRLESRTKEQHAQLEKKRR  474

Query  472  KCAAQ-RHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKCKEKIKMLEMEVS  530
            + A Q R    +  AL R + D  +L Q  ++++  E+  K   + K   K++    E+ 
Sbjct  475  ELAEQKRREREMVEALERQEEDTVDLKQT-FSDLRTEVEAKTKKLKKMLIKLRQARNEIR  533

Query  531  DLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPETVMQNSSWNEDL  590
            D++  +  +R+D    I  + + ++    ++    P      R+ + E + + + WNED 
Sbjct  534  DVSGAYSDERQDLDQTIAEVSKELKLKLLIVENFIP------RDVS-ERIKERAEWNEDS  586

Query  591  KTWRIPEIDSLKLPPATLKSGVYRIQNSGFGCNNFMYVNENA  632
              W +    S                NS    NN + VNE+ 
Sbjct  587  FEWNVNAFQSTS-------------SNSSTPLNNTIEVNEDG  615



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062611.1 osmotic avoidance abnormal protein 3 isoform X2
[Drosophila eugracilis]

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM3_CAEEL  unnamed protein product                                   430     3e-142
Q19633_CAEEL  unnamed protein product                                 357     2e-113
KRP95_STRPU  unnamed protein product                                  353     3e-112


>OSM3_CAEEL unnamed protein product
Length=699

 Score = 430 bits (1105),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 262/637 (41%), Positives = 361/637 (57%), Gaps = 64/637 (10%)

Query  2    FTFDSVYNTITKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDGNL-NNS  60
            FTFD  Y   +  + IYN++ + LVE+ IEGYNGT+FAYGQTG GKT +MQG   +    
Sbjct  48   FTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQR  107

Query  61   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  120
            G+I + FDHIF   +   NV++L   SYLEIYNE +RDLL  +   ++    +KE P  G
Sbjct  108  GVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKL---EIKEQPDRG  164

Query  121  VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  180
            V V  L+ H   +   C   ++ G  NR   ATLMN+ SSRSH+IFT+ +E         
Sbjct  165  VYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVE---------  215

Query  181  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  240
                 G IR GKL+LVDLAGSERQSKTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+K
Sbjct  216  GMTETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSK  275

Query  241  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  300
            H+P+RDSKLTRLLQDSLGGNTKT+MI+C+SPS  +YDETLSTLRYA+RAKNI NKPTINE
Sbjct  276  HIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINE  335

Query  301  DPKDAKLRQYQNEILHLKRMLEETQQKSHYRNNDKI----------KSNELPMANLNDKY  350
            DPKDA LR+YQ EI  LK M++           D            +  E  M +L  +Y
Sbjct  336  DPKDALLREYQEEIARLKSMVQPGAVGVGAPAQDAFSIEEERKKLREEFEEAMNDLRGEY  395

Query  351  FNSKEHVDIIRSIQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGGE  410
               +     ++         K L+S+      ++    +    +A  +I  ++   IGGE
Sbjct  396  EREQTSKAELQ---------KDLESLRADYERANANLDNLNPEEAAKKIQQLQDQFIGGE  446

Query  411  RVNDLGLKEKHKAQKCAAQRHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISK  470
               +  LK+K   Q   A+     +A AL+  K  D  LLQ  Y+   ++++     + K
Sbjct  447  EAGNTQLKQKRMKQLKEAETKTQKLAAALNVHK--DDPLLQ-VYSTTQEKLDAVTSQLEK  503

Query  471  CKEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTP  530
              +K K  E E+ DL+ EF+LDR DYLD IR   + ++   Q++ K  P+ +K+      
Sbjct  504  EVKKSKGYEREIEDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNV  563

Query  531  ETVMQNSSWNEDLKTWRIPEIDSLKLPPATLKSGVYRIQNSGFGCNNFMYVNENAKQ---  587
            + + + + WNED   W +PE+        ++   +  + N+G       Y+ E A+Q   
Sbjct  564  DRIKKEAVWNEDESRWILPEM--------SMSRTILPLANNG-------YMQEPARQENT  608

Query  588  ------DVKATEIKNPSNSKEKFNINIQNNYFRTSRH  618
                  D K  E    S+S+     N+ N+YF+  + 
Sbjct  609  LLRSNFDDKLRERLAKSDSE-----NLANSYFKPVKQ  640


>Q19633_CAEEL unnamed protein product
Length=782

 Score = 357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 232/594 (39%), Positives = 331/594 (56%), Gaps = 48/594 (8%)

Query  2    FTFDSVYNTITKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNS  60
            FTFD++Y+  +    +Y E    LV+S + GYN TIFAYGQTG GKTHTM+G   +    
Sbjct  60   FTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQR  119

Query  61   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  120
            G+I+KC DHIFE ++ + N  YL   SYLEIY E +RDLL    N ++    +KE P  G
Sbjct  120  GVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKL---EIKERPDGG  176

Query  121  VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  180
            V V  LT+       + +  +  GN +R    T MNE SSRSH IF IT+E      S  
Sbjct  177  VYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVE-----CSRI  231

Query  181  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  240
             E+    I  G+L+LVDLAGSERQSKTGA GER KEA+KINLSLSALGNVIS+LVD K+ 
Sbjct  232  GEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSA  291

Query  241  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  300
            H+P+RDSKLTRLLQDSLGGN+KT+M++CI P+  +++ETL TLRYA+RAKNI N+P INE
Sbjct  292  HIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINE  351

Query  301  DPKDAKLRQYQNEILHLKRMLEETQQKSHYRNNDKIKSNELPMANLNDKYFNSKEHVDII  360
            DPKDA LR++Q EI  L+  L+  Q+K+  R+       +   A L D     ++   +I
Sbjct  352  DPKDALLREFQEEIEMLREQLK--QRKTRSRDGATQSFYDAERAKLEDDIEAIQKDDSLI  409

Query  361  RSIQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIK-RTLIGGERVNDLG--L  417
            +  +D     + ++ I  K  +   +  +  Q +   RI  I+ R ++G E    L    
Sbjct  410  KHEKD-----RLIREIQEKHDLLEKERIE--QARVAERIANIQSRLIVGSEEDGRLESRT  462

Query  418  KEKH-----KAQKCAAQ-RHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKC  471
            KE+H     K ++ A Q R    +  AL R + D  +L Q  ++++  E+  K   + K 
Sbjct  463  KEQHAQLEKKRRELAEQKRREREMVEALERQEEDTVDLKQT-FSDLRTEVEAKTKKLKKM  521

Query  472  KEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPE  531
              K++    E+ D++  +  +R+D    I  + + ++    ++    P      R+ + E
Sbjct  522  LIKLRQARNEIRDVSGAYSDERQDLDQTIAEVSKELKLKLLIVENFIP------RDVS-E  574

Query  532  TVMQNSSWNEDLKTWRIPEIDSLKLPPATLKSGVYRIQNSGFGCNNFMYVNENA  585
             + + + WNED   W +    S                NS    NN + VNE+ 
Sbjct  575  RIKERAEWNEDSFEWNVNAFQSTS-------------SNSSTPLNNTIEVNEDG  615


>KRP95_STRPU unnamed protein product
Length=742

 Score = 353 bits (907),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/322 (57%), Positives = 233/322 (72%), Gaps = 9/322 (3%)

Query  2    FTFDSVYNTITKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNS  60
            FTFD+VY+  +K   +Y+E   SLVES ++G+NGTIFAYGQTG GKT TM+G   N    
Sbjct  56   FTFDTVYDWNSKQIDLYDETFRSLVESVLQGFNGTIFAYGQTGTGKTFTMEGVRSNPELR  115

Query  61   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  120
            G+I   F+HIF  I+   N ++L   SYLEIY E IRDLL  ++  R+    LKE P  G
Sbjct  116  GVIPNSFEHIFTHIARTQNQQFLVRASYLEIYQEEIRDLLAKDQKKRL---DLKERPDTG  172

Query  121  VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  180
            V V  L++    +  +  + +++GN NR   +T MNE SSRSH IF IT+E S     V 
Sbjct  173  VYVKDLSSFVTKSVKEIEHVMTVGNNNRSVGSTNMNEHSSRSHAIFIITIECSEL--GVD  230

Query  181  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  240
             EN+   IR GKL+LVDLAGSERQ+KTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+ 
Sbjct  231  GENH---IRVGKLNLVDLAGSERQAKTGATGDRLKEATKINLSLSALGNVISALVDGKSS  287

Query  241  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  300
            H+P+RDSKLTRLLQDSLGGN KT+M++ + P+  ++DET++TLRYA+RAKNI NKP INE
Sbjct  288  HIPYRDSKLTRLLQDSLGGNAKTVMVANMGPASYNFDETITTLRYANRAKNIKNKPKINE  347

Query  301  DPKDAKLRQYQNEILHLKRMLE  322
            DPKDA LR++Q EI  LK+ L+
Sbjct  348  DPKDALLREFQEEISRLKQALD  369



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062612.1 osmotic avoidance abnormal protein 3 isoform X2
[Drosophila eugracilis]

Length=632
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM3_CAEEL  unnamed protein product                                   430     3e-142
Q19633_CAEEL  unnamed protein product                                 357     2e-113
KRP95_STRPU  unnamed protein product                                  353     3e-112


>OSM3_CAEEL unnamed protein product
Length=699

 Score = 430 bits (1105),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 262/637 (41%), Positives = 361/637 (57%), Gaps = 64/637 (10%)

Query  2    FTFDSVYNTITKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDGNL-NNS  60
            FTFD  Y   +  + IYN++ + LVE+ IEGYNGT+FAYGQTG GKT +MQG   +    
Sbjct  48   FTFDGAYFMDSTGEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQR  107

Query  61   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  120
            G+I + FDHIF   +   NV++L   SYLEIYNE +RDLL  +   ++    +KE P  G
Sbjct  108  GVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKL---EIKEQPDRG  164

Query  121  VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  180
            V V  L+ H   +   C   ++ G  NR   ATLMN+ SSRSH+IFT+ +E         
Sbjct  165  VYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVE---------  215

Query  181  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  240
                 G IR GKL+LVDLAGSERQSKTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+K
Sbjct  216  GMTETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSK  275

Query  241  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  300
            H+P+RDSKLTRLLQDSLGGNTKT+MI+C+SPS  +YDETLSTLRYA+RAKNI NKPTINE
Sbjct  276  HIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINE  335

Query  301  DPKDAKLRQYQNEILHLKRMLEETQQKSHYRNNDKI----------KSNELPMANLNDKY  350
            DPKDA LR+YQ EI  LK M++           D            +  E  M +L  +Y
Sbjct  336  DPKDALLREYQEEIARLKSMVQPGAVGVGAPAQDAFSIEEERKKLREEFEEAMNDLRGEY  395

Query  351  FNSKEHVDIIRSIQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGGE  410
               +     ++         K L+S+      ++    +    +A  +I  ++   IGGE
Sbjct  396  EREQTSKAELQ---------KDLESLRADYERANANLDNLNPEEAAKKIQQLQDQFIGGE  446

Query  411  RVNDLGLKEKHKAQKCAAQRHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISK  470
               +  LK+K   Q   A+     +A AL+  K  D  LLQ  Y+   ++++     + K
Sbjct  447  EAGNTQLKQKRMKQLKEAETKTQKLAAALNVHK--DDPLLQ-VYSTTQEKLDAVTSQLEK  503

Query  471  CKEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTP  530
              +K K  E E+ DL+ EF+LDR DYLD IR   + ++   Q++ K  P+ +K+      
Sbjct  504  EVKKSKGYEREIEDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNV  563

Query  531  ETVMQNSSWNEDLKTWRIPEIDSLKLPPATLKSGVYRIQNSGFGCNNFMYVNENAKQ---  587
            + + + + WNED   W +PE+        ++   +  + N+G       Y+ E A+Q   
Sbjct  564  DRIKKEAVWNEDESRWILPEM--------SMSRTILPLANNG-------YMQEPARQENT  608

Query  588  ------DVKATEIKNPSNSKEKFNINIQNNYFRTSRH  618
                  D K  E    S+S+     N+ N+YF+  + 
Sbjct  609  LLRSNFDDKLRERLAKSDSE-----NLANSYFKPVKQ  640


>Q19633_CAEEL unnamed protein product
Length=782

 Score = 357 bits (917),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 232/594 (39%), Positives = 331/594 (56%), Gaps = 48/594 (8%)

Query  2    FTFDSVYNTITKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNS  60
            FTFD++Y+  +    +Y E    LV+S + GYN TIFAYGQTG GKTHTM+G   +    
Sbjct  60   FTFDAIYDENSTQSDLYEETFRDLVDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQR  119

Query  61   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  120
            G+I+KC DHIFE ++ + N  YL   SYLEIY E +RDLL    N ++    +KE P  G
Sbjct  120  GVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKL---EIKERPDGG  176

Query  121  VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  180
            V V  LT+       + +  +  GN +R    T MNE SSRSH IF IT+E      S  
Sbjct  177  VYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVE-----CSRI  231

Query  181  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  240
             E+    I  G+L+LVDLAGSERQSKTGA GER KEA+KINLSLSALGNVIS+LVD K+ 
Sbjct  232  GEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSA  291

Query  241  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  300
            H+P+RDSKLTRLLQDSLGGN+KT+M++CI P+  +++ETL TLRYA+RAKNI N+P INE
Sbjct  292  HIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINE  351

Query  301  DPKDAKLRQYQNEILHLKRMLEETQQKSHYRNNDKIKSNELPMANLNDKYFNSKEHVDII  360
            DPKDA LR++Q EI  L+  L+  Q+K+  R+       +   A L D     ++   +I
Sbjct  352  DPKDALLREFQEEIEMLREQLK--QRKTRSRDGATQSFYDAERAKLEDDIEAIQKDDSLI  409

Query  361  RSIQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIK-RTLIGGERVNDLG--L  417
            +  +D     + ++ I  K  +   +  +  Q +   RI  I+ R ++G E    L    
Sbjct  410  KHEKD-----RLIREIQEKHDLLEKERIE--QARVAERIANIQSRLIVGSEEDGRLESRT  462

Query  418  KEKH-----KAQKCAAQ-RHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKC  471
            KE+H     K ++ A Q R    +  AL R + D  +L Q  ++++  E+  K   + K 
Sbjct  463  KEQHAQLEKKRRELAEQKRREREMVEALERQEEDTVDLKQT-FSDLRTEVEAKTKKLKKM  521

Query  472  KEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPE  531
              K++    E+ D++  +  +R+D    I  + + ++    ++    P      R+ + E
Sbjct  522  LIKLRQARNEIRDVSGAYSDERQDLDQTIAEVSKELKLKLLIVENFIP------RDVS-E  574

Query  532  TVMQNSSWNEDLKTWRIPEIDSLKLPPATLKSGVYRIQNSGFGCNNFMYVNENA  585
             + + + WNED   W +    S                NS    NN + VNE+ 
Sbjct  575  RIKERAEWNEDSFEWNVNAFQSTS-------------SNSSTPLNNTIEVNEDG  615


>KRP95_STRPU unnamed protein product
Length=742

 Score = 353 bits (907),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 183/322 (57%), Positives = 233/322 (72%), Gaps = 9/322 (3%)

Query  2    FTFDSVYNTITKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNS  60
            FTFD+VY+  +K   +Y+E   SLVES ++G+NGTIFAYGQTG GKT TM+G   N    
Sbjct  56   FTFDTVYDWNSKQIDLYDETFRSLVESVLQGFNGTIFAYGQTGTGKTFTMEGVRSNPELR  115

Query  61   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  120
            G+I   F+HIF  I+   N ++L   SYLEIY E IRDLL  ++  R+    LKE P  G
Sbjct  116  GVIPNSFEHIFTHIARTQNQQFLVRASYLEIYQEEIRDLLAKDQKKRL---DLKERPDTG  172

Query  121  VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  180
            V V  L++    +  +  + +++GN NR   +T MNE SSRSH IF IT+E S     V 
Sbjct  173  VYVKDLSSFVTKSVKEIEHVMTVGNNNRSVGSTNMNEHSSRSHAIFIITIECSEL--GVD  230

Query  181  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  240
             EN+   IR GKL+LVDLAGSERQ+KTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+ 
Sbjct  231  GENH---IRVGKLNLVDLAGSERQAKTGATGDRLKEATKINLSLSALGNVISALVDGKSS  287

Query  241  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  300
            H+P+RDSKLTRLLQDSLGGN KT+M++ + P+  ++DET++TLRYA+RAKNI NKP INE
Sbjct  288  HIPYRDSKLTRLLQDSLGGNAKTVMVANMGPASYNFDETITTLRYANRAKNIKNKPKINE  347

Query  301  DPKDAKLRQYQNEILHLKRMLE  322
            DPKDA LR++Q EI  LK+ L+
Sbjct  348  DPKDALLREFQEEISRLKQALD  369



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062613.1 osmotic avoidance abnormal protein 3 isoform X3
[Drosophila eugracilis]

Length=607
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM3_CAEEL  unnamed protein product                                   408     3e-134
Q19633_CAEEL  unnamed protein product                                 339     9e-107
KLP20_CAEEL  unnamed protein product                                  333     6e-106


>OSM3_CAEEL unnamed protein product
Length=699

 Score = 408 bits (1049),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 237/537 (44%), Positives = 319/537 (59%), Gaps = 35/537 (7%)

Query  1    MESTIEGYNGTIFAYGQTGCGKTHTMQGDGNL-NNSGIIHKCFDHIFETISMATNVRYLA  59
            +E+ IEGYNGT+FAYGQTG GKT +MQG   +    G+I + FDHIF   +   NV++L 
Sbjct  72   VENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFTATATTENVKFLV  131

Query  60   LVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHPVINTNQCYNWLSLG  119
              SYLEIYNE +RDLL  +   ++    +KE P  GV V  L+ H   +   C   ++ G
Sbjct  132  HCSYLEIYNEEVRDLLGADNKQKL---EIKEQPDRGVYVAGLSMHVCHDVPACKELMTRG  188

Query  120  NKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRRGKLSLVDLAGSERQ  179
              NR   ATLMN+ SSRSH+IFT+ +E              G IR GKL+LVDLAGSERQ
Sbjct  189  FNNRHVGATLMNKDSSRSHSIFTVYVE---------GMTETGSIRMGKLNLVDLAGSERQ  239

Query  180  SKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTL  239
            SKTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+KH+P+RDSKLTRLLQDSLGGNTKT+
Sbjct  240  SKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRLLQDSLGGNTKTI  299

Query  240  MISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQYQNEILHLKRMLEET  299
            MI+C+SPS  +YDETLSTLRYA+RAKNI NKPTINEDPKDA LR+YQ EI  LK M++  
Sbjct  300  MIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQEEIARLKSMVQPG  359

Query  300  QQKSHYRNNDKI----------KSNELPMANLNDKYFNSKEHVDIIRSIQDIGVSVKTLK  349
                     D            +  E  M +L  +Y   +     ++         K L+
Sbjct  360  AVGVGAPAQDAFSIEEERKKLREEFEEAMNDLRGEYEREQTSKAELQ---------KDLE  410

Query  350  SISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGGERVNDLGLKEKHKAQKCAAQRHLSA  409
            S+      ++    +    +A  +I  ++   IGGE   +  LK+K   Q   A+     
Sbjct  411  SLRADYERANANLDNLNPEEAAKKIQQLQDQFIGGEEAGNTQLKQKRMKQLKEAETKTQK  470

Query  410  IAYALSRVKCDDRELLQGHYANITQEINIKNDHISKCKEKIKMLEMEVSDLNSEFQLDRE  469
            +A AL+  K  D  LLQ  Y+   ++++     + K  +K K  E E+ DL+ EF+LDR 
Sbjct  471  LAAALNVHK--DDPLLQ-VYSTTQEKLDAVTSQLEKEVKKSKGYEREIEDLHGEFELDRL  527

Query  470  DYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPETVMQNSSWNEDLKTWRIPEI  526
            DYLD IR   + ++   Q++ K  P+ +K+      + + + + WNED   W +PE+
Sbjct  528  DYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNVDRIKKEAVWNEDESRWILPEM  584


>Q19633_CAEEL unnamed protein product
Length=782

 Score = 339 bits (870),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 223/570 (39%), Positives = 318/570 (56%), Gaps = 48/570 (8%)

Query  1    MESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNSGIIHKCFDHIFETISMATNVRYLA  59
            ++S + GYN TIFAYGQTG GKTHTM+G   +    G+I+KC DHIFE ++ + N  YL 
Sbjct  84   VDSVLNGYNATIFAYGQTGTGKTHTMEGKSSDPEQRGVIYKCIDHIFEHMAASHNQEYLV  143

Query  60   LVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHPVINTNQCYNWLSLG  119
              SYLEIY E +RDLL    N ++    +KE P  GV V  LT+       + +  +  G
Sbjct  144  RASYLEIYQEELRDLLEAESNKKL---EIKERPDGGVYVKDLTSKLTRTVGEIHEVMIRG  200

Query  120  NKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRRGKLSLVDLAGSERQ  179
            N +R    T MNE SSRSH IF IT+E      S   E+    I  G+L+LVDLAGSERQ
Sbjct  201  NGHRSVGRTNMNEHSSRSHAIFIITVE-----CSRIGEDGESHITVGRLNLVDLAGSERQ  255

Query  180  SKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKTL  239
            SKTGA GER KEA+KINLSLSALGNVIS+LVD K+ H+P+RDSKLTRLLQDSLGGN+KT+
Sbjct  256  SKTGATGERFKEATKINLSLSALGNVISALVDAKSAHIPYRDSKLTRLLQDSLGGNSKTV  315

Query  240  MISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQYQNEILHLKRMLEET  299
            M++CI P+  +++ETL TLRYA+RAKNI N+P INEDPKDA LR++Q EI  L+  L+  
Sbjct  316  MVACIGPASYNFEETLGTLRYANRAKNIKNQPKINEDPKDALLREFQEEIEMLREQLK--  373

Query  300  QQKSHYRNNDKIKSNELPMANLNDKYFNSKEHVDIIRSIQDIGVSVKTLKSISTKPSVSS  359
            Q+K+  R+       +   A L D     ++   +I+  +D     + ++ I  K  +  
Sbjct  374  QRKTRSRDGATQSFYDAERAKLEDDIEAIQKDDSLIKHEKD-----RLIREIQEKHDLLE  428

Query  360  VQAADDMQLQARSRIDFIK-RTLIGGERVNDLG--LKEKH-----KAQKCAAQ-RHLSAI  410
             +  +  Q +   RI  I+ R ++G E    L    KE+H     K ++ A Q R    +
Sbjct  429  KERIE--QARVAERIANIQSRLIVGSEEDGRLESRTKEQHAQLEKKRRELAEQKRREREM  486

Query  411  AYALSRVKCDDRELLQGHYANITQEINIKNDHISKCKEKIKMLEMEVSDLNSEFQLDRED  470
              AL R + D  +L Q  ++++  E+  K   + K   K++    E+ D++  +  +R+D
Sbjct  487  VEALERQEEDTVDLKQT-FSDLRTEVEAKTKKLKKMLIKLRQARNEIRDVSGAYSDERQD  545

Query  471  YLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPETVMQNSSWNEDLKTWRIPEIDSLK  530
                I  + + ++    ++    P      R+ + E + + + WNED   W +    S  
Sbjct  546  LDQTIAEVSKELKLKLLIVENFIP------RDVS-ERIKERAEWNEDSFEWNVNAFQSTS  598

Query  531  LPPATLKSGVYRIQNSGFGCNNFMYVNENA  560
                          NS    NN + VNE+ 
Sbjct  599  -------------SNSSTPLNNTIEVNEDG  615


>KLP20_CAEEL unnamed protein product
Length=646

 Score = 333 bits (854),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 221/548 (40%), Positives = 315/548 (57%), Gaps = 61/548 (11%)

Query  1    MESTIEGYNGTIFAYGQTGCGKTHTMQGD-GNLNNSGIIHKCFDHIFETISMAT-NVRYL  58
            +E+ ++GYNGTIFAYGQTG GKT TM GD   +   GII   F HIF+ I+    +  +L
Sbjct  76   VENVLKGYNGTIFAYGQTGTGKTFTMAGDLEPVEMRGIIPNSFAHIFDHIAKCQHDTTFL  135

Query  59   ALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHPVINTNQCYNWLSL  118
              VSYLEIYNE IRDLL+ + N    N  +KE P +GV V  L+   V N ++    +  
Sbjct  136  VRVSYLEIYNEEIRDLLSKDHNG---NLEIKERPDVGVYVRNLSNPTVENASKMQALMEF  192

Query  119  GNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRRGKLSLVDLAGSER  178
            G+KNR   AT MN +SSRSH +FT+T+E        +  N L  + +GKL LVDLAGSER
Sbjct  193  GSKNRKVGATAMNLESSRSHAMFTVTIE--------SCRNGL--VTQGKLQLVDLAGSER  242

Query  179  QSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLTRLLQDSLGGNTKT  238
            QSKTGAQGERLKEA+KINLSLS LGNVISSLVDGK+ H+P+R+SKLTRLLQDSLGGN+KT
Sbjct  243  QSKTGAQGERLKEAAKINLSLSTLGNVISSLVDGKSTHIPYRNSKLTRLLQDSLGGNSKT  302

Query  239  LMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQYQNEILHLKRMLEE  298
            +MI+ + P+  +YDETLSTLRYA+RAKNI N   INEDPKDA+LR++Q EI  L+++L+E
Sbjct  303  VMIANVGPATYNYDETLSTLRYANRAKNIQNVAKINEDPKDAQLRKFQLEIEALRKILDE  362

Query  299  TQQKSHYRNND----KIKSNELPMAN----LNDKY---FNSKEHVDIIRSIQDIGVSVKT  347
                      +    K++  E+ M      L ++     N +E   +++ + +    +K 
Sbjct  363  ENPGDDENQEEAWEAKMQEREVEMEKKRKILEERVNSAVNDEETHRLVKEMMENEAELKK  422

Query  348  LKSISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGG-----ERVND----LGLKEKHKA  398
             +S   K                RS+++ I++ LI G     E+V +    L +  K   
Sbjct  423  ARSEHEK---------------LRSKLEKIEKKLIVGGENLLEKVEEQAKLLEVNNKELE  467

Query  399  QKCAAQRHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKCKEKIKMLEMEVS  458
            Q    + HL       + VK +    ++  Y+++ +E  +K+  I K   ++K    E+ 
Sbjct  468  QSKFQEAHLRTQLEERTAVKVE----IEERYSSLQEEAFVKSKKIKKVSNELKDARAELK  523

Query  459  DLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPETVMQNSSWNEDL  518
            DL  + Q   E  LD+IR L + +     ++ +  P+          E + +  SW+E+ 
Sbjct  524  DLEEDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEH-------VELIEKYVSWSEEH  576

Query  519  KTWRIPEI  526
              W++  I
Sbjct  577  GDWQLKAI  584



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062614.1 osmotic avoidance abnormal protein 3 isoform X4
[Drosophila eugracilis]

Length=582
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM3_CAEEL  unnamed protein product                                   367     7e-119
Q19633_CAEEL  unnamed protein product                                 298     2e-91 
Q9VRK9_DROME  unnamed protein product                                 293     2e-90 


>OSM3_CAEEL unnamed protein product
Length=699

 Score = 367 bits (943),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 217/501 (43%), Positives = 293/501 (58%), Gaps = 34/501 (7%)

Query  11   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  70
            G+I + FDHIF   +   NV++L   SYLEIYNE +RDLL  +   ++    +KE P  G
Sbjct  108  GVIPRAFDHIFTATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKL---EIKEQPDRG  164

Query  71   VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  130
            V V  L+ H   +   C   ++ G  NR   ATLMN+ SSRSH+IFT+ +E         
Sbjct  165  VYVAGLSMHVCHDVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVE---------  215

Query  131  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  190
                 G IR GKL+LVDLAGSERQSKTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+K
Sbjct  216  GMTETGSIRMGKLNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSK  275

Query  191  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  250
            H+P+RDSKLTRLLQDSLGGNTKT+MI+C+SPS  +YDETLSTLRYA+RAKNI NKPTINE
Sbjct  276  HIPYRDSKLTRLLQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINE  335

Query  251  DPKDAKLRQYQNEILHLKRMLEETQQKSHYRNNDKI----------KSNELPMANLNDKY  300
            DPKDA LR+YQ EI  LK M++           D            +  E  M +L  +Y
Sbjct  336  DPKDALLREYQEEIARLKSMVQPGAVGVGAPAQDAFSIEEERKKLREEFEEAMNDLRGEY  395

Query  301  FNSKEHVDIIRSIQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGGE  360
               +E        +D       L+S+      ++    +    +A  +I  ++   IGGE
Sbjct  396  --EREQTSKAELQKD-------LESLRADYERANANLDNLNPEEAAKKIQQLQDQFIGGE  446

Query  361  RVNDLGLKEKHKAQKCAAQRHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISK  420
               +  LK+K   Q   A+     +A AL+  K  D  LLQ  Y+   ++++     + K
Sbjct  447  EAGNTQLKQKRMKQLKEAETKTQKLAAALNVHK--DDPLLQ-VYSTTQEKLDAVTSQLEK  503

Query  421  CKEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTP  480
              +K K  E E+ DL+ EF+LDR DYLD IR   + ++   Q++ K  P+ +K+      
Sbjct  504  EVKKSKGYEREIEDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKDTNYSNV  563

Query  481  ETVMQNSSWNEDLKTWRIPEI  501
            + + + + WNED   W +PE+
Sbjct  564  DRIKKEAVWNEDESRWILPEM  584


>Q19633_CAEEL unnamed protein product
Length=782

 Score = 298 bits (762),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 203/534 (38%), Positives = 293/534 (55%), Gaps = 47/534 (9%)

Query  11   GIIHKCFDHIFETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIG  70
            G+I+KC DHIFE ++ + N  YL   SYLEIY E +RDLL    N ++    +KE P  G
Sbjct  120  GVIYKCIDHIFEHMAASHNQEYLVRASYLEIYQEELRDLLEAESNKKL---EIKERPDGG  176

Query  71   VSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVA  130
            V V  LT+       + +  +  GN +R    T MNE SSRSH IF IT+E      S  
Sbjct  177  VYVKDLTSKLTRTVGEIHEVMIRGNGHRSVGRTNMNEHSSRSHAIFIITVE-----CSRI  231

Query  131  SENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAK  190
             E+    I  G+L+LVDLAGSERQSKTGA GER KEA+KINLSLSALGNVIS+LVD K+ 
Sbjct  232  GEDGESHITVGRLNLVDLAGSERQSKTGATGERFKEATKINLSLSALGNVISALVDAKSA  291

Query  191  HVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINE  250
            H+P+RDSKLTRLLQDSLGGN+KT+M++CI P+  +++ETL TLRYA+RAKNI N+P INE
Sbjct  292  HIPYRDSKLTRLLQDSLGGNSKTVMVACIGPASYNFEETLGTLRYANRAKNIKNQPKINE  351

Query  251  DPKDAKLRQYQNEILHLKRMLEETQQKSHYRNNDKIKSNELPMANLNDKYFNSKEHVDII  310
            DPKDA LR++Q EI  L+  L+  Q+K+  R+       +   A L D     ++   +I
Sbjct  352  DPKDALLREFQEEIEMLREQLK--QRKTRSRDGATQSFYDAERAKLEDDIEAIQKDDSLI  409

Query  311  RSIQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIK-RTLIGGERVNDLG--L  367
            +  +D     + ++ I  K  +   +  +  Q +   RI  I+ R ++G E    L    
Sbjct  410  KHEKD-----RLIREIQEKHDLLEKERIE--QARVAERIANIQSRLIVGSEEDGRLESRT  462

Query  368  KEKH-----KAQKCAAQ-RHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKC  421
            KE+H     K ++ A Q R    +  AL R + D  +L Q  ++++  E+  K   + K 
Sbjct  463  KEQHAQLEKKRRELAEQKRREREMVEALERQEEDTVDLKQ-TFSDLRTEVEAKTKKLKKM  521

Query  422  KEKIKMLEMEVSDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKNGRNWTPE  481
              K++    E+ D++  +  +R+D    I  + + ++    ++    P      R+ + E
Sbjct  522  LIKLRQARNEIRDVSGAYSDERQDLDQTIAEVSKELKLKLLIVENFIP------RDVS-E  574

Query  482  TVMQNSSWNEDLKTWRIPEIDSLKLPPATLKSGVYRIQNSGFGCNNFMYVNENA  535
             + + + WNED   W +    S                NS    NN + VNE+ 
Sbjct  575  RIKERAEWNEDSFEWNVNAFQSTS-------------SNSSTPLNNTIEVNEDG  615


>Q9VRK9_DROME unnamed protein product
Length=677

 Score = 293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 193/264 (73%), Gaps = 9/264 (3%)

Query  11   GIIHKCFDHIFETISMAT-NVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGI  69
            GII   F HIF  I+ A  N ++L  VSY+EIYNE +RDLL  +    +    +KE P I
Sbjct  128  GIIPNAFAHIFGHIAKAKENQKFLVRVSYMEIYNEEVRDLLGKDVGKSL---EVKERPDI  184

Query  70   GVSVPTLTTHPVINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSV  129
            GV V  L+ + V N +   N + LGNKNR   AT MN++SSRSH IF+IT+E+S      
Sbjct  185  GVFVKDLSGYVVHNADDLENIMRLGNKNRAVGATKMNQESSRSHAIFSITVERSEL----  240

Query  130  ASENNLGGIRRGKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKA  189
              E ++  +R GKL LVDLAGSERQSKT A G+RLKEA+KINLSLS LGNVIS+LVDGK+
Sbjct  241  -GEGDVQHVRMGKLQLVDLAGSERQSKTQASGQRLKEATKINLSLSVLGNVISALVDGKS  299

Query  190  KHVPFRDSKLTRLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTIN  249
             H+P+R+SKLTRLLQDSLGGN+KT+M + ISP++S+Y ET+STLRYASRAKNI N+  IN
Sbjct  300  THIPYRNSKLTRLLQDSLGGNSKTVMCATISPADSNYMETISTLRYASRAKNIQNRMHIN  359

Query  250  EDPKDAKLRQYQNEILHLKRMLEE  273
            E+PKDA LR +Q EI  L++ LEE
Sbjct  360  EEPKDALLRHFQEEIARLRKQLEE  383



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062615.1 osmotic avoidance abnormal protein 3 isoform X5
[Drosophila eugracilis]

Length=574
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OSM3_CAEEL  unnamed protein product                                   434     1e-144
KRP85_STRPU  unnamed protein product                                  385     1e-125
KRP95_STRPU  unnamed protein product                                  383     2e-124


>OSM3_CAEEL unnamed protein product
Length=699

 Score = 434 bits (1116),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 256/582 (44%), Positives = 344/582 (59%), Gaps = 36/582 (6%)

Query  1    MSENIKVVVRCRPMNQSENEKKRENIVEINEYSVSVANPSASLTQKKMFTFDSVYNTITK  60
            M+E+++V VRCRP NQ E +      V +   +V   N +A     K FTFD  Y   + 
Sbjct  1    MAESVRVAVRCRPFNQREKDLNTTLCVGMTP-NVGQVNLNAPDGAAKDFTFDGAYFMDST  59

Query  61   TDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQGDGNLN-NSGIIHKCFDHIFE  119
             + IYN++ + LVE+ IEGYNGT+FAYGQTG GKT +MQG   +    G+I + FDHIF 
Sbjct  60   GEQIYNDIVFPLVENVIEGYNGTVFAYGQTGSGKTFSMQGIETIPAQRGVIPRAFDHIFT  119

Query  120  TISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHPVI  179
              +   NV++L   SYLEIYNE +RDLL  +   ++    +KE P  GV V  L+ H   
Sbjct  120  ATATTENVKFLVHCSYLEIYNEEVRDLLGADNKQKL---EIKEQPDRGVYVAGLSMHVCH  176

Query  180  NTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRRGK  239
            +   C   ++ G  NR   ATLMN+ SSRSH+IFT+ +E              G IR GK
Sbjct  177  DVPACKELMTRGFNNRHVGATLMNKDSSRSHSIFTVYVE---------GMTETGSIRMGK  227

Query  240  LSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLTRL  299
            L+LVDLAGSERQSKTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+KH+P+RDSKLTRL
Sbjct  228  LNLVDLAGSERQSKTGATGDRLKEATKINLSLSALGNVISALVDGKSKHIPYRDSKLTRL  287

Query  300  LQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQYQN  359
            LQDSLGGNTKT+MI+C+SPS  +YDETLSTLRYA+RAKNI NKPTINEDPKDA LR+YQ 
Sbjct  288  LQDSLGGNTKTIMIACVSPSSDNYDETLSTLRYANRAKNIKNKPTINEDPKDALLREYQE  347

Query  360  EILHLKRMLEETQQKSHYRNNDKI----------KSNELPMANLNDKYFNSKEHVDIIRS  409
            EI  LK M++           D            +  E  M +L  +Y   +     ++ 
Sbjct  348  EIARLKSMVQPGAVGVGAPAQDAFSIEEERKKLREEFEEAMNDLRGEYEREQTSKAELQ-  406

Query  410  IQDIGVSVKTLKSISTKPSVSSVQAADDMQLQARSRIDFIKRTLIGGERVNDLGLKEKHK  469
                    K L+S+      ++    +    +A  +I  ++   IGGE   +  LK+K  
Sbjct  407  --------KDLESLRADYERANANLDNLNPEEAAKKIQQLQDQFIGGEEAGNTQLKQKRM  458

Query  470  AQKCAAQRHLSAIAYALSRVKCDDRELLQGHYANITQEINIKNDHISKCKEKIKMLEMEV  529
             Q   A+     +A AL+  K  D  LLQ  Y+   ++++     + K  +K K  E E+
Sbjct  459  KQLKEAETKTQKLAAALNVHK--DDPLLQ-VYSTTQEKLDAVTSQLEKEVKKSKGYEREI  515

Query  530  SDLNSEFQLDREDYLDEIRNLGRHIQFYQQLLCKCYPLFQKN  571
             DL+ EF+LDR DYLD IR   + ++   Q++ K  P+ +K+
Sbjct  516  EDLHGEFELDRLDYLDTIRKQDQQLKLLMQIMDKIQPIIKKD  557


>KRP85_STRPU unnamed protein product
Length=699

 Score = 385 bits (989),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 206/374 (55%), Positives = 263/374 (70%), Gaps = 13/374 (3%)

Query  3    ENIKVVVRCRPMNQSENEKKRENIVEINEY--SVSVANPSA-SLTQKKMFTFDSVYNTIT  59
            +N++VVVRCRP+N  E  +  +++V+++E   +V V NP+A S    K FTFD+V+    
Sbjct  9    DNVRVVVRCRPLNSKETGQGFKSVVKMDEMRGTVQVTNPNAPSGEPPKSFTFDTVFAPGA  68

Query  60   KTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNSGIIHKCFDHIF  118
            K   +YN+    +V++ IEGYNGTIFAYGQTG GKT TM+G        GII   F HIF
Sbjct  69   KQTDVYNQTARPIVDAIIEGYNGTIFAYGQTGTGKTFTMEGVRSQPELRGIIPNSFAHIF  128

Query  119  ETISMAT-NVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHP  177
              I+    NVR+L  VSYLEIYNE ++DLL  ++  R+    +KE P +GV V  L+   
Sbjct  129  GHIAKEQENVRFLVRVSYLEIYNEEVKDLLGKDQQHRL---EVKERPDVGVYVKDLSAFV  185

Query  178  VINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRR  237
            V N +     ++LGNKNR   AT MNE SSRSH IFTITLE+S     +  E +   +R 
Sbjct  186  VNNADDMDRIMTLGNKNRSVGATNMNESSSRSHAIFTITLERSDM--GLDKEQH---VRV  240

Query  238  GKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLT  297
            GKL +VDLAGSERQ+KTGA G+RLKEA+KINLSLS LGNVISSLVDGK+ H+P+R+SKLT
Sbjct  241  GKLHMVDLAGSERQTKTGATGQRLKEATKINLSLSTLGNVISSLVDGKSTHIPYRNSKLT  300

Query  298  RLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQY  357
            RLLQDSLGGN KT+M + I P+E +YDET+STLRYA+RAKNI NK  INEDPKDA LR++
Sbjct  301  RLLQDSLGGNAKTVMCANIGPAEYNYDETISTLRYANRAKNIKNKAKINEDPKDALLREF  360

Query  358  QNEILHLKRMLEET  371
            Q EI  LK+ + E+
Sbjct  361  QKEIEELKKQISES  374


>KRP95_STRPU unnamed protein product
Length=742

 Score = 383 bits (984),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 203/372 (55%), Positives = 260/372 (70%), Gaps = 12/372 (3%)

Query  2    SENIKVVVRCRPMNQSENEKKRENIVEINEYS--VSVANPSASLTQK-KMFTFDSVYNTI  58
            +E +KVVVRCRPMN  E  +  + IVE++     V V NP     +  K FTFD+VY+  
Sbjct  6    AETVKVVVRCRPMNSKEISQGHKRIVEMDNKRGLVEVTNPKGPPGEPNKSFTFDTVYDWN  65

Query  59   TKTDVIYNEMCYSLVESTIEGYNGTIFAYGQTGCGKTHTMQG-DGNLNNSGIIHKCFDHI  117
            +K   +Y+E   SLVES ++G+NGTIFAYGQTG GKT TM+G   N    G+I   F+HI
Sbjct  66   SKQIDLYDETFRSLVESVLQGFNGTIFAYGQTGTGKTFTMEGVRSNPELRGVIPNSFEHI  125

Query  118  FETISMATNVRYLALVSYLEIYNESIRDLLNTNENTRMINHSLKEIPGIGVSVPTLTTHP  177
            F  I+   N ++L   SYLEIY E IRDLL  ++  R+    LKE P  GV V  L++  
Sbjct  126  FTHIARTQNQQFLVRASYLEIYQEEIRDLLAKDQKKRL---DLKERPDTGVYVKDLSSFV  182

Query  178  VINTNQCYNWLSLGNKNRVTAATLMNEKSSRSHTIFTITLEQSPFFSSVASENNLGGIRR  237
              +  +  + +++GN NR   +T MNE SSRSH IF IT+E S     V  EN+   IR 
Sbjct  183  TKSVKEIEHVMTVGNNNRSVGSTNMNEHSSRSHAIFIITIECSEL--GVDGENH---IRV  237

Query  238  GKLSLVDLAGSERQSKTGAQGERLKEASKINLSLSALGNVISSLVDGKAKHVPFRDSKLT  297
            GKL+LVDLAGSERQ+KTGA G+RLKEA+KINLSLSALGNVIS+LVDGK+ H+P+RDSKLT
Sbjct  238  GKLNLVDLAGSERQAKTGATGDRLKEATKINLSLSALGNVISALVDGKSSHIPYRDSKLT  297

Query  298  RLLQDSLGGNTKTLMISCISPSESDYDETLSTLRYASRAKNISNKPTINEDPKDAKLRQY  357
            RLLQDSLGGN KT+M++ + P+  ++DET++TLRYA+RAKNI NKP INEDPKDA LR++
Sbjct  298  RLLQDSLGGNAKTVMVANMGPASYNFDETITTLRYANRAKNIKNKPKINEDPKDALLREF  357

Query  358  QNEILHLKRMLE  369
            Q EI  LK+ L+
Sbjct  358  QEEISRLKQALD  369



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062618.2 LOW QUALITY PROTEIN: polycomb protein PHO [Drosophila
eugracilis]

Length=545
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PHO_DROME  unnamed protein product                                    636     0.0  
Q9VSZ3_DROME  unnamed protein product                                 216     2e-62
Q54ET8_DICDI  unnamed protein product                                 103     5e-23


>PHO_DROME unnamed protein product
Length=520

 Score = 636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/534 (62%), Positives = 399/534 (75%), Gaps = 25/534 (5%)

Query  23   MAYERYGILLKSEHYEEEDIVNRNGIQKINVQNISNVGMPPSNHIQLNRCNVFESVVCSE  82
            MAYER+GI+L+SE Y+E DI N    QK+N            NH  L+R N F+ ++ SE
Sbjct  1    MAYERFGIILQSEQYDE-DIGNTKVNQKMN----------EGNHYDLHRKNAFDRIIHSE  49

Query  83   PNDNGNAINY--YEKNQLKASENVLSSKIRKQTNFDHQININCCKNVSSAENQET-KVMS  139
                 N INY  +E +++KA++N+ SSK++   N  +++NINC KN+   ENQET KV++
Sbjct  50   SKKGDNVINYNIHENDKIKAADNIFSSKLKMNPNMSYEMNINCFKNIGYGENQETSKVLT  109

Query  140  ASLLHNSTNTEESGTGDSGLPFLTLDTTPLIQGGKTRRWEQKLVQIKTMEGEFSVTMWAS  199
             SL +N  NTEESG  D   PFLTL TT L   GK+RRWEQKLV IKTMEGEFSVTMWAS
Sbjct  110  NSLSNNDINTEESGVVDKNSPFLTLGTTILNSNGKSRRWEQKLVHIKTMEGEFSVTMWAS  169

Query  200  GLSDDEFSGSDQNIGDAEFLKDKD-LDFDRNTYQRNKDFEGVESILTQKPQTFERDHPLG  258
            G+SDDE+SGSDQ +G ++ LK K+    D  T Q+NK+++ +ES  T   QT E  HP+ 
Sbjct  170  GISDDEYSGSDQIVGASDLLKGKEEFGIDGFTSQQNKEYQKMESKFTN-AQTLEMPHPIS  228

Query  259  SAPNKEQLTKEEGILSNKSNLSTKILDKSNISFEDTILTTDSTTLQLVNETAAITIDNHR  318
            S    + L KE G LS ++N+S +IL K+ +SFE+ IL  DS++++LVNETAA+TI+NHR
Sbjct  229  SVQIMDHLIKERGNLSQENNISERILSKTTLSFEEPILLPDSSSIELVNETAAMTINNHR  288

Query  319  ILC--TDNTADLQTLTNSVPFDFGVHERQ-----ATSSQLVYHNNTGSSGSADLNLNLSE  371
             L   T NT DL  L +SVPF  G+HE Q     +T SQ  + +NT S+G  ++NL  SE
Sbjct  289  TLSNHTGNTGDLHALPSSVPFRIGLHEGQVNDCLSTISQSTHQDNTDSTGCGEMNL--SE  346

Query  372  VAVAYPTDKKXIVPHKGCHKSFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQL  431
            V V+Y  DKK   PHKGC+K FRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQL
Sbjct  347  VTVSYTNDKKIACPHKGCNKHFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQL  406

Query  432  VHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHIL  491
            VHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHIL
Sbjct  407  VHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHIL  466

Query  492  THAKAKRNTSISRKNDCSNLESNSQNEDKSIKYIKVELRESVSESHVPFVVYAD  545
            THAKAKRNTSIS K+ CSN ESNSQ+ED S  Y+KVEL++SV+E+HVPFVVYAD
Sbjct  467  THAKAKRNTSISGKSGCSNAESNSQSEDTSANYVKVELQDSVTENHVPFVVYAD  520


>Q9VSZ3_DROME unnamed protein product
Length=669

 Score = 216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 93/113 (82%), Positives = 102/113 (90%), Gaps = 0/113 (0%)

Query  386  HKGCHKSFRDSSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEG  445
            H+GC+K FR+ SAMRKH+HTHGPR HVC  CGK+FVESSKLKRHQLVHTGEKPF+CTFEG
Sbjct  506  HRGCNKEFRNHSAMRKHMHTHGPRGHVCNVCGKSFVESSKLKRHQLVHTGEKPFECTFEG  565

Query  446  CGKRFSLDFNLRTHVRIHTGDRPFVCPFDACNKKFAQSTNLKSHILTHAKAKR  498
            CGKRFSLDFNLRTHVRIHTGDRP+ CP D C+K FAQSTNLKSH+LTH K KR
Sbjct  566  CGKRFSLDFNLRTHVRIHTGDRPYHCPIDGCSKCFAQSTNLKSHMLTHTKPKR  618


 Score = 33.1 bits (74),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 11/24 (46%), Positives = 18/24 (75%), Gaps = 0/24 (0%)

Query  176  RRWEQKLVQIKTMEGEFSVTMWAS  199
            +RW+Q  V I+  + EF+VT+W+S
Sbjct  235  KRWKQTKVPIRITQDEFNVTLWSS  258


>Q54ET8_DICDI unnamed protein product
Length=810

 Score = 103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 80/139 (58%), Gaps = 9/139 (6%)

Query  364  DLNLNLSEV------AVAYPTDKKXIVPHKGCHKSFRDSSAMRKHLHTH-GPRVHVCAE-  415
            +LN N S+V      ++    ++K    ++ C KSF   +  ++HL  H G +  VC E 
Sbjct  542  NLNSNSSDVESYLIKSIGEGGEEKFTCDYQSCGKSFSTLAIFKRHLKEHTGCKPFVCTEE  601

Query  416  -CGKAFVESSKLKRHQLVHTGEKPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPFVCPFD  474
             C K F     LK H   HTGEKP+ CTF GC KRF+   +LR H RIHTG++PFVC ++
Sbjct  602  GCNKRFSRKFDLKVHLRSHTGEKPYLCTFPGCSKRFARSSDLRLHQRIHTGEKPFVCDWE  661

Query  475  ACNKKFAQSTNLKSHILTH  493
             C+K+F +  +LK H  TH
Sbjct  662  GCSKRFIRQADLKKHRKTH  680



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062621.2 LOW QUALITY PROTEIN: uncharacterized protein
LOC108102332 [Drosophila eugracilis]

Length=398
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EBE3_CAEEL  unnamed protein product                                 30.0    3.8  
Q8MRY5_DROME  unnamed protein product                                 30.0    4.0  
Q9VML2_DROME  unnamed protein product                                 29.6    6.1  


>G5EBE3_CAEEL unnamed protein product
Length=560

 Score = 30.0 bits (66),  Expect = 3.8, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (53%), Gaps = 1/51 (2%)

Query  225  SFQRLKELIWTERAKELTEQRRDEELAARAAALKEITNGKNILANYYPQSG  275
            +F+ LK ++W  R K+  E +R EEL       +EI N K +L +   + G
Sbjct  18   AFRNLK-MVWEARQKKSLEDKRQEELRVAYEKEQEILNNKALLGDEKAKMG  67


>Q8MRY5_DROME unnamed protein product
Length=381

 Score = 30.0 bits (66),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query  203  GVPNGGTGTNTKENKDSVAIQGSFQRLKELI--WTERAKELTEQRRDEEL  250
            G P    G N +E      +Q S   LK+L   +T   + L+EQ RD++L
Sbjct  41   GAPTAANGRNAEEALMDARVQVSLTTLKKLFNEYTHPREPLSEQERDDKL  90


>Q9VML2_DROME unnamed protein product
Length=3489

 Score = 29.6 bits (65),  Expect = 6.1, Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query  203  GVPNGGTGTNTKENKDSVAIQGSFQRLKELI--WTERAKELTEQRRDEEL  250
            G P    G N +E      +Q S   LK+L   +T   + L+EQ RD++L
Sbjct  39   GAPTAANGRNAEEALMDARVQVSLTTLKKLFNEYTHPREPLSEQERDDKL  88



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062625.2 uncharacterized protein LOC108102333 isoform X1
[Drosophila eugracilis]

Length=1131
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01443_CAEEL  unnamed protein product                                 159     2e-39
PAC1_CAEEL  unnamed protein product                                   112     1e-24
H1ZUV8_CAEEL  unnamed protein product                                 112     1e-24


>O01443_CAEEL unnamed protein product
Length=986

 Score = 159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 96/230 (42%), Positives = 137/230 (60%), Gaps = 15/230 (7%)

Query  848   DQLQLMVPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRISVD----  903
             D   L VP  V NC ++L   GL QVGLFRV+ + KR +QLR  L+K     +  D    
Sbjct  522   DPHALQVPKIVENCTQYLMTYGLTQVGLFRVAGNTKRCRQLRNALEKVGGGAVINDNMVE  581

Query  904   -TCPHDVATLLKEFLRDLPEPLLCYRLYSTFLRTQRIRNRRLQLEALSHIIRLLPIPHRD  962
              T  HDVATLLKE+ RDLP+ LL    YS ++   ++ N   ++EA+  +  LL  P  D
Sbjct  582   NTTSHDVATLLKEYFRDLPQSLLPGEHYSAYIGAAKL-NVDERIEAIRLLFALLVSPILD  640

Query  963   TLYVLLAFLAKVAAHSDNVCSVDGSYVMGGNKMDCNNLATVFAPNILRGTLVTLSRDKEQ  1022
             TL+VLL FL +V+ HS +    DG  ++ GNKMD  NLAT+FAP+ILR     +  DK  
Sbjct  641   TLFVLLKFLHEVSCHSQDRHDEDGE-LLSGNKMDARNLATIFAPSILR-----VDHDKLH  694

Query  1023  ENMSDS---INVVRTLINHYEEIFTISAELINSIYTQMLEACPEKLYELI  1069
             E ++++   + +V T+I++ EEIF I  EL   IYT++ E  P++L  ++
Sbjct  695   ETLAENEHQVIIVETMISNVEEIFKIPKELQCKIYTKLRETEPDRLDRIL  744


>PAC1_CAEEL unnamed protein product
Length=1605

 Score = 112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 103/201 (51%), Gaps = 36/201 (18%)

Query  854   VPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRI------SVDTCPH  907
             VPM V  C+  +E  G++ VG++R+  +   V  L+E L       +      S+D    
Sbjct  962   VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWR  1021

Query  908   DV---ATLLKEFLRDLPEPLLCYRLYSTFLRTQRIRNRRLQLEALSHIIRLLPIPHRDTL  964
             DV   ++LLK FLR LPEPLL  +LY  F+   RI     +L  L +++R LP PH DTL
Sbjct  1022  DVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTL  1081

Query  965   YVLLAFLAKVAAHSDNVCSVDGSYVMGGNKMDCNNLATVFAPNILR------GTLVTLSR  1018
               L+  L+++  HSD             NKM+C NLA +F P+I+R       T+VT   
Sbjct  1082  RFLIVHLSEITKHSDV------------NKMECRNLALMFGPSIVRPSDDNMATMVT---  1126

Query  1019  DKEQENMSDSINVVRTLINHY  1039
                  +MSD   ++ TLI HY
Sbjct  1127  -----HMSDQCKIIETLI-HY  1141


>H1ZUV8_CAEEL unnamed protein product
Length=1718

 Score = 112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 103/201 (51%), Gaps = 36/201 (18%)

Query  854   VPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRI------SVDTCPH  907
             VPM V  C+  +E  G++ VG++R+  +   V  L+E L       +      S+D    
Sbjct  1075  VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWR  1134

Query  908   DV---ATLLKEFLRDLPEPLLCYRLYSTFLRTQRIRNRRLQLEALSHIIRLLPIPHRDTL  964
             DV   ++LLK FLR LPEPLL  +LY  F+   RI     +L  L +++R LP PH DTL
Sbjct  1135  DVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTL  1194

Query  965   YVLLAFLAKVAAHSDNVCSVDGSYVMGGNKMDCNNLATVFAPNILR------GTLVTLSR  1018
               L+  L+++  HSD             NKM+C NLA +F P+I+R       T+VT   
Sbjct  1195  RFLIVHLSEITKHSDV------------NKMECRNLALMFGPSIVRPSDDNMATMVT---  1239

Query  1019  DKEQENMSDSINVVRTLINHY  1039
                  +MSD   ++ TLI HY
Sbjct  1240  -----HMSDQCKIIETLI-HY  1254



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062630.2 uncharacterized protein LOC108102333 isoform X2
[Drosophila eugracilis]

Length=1110
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01443_CAEEL  unnamed protein product                                 159     1e-39
PAC1_CAEEL  unnamed protein product                                   112     1e-24
H1ZUV8_CAEEL  unnamed protein product                                 112     1e-24


>O01443_CAEEL unnamed protein product
Length=986

 Score = 159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 141/239 (59%), Gaps = 17/239 (7%)

Query  839   ELNIDRPYQDQLQLMVPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHF  898
             + NID    D   L VP  V NC ++L   GL QVGLFRV+ + KR +QLR  L+K    
Sbjct  515   DANIDD--VDPHALQVPKIVENCTQYLMTYGLTQVGLFRVAGNTKRCRQLRNALEKVGGG  572

Query  899   RISVD-----TCPHDVATLLKEFLRDLPEPLLCYRLYSTFLRTQRIRNRRLQLEALSHII  953
              +  D     T  HDVATLLKE+ RDLP+ LL    YS ++   ++ N   ++EA+  + 
Sbjct  573   AVINDNMVENTTSHDVATLLKEYFRDLPQSLLPGEHYSAYIGAAKL-NVDERIEAIRLLF  631

Query  954   RLLPIPHRDTLYVLLAFLAKVAAHSDNVCSVDGSYVMGGNKMDCNNLATVFAPNILRGTL  1013
              LL  P  DTL+VLL FL +V+ HS +    DG  ++ GNKMD  NLAT+FAP+ILR   
Sbjct  632   ALLVSPILDTLFVLLKFLHEVSCHSQDRHDEDGE-LLSGNKMDARNLATIFAPSILR---  687

Query  1014  VTLSRDKEQENMSDS---INVVRTLINHYEEIFTISAELINSIYTQMLEACPEKLYELI  1069
               +  DK  E ++++   + +V T+I++ EEIF I  EL   IYT++ E  P++L  ++
Sbjct  688   --VDHDKLHETLAENEHQVIIVETMISNVEEIFKIPKELQCKIYTKLRETEPDRLDRIL  744


>PAC1_CAEEL unnamed protein product
Length=1605

 Score = 112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 103/201 (51%), Gaps = 36/201 (18%)

Query  854   VPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRI------SVDTCPH  907
             VPM V  C+  +E  G++ VG++R+  +   V  L+E L       +      S+D    
Sbjct  962   VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWR  1021

Query  908   DV---ATLLKEFLRDLPEPLLCYRLYSTFLRTQRIRNRRLQLEALSHIIRLLPIPHRDTL  964
             DV   ++LLK FLR LPEPLL  +LY  F+   RI     +L  L +++R LP PH DTL
Sbjct  1022  DVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTL  1081

Query  965   YVLLAFLAKVAAHSDNVCSVDGSYVMGGNKMDCNNLATVFAPNILR------GTLVTLSR  1018
               L+  L+++  HSD             NKM+C NLA +F P+I+R       T+VT   
Sbjct  1082  RFLIVHLSEITKHSDV------------NKMECRNLALMFGPSIVRPSDDNMATMVT---  1126

Query  1019  DKEQENMSDSINVVRTLINHY  1039
                  +MSD   ++ TLI HY
Sbjct  1127  -----HMSDQCKIIETLI-HY  1141


>H1ZUV8_CAEEL unnamed protein product
Length=1718

 Score = 112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/201 (36%), Positives = 103/201 (51%), Gaps = 36/201 (18%)

Query  854   VPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRI------SVDTCPH  907
             VPM V  C+  +E  G++ VG++R+  +   V  L+E L       +      S+D    
Sbjct  1075  VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWR  1134

Query  908   DV---ATLLKEFLRDLPEPLLCYRLYSTFLRTQRIRNRRLQLEALSHIIRLLPIPHRDTL  964
             DV   ++LLK FLR LPEPLL  +LY  F+   RI     +L  L +++R LP PH DTL
Sbjct  1135  DVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTL  1194

Query  965   YVLLAFLAKVAAHSDNVCSVDGSYVMGGNKMDCNNLATVFAPNILR------GTLVTLSR  1018
               L+  L+++  HSD             NKM+C NLA +F P+I+R       T+VT   
Sbjct  1195  RFLIVHLSEITKHSDV------------NKMECRNLALMFGPSIVRPSDDNMATMVT---  1239

Query  1019  DKEQENMSDSINVVRTLINHY  1039
                  +MSD   ++ TLI HY
Sbjct  1240  -----HMSDQCKIIETLI-HY  1254



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062631.2 uncharacterized protein LOC108102333 isoform X3
[Drosophila eugracilis]

Length=947
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2KYD2_CAEEL  unnamed protein product                                 81.3    2e-15
O01443_CAEEL  unnamed protein product                                 80.9    3e-15
A8JR05_DROME  unnamed protein product                                 60.5    7e-09


>H2KYD2_CAEEL unnamed protein product
Length=622

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 58/101 (57%), Gaps = 7/101 (7%)

Query  839  ELNIDRPYQDQLQLMVPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHF  898
            + NID    D   L VP  V NC ++L   GL QVGLFRV+ + KR +QLR  L+K    
Sbjct  515  DANIDD--VDPHALQVPKIVENCTQYLMTYGLTQVGLFRVAGNTKRCRQLRNALEKVGGG  572

Query  899  RISVD-----TCPHDVATLLKEFLRDLPEPLLCYRLYSTFL  934
             +  D     T  HDVATLLKE+ RDLP+ LL    YS ++
Sbjct  573  AVINDNMVENTTSHDVATLLKEYFRDLPQSLLPGEHYSAYI  613


>O01443_CAEEL unnamed protein product
Length=986

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 60/106 (57%), Gaps = 7/106 (7%)

Query  839  ELNIDRPYQDQLQLMVPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHF  898
            + NID    D   L VP  V NC ++L   GL QVGLFRV+ + KR +QLR  L+K    
Sbjct  515  DANIDD--VDPHALQVPKIVENCTQYLMTYGLTQVGLFRVAGNTKRCRQLRNALEKVGGG  572

Query  899  RISVD-----TCPHDVATLLKEFLRDLPEPLLCYRLYSTFLRTQRM  939
             +  D     T  HDVATLLKE+ RDLP+ LL    YS ++   ++
Sbjct  573  AVINDNMVENTTSHDVATLLKEYFRDLPQSLLPGEHYSAYIGAAKL  618


>A8JR05_DROME unnamed protein product
Length=2351

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 4/85 (5%)

Query  854   VPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRISVDTC----PHDV  909
             +P+ V     +L+ N L+QVG+FR S  K R+ +LRE+++  +     +D       +DV
Sbjct  1912  LPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMKLREQIEVTDSTAECMDVFDLQQAYDV  1971

Query  910   ATLLKEFLRDLPEPLLCYRLYSTFL  934
             A +LK++ R+LPE LL  ++  TF+
Sbjct  1972  ADMLKQYFRELPESLLTTKMSETFV  1996



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062632.2 uncharacterized protein LOC108102333 isoform X4
[Drosophila eugracilis]

Length=944
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

H2KYD2_CAEEL  unnamed protein product                                 81.3    2e-15
O01443_CAEEL  unnamed protein product                                 80.5    4e-15
A8JR05_DROME  unnamed protein product                                 60.5    7e-09


>H2KYD2_CAEEL unnamed protein product
Length=622

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 58/101 (57%), Gaps = 7/101 (7%)

Query  839  ELNIDRPYQDQLQLMVPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHF  898
            + NID    D   L VP  V NC ++L   GL QVGLFRV+ + KR +QLR  L+K    
Sbjct  515  DANIDD--VDPHALQVPKIVENCTQYLMTYGLTQVGLFRVAGNTKRCRQLRNALEKVGGG  572

Query  899  RISVD-----TCPHDVATLLKEFLRDLPEPLLCYRLYSTFL  934
             +  D     T  HDVATLLKE+ RDLP+ LL    YS ++
Sbjct  573  AVINDNMVENTTSHDVATLLKEYFRDLPQSLLPGEHYSAYI  613


>O01443_CAEEL unnamed protein product
Length=986

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 58/101 (57%), Gaps = 7/101 (7%)

Query  839  ELNIDRPYQDQLQLMVPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHF  898
            + NID    D   L VP  V NC ++L   GL QVGLFRV+ + KR +QLR  L+K    
Sbjct  515  DANIDD--VDPHALQVPKIVENCTQYLMTYGLTQVGLFRVAGNTKRCRQLRNALEKVGGG  572

Query  899  RISVD-----TCPHDVATLLKEFLRDLPEPLLCYRLYSTFL  934
             +  D     T  HDVATLLKE+ RDLP+ LL    YS ++
Sbjct  573  AVINDNMVENTTSHDVATLLKEYFRDLPQSLLPGEHYSAYI  613


>A8JR05_DROME unnamed protein product
Length=2351

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 51/85 (60%), Gaps = 4/85 (5%)

Query  854   VPMFVNNCIEFLEENGLEQVGLFRVSPSKKRVKQLREELDKDNHFRISVDTC----PHDV  909
             +P+ V     +L+ N L+QVG+FR S  K R+ +LRE+++  +     +D       +DV
Sbjct  1912  LPLAVRAAFRWLQLNALDQVGIFRKSGGKSRIMKLREQIEVTDSTAECMDVFDLQQAYDV  1971

Query  910   ATLLKEFLRDLPEPLLCYRLYSTFL  934
             A +LK++ R+LPE LL  ++  TF+
Sbjct  1972  ADMLKQYFRELPESLLTTKMSETFV  1996



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


Query= XP_017062636.1 nuclear factor 1 A-type isoform X1 [Drosophila
eugracilis]

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 240     3e-68
Q5H9N3_CAEEL  unnamed protein product                                 240     7e-68
Q09631_CAEEL  unnamed protein product                                 239     1e-67


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  33   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  92

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  93   VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  152

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  153  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  206


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 240 bits (612),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  69   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  128

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  129  VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  188

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  189  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  242


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 143/181 (79%), Gaps = 1/181 (1%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANF  200
            ADKVWRLDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN+
Sbjct  167  ADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANY  225

Query  201  I  201
            +
Sbjct  226  L  226



Lambda      K        H
   0.322    0.137    0.410 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 11468334108


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062637.1 nuclear factor 1 A-type isoform X1 [Drosophila
eugracilis]

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 240     3e-68
Q5H9N3_CAEEL  unnamed protein product                                 240     7e-68
Q09631_CAEEL  unnamed protein product                                 239     1e-67


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  33   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  92

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  93   VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  152

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  153  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  206


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 240 bits (612),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  69   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  128

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  129  VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  188

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  189  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  242


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 143/181 (79%), Gaps = 1/181 (1%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANF  200
            ADKVWRLDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN+
Sbjct  167  ADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANY  225

Query  201  I  201
            +
Sbjct  226  L  226



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062638.1 nuclear factor 1 A-type isoform X1 [Drosophila
eugracilis]

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 240     3e-68
Q5H9N3_CAEEL  unnamed protein product                                 240     7e-68
Q09631_CAEEL  unnamed protein product                                 239     1e-67


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  33   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  92

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  93   VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  152

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  153  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  206


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 240 bits (612),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  69   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  128

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  129  VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  188

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  189  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  242


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 143/181 (79%), Gaps = 1/181 (1%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANF  200
            ADKVWRLDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN+
Sbjct  167  ADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANY  225

Query  201  I  201
            +
Sbjct  226  L  226



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062639.1 nuclear factor 1 A-type isoform X2 [Drosophila
eugracilis]

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 240     3e-68
Q5H9N3_CAEEL  unnamed protein product                                 240     5e-68
Q09631_CAEEL  unnamed protein product                                 239     1e-67


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 240 bits (613),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  33   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  92

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  93   VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  152

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  153  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  206


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 240 bits (613),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  69   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  128

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  129  VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  188

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  189  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  242


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 143/181 (79%), Gaps = 1/181 (1%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANF  200
            ADKVWRLDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN+
Sbjct  167  ADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANY  225

Query  201  I  201
            +
Sbjct  226  L  226



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062640.1 nuclear factor 1 A-type isoform X3 [Drosophila
eugracilis]

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 240     3e-68
Q5H9N3_CAEEL  unnamed protein product                                 240     4e-68
Q09631_CAEEL  unnamed protein product                                 239     1e-67


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 240 bits (612),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  33   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  92

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  93   VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  152

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  153  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  206


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 240 bits (612),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 141/175 (81%), Gaps = 1/175 (1%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  69   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  128

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  129  VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  188

Query  147  LDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANFI  201
            LDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN++
Sbjct  189  LDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANYL  242


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 239 bits (609),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 143/181 (79%), Gaps = 1/181 (1%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLVMVILFKAIPLESTDGERLEKNPECLHPGLCVNPYHINVSVRELDLYLANF  200
            ADKVWRLDLV +ILFK IPLESTDGERLE++  C+HP LC+NP+H+ +SVR LD+++AN+
Sbjct  167  ADKVWRLDLVTIILFKGIPLESTDGERLERSEACVHP-LCINPFHMAISVRGLDVFMANY  225

Query  201  I  201
            +
Sbjct  226  L  226



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062641.1 nuclear factor 1 X-type isoform X4 [Drosophila
eugracilis]

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 189     6e-51
Q5H9N3_CAEEL  unnamed protein product                                 189     8e-51
Q09631_CAEEL  unnamed protein product                                 187     2e-50


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 189 bits (480),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 109/138 (79%), Gaps = 0/138 (0%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  33   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  92

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  93   VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  152

Query  147  LDLVMVILFKAIPLESTD  164
            LDLV +ILFK IPLESTD
Sbjct  153  LDLVTIILFKGIPLESTD  170


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 189 bits (480),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 109/138 (79%), Gaps = 0/138 (0%)

Query  27   QDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEKTEVK  86
            Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++ E+K
Sbjct  69   QEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDRDELK  128

Query  87   QKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQADKVWR  146
             KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQADKVWR
Sbjct  129  VKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQADKVWR  188

Query  147  LDLVMVILFKAIPLESTD  164
            LDLV +ILFK IPLESTD
Sbjct  189  LDLVTIILFKGIPLESTD  206


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 187 bits (476),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 111/144 (77%), Gaps = 0/144 (0%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLVMVILFKAIPLESTD  164
            ADKVWRLDLV +ILFK IPLESTD
Sbjct  167  ADKVWRLDLVTIILFKGIPLESTD  190



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062642.1 nuclear factor 1 isoform X5 [Drosophila eugracilis]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q5H9N2_CAEEL  unnamed protein product                                 158     1e-45
Q5H9N3_CAEEL  unnamed protein product                                 158     2e-45
Q09631_CAEEL  unnamed protein product                                 157     4e-45


>Q5H9N2_CAEEL unnamed protein product
Length=787

 Score = 158 bits (400),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 70/128 (55%), Positives = 98/128 (77%), Gaps = 0/128 (0%)

Query  23   SSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEK  82
            S   Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++
Sbjct  29   SPYSQEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDR  88

Query  83   TEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQAD  142
             E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQAD
Sbjct  89   DELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQAD  148

Query  143  KVWRLDLI  150
            KVWRLDL+
Sbjct  149  KVWRLDLV  156


>Q5H9N3_CAEEL unnamed protein product
Length=823

 Score = 158 bits (399),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 70/128 (55%), Positives = 98/128 (77%), Gaps = 0/128 (0%)

Query  23   SSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQNEK  82
            S   Q++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN++
Sbjct  65   SPYSQEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQNDR  124

Query  83   TEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQAD  142
             E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQAD
Sbjct  125  DELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQAD  184

Query  143  KVWRLDLI  150
            KVWRLDL+
Sbjct  185  KVWRLDLV  192


>Q09631_CAEEL unnamed protein product
Length=807

 Score = 157 bits (396),  Expect = 4e-45, Method: Composition-based stats.
 Identities = 70/130 (54%), Positives = 99/130 (76%), Gaps = 0/130 (0%)

Query  21   QTSSSGQDEFHPFIEALLPYVKSFSYSWFNLQAAKRKYYKKHEKRMSLEEERHCKDELQN  80
            Q +S   ++  PF+E LLP+V++ +Y+WF+LQAAKR+++K+ +K+M   EE     ELQN
Sbjct  47   QFNSPEAEDMGPFVEQLLPFVRASAYNWFHLQAAKRRHFKEFDKKMCASEENAKLAELQN  106

Query  81   EKTEVKQKWASRLLGKLRKDITQESREDFVQSIIGKRKSICVLSNPDQKGKMRRIDCLRQ  140
            ++ E+K KWASRLLGK++KDI  + +E F+ +I G   + C++S  DQKGKMRRIDCLRQ
Sbjct  107  DRDELKVKWASRLLGKIKKDIQNDDKEAFISAINGSEPNKCIISVADQKGKMRRIDCLRQ  166

Query  141  ADKVWRLDLI  150
            ADKVWRLDL+
Sbjct  167  ADKVWRLDLV  176



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062644.1 synaptotagmin-7 isoform X1 [Drosophila eugracilis]

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4C4_DROME  unnamed protein product                                 826     0.0  
Q6NNV2_DROME  unnamed protein product                                 635     0.0  
H9XVN2_DROME  unnamed protein product                                 604     0.0  


>Q9V4C4_DROME unnamed protein product
Length=416

 Score = 826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/416 (95%), Positives = 405/416 (97%), Gaps = 0/416 (0%)

Query  1    MANIVLIASLAVLGLIIAIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60
            MA+IVLIA LA+LGLII IALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
Sbjct  1    MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60

Query  61   ESGNPPLKPQVPVAQAISTPLQNNINRKLNGFLSLRTPLIGGSGNTPSKAQNVSSAGNAG  120
            +SGNPP KPQVPVA AI+TPLQNNINRKLNGFLSLRTPLIGGSG + +K Q +SS GN G
Sbjct  61   DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG  120

Query  121  DGTPKDSANKSISMTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180
            DGT KDSANKSISMTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
Sbjct  121  DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180

Query  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240
            GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
Sbjct  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240

Query  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300
            FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
Sbjct  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300

Query  301  RNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS  360
            RNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS
Sbjct  301  RNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS  360

Query  361  LDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  416
            LDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE
Sbjct  361  LDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  416


>Q6NNV2_DROME unnamed protein product
Length=327

 Score = 635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/326 (94%), Positives = 315/326 (97%), Gaps = 0/326 (0%)

Query  1    MANIVLIASLAVLGLIIAIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60
            MA+IVLIA LA+LGLII IALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
Sbjct  1    MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60

Query  61   ESGNPPLKPQVPVAQAISTPLQNNINRKLNGFLSLRTPLIGGSGNTPSKAQNVSSAGNAG  120
            +SGNPP KPQVPVA AI+TPLQNNINRKLNGFLSLRTPLIGGSG + +K Q +SS GN G
Sbjct  61   DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG  120

Query  121  DGTPKDSANKSISMTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180
            DGT KDSANKSISMTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
Sbjct  121  DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180

Query  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240
            GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
Sbjct  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240

Query  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300
            FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
Sbjct  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300

Query  301  RNLKAKDINGKSDPYVKVWLQFGDKR  326
            RNLKAKDINGKSDPYVKVWLQFGDKR
Sbjct  301  RNLKAKDINGKSDPYVKVWLQFGDKR  326


 Score = 68.9 bits (167),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (56%), Gaps = 3/126 (2%)

Query  275  DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPI  334
            +  G++  SL Y   N+ L L +++ + L AKD++G SDPYV+V L   DK+  + +T I
Sbjct  146  ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTL-LPDKK-HRLETKI  203

Query  335  FTCTLNPVFNESFSF-NVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASET  393
               TLNP +NE+F F   P +K++   L + V D+D   R++ IG + L       A + 
Sbjct  204  KRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQ  263

Query  394  KHWQDM  399
              W+ +
Sbjct  264  SFWKAL  269


>H9XVN2_DROME unnamed protein product
Length=345

 Score = 604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 301/312 (96%), Gaps = 0/312 (0%)

Query  1    MANIVLIASLAVLGLIIAIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60
            MA+IVLIA LA+LGLII IALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
Sbjct  1    MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60

Query  61   ESGNPPLKPQVPVAQAISTPLQNNINRKLNGFLSLRTPLIGGSGNTPSKAQNVSSAGNAG  120
            +SGNPP KPQVPVA AI+TPLQNNINRKLNGFLSLRTPLIGGSG + +K Q +SS GN G
Sbjct  61   DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG  120

Query  121  DGTPKDSANKSISMTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180
            DGT KDSANKSISMTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
Sbjct  121  DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180

Query  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240
            GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
Sbjct  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240

Query  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300
            FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
Sbjct  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300

Query  301  RNLKAKDINGKS  312
            RNLKAKDINGKS
Sbjct  301  RNLKAKDINGKS  312


 Score = 104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 100/202 (50%), Gaps = 62/202 (31%)

Query  275  DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPI  334
            +  G++  SL Y   N+ L L +++ + L AKD++G SDPYV+V L   DK+  + +T I
Sbjct  146  ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTL-LPDKK-HRLETKI  203

Query  335  FTCTLNPVFNESFSF-NVPWEKIRECSLDVMVMDF------DNIGR--------------  373
               TLNP +NE+F F   P +K++   L + V D+      D+IG               
Sbjct  204  KRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQ  263

Query  374  --------------------------NELIGRILL-------------AGKNGSGASETK  394
                                      N ++   L+             +GKNGSGASETK
Sbjct  264  SFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSGKNGSGASETK  323

Query  395  HWQDMISKPRQTVVQWHRLKPE  416
            HWQDMISKPRQTVVQWHRLKPE
Sbjct  324  HWQDMISKPRQTVVQWHRLKPE  345



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062645.1 synaptotagmin-7 isoform X1 [Drosophila eugracilis]

Length=416
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4C4_DROME  unnamed protein product                                 826     0.0  
Q6NNV2_DROME  unnamed protein product                                 635     0.0  
H9XVN2_DROME  unnamed protein product                                 604     0.0  


>Q9V4C4_DROME unnamed protein product
Length=416

 Score = 826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/416 (95%), Positives = 405/416 (97%), Gaps = 0/416 (0%)

Query  1    MANIVLIASLAVLGLIIAIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60
            MA+IVLIA LA+LGLII IALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
Sbjct  1    MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60

Query  61   ESGNPPLKPQVPVAQAISTPLQNNINRKLNGFLSLRTPLIGGSGNTPSKAQNVSSAGNAG  120
            +SGNPP KPQVPVA AI+TPLQNNINRKLNGFLSLRTPLIGGSG + +K Q +SS GN G
Sbjct  61   DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG  120

Query  121  DGTPKDSANKSISMTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180
            DGT KDSANKSISMTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
Sbjct  121  DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180

Query  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240
            GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
Sbjct  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240

Query  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300
            FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
Sbjct  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300

Query  301  RNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS  360
            RNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS
Sbjct  301  RNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECS  360

Query  361  LDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  416
            LDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE
Sbjct  361  LDVMVMDFDNIGRNELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  416


>Q6NNV2_DROME unnamed protein product
Length=327

 Score = 635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/326 (94%), Positives = 315/326 (97%), Gaps = 0/326 (0%)

Query  1    MANIVLIASLAVLGLIIAIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60
            MA+IVLIA LA+LGLII IALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
Sbjct  1    MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60

Query  61   ESGNPPLKPQVPVAQAISTPLQNNINRKLNGFLSLRTPLIGGSGNTPSKAQNVSSAGNAG  120
            +SGNPP KPQVPVA AI+TPLQNNINRKLNGFLSLRTPLIGGSG + +K Q +SS GN G
Sbjct  61   DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG  120

Query  121  DGTPKDSANKSISMTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180
            DGT KDSANKSISMTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
Sbjct  121  DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180

Query  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240
            GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
Sbjct  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240

Query  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300
            FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
Sbjct  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300

Query  301  RNLKAKDINGKSDPYVKVWLQFGDKR  326
            RNLKAKDINGKSDPYVKVWLQFGDKR
Sbjct  301  RNLKAKDINGKSDPYVKVWLQFGDKR  326


 Score = 68.9 bits (167),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (56%), Gaps = 3/126 (2%)

Query  275  DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPI  334
            +  G++  SL Y   N+ L L +++ + L AKD++G SDPYV+V L   DK+  + +T I
Sbjct  146  ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTL-LPDKK-HRLETKI  203

Query  335  FTCTLNPVFNESFSF-NVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASET  393
               TLNP +NE+F F   P +K++   L + V D+D   R++ IG + L       A + 
Sbjct  204  KRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQ  263

Query  394  KHWQDM  399
              W+ +
Sbjct  264  SFWKAL  269


>H9XVN2_DROME unnamed protein product
Length=345

 Score = 604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/312 (94%), Positives = 301/312 (96%), Gaps = 0/312 (0%)

Query  1    MANIVLIASLAVLGLIIAIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60
            MA+IVLIA LA+LGLII IALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV
Sbjct  1    MASIVLIACLAILGLIITIALFLAGGYLWWRHKRSQLQFIEPNEDEESSSYSLRAAQDIV  60

Query  61   ESGNPPLKPQVPVAQAISTPLQNNINRKLNGFLSLRTPLIGGSGNTPSKAQNVSSAGNAG  120
            +SGNPP KPQVPVA AI+TPLQNNINRKLNGFLSLRTPLIGGSG + +K Q +SS GN G
Sbjct  61   DSGNPPTKPQVPVAHAITTPLQNNINRKLNGFLSLRTPLIGGSGASQTKPQIISSVGNPG  120

Query  121  DGTPKDSANKSISMTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180
            DGT KDSANKSISMTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS
Sbjct  121  DGTTKDSANKSISMTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLS  180

Query  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240
            GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR
Sbjct  181  GTSDPYVRVTLLPDKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDR  240

Query  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300
            FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA
Sbjct  241  FSRDDSIGEVFLPLCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKA  300

Query  301  RNLKAKDINGKS  312
            RNLKAKDINGKS
Sbjct  301  RNLKAKDINGKS  312


 Score = 104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 74/202 (37%), Positives = 100/202 (50%), Gaps = 62/202 (31%)

Query  275  DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPI  334
            +  G++  SL Y   N+ L L +++ + L AKD++G SDPYV+V L   DK+  + +T I
Sbjct  146  ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTL-LPDKK-HRLETKI  203

Query  335  FTCTLNPVFNESFSF-NVPWEKIRECSLDVMVMDF------DNIGR--------------  373
               TLNP +NE+F F   P +K++   L + V D+      D+IG               
Sbjct  204  KRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQ  263

Query  374  --------------------------NELIGRILL-------------AGKNGSGASETK  394
                                      N ++   L+             +GKNGSGASETK
Sbjct  264  SFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSGKNGSGASETK  323

Query  395  HWQDMISKPRQTVVQWHRLKPE  416
            HWQDMISKPRQTVVQWHRLKPE
Sbjct  324  HWQDMISKPRQTVVQWHRLKPE  345



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062647.1 synaptotagmin-7 isoform X2 [Drosophila eugracilis]

Length=283
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V4C4_DROME  unnamed protein product                                 592     0.0   
Q59DP7_DROME  unnamed protein product                                 588     0.0   
Q6NNV2_DROME  unnamed protein product                                 402     6e-142


>Q9V4C4_DROME unnamed protein product
Length=416

 Score = 592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/283 (99%), Positives = 283/283 (100%), Gaps = 0/283 (0%)

Query  1    MTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP  60
            MTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP
Sbjct  134  MTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP  193

Query  61   DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP  120
            DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP
Sbjct  194  DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP  253

Query  121  LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD  180
            LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD
Sbjct  254  LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD  313

Query  181  PYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR  240
            PYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR
Sbjct  314  PYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR  373

Query  241  NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  283
            NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE
Sbjct  374  NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  416


>Q59DP7_DROME unnamed protein product
Length=283

 Score = 588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/283 (99%), Positives = 283/283 (100%), Gaps = 0/283 (0%)

Query  1    MTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP  60
            MTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP
Sbjct  1    MTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP  60

Query  61   DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP  120
            DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP
Sbjct  61   DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP  120

Query  121  LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD  180
            LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD
Sbjct  121  LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD  180

Query  181  PYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR  240
            PYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR
Sbjct  181  PYVKVWLQFGDKRVEKRKTPIFTCTLNPVFNESFSFNVPWEKIRECSLDVMVMDFDNIGR  240

Query  241  NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  283
            NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE
Sbjct  241  NELIGRILLAGKNGSGASETKHWQDMISKPRQTVVQWHRLKPE  283


>Q6NNV2_DROME unnamed protein product
Length=327

 Score = 402 bits (1033),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 192/193 (99%), Positives = 193/193 (100%), Gaps = 0/193 (0%)

Query  1    MTDMYLDTTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP  60
            MTDMYLD+TDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP
Sbjct  134  MTDMYLDSTDPSENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTLLP  193

Query  61   DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP  120
            DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP
Sbjct  194  DKKHRLETKIKRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLP  253

Query  121  LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD  180
            LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD
Sbjct  254  LCQVDFAGKQSFWKALKPPAKDKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSD  313

Query  181  PYVKVWLQFGDKR  193
            PYVKVWLQFGDKR
Sbjct  314  PYVKVWLQFGDKR  326


 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (56%), Gaps = 3/126 (2%)

Query  142  DKCGELLSSLCYHPSNSILTLTLIKARNLKAKDINGKSDPYVKVWLQFGDKRVEKRKTPI  201
            +  G++  SL Y   N+ L L +++ + L AKD++G SDPYV+V L   DK+  + +T I
Sbjct  146  ENVGQIHFSLEYDFQNTTLILKVLQGKELPAKDLSGTSDPYVRVTL-LPDKK-HRLETKI  203

Query  202  FTCTLNPVFNESFSF-NVPWEKIRECSLDVMVMDFDNIGRNELIGRILLAGKNGSGASET  260
               TLNP +NE+F F   P +K++   L + V D+D   R++ IG + L       A + 
Sbjct  204  KRRTLNPRWNETFYFEGFPIQKLQSRVLHLHVFDYDRFSRDDSIGEVFLPLCQVDFAGKQ  263

Query  261  KHWQDM  266
              W+ +
Sbjct  264  SFWKAL  269



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062648.1 zwei Ig domain protein zig-8 isoform X1 [Drosophila
eugracilis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 522     0.0   
A8DZ28_DROME  unnamed protein product                                 471     2e-169
X2J8X8_DROME  unnamed protein product                                 206     1e-63 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 284/315 (90%), Gaps = 4/315 (1%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSKAARAKILGST  179
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K+ARAKILGST
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  180  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  239
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  240  ASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAICVKTYTAMITIISVKVL  299
            ASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI ++ +TAMITIIS KVL
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIRIRAFTAMITIISTKVL  297

Query  300  FYIPSLKDILYRRER  314
             YI SL + +Y RER
Sbjct  298  LYISSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 471 bits (1212),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 247/271 (91%), Gaps = 4/271 (1%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  223
            R YD+K+ARAKILGSTEIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  224  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAIC  283
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIR  255

Query  284  VKTYTAMITIISVKVLFYIPSLKDILYRRER  314
            ++ +TAMITIIS KVL YI SL + +Y RER
Sbjct  256  IRAFTAMITIISTKVLLYISSLMEHMYLRER  286


>X2J8X8_DROME unnamed protein product
Length=396

 Score = 206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 155/258 (60%), Gaps = 25/258 (10%)

Query  50   RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSV  109
             P+FD  +PRNV+A++ + A L CRV+N  N+TVSW+R RD+HILT   YTY+ DQRF  
Sbjct  72   EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQA  131

Query  110  IHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDLKTENRLYDSK  169
             H   ++DW L+I +AQ RD+G+YECQ++T+P  +  + L +                  
Sbjct  132  THHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNV-----------------V  174

Query  170  AARAKILGSTEIHVKRDSTIALACSVNIHASS---VVWYHGLSIVDFDSLRGGISLETEK  226
               A ILG  ++HV + STI L C+V         + WYH   ++++DS RGG+S+ TEK
Sbjct  175  VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEK  234

Query  227  TDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTV---FTGEQPAAMQTSAAIC  283
             D  TTS L++  A L DSG Y+C P+ A  ASVRVHVL V    +GE P AMQT ++ C
Sbjct  235  GDV-TTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGC  293

Query  284  VKTYTAMITIISVKVLFY  301
               +  ++ ++ + VL Y
Sbjct  294  QYNWLTIVLLLGL-VLCY  310



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062649.1 zwei Ig domain protein zig-8 isoform X1 [Drosophila
eugracilis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 522     0.0   
A8DZ28_DROME  unnamed protein product                                 471     2e-169
X2J8X8_DROME  unnamed protein product                                 206     1e-63 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 284/315 (90%), Gaps = 4/315 (1%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSKAARAKILGST  179
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K+ARAKILGST
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  180  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  239
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  240  ASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAICVKTYTAMITIISVKVL  299
            ASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI ++ +TAMITIIS KVL
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIRIRAFTAMITIISTKVL  297

Query  300  FYIPSLKDILYRRER  314
             YI SL + +Y RER
Sbjct  298  LYISSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 471 bits (1212),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 247/271 (91%), Gaps = 4/271 (1%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  223
            R YD+K+ARAKILGSTEIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  224  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAIC  283
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIR  255

Query  284  VKTYTAMITIISVKVLFYIPSLKDILYRRER  314
            ++ +TAMITIIS KVL YI SL + +Y RER
Sbjct  256  IRAFTAMITIISTKVLLYISSLMEHMYLRER  286


>X2J8X8_DROME unnamed protein product
Length=396

 Score = 206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 155/258 (60%), Gaps = 25/258 (10%)

Query  50   RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSV  109
             P+FD  +PRNV+A++ + A L CRV+N  N+TVSW+R RD+HILT   YTY+ DQRF  
Sbjct  72   EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQA  131

Query  110  IHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDLKTENRLYDSK  169
             H   ++DW L+I +AQ RD+G+YECQ++T+P  +  + L +                  
Sbjct  132  THHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNV-----------------V  174

Query  170  AARAKILGSTEIHVKRDSTIALACSVNIHASS---VVWYHGLSIVDFDSLRGGISLETEK  226
               A ILG  ++HV + STI L C+V         + WYH   ++++DS RGG+S+ TEK
Sbjct  175  VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEK  234

Query  227  TDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTV---FTGEQPAAMQTSAAIC  283
             D  TTS L++  A L DSG Y+C P+ A  ASVRVHVL V    +GE P AMQT ++ C
Sbjct  235  GDV-TTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGC  293

Query  284  VKTYTAMITIISVKVLFY  301
               +  ++ ++ + VL Y
Sbjct  294  QYNWLTIVLLLGL-VLCY  310



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062650.1 zwei Ig domain protein zig-8 isoform X1 [Drosophila
eugracilis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 522     0.0   
A8DZ28_DROME  unnamed protein product                                 471     2e-169
X2J8X8_DROME  unnamed protein product                                 206     1e-63 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 284/315 (90%), Gaps = 4/315 (1%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSKAARAKILGST  179
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K+ARAKILGST
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  180  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  239
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  240  ASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAICVKTYTAMITIISVKVL  299
            ASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI ++ +TAMITIIS KVL
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIRIRAFTAMITIISTKVL  297

Query  300  FYIPSLKDILYRRER  314
             YI SL + +Y RER
Sbjct  298  LYISSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 471 bits (1212),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 247/271 (91%), Gaps = 4/271 (1%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  223
            R YD+K+ARAKILGSTEIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  224  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAIC  283
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIR  255

Query  284  VKTYTAMITIISVKVLFYIPSLKDILYRRER  314
            ++ +TAMITIIS KVL YI SL + +Y RER
Sbjct  256  IRAFTAMITIISTKVLLYISSLMEHMYLRER  286


>X2J8X8_DROME unnamed protein product
Length=396

 Score = 206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 155/258 (60%), Gaps = 25/258 (10%)

Query  50   RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSV  109
             P+FD  +PRNV+A++ + A L CRV+N  N+TVSW+R RD+HILT   YTY+ DQRF  
Sbjct  72   EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQA  131

Query  110  IHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDLKTENRLYDSK  169
             H   ++DW L+I +AQ RD+G+YECQ++T+P  +  + L +                  
Sbjct  132  THHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNV-----------------V  174

Query  170  AARAKILGSTEIHVKRDSTIALACSVNIHASS---VVWYHGLSIVDFDSLRGGISLETEK  226
               A ILG  ++HV + STI L C+V         + WYH   ++++DS RGG+S+ TEK
Sbjct  175  VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEK  234

Query  227  TDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTV---FTGEQPAAMQTSAAIC  283
             D  TTS L++  A L DSG Y+C P+ A  ASVRVHVL V    +GE P AMQT ++ C
Sbjct  235  GDV-TTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGC  293

Query  284  VKTYTAMITIISVKVLFY  301
               +  ++ ++ + VL Y
Sbjct  294  QYNWLTIVLLLGL-VLCY  310



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062651.1 zwei Ig domain protein zig-8 isoform X1 [Drosophila
eugracilis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 522     0.0   
A8DZ28_DROME  unnamed protein product                                 471     2e-169
X2J8X8_DROME  unnamed protein product                                 206     1e-63 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 284/315 (90%), Gaps = 4/315 (1%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSKAARAKILGST  179
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K+ARAKILGST
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  180  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  239
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  240  ASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAICVKTYTAMITIISVKVL  299
            ASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI ++ +TAMITIIS KVL
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIRIRAFTAMITIISTKVL  297

Query  300  FYIPSLKDILYRRER  314
             YI SL + +Y RER
Sbjct  298  LYISSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 471 bits (1212),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 247/271 (91%), Gaps = 4/271 (1%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  223
            R YD+K+ARAKILGSTEIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  224  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAIC  283
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIR  255

Query  284  VKTYTAMITIISVKVLFYIPSLKDILYRRER  314
            ++ +TAMITIIS KVL YI SL + +Y RER
Sbjct  256  IRAFTAMITIISTKVLLYISSLMEHMYLRER  286


>X2J8X8_DROME unnamed protein product
Length=396

 Score = 206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 155/258 (60%), Gaps = 25/258 (10%)

Query  50   RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSV  109
             P+FD  +PRNV+A++ + A L CRV+N  N+TVSW+R RD+HILT   YTY+ DQRF  
Sbjct  72   EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQA  131

Query  110  IHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDLKTENRLYDSK  169
             H   ++DW L+I +AQ RD+G+YECQ++T+P  +  + L +                  
Sbjct  132  THHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNV-----------------V  174

Query  170  AARAKILGSTEIHVKRDSTIALACSVNIHASS---VVWYHGLSIVDFDSLRGGISLETEK  226
               A ILG  ++HV + STI L C+V         + WYH   ++++DS RGG+S+ TEK
Sbjct  175  VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEK  234

Query  227  TDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTV---FTGEQPAAMQTSAAIC  283
             D  TTS L++  A L DSG Y+C P+ A  ASVRVHVL V    +GE P AMQT ++ C
Sbjct  235  GDV-TTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGC  293

Query  284  VKTYTAMITIISVKVLFY  301
               +  ++ ++ + VL Y
Sbjct  294  QYNWLTIVLLLGL-VLCY  310



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062652.1 zwei Ig domain protein zig-8 isoform X1 [Drosophila
eugracilis]

Length=314
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 522     0.0   
A8DZ28_DROME  unnamed protein product                                 471     2e-169
X2J8X8_DROME  unnamed protein product                                 206     1e-63 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 522 bits (1345),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 284/315 (90%), Gaps = 4/315 (1%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSKAARAKILGST  179
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K+ARAKILGST
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  180  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  239
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  240  ASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAICVKTYTAMITIISVKVL  299
            ASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI ++ +TAMITIIS KVL
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIRIRAFTAMITIISTKVL  297

Query  300  FYIPSLKDILYRRER  314
             YI SL + +Y RER
Sbjct  298  LYISSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 471 bits (1212),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/271 (84%), Positives = 247/271 (91%), Gaps = 4/271 (1%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  223
            R YD+K+ARAKILGSTEIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  224  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAIC  283
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIR  255

Query  284  VKTYTAMITIISVKVLFYIPSLKDILYRRER  314
            ++ +TAMITIIS KVL YI SL + +Y RER
Sbjct  256  IRAFTAMITIISTKVLLYISSLMEHMYLRER  286


>X2J8X8_DROME unnamed protein product
Length=396

 Score = 206 bits (524),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/258 (42%), Positives = 155/258 (60%), Gaps = 25/258 (10%)

Query  50   RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSV  109
             P+FD  +PRNV+A++ + A L CRV+N  N+TVSW+R RD+HILT   YTY+ DQRF  
Sbjct  72   EPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQA  131

Query  110  IHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDLKTENRLYDSK  169
             H   ++DW L+I +AQ RD+G+YECQ++T+P  +  + L +                  
Sbjct  132  THHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNV-----------------V  174

Query  170  AARAKILGSTEIHVKRDSTIALACSVNIHASS---VVWYHGLSIVDFDSLRGGISLETEK  226
               A ILG  ++HV + STI L C+V         + WYH   ++++DS RGG+S+ TEK
Sbjct  175  VPTATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEK  234

Query  227  TDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTV---FTGEQPAAMQTSAAIC  283
             D  TTS L++  A L DSG Y+C P+ A  ASVRVHVL V    +GE P AMQT ++ C
Sbjct  235  GDV-TTSFLLIQNADLADSGKYSCAPSNADVASVRVHVLNVRAIISGEHPEAMQTGSSGC  293

Query  284  VKTYTAMITIISVKVLFY  301
               +  ++ ++ + VL Y
Sbjct  294  QYNWLTIVLLLGL-VLCY  310



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062653.1 zwei Ig domain protein zig-8 isoform X2 [Drosophila
eugracilis]

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 528     0.0   
A8DZ28_DROME  unnamed protein product                                 477     1e-171
Q9VY33_DROME  unnamed protein product                                 209     2e-65 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/312 (81%), Positives = 284/312 (91%), Gaps = 1/312 (0%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSKAARAKILGST  179
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K+ARAKILGST
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  180  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  239
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  240  ASLRDSGNYTCIPNGAIPASVRVHVLTGEQPAAMQTSAAICVKTYTAMITIISVKVLFYI  299
            ASLRDSGNYTC+PNGAIPASVRVHVLTGEQPAAMQTS+AI ++ +TAMITIIS KVL YI
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYI  300

Query  300  PSLKDILYRRER  311
             SL + +Y RER
Sbjct  301  SSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 477 bits (1227),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 228/268 (85%), Positives = 247/268 (92%), Gaps = 1/268 (0%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  223
            R YD+K+ARAKILGSTEIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  224  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTGEQPAAMQTSAAICVKT  283
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVLTGEQPAAMQTS+AI ++ 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRA  258

Query  284  YTAMITIISVKVLFYIPSLKDILYRRER  311
            +TAMITIIS KVL YI SL + +Y RER
Sbjct  259  FTAMITIISTKVLLYISSLMEHMYLRER  286


>Q9VY33_DROME unnamed protein product
Length=344

 Score = 209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/240 (46%), Positives = 146/240 (61%), Gaps = 23/240 (10%)

Query  42   LNDLAS--SNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIY  99
            L DL +  +  P FD     N++ +V +   L CRVKN GNRTVSW+R RD+H+LT   Y
Sbjct  31   LQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRY  90

Query  100  TYSGDQRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDL  159
            TY+ DQRF  +H P ++DW L+I YAQ +DSG+YECQ++T P I  ++ L I  + V D 
Sbjct  91   TYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNI-VEPVTD-  148

Query  160  KTENRLYDSKAARAKILGSTEIHVKRDSTIALACSVNIHAS---SVVWYHGLSIVDFDSL  216
                           I+G  E+H+ R STI L C V        +V+W H   I++FDS 
Sbjct  149  ---------------IIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSP  193

Query  217  RGGISLETEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTGEQPAAMQTS  276
            RGGISL TEK    TTSRL++ +A  +DSG YTC P+ A P SVRVH++ GE PAAM T 
Sbjct  194  RGGISLVTEK-GVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIVDGEHPAAMHTG  252



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062654.1 zwei Ig domain protein zig-8 isoform X3 [Drosophila
eugracilis]

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A8DZ27_DROME  unnamed protein product                                 496     4e-179
A8DZ28_DROME  unnamed protein product                                 445     3e-159
Q9VY33_DROME  unnamed protein product                                 202     5e-63 


>A8DZ27_DROME unnamed protein product
Length=312

 Score = 496 bits (1278),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 274/315 (87%), Gaps = 14/315 (4%)

Query  1    MTVGNNATYSDNFPIRIKPFVILILNVNICFHHVSASSFLNLNDLASSNRPFFDDISPRN  60
            M+ G +AT+ +N PI+IKPF+IL+LN+NI   ++SA+S+L+LNDL +  RPFFDDISPRN
Sbjct  1    MSRGKHATFLNNSPIKIKPFIILVLNLNIWCQYISATSYLSLNDLTNLERPFFDDISPRN  60

Query  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGDQRFSVIHPPSSDDWNL  120
            VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GDQRFSVIHPP S+DW+L
Sbjct  61   VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDL  120

Query  121  KIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTENRLYDSK----------  169
            KIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ R YD+K          
Sbjct  121  KIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST  180

Query  170  EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLETEKTDTGTTSRLMLTR  229
            EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLETEKTD GTTSRLMLTR
Sbjct  181  EIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTR  240

Query  230  ASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAICVKTYTAMITIISVKVL  289
            ASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI ++ +TAMITIIS KVL
Sbjct  241  ASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIRIRAFTAMITIISTKVL  297

Query  290  FYIPSLKDILYRRER  304
             YI SL + +Y RER
Sbjct  298  LYISSLMEHMYLRER  312


>A8DZ28_DROME unnamed protein product
Length=286

 Score = 445 bits (1145),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 219/271 (81%), Positives = 237/271 (87%), Gaps = 14/271 (5%)

Query  45   LASSNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYSGD  104
            L +  RPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTY+GD
Sbjct  19   LTNLERPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGD  78

Query  105  QRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKAD-DVRDLKTEN  163
            QRFSVIHPP S+DW+LKIDYAQPRDSGVYECQVNTEPKINLAI L++ AD D +DLKT+ 
Sbjct  79   QRFSVIHPPGSEDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKK  138

Query  164  RLYDSK----------EIHVKRDSTIALACSVNIHASSVVWYHGLSIVDFDSLRGGISLE  213
            R YD+K          EIHVKRDSTIALACSVNIHA SV+WYHG S+VDFDSLRGGISLE
Sbjct  139  RFYDTKSARAKILGSTEIHVKRDSTIALACSVNIHAPSVIWYHGSSVVDFDSLRGGISLE  198

Query  214  TEKTDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTSAAIC  273
            TEKTD GTTSRLMLTRASLRDSGNYTC+PNGAIPASVRVHVL   TGEQPAAMQTS+AI 
Sbjct  199  TEKTDVGTTSRLMLTRASLRDSGNYTCVPNGAIPASVRVHVL---TGEQPAAMQTSSAIR  255

Query  274  VKTYTAMITIISVKVLFYIPSLKDILYRRER  304
            ++ +TAMITIIS KVL YI SL + +Y RER
Sbjct  256  IRAFTAMITIISTKVLLYISSLMEHMYLRER  286


>Q9VY33_DROME unnamed protein product
Length=344

 Score = 202 bits (515),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 144/233 (62%), Gaps = 16/233 (7%)

Query  42   LNDLAS--SNRPFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIY  99
            L DL +  +  P FD     N++ +V +   L CRVKN GNRTVSW+R RD+H+LT   Y
Sbjct  31   LQDLPTPGTGGPTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRY  90

Query  100  TYSGDQRFSVIHPPSSDDWNLKIDYAQPRDSGVYECQVNTEPKINLAIILEIKADDVRDL  159
            TY+ DQRF  +H P ++DW L+I YAQ +DSG+YECQ++T P I  ++ L I  + V D 
Sbjct  91   TYTSDQRFEAMHSPHAEDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNI-VEPVTD-  148

Query  160  KTENRLYDSKEIHVKRDSTIALACSVNIHAS---SVVWYHGLSIVDFDSLRGGISLETEK  216
                 +    E+H+ R STI L C V        +V+W H   I++FDS RGGISL TEK
Sbjct  149  -----IIGGPELHINRGSTINLTCIVKFAPEPPPTVIWSHNREIINFDSPRGGISLVTEK  203

Query  217  TDTGTTSRLMLTRASLRDSGNYTCIPNGAIPASVRVHVLTVFTGEQPAAMQTS  269
                TTSRL++ +A  +DSG YTC P+ A P SVRVH++    GE PAAM T 
Sbjct  204  -GVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRVHIV---DGEHPAAMHTG  252



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062656.1 calcium-dependent secretion activator isoform X1
[Drosophila eugracilis]

Length=1535
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   1842    0.0  
CAPS_CAEEL  unnamed protein product                                   1007    0.0  
H9G2V3_CAEEL  unnamed protein product                                 1006    0.0  


>CAPS_DROME unnamed protein product
Length=1447

 Score = 1842 bits (4770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 902/967 (93%), Positives = 922/967 (95%), Gaps = 19/967 (2%)

Query  1    MIDPSSSEEEGDDDPIANVVSKGRISHAPKGAGTASIIGGCTGSGVGSNIPISGSNGDLA  60
            MIDPSSSEEEG+DD + NV SKGR+++  KG    SIIGG  GS VGSNIP+SGSN DL 
Sbjct  1    MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLI  60

Query  61   VNQRQSNISYISNRNDVGNISVAAGLGVSSNKNEQIHSSRVDTGSLEVPNNGIPSGISQE  120
             NQRQSNIS I NRNDVGNISVAA LG +SNK EQI  +R DTG+LEVP+NGIPSGISQE
Sbjct  61   GNQRQSNISSICNRNDVGNISVAA-LGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQE  119

Query  121  TLNQSIGSSRANSLPRPLSPSPSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCIS  180
            TLNQS+GSSRANSLPRPLSPSPSL+SEK ET + H KHEREEEERKRRIQLYVFISRCIS
Sbjct  120  TLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVFISRCIS  179

Query  181  YPFNAKQPTDMTKRQTKITKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  240
            YPFNAKQPTDMTKRQTKI+KQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS
Sbjct  180  YPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  239

Query  241  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  300
            ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE
Sbjct  240  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  299

Query  301  EDSKRPTRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  360
            EDSKRP+RMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR
Sbjct  300  EDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  359

Query  361  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  420
            ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY
Sbjct  360  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  419

Query  421  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKG  480
            GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV  
Sbjct  420  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV--  477

Query  481  LKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGM  540
                            ENGEKLQTDQAEASKPMWDTQGDFTTTHPLP+VKVKLYTENPGM
Sbjct  478  ----------------ENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGM  521

Query  541  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLY  600
            LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCG+LY
Sbjct  522  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLY  581

Query  601  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  660
            AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF
Sbjct  582  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  641

Query  661  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  720
            GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS
Sbjct  642  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  701

Query  721  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  780
            KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV
Sbjct  702  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  761

Query  781  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  840
            LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI
Sbjct  762  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  821

Query  841  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  900
            THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP
Sbjct  822  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  881

Query  901  EEVRQMIKKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQ  960
            EEVRQMIKKSLETAALVNYTRLSNKA+I+EDLRG+VIVPAPKKLEDLIHLAELCVDLLQQ
Sbjct  882  EEVRQMIKKSLETAALVNYTRLSNKAKIDEDLRGDVIVPAPKKLEDLIHLAELCVDLLQQ  941

Query  961  NEEHYGE  967
            NEEHYGE
Sbjct  942  NEEHYGE  948


 Score = 928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/499 (97%), Positives = 491/499 (98%), Gaps = 0/499 (0%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1096
             AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLR DDNLRNGRF
Sbjct  949   AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRTDDNLRNGRF  1008

Query  1097  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1156
             HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA
Sbjct  1009  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1068

Query  1157  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1216
             ALNPSM+L GKKDQVNFYVPKLPKQSNSTAA D+MRNGCATSEDLFWKLDALQSFIRDLH
Sbjct  1069  ALNPSMILCGKKDQVNFYVPKLPKQSNSTAANDEMRNGCATSEDLFWKLDALQSFIRDLH  1128

Query  1217  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1276
             WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV
Sbjct  1129  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1188

Query  1277  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1336
             ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLS KLMSVLESTLSKLARYD
Sbjct  1189  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSGKLMSVLESTLSKLARYD  1248

Query  1337  EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIGDDLWTLNFFEQWYSQQINM  1396
             EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKI DDLWTL+FFEQWYSQQINM
Sbjct  1249  EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIADDLWTLHFFEQWYSQQINM  1308

Query  1397  LCNWLSERLDHALHYAQVSSISHITKKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT  1456
             LCNWLSER+DHALHYAQV+SISHI KKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT
Sbjct  1309  LCNWLSERVDHALHYAQVASISHIIKKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT  1368

Query  1457  CALTMPDVSEDEPCDDIREGEEEDNGDESTSNLPRGLPKPKVAAAQAAAVTNVVAGRVGN  1516
             CALTMPD  EDEPCD+IREGEEEDNGDESTSN+PRGLPKPKVAAAQAAAVTNVVAGRVGN
Sbjct  1369  CALTMPDACEDEPCDEIREGEEEDNGDESTSNIPRGLPKPKVAAAQAAAVTNVVAGRVGN  1428

Query  1517  LLGKGIGGLSSKLGSGSWF  1535
             LLGKGIGGLSSKLGSGSWF
Sbjct  1429  LLGKGIGGLSSKLGSGSWF  1447


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 1007 bits (2604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/840 (59%), Positives = 634/840 (75%), Gaps = 31/840 (4%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVS-KGNMDSKYGLQKLKRYNHSTPSF  435
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+ +G    K   +   R       F
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLF  414

Query  436  LKLILR-SHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
              L  R S GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  415  NSLKRRTSSGSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  472

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  473  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  531

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  532  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  591

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  592  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  647

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  648  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  704

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  705  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  764

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  765  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  824

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  825  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  884

Query  908  KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
            +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  885  RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  942


 Score = 284 bits (726),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 240/449 (53%), Gaps = 91/449 (20%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1096
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  943   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  1002

Query  1097  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1156
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+    A                
Sbjct  1003  HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCA----------------  1046

Query  1157  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1216
                 S  +  K D ++ +V                        DL W  +  + ++    
Sbjct  1047  ---TSEDIYWKLDALHTFVI-----------------------DLNWPEEDFRKYL----  1076

Query  1217  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1276
                       + ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C  +NV
Sbjct  1077  ----------QTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCVQINV  1124

Query  1277  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1336
             +  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+LARYD
Sbjct  1125  MFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYD  1182

Query  1337  EGSLIGSILS------------------------------FTNVSSSGKDLGQGYVNFFR  1366
             EG+ IG+IL+                               T   SSG+ +G  YV FF 
Sbjct  1183  EGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYVTFFH  1241

Query  1367  NNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYS  1426
                + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I KK+Y 
Sbjct  1242  GCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ  1301

Query  1427  DFELQGVLEDKLNSKAYQAVAQRMATEEA  1455
             DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1302  DFSLQGIDEERLNSKTYQSISRRLQLEES  1330


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/840 (58%), Positives = 632/840 (75%), Gaps = 43/840 (5%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSK--GNMDSKYGLQKLKRYNHSTPS  434
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+     +  +    +LKR   S   
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRLKRRTSS---  411

Query  435  FLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
                     GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  412  ---------GSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  460

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  461  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  519

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  520  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  579

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  580  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  635

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  636  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  692

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  693  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  752

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  753  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  812

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  813  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  872

Query  908  KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
            +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  873  RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  930


 Score = 283 bits (725),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 240/449 (53%), Gaps = 91/449 (20%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1096
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  931   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  990

Query  1097  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1156
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+    A                
Sbjct  991   HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCAT---------------  1035

Query  1157  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1216
                 S  +  K D ++ +V                        DL W  +  + ++    
Sbjct  1036  ----SEDIYWKLDALHTFVI-----------------------DLNWPEEDFRKYL----  1064

Query  1217  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1276
                       + ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C  +NV
Sbjct  1065  ----------QTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCVQINV  1112

Query  1277  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1336
             +  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+LARYD
Sbjct  1113  MFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYD  1170

Query  1337  EGSLIGSILS------------------------------FTNVSSSGKDLGQGYVNFFR  1366
             EG+ IG+IL+                               T   SSG+ +G  YV FF 
Sbjct  1171  EGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYVTFFH  1229

Query  1367  NNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYS  1426
                + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I KK+Y 
Sbjct  1230  GCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ  1289

Query  1427  DFELQGVLEDKLNSKAYQAVAQRMATEEA  1455
             DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1290  DFSLQGIDEERLNSKTYQSISRRLQLEES  1318



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062659.1 calcium-dependent secretion activator isoform X2
[Drosophila eugracilis]

Length=1534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   1836    0.0  
CAPS_CAEEL  unnamed protein product                                   1010    0.0  
H9G2V3_CAEEL  unnamed protein product                                 1008    0.0  


>CAPS_DROME unnamed protein product
Length=1447

 Score = 1836 bits (4756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 902/967 (93%), Positives = 921/967 (95%), Gaps = 20/967 (2%)

Query  1    MIDPSSSEEEGDDDPIANVVSKGRISHAPKGAGTASIIGGCTGSGVGSNIPISGSNGDLA  60
            MIDPSSSEEEG+DD + NV SKGR+++  KG    SIIGG  GS VGSNIP+SGSN DL 
Sbjct  1    MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLI  60

Query  61   VNQRQSNISYISNRNDVGNISVAAGLGVSSNKNEQIHSSRVDTGSLEVPNNGIPSGISQE  120
             NQRQSNIS I NRNDVGNISVAA LG +SNK EQI  +R DTG+LEVP+NGIPSGISQE
Sbjct  61   GNQRQSNISSICNRNDVGNISVAA-LGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQE  119

Query  121  TLNQSIGSSRANSLPRPLSPSPSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCIS  180
            TLNQS+GSSRANSLPRPLSPSPSL+SEK ET + H KHEREEEERKRRIQLYVFISRCIS
Sbjct  120  TLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVFISRCIS  179

Query  181  YPFNAKQPTDMTKRQTKITKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  240
            YPFNAKQPTDMTKRQTKI+KQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS
Sbjct  180  YPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  239

Query  241  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  300
            ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE
Sbjct  240  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  299

Query  301  EDSKRPTRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  360
            EDSKRP+RMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR
Sbjct  300  EDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  359

Query  361  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  420
            ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY
Sbjct  360  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  419

Query  421  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKG  480
            GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV  
Sbjct  420  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV--  477

Query  481  LKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGM  540
                            ENGEKLQTDQAEASKPMWDTQGDFTTTHPLP+VKVKLYTENPGM
Sbjct  478  ----------------ENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGM  521

Query  541  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLY  600
            LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCG+LY
Sbjct  522  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLY  581

Query  601  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  660
            AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF
Sbjct  582  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  641

Query  661  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  720
            GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS
Sbjct  642  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  701

Query  721  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  780
            KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV
Sbjct  702  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  761

Query  781  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  840
            LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI
Sbjct  762  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  821

Query  841  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  900
            THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP
Sbjct  822  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  881

Query  901  EEVRQMIKKSLETAALVNYTRLSNKARI-EDLRGEVIVPAPKKLEDLIHLAELCVDLLQQ  959
            EEVRQMIKKSLETAALVNYTRLSNKA+I EDLRG+VIVPAPKKLEDLIHLAELCVDLLQQ
Sbjct  882  EEVRQMIKKSLETAALVNYTRLSNKAKIDEDLRGDVIVPAPKKLEDLIHLAELCVDLLQQ  941

Query  960  NEEHYGE  966
            NEEHYGE
Sbjct  942  NEEHYGE  948


 Score = 928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/499 (97%), Positives = 491/499 (98%), Gaps = 0/499 (0%)

Query  1036  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1095
             AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLR DDNLRNGRF
Sbjct  949   AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRTDDNLRNGRF  1008

Query  1096  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1155
             HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA
Sbjct  1009  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1068

Query  1156  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1215
             ALNPSM+L GKKDQVNFYVPKLPKQSNSTAA D+MRNGCATSEDLFWKLDALQSFIRDLH
Sbjct  1069  ALNPSMILCGKKDQVNFYVPKLPKQSNSTAANDEMRNGCATSEDLFWKLDALQSFIRDLH  1128

Query  1216  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1275
             WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV
Sbjct  1129  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1188

Query  1276  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1335
             ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLS KLMSVLESTLSKLARYD
Sbjct  1189  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSGKLMSVLESTLSKLARYD  1248

Query  1336  EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIGDDLWTLNFFEQWYSQQINM  1395
             EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKI DDLWTL+FFEQWYSQQINM
Sbjct  1249  EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIADDLWTLHFFEQWYSQQINM  1308

Query  1396  LCNWLSERLDHALHYAQVSSISHITKKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT  1455
             LCNWLSER+DHALHYAQV+SISHI KKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT
Sbjct  1309  LCNWLSERVDHALHYAQVASISHIIKKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT  1368

Query  1456  CALTMPDVSEDEPCDDIREGEEEDNGDESTSNLPRGLPKPKVAAAQAAAVTNVVAGRVGN  1515
             CALTMPD  EDEPCD+IREGEEEDNGDESTSN+PRGLPKPKVAAAQAAAVTNVVAGRVGN
Sbjct  1369  CALTMPDACEDEPCDEIREGEEEDNGDESTSNIPRGLPKPKVAAAQAAAVTNVVAGRVGN  1428

Query  1516  LLGKGIGGLSSKLGSGSWF  1534
             LLGKGIGGLSSKLGSGSWF
Sbjct  1429  LLGKGIGGLSSKLGSGSWF  1447


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/839 (59%), Positives = 632/839 (75%), Gaps = 30/839 (4%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVS-KGNMDSKYGLQKLKRYNHSTPSF  435
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+ +G    K   +   R       F
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLF  414

Query  436  LKLILR-SHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
              L  R S GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  415  NSLKRRTSSGSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  472

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  473  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  531

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  532  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  591

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  592  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  647

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  648  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  704

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  705  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  764

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  765  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  824

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  825  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  884

Query  908  KKSLETAALVNYTRLSNKARIEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  966
            +K LE AALVNYTR+ N+A+IE   G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  885  RKCLEDAALVNYTRICNEAKIEQRMGIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  942


 Score = 284 bits (726),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 240/449 (53%), Gaps = 91/449 (20%)

Query  1036  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1095
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  943   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  1002

Query  1096  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1155
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+    A                
Sbjct  1003  HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCA----------------  1046

Query  1156  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1215
                 S  +  K D ++ +V                        DL W  +  + ++    
Sbjct  1047  ---TSEDIYWKLDALHTFVI-----------------------DLNWPEEDFRKYL----  1076

Query  1216  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1275
                       + ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C  +NV
Sbjct  1077  ----------QTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCVQINV  1124

Query  1276  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1335
             +  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+LARYD
Sbjct  1125  MFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYD  1182

Query  1336  EGSLIGSILS------------------------------FTNVSSSGKDLGQGYVNFFR  1365
             EG+ IG+IL+                               T   SSG+ +G  YV FF 
Sbjct  1183  EGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYVTFFH  1241

Query  1366  NNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYS  1425
                + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I KK+Y 
Sbjct  1242  GCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ  1301

Query  1426  DFELQGVLEDKLNSKAYQAVAQRMATEEA  1454
             DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1302  DFSLQGIDEERLNSKTYQSISRRLQLEES  1330


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/839 (58%), Positives = 630/839 (75%), Gaps = 42/839 (5%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSK--GNMDSKYGLQKLKRYNHSTPS  434
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+     +  +    +LKR   S   
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRLKRRTSS---  411

Query  435  FLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
                     GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  412  ---------GSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  460

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  461  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  519

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  520  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  579

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  580  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  635

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  636  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  692

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  693  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  752

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  753  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  812

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  813  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  872

Query  908  KKSLETAALVNYTRLSNKARIEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  966
            +K LE AALVNYTR+ N+A+IE   G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  873  RKCLEDAALVNYTRICNEAKIEQRMGIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  930


 Score = 283 bits (725),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/449 (36%), Positives = 240/449 (53%), Gaps = 91/449 (20%)

Query  1036  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1095
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  931   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  990

Query  1096  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1155
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+    A                
Sbjct  991   HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCAT---------------  1035

Query  1156  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1215
                 S  +  K D ++ +V                        DL W  +  + ++    
Sbjct  1036  ----SEDIYWKLDALHTFVI-----------------------DLNWPEEDFRKYL----  1064

Query  1216  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1275
                       + ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C  +NV
Sbjct  1065  ----------QTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCVQINV  1112

Query  1276  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1335
             +  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+LARYD
Sbjct  1113  MFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYD  1170

Query  1336  EGSLIGSILS------------------------------FTNVSSSGKDLGQGYVNFFR  1365
             EG+ IG+IL+                               T   SSG+ +G  YV FF 
Sbjct  1171  EGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYVTFFH  1229

Query  1366  NNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYS  1425
                + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I KK+Y 
Sbjct  1230  GCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ  1289

Query  1426  DFELQGVLEDKLNSKAYQAVAQRMATEEA  1454
             DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1290  DFSLQGIDEERLNSKTYQSISRRLQLEES  1318



Lambda      K        H
   0.313    0.127    0.367 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062660.1 calcium-dependent secretion activator isoform X3
[Drosophila eugracilis]

Length=1479
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   1840    0.0  
CAPS_CAEEL  unnamed protein product                                   1006    0.0  
H9G2V3_CAEEL  unnamed protein product                                 1006    0.0  


>CAPS_DROME unnamed protein product
Length=1447

 Score = 1840 bits (4767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 902/967 (93%), Positives = 922/967 (95%), Gaps = 19/967 (2%)

Query  1    MIDPSSSEEEGDDDPIANVVSKGRISHAPKGAGTASIIGGCTGSGVGSNIPISGSNGDLA  60
            MIDPSSSEEEG+DD + NV SKGR+++  KG    SIIGG  GS VGSNIP+SGSN DL 
Sbjct  1    MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLI  60

Query  61   VNQRQSNISYISNRNDVGNISVAAGLGVSSNKNEQIHSSRVDTGSLEVPNNGIPSGISQE  120
             NQRQSNIS I NRNDVGNISVAA LG +SNK EQI  +R DTG+LEVP+NGIPSGISQE
Sbjct  61   GNQRQSNISSICNRNDVGNISVAA-LGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQE  119

Query  121  TLNQSIGSSRANSLPRPLSPSPSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCIS  180
            TLNQS+GSSRANSLPRPLSPSPSL+SEK ET + H KHEREEEERKRRIQLYVFISRCIS
Sbjct  120  TLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVFISRCIS  179

Query  181  YPFNAKQPTDMTKRQTKITKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  240
            YPFNAKQPTDMTKRQTKI+KQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS
Sbjct  180  YPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  239

Query  241  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  300
            ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE
Sbjct  240  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  299

Query  301  EDSKRPTRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  360
            EDSKRP+RMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR
Sbjct  300  EDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  359

Query  361  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  420
            ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY
Sbjct  360  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  419

Query  421  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKG  480
            GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV  
Sbjct  420  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV--  477

Query  481  LKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGM  540
                            ENGEKLQTDQAEASKPMWDTQGDFTTTHPLP+VKVKLYTENPGM
Sbjct  478  ----------------ENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGM  521

Query  541  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLY  600
            LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCG+LY
Sbjct  522  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLY  581

Query  601  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  660
            AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF
Sbjct  582  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  641

Query  661  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  720
            GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS
Sbjct  642  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  701

Query  721  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  780
            KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV
Sbjct  702  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  761

Query  781  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  840
            LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI
Sbjct  762  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  821

Query  841  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  900
            THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP
Sbjct  822  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  881

Query  901  EEVRQMIKKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQ  960
            EEVRQMIKKSLETAALVNYTRLSNKA+I+EDLRG+VIVPAPKKLEDLIHLAELCVDLLQQ
Sbjct  882  EEVRQMIKKSLETAALVNYTRLSNKAKIDEDLRGDVIVPAPKKLEDLIHLAELCVDLLQQ  941

Query  961  NEEHYGE  967
            NEEHYGE
Sbjct  942  NEEHYGE  948


 Score = 818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/499 (85%), Positives = 434/499 (87%), Gaps = 56/499 (11%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1096
             AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLR DDNLRNGRF
Sbjct  949   AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRTDDNLRNGRF  1008

Query  1097  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKG--------------------  1136
             HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKG                    
Sbjct  1009  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1068

Query  1137  --------------------------NGCATSEDL----------FWKLDALQSFIRDLH  1160
                                       N  A ++++          FWKLDALQSFIRDLH
Sbjct  1069  ALNPSMILCGKKDQVNFYVPKLPKQSNSTAANDEMRNGCATSEDLFWKLDALQSFIRDLH  1128

Query  1161  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1220
             WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV
Sbjct  1129  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1188

Query  1221  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1280
             ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLS KLMSVLESTLSKLARYD
Sbjct  1189  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSGKLMSVLESTLSKLARYD  1248

Query  1281  EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIGDDLWTLNFFEQWYSQQINM  1340
             EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKI DDLWTL+FFEQWYSQQINM
Sbjct  1249  EGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIADDLWTLHFFEQWYSQQINM  1308

Query  1341  LCNWLSERLDHALHYAQVSSISHITKKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT  1400
             LCNWLSER+DHALHYAQV+SISHI KKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT
Sbjct  1309  LCNWLSERVDHALHYAQVASISHIIKKIYSDFELQGVLEDKLNSKAYQAVAQRMATEEAT  1368

Query  1401  CALTMPDVSEDEPCDDIREGEEEDNGDESTSNLPRGLPKPKVAAAQAAAVTNVVAGRVGN  1460
             CALTMPD  EDEPCD+IREGEEEDNGDESTSN+PRGLPKPKVAAAQAAAVTNVVAGRVGN
Sbjct  1369  CALTMPDACEDEPCDEIREGEEEDNGDESTSNIPRGLPKPKVAAAQAAAVTNVVAGRVGN  1428

Query  1461  LLGKGIGGLSSKLGSGSWF  1479
             LLGKGIGGLSSKLGSGSWF
Sbjct  1429  LLGKGIGGLSSKLGSGSWF  1447


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 1006 bits (2601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/840 (59%), Positives = 634/840 (75%), Gaps = 31/840 (4%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTR-----MQQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVS-KGNMDSKYGLQKLKRYNHSTPSF  435
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+ +G    K   +   R       F
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLF  414

Query  436  LKLILR-SHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
              L  R S GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  415  NSLKRRTSSGSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  472

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  473  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  531

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  532  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  591

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  592  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  647

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  648  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  704

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  705  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  764

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  765  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  824

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  825  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  884

Query  908  KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
            +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  885  RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  942


 Score = 362 bits (928),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/393 (45%), Positives = 254/393 (65%), Gaps = 35/393 (9%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1096
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  943   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  1002

Query  1097  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGNGCATSEDLFWKLDALQSFI  1156
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+  GCATSED++WKLDAL +F+
Sbjct  1003  HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCATSEDIYWKLDALHTFV  1062

Query  1157  RDLHWPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCA  1216
              DL+WP+ +FR++L+ ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C 
Sbjct  1063  IDLNWPEEDFRKYLQTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCV  1120

Query  1217  MVNVILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKL  1276
              +NV+  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+L
Sbjct  1121  QINVMFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRL  1178

Query  1277  ARYDEGSLIGSILS------------------------------FTNVSSSGKDLGQGYV  1306
             ARYDEG+ IG+IL+                               T   SSG+ +G  YV
Sbjct  1179  ARYDEGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYV  1237

Query  1307  NFFRNNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITK  1366
              FF    + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I K
Sbjct  1238  TFFHGCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVK  1297

Query  1367  KIYSDFELQGVLEDKLNSKAYQAVAQRMATEEA  1399
             K+Y DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1298  KVYQDFSLQGIDEERLNSKTYQSISRRLQLEES  1330


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 1006 bits (2600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/840 (58%), Positives = 632/840 (75%), Gaps = 43/840 (5%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTR-----MQQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSK--GNMDSKYGLQKLKRYNHSTPS  434
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+     +  +    +LKR   S   
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRLKRRTSS---  411

Query  435  FLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
                     GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  412  ---------GSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  460

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  461  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  519

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  520  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  579

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  580  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  635

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  636  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  692

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  693  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  752

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  753  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  812

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  813  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  872

Query  908  KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
            +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  873  RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  930


 Score = 362 bits (928),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/393 (45%), Positives = 254/393 (65%), Gaps = 35/393 (9%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1096
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  931   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  990

Query  1097  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGNGCATSEDLFWKLDALQSFI  1156
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+  GCATSED++WKLDAL +F+
Sbjct  991   HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCATSEDIYWKLDALHTFV  1050

Query  1157  RDLHWPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCA  1216
              DL+WP+ +FR++L+ ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C 
Sbjct  1051  IDLNWPEEDFRKYLQTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCV  1108

Query  1217  MVNVILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKL  1276
              +NV+  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+L
Sbjct  1109  QINVMFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRL  1166

Query  1277  ARYDEGSLIGSILS------------------------------FTNVSSSGKDLGQGYV  1306
             ARYDEG+ IG+IL+                               T   SSG+ +G  YV
Sbjct  1167  ARYDEGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYV  1225

Query  1307  NFFRNNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITK  1366
              FF    + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I K
Sbjct  1226  TFFHGCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVK  1285

Query  1367  KIYSDFELQGVLEDKLNSKAYQAVAQRMATEEA  1399
             K+Y DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1286  KVYQDFSLQGIDEERLNSKTYQSISRRLQLEES  1318



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062661.1 calcium-dependent secretion activator isoform X4
[Drosophila eugracilis]

Length=1466
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   2766    0.0  
CAPS_CAEEL  unnamed protein product                                   1286    0.0  
H9G2V3_CAEEL  unnamed protein product                                 1285    0.0  


>CAPS_DROME unnamed protein product
Length=1447

 Score = 2766 bits (7171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1386/1466 (95%), Positives = 1413/1466 (96%), Gaps = 19/1466 (1%)

Query  1     MIDPSSSEEEGDDDPIANVVSKGRISHAPKGAGTASIIGGCTGSGVGSNIPISGSNGDLA  60
             MIDPSSSEEEG+DD + NV SKGR+++  KG    SIIGG  GS VGSNIP+SGSN DL 
Sbjct  1     MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLI  60

Query  61    VNQRQSNISYISNRNDVGNISVAAGLGVSSNKNEQIHSSRVDTGSLEVPNNGIPSGISQE  120
              NQRQSNIS I NRNDVGNISVAA LG +SNK EQI  +R DTG+LEVP+NGIPSGISQE
Sbjct  61    GNQRQSNISSICNRNDVGNISVAA-LGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQE  119

Query  121   TLNQSIGSSRANSLPRPLSPSPSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCIS  180
             TLNQS+GSSRANSLPRPLSPSPSL+SEK ET + H KHEREEEERKRRIQLYVFISRCIS
Sbjct  120   TLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVFISRCIS  179

Query  181   YPFNAKQPTDMTKRQTKITKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  240
             YPFNAKQPTDMTKRQTKI+KQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS
Sbjct  180   YPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  239

Query  241   ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  300
             ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE
Sbjct  240   ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  299

Query  301   EDSKRPTRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  360
             EDSKRP+RMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR
Sbjct  300   EDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  359

Query  361   ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  420
             ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY
Sbjct  360   ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  419

Query  421   GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKG  480
             GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV  
Sbjct  420   GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV--  477

Query  481   LKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGM  540
                             ENGEKLQTDQAEASKPMWDTQGDFTTTHPLP+VKVKLYTENPGM
Sbjct  478   ----------------ENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGM  521

Query  541   LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLY  600
             LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCG+LY
Sbjct  522   LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLY  581

Query  601   AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  660
             AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF
Sbjct  582   AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  641

Query  661   GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  720
             GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS
Sbjct  642   GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  701

Query  721   KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  780
             KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV
Sbjct  702   KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  761

Query  781   LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  840
             LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI
Sbjct  762   LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  821

Query  841   THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  900
             THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP
Sbjct  822   THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  881

Query  901   EEVRQMIKKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQ  960
             EEVRQMIKKSLETAALVNYTRLSNKA+I+EDLRG+VIVPAPKKLEDLIHLAELCVDLLQQ
Sbjct  882   EEVRQMIKKSLETAALVNYTRLSNKAKIDEDLRGDVIVPAPKKLEDLIHLAELCVDLLQQ  941

Query  961   NEEHYGEAFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADD  1020
             NEEHYGEAFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLR DD
Sbjct  942   NEEHYGEAFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRTDD  1001

Query  1021  NLRNGRFHQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNA  1080
             NLRNGRFHQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNA
Sbjct  1002  NLRNGRFHQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNA  1061

Query  1081  AQALNTAALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQ  1140
             AQALNTAALNPSM+L GKKDQVNFYVPKLPKQSNSTAA D+MRNGCATSEDLFWKLDALQ
Sbjct  1062  AQALNTAALNPSMILCGKKDQVNFYVPKLPKQSNSTAANDEMRNGCATSEDLFWKLDALQ  1121

Query  1141  SFIRDLHWPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSE  1200
             SFIRDLHWPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSE
Sbjct  1122  SFIRDLHWPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSE  1181

Query  1201  MCAMVNVILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTL  1260
             MCAMVNVILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLS KLMSVLESTL
Sbjct  1182  MCAMVNVILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSGKLMSVLESTL  1241

Query  1261  SKLARYDEGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIGDDLWTLNFFEQW  1320
             SKLARYDEGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKI DDLWTL+FFEQW
Sbjct  1242  SKLARYDEGSLIGSILSFTNVSSSGKDLGQGYVNFFRNNMDQVRGKIADDLWTLHFFEQW  1301

Query  1321  YSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYSDFELQGVLEDKLNSKAYQAVAQR  1380
             YSQQINMLCNWLSER+DHALHYAQV+SISHI KKIYSDFELQGVLEDKLNSKAYQAVAQR
Sbjct  1302  YSQQINMLCNWLSERVDHALHYAQVASISHIIKKIYSDFELQGVLEDKLNSKAYQAVAQR  1361

Query  1381  MATEEATCALTMPDVSEDEPCDDIREGEEEDNGDESTSNLPRGLPKPKVAAAQAAAVTNV  1440
             MATEEATCALTMPD  EDEPCD+IREGEEEDNGDESTSN+PRGLPKPKVAAAQAAAVTNV
Sbjct  1362  MATEEATCALTMPDACEDEPCDEIREGEEEDNGDESTSNIPRGLPKPKVAAAQAAAVTNV  1421

Query  1441  VAGRVGNLLGKGIGGLSSKLGSGSWF  1466
             VAGRVGNLLGKGIGGLSSKLGSGSWF
Sbjct  1422  VAGRVGNLLGKGIGGLSSKLGSGSWF  1447


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 1286 bits (3328),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/1289 (51%), Positives = 874/1289 (68%), Gaps = 122/1289 (9%)

Query  142   PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
             P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120   PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202   QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
             +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176   ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262   RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
             R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236   RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317   LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
              +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295   AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377   KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVS-KGNMDSKYGLQKLKRYNHSTPSF  435
             +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+ +G    K   +   R       F
Sbjct  355   RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLF  414

Query  436   LKLILR-SHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
               L  R S GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  415   NSLKRRTSSGSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  472

Query  495   EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
             EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  473   EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  531

Query  555   PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
             PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  532   PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  591

Query  615   FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
             F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  592   FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  647

Query  675   REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
             +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  648   KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  704

Query  735   EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
             +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  705   DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  764

Query  795   RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
             RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  765   RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  824

Query  848   FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
             F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  825   FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  884

Query  908   KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
             +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  885   RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  942

Query  968   AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1027
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  943   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  1002

Query  1028  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1087
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+    A                
Sbjct  1003  HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCAT---------------  1047

Query  1088  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1147
                 S  +  K D ++ +V                        DL W  +  + ++    
Sbjct  1048  ----SEDIYWKLDALHTFVI-----------------------DLNWPEEDFRKYL----  1076

Query  1148  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1207
                       + ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C  +NV
Sbjct  1077  ----------QTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCVQINV  1124

Query  1208  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1267
             +  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+LARYD
Sbjct  1125  MFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYD  1182

Query  1268  EGSLIGSILS------------------------------FTNVSSSGKDLGQGYVNFFR  1297
             EG+ IG+IL+                               T   SSG+ +G  YV FF 
Sbjct  1183  EGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYVTFFH  1241

Query  1298  NNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYS  1357
                + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I KK+Y 
Sbjct  1242  GCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ  1301

Query  1358  DFELQGVLEDKLNSKAYQAVAQRMATEEA  1386
             DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1302  DFSLQGIDEERLNSKTYQSISRRLQLEES  1330


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 1285 bits (3326),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/1289 (51%), Positives = 872/1289 (68%), Gaps = 134/1289 (10%)

Query  142   PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
             P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120   PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202   QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
             +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176   ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262   RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
             R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236   RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317   LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
              +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295   AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377   KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSK--GNMDSKYGLQKLKRYNHSTPS  434
             +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+     +  +    +LKR   S   
Sbjct  355   RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRLKRRTSS---  411

Query  435   FLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
                      GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  412   ---------GSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  460

Query  495   EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
             EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  461   EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  519

Query  555   PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
             PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  520   PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  579

Query  615   FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
             F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  580   FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  635

Query  675   REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
             +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  636   KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  692

Query  735   EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
             +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  693   DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  752

Query  795   RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
             RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  753   RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  812

Query  848   FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
             F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  813   FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  872

Query  908   KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
             +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  873   RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  930

Query  968   AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADDNLRNGRF  1027
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L ++ +L+ G F
Sbjct  931   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFLLSESSLKGGIF  990

Query  1028  HQHLRDTFAPLVVRYVDLMESSIAQSIHKGFEKERWESKGINAALNPAALNNAAQALNTA  1087
             H  +   F PLVVRY+DLME SIAQ+I KGF KE+WES+    A                
Sbjct  991   HNKIVQQFQPLVVRYIDLMEHSIAQAIDKGFSKEKWESRKEGCAT---------------  1035

Query  1088  ALNPSMLLSGKKDQVNFYVPKLPKQSNSTAACDDMRNGCATSEDLFWKLDALQSFIRDLH  1147
                 S  +  K D ++ +V                        DL W  +  + ++    
Sbjct  1036  ----SEDIYWKLDALHTFVI-----------------------DLNWPEEDFRKYL----  1064

Query  1148  WPDAEFRQHLEQRLKMMAVDMIEQCIQRTDSSFQSWLKKNIAFISTDYILPSEMCAMVNV  1207
                       + ++K +  DMI +    T ++F SW+++  A  STDY+LPSE+C  +NV
Sbjct  1065  ----------QTKMKSLTSDMISKVSDCTFTAFDSWMQR--AKKSTDYMLPSEVCVQINV  1112

Query  1208  ILDAKNQSFKLTTIDGIDLYKFHAKIDDQIDKANVAMTQGLSSKLMSVLESTLSKLARYD  1267
             +  +K+++ ++T   G   YK+ +K+D+ ++     M   +  KL  VLES LS+LARYD
Sbjct  1113  MFSSKSRAVRVTVDSG--EYKYQSKLDETLETMLKTMESCIQEKLHGVLESVLSRLARYD  1170

Query  1268  EGSLIGSILS------------------------------FTNVSSSGKDLGQGYVNFFR  1297
             EG+ IG+IL+                               T   SSG+ +G  YV FF 
Sbjct  1171  EGNPIGAILNIAPKPASIFNKLKTMAGDTSAQATTTARQPLTAQQSSGQ-IGNSYVTFFH  1229

Query  1298  NNMDQVRGKIGDDLWTLNFFEQWYSQQINMLCNWLSERLDHALHYAQVSSISHITKKIYS  1357
                + +R  I D++W    FE WY  Q+  +  WL+ERL  +L   Q  S+S I KK+Y 
Sbjct  1230  GCTELLRQVIIDEIWVNGLFEHWYDNQMKSINEWLTERLQQSLSATQYISLSTIVKKVYQ  1289

Query  1358  DFELQGVLEDKLNSKAYQAVAQRMATEEA  1386
             DF LQG+ E++LNSK YQ++++R+  EE+
Sbjct  1290  DFSLQGIDEERLNSKTYQSISRRLQLEES  1318



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062663.1 calcium-dependent secretion activator isoform X6
[Drosophila eugracilis]

Length=1101
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   1841    0.0  
CAPS_CAEEL  unnamed protein product                                   1007    0.0  
H9G2V3_CAEEL  unnamed protein product                                 1005    0.0  


>CAPS_DROME unnamed protein product
Length=1447

 Score = 1841 bits (4769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 902/967 (93%), Positives = 922/967 (95%), Gaps = 19/967 (2%)

Query  1    MIDPSSSEEEGDDDPIANVVSKGRISHAPKGAGTASIIGGCTGSGVGSNIPISGSNGDLA  60
            MIDPSSSEEEG+DD + NV SKGR+++  KG    SIIGG  GS VGSNIP+SGSN DL 
Sbjct  1    MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLI  60

Query  61   VNQRQSNISYISNRNDVGNISVAAGLGVSSNKNEQIHSSRVDTGSLEVPNNGIPSGISQE  120
             NQRQSNIS I NRNDVGNISVAA LG +SNK EQI  +R DTG+LEVP+NGIPSGISQE
Sbjct  61   GNQRQSNISSICNRNDVGNISVAA-LGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQE  119

Query  121  TLNQSIGSSRANSLPRPLSPSPSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCIS  180
            TLNQS+GSSRANSLPRPLSPSPSL+SEK ET + H KHEREEEERKRRIQLYVFISRCIS
Sbjct  120  TLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVFISRCIS  179

Query  181  YPFNAKQPTDMTKRQTKITKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  240
            YPFNAKQPTDMTKRQTKI+KQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS
Sbjct  180  YPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  239

Query  241  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  300
            ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE
Sbjct  240  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  299

Query  301  EDSKRPTRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  360
            EDSKRP+RMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR
Sbjct  300  EDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  359

Query  361  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  420
            ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY
Sbjct  360  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  419

Query  421  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKG  480
            GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV  
Sbjct  420  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV--  477

Query  481  LKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGM  540
                            ENGEKLQTDQAEASKPMWDTQGDFTTTHPLP+VKVKLYTENPGM
Sbjct  478  ----------------ENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGM  521

Query  541  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLY  600
            LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCG+LY
Sbjct  522  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLY  581

Query  601  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  660
            AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF
Sbjct  582  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  641

Query  661  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  720
            GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS
Sbjct  642  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  701

Query  721  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  780
            KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV
Sbjct  702  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  761

Query  781  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  840
            LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI
Sbjct  762  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  821

Query  841  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  900
            THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP
Sbjct  822  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  881

Query  901  EEVRQMIKKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQ  960
            EEVRQMIKKSLETAALVNYTRLSNKA+I+EDLRG+VIVPAPKKLEDLIHLAELCVDLLQQ
Sbjct  882  EEVRQMIKKSLETAALVNYTRLSNKAKIDEDLRGDVIVPAPKKLEDLIHLAELCVDLLQQ  941

Query  961  NEEHYGE  967
            NEEHYGE
Sbjct  942  NEEHYGE  948


 Score = 117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/53 (96%), Positives = 52/53 (98%), Gaps = 0/53 (0%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRADE  1089
             AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLR D+
Sbjct  949   AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYLRTDD  1001


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 1007 bits (2603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/840 (59%), Positives = 634/840 (75%), Gaps = 31/840 (4%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVS-KGNMDSKYGLQKLKRYNHSTPSF  435
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+ +G    K   +   R       F
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLF  414

Query  436  LKLILR-SHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
              L  R S GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  415  NSLKRRTSSGSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  472

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  473  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  531

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  532  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  591

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  592  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  647

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  648  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  704

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  705  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  764

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  765  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  824

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  825  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  884

Query  908  KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
            +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  885  RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  942


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYL  1085
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L
Sbjct  943   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFL  991


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 1005 bits (2599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/840 (58%), Positives = 632/840 (75%), Gaps = 43/840 (5%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSK--GNMDSKYGLQKLKRYNHSTPS  434
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+     +  +    +LKR   S   
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRLKRRTSS---  411

Query  435  FLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
                     GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  412  ---------GSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  460

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  461  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  519

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  520  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  579

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  580  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  635

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  636  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  692

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  693  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  752

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  753  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  812

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  813  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  872

Query  908  KKSLETAALVNYTRLSNKARIEEDLRGEVIVPAPKKLEDLIHLAELCVDLLQQNEEHYGE  967
            +K LE AALVNYTR+ N+A+IE+ + G  + PA +++ED+I + E C+DLL++NEEH+GE
Sbjct  873  RKCLEDAALVNYTRICNEAKIEQRM-GIDVSPA-QRIEDMIRVTEFCIDLLKENEEHHGE  930


 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 42/49 (86%), Gaps = 0/49 (0%)

Query  1037  AFAWFSDLLVEHAEIFWSLFAVDMDRVLSEQAPDTWDSFPLFQILNDYL  1085
             AFAWFSDLL +H+EIFWSL++VD+D  L  Q  D+WDSFPLFQ+LND+L
Sbjct  931   AFAWFSDLLSDHSEIFWSLYSVDLDSALEVQPHDSWDSFPLFQMLNDFL  979



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062664.1 calcium-dependent secretion activator isoform X7
[Drosophila eugracilis]

Length=934
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAPS_DROME  unnamed protein product                                   1764    0.0  
CAPS_CAEEL  unnamed protein product                                   974     0.0  
H9G2V3_CAEEL  unnamed protein product                                 973     0.0  


>CAPS_DROME unnamed protein product
Length=1447

 Score = 1764 bits (4570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 865/929 (93%), Positives = 884/929 (95%), Gaps = 19/929 (2%)

Query  1    MIDPSSSEEEGDDDPIANVVSKGRISHAPKGAGTASIIGGCTGSGVGSNIPISGSNGDLA  60
            MIDPSSSEEEG+DD + NV SKGR+++  KG    SIIGG  GS VGSNIP+SGSN DL 
Sbjct  1    MIDPSSSEEEGEDDAVPNVSSKGRLTNTTKGTSAVSIIGGSAGSVVGSNIPVSGSNTDLI  60

Query  61   VNQRQSNISYISNRNDVGNISVAAGLGVSSNKNEQIHSSRVDTGSLEVPNNGIPSGISQE  120
             NQRQSNIS I NRNDVGNISVAA LG +SNK EQI  +R DTG+LEVP+NGIPSGISQE
Sbjct  61   GNQRQSNISSICNRNDVGNISVAA-LGSTSNKIEQICGNRADTGNLEVPSNGIPSGISQE  119

Query  121  TLNQSIGSSRANSLPRPLSPSPSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCIS  180
            TLNQS+GSSRANSLPRPLSPSPSL+SEK ET + H KHEREEEERKRRIQLYVFISRCIS
Sbjct  120  TLNQSVGSSRANSLPRPLSPSPSLTSEKHETAEPHGKHEREEEERKRRIQLYVFISRCIS  179

Query  181  YPFNAKQPTDMTKRQTKITKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  240
            YPFNAKQPTDMTKRQTKI+KQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS
Sbjct  180  YPFNAKQPTDMTKRQTKISKQQLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKS  239

Query  241  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  300
            ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE
Sbjct  240  ERVLKMVQSGASSQHDFREVFRNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGE  299

Query  301  EDSKRPTRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  360
            EDSKRP+RMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR
Sbjct  300  EDSKRPSRMQQSLNSELILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRR  359

Query  361  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  420
            ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY
Sbjct  360  ELDGRMQRVGEMEKNRKLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSKGNMDSKY  419

Query  421  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKG  480
            GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV  
Sbjct  420  GLQKLKRYNHSTPSFLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEV--  477

Query  481  LKSLAPNRIVYCTMEVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGM  540
                            ENGEKLQTDQAEASKPMWDTQGDFTTTHPLP+VKVKLYTENPGM
Sbjct  478  ----------------ENGEKLQTDQAEASKPMWDTQGDFTTTHPLPVVKVKLYTENPGM  521

Query  541  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLY  600
            LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCG+LY
Sbjct  522  LALEDKELGKVTLKPTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGYLY  581

Query  601  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  660
            AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF
Sbjct  582  AIGKSVWKKWKRRYFVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMF  641

Query  661  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  720
            GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS
Sbjct  642  GIDLNGGRYFFNAVREGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMS  701

Query  721  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  780
            KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV
Sbjct  702  KIQGDADKARKHGMEDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFV  761

Query  781  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  840
            LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI
Sbjct  762  LDEYCARYGVRGCYRHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNRPDGVGSI  821

Query  841  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  900
            THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP
Sbjct  822  THEEKEKFSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPP  881

Query  901  EEVRQMIKKSLETAALVNYTRLSNKARIE  929
            EEVRQMIKKSLETAALVNYTRLSNKA+I+
Sbjct  882  EEVRQMIKKSLETAALVNYTRLSNKAKID  910


>CAPS_CAEEL unnamed protein product
Length=1378

 Score = 974 bits (2518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 475/802 (59%), Positives = 605/802 (75%), Gaps = 29/802 (4%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVS-KGNMDSKYGLQKLKRYNHSTPSF  435
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+ +G    K   +   R       F
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRSRSIEDLSLF  414

Query  436  LKLILR-SHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
              L  R S GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  415  NSLKRRTSSGSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  472

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  473  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  531

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  532  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  591

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  592  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  647

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  648  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  704

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  705  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  764

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  765  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  824

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  825  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  884

Query  908  KKSLETAALVNYTRLSNKARIE  929
            +K LE AALVNYTR+ N+A+IE
Sbjct  885  RKCLEDAALVNYTRICNEAKIE  906


>H9G2V3_CAEEL unnamed protein product
Length=1366

 Score = 973 bits (2515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/802 (59%), Positives = 603/802 (75%), Gaps = 41/802 (5%)

Query  142  PSLSSEKPETGDSHDKHEREEEERKRRIQLYVFISRCISYPFNAKQPTDMTKRQTKITKQ  201
            P+LS E+ E      K EREEE+ K+ +Q+Y+F++RCI+YPFN +Q  DM +RQ K+ KQ
Sbjct  120  PALSKEEQE----RMKAEREEEDHKKNLQMYMFLARCIAYPFNGQQTGDMARRQMKVNKQ  175

Query  202  QLEIITQRFQAFLKGETQIMADEAFQNAVQSYHDVFLKSERVLKMVQSGASSQHDFREVF  261
            +L  I +RF  FLKGET I ADEAF  A+QSY +VFLKSERV K+V +G  SQHDFREVF
Sbjct  176  ELARIRERFTLFLKGETNIAADEAFTKAIQSYFEVFLKSERVQKVVHAGGFSQHDFREVF  235

Query  262  RNNIEKRVRSLPEIDGLSKETVLTSWMAKFDIILKGTGEEDSKRPTRM-----QQSLNSE  316
            R NIEKRVRSLP+I+GLSK+TVL SW+AKFD I+KG  E D  R  R      Q +++++
Sbjct  236  RLNIEKRVRSLPDIEGLSKDTVLNSWLAKFDAIIKG-DETDQNRNARGRSRNPQNAMSAD  294

Query  317  LILSKEQLYDMFQQILLVKKFEHQILFNALMLDSADEQAAAIRRELDGRMQRVGEMEKNR  376
             +L KEQLYD+FQQIL VKKFEHQI+FNAL LD+ DEQAAAIRRE   R + + +  K +
Sbjct  295  AVLGKEQLYDVFQQILGVKKFEHQIIFNALQLDNPDEQAAAIRREFATREEALKDPIKMK  354

Query  377  KLMPKFVLKEMESLYVEELKSSINLLMANLESLPVSK--GNMDSKYGLQKLKRYNHSTPS  434
            +L PKFV+K+ME+LY++E++ SIN L+ NLE++PV+     +  +    +LKR   S   
Sbjct  355  RLTPKFVVKDMETLYMDEVRMSINTLIGNLETVPVTTRGATVGKRKDKSRLKRRTSS---  411

Query  435  FLKLILRSHGSLSKLEGDSEDGSTQLTKLDVVLTFQLEVIVMEVKGLKSLAPNRIVYCTM  494
                     GSL+K  GDSEDG   LTK DV L   +EV+VMEV+GLKS+ P++IVYCTM
Sbjct  412  ---------GSLNK--GDSEDGDVTLTKSDVSLALSMEVVVMEVQGLKSVQPSKIVYCTM  460

Query  495  EVENGEKLQTDQAEASKPMWDTQGDFTTTHPLPIVKVKLYTENPGMLALEDKELGKVTLK  554
            EV +G KLQTD AEASKP WDTQGDF+T +PLP+VKVKLYTE   M+A EDKELGKV ++
Sbjct  461  EV-DGHKLQTDHAEASKPKWDTQGDFSTKNPLPVVKVKLYTEVKSMIAFEDKELGKVIIQ  519

Query  555  PTPLSSKSPEWHRMIVPKNLPDQDIRIKIACRLDKPLNMKHCGHLYAIGKSVWKKWKRRY  614
            PTP  ++SPEW+ M +PK+  DQ+++I+IA R++KP N+K+CG+ Y IG++ WKKWK+R+
Sbjct  520  PTPNCARSPEWYTMTLPKSSQDQNLKIRIAIRVEKPPNLKYCGYCYCIGRNAWKKWKKRF  579

Query  615  FVLVQVSQYTFAMCSYKEKKSEPSEMMQLDGYTVDYIEAASANLMFGIDLNGGRYFFNAV  674
            F LVQVSQY FA+CS+++KK++P+E +QLDG+T+DY+  +   L       GG++FF A+
Sbjct  580  FCLVQVSQYAFAVCSFRQKKADPTEFIQLDGFTIDYMPESDPEL----SAQGGKHFFTAI  635

Query  675  REGDSISFACDDENECSLWVMAMYRATGQSHKPTPPITQDKNSAMSKIQGDADKARKHGM  734
            +EGD + FA DDENE  LWV A+YRATGQ++KP PP    +++   K QG  DKA KHGM
Sbjct  636  KEGDELKFATDDENERHLWVQALYRATGQAYKPVPP---KQSTIAPKAQGFQDKASKHGM  692

Query  735  EDFISTDPCTFDHATLFKTLQNLTLEYRLNDPYASLGWFSPGQVFVLDEYCARYGVRGCY  794
            +  I  D   FDH   +  +Q LTL++R+N+P  SLGWFSPGQ FVL+EY ARY VRGC+
Sbjct  693  DAMIQADSINFDHDHFYSDVQRLTLDFRINEPICSLGWFSPGQAFVLEEYSARYMVRGCF  752

Query  795  RHLCYLSDLLDRAEKQHMIDPTLIHYSFAFCASHVHGNR-------PDGVGSITHEEKEK  847
            RH+  LS+LLD+A+   +IDP LIHYSFAFCASHVHGNR       P+GVG++T EEKEK
Sbjct  753  RHVTLLSNLLDKADDGLLIDPALIHYSFAFCASHVHGNRCMPDRQGPEGVGTVTLEEKEK  812

Query  848  FSEIKERLRQLLEFQITNFRYCFPFGRPEGALKATLSLLERVLMKDIVTPVPPEEVRQMI  907
            F EIKERLR LLE QITNFRYCFPFGRPEGALK TL LLERVLMKD+V+PVPPEEVR +I
Sbjct  813  FQEIKERLRVLLEKQITNFRYCFPFGRPEGALKGTLGLLERVLMKDVVSPVPPEEVRAVI  872

Query  908  KKSLETAALVNYTRLSNKARIE  929
            +K LE AALVNYTR+ N+A+IE
Sbjct  873  RKCLEDAALVNYTRICNEAKIE  894



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062665.2 putative dual specificity
tyrosine-phosphorylation-regulated kinase 3 homolog isoform X1
[Drosophila eugracilis]

Length=844
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

MBK2_CAEEL  unnamed protein product                                   579     0.0   
DYRK2_DROME  unnamed protein product                                  422     2e-136
MNB_DROME  unnamed protein product                                    293     7e-86 


>MBK2_CAEEL unnamed protein product
Length=817

 Score = 579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/399 (66%), Positives = 318/399 (80%), Gaps = 2/399 (1%)

Query  216  PQQVMILYMHKLTPYERTEILAYPQIYFIGANAKKRPGVYG-PNNSDYDNEQGAYIHVPH  274
            P+  +  +  KL P+E+ EI  Y +++F+G++AKK+ GV G  NN  YD+E G+Y  V H
Sbjct  395  PEDAVQTFGAKLVPFEKNEIYNYTRVFFVGSHAKKQAGVIGGANNGGYDDENGSYQLVVH  454

Query  275  DHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRILHHLRR  334
            DH+AYRYE+LK+IGKGSFGQVIKA+DHK  ++VALK+VRNEKRFHRQA EEIRIL HLRR
Sbjct  455  DHIAYRYEVLKVIGKGSFGQVIKAFDHKYQQYVALKLVRNEKRFHRQADEEIRILDHLRR  514

Query  335  HDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAHSLLQC  394
             D   T NIIHM DYF FRNH CITFELLSINLYELIK+N F+GFSL LVRKFA+S+L C
Sbjct  515  QDSDGTHNIIHMLDYFNFRNHKCITFELLSINLYELIKRNKFQGFSLMLVRKFAYSMLLC  574

Query  395  LDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRAPEVIL  454
            LD L KN +IHCD+KPENVLLKQQGRSGIKVIDFGSSCF++QRIYTYIQSRFYRAPEVIL
Sbjct  575  LDLLQKNRLIHCDLKPENVLLKQQGRSGIKVIDFGSSCFDDQRIYTYIQSRFYRAPEVIL  634

Query  455  GAKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILANSKRSKSF  514
            G KYG  IDMWSLGCILAELL+G+ L PGE+E+DQLA IIE+LGMP    L  +KR+++F
Sbjct  635  GTKYGMPIDMWSLGCILAELLTGYPLLPGEDENDQLALIIELLGMPPPKSLETAKRARTF  694

Query  515  FNPKGYPRYCTVRTMSDGMVVLIGGQSRRGKPRGPPCSKSLSKALDGCKDPLFLNFIRGC  574
               KGYPRYCT  +M DG VVL G +S+RGK RGPP S+S S AL    D LF++F++ C
Sbjct  695  ITSKGYPRYCTATSMPDGSVVLAGARSKRGKMRGPPASRSWSTALKNMGDELFVDFLKRC  754

Query  575  LEWDADKRLTPSEALKHPWLRRRLPRPPSSS-SGCGGIS  612
            L+WD + R+TP++ALKH WLRRRLP PP       GG++
Sbjct  755  LDWDPETRMTPAQALKHKWLRRRLPNPPRDGLESMGGLA  793


>DYRK2_DROME unnamed protein product
Length=722

 Score = 422 bits (1086),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/386 (52%), Positives = 274/386 (71%), Gaps = 21/386 (5%)

Query  214  VSPQQVMILYMHKLTPYERTEILAYPQIYFIGANAKKRPGVYGPN----NSDYDNEQGAY  269
            ++P +++  + + LT  E  E+  Y ++++ G +A K      P     N  YD++ G Y
Sbjct  127  MTPSELVKKFRNYLTDLEFEELKVYKEVWYFGQHASKNYNKPAPTANTTNLGYDDDNGNY  186

Query  270  IHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRFHRQAQEEIRIL  329
              + HDH+A+RYE+L++IGKGSFGQVI+A DHKT+ HVA+KI+RN+KRF  QA  E+ IL
Sbjct  187  KIIEHDHIAFRYEILEVIGKGSFGQVIRALDHKTNTHVAIKIIRNKKRFLNQAVVELNIL  246

Query  330  HHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKGFSLQLVRKFAH  389
              LR  D   + N+IHM DY  FR H CITFEL+S+NLYELIKKN + GFS+ L+R+F +
Sbjct  247  DELREKDADGSHNVIHMLDYTYFRKHLCITFELMSLNLYELIKKNNYNGFSMSLIRRFCN  306

Query  390  SLLQCLDALYKNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQRIYTYIQSRFYRA  449
            S+++CL  LYK +IIHCD+KPEN+LLKQ+G S IKVIDFGSSC+ +++IYTYIQSRFYR+
Sbjct  307  SIVKCLRLLYKENIIHCDLKPENILLKQRGSSSIKVIDFGSSCYVDRKIYTYIQSRFYRS  366

Query  450  PEVILGAKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEVLGMPNKNILANSK  509
            PEVILG +YG AIDMWSLGCILAEL +G  LFPGENE +QLACI+EVLG+P K +++ ++
Sbjct  367  PEVILGLQYGTAIDMWSLGCILAELYTGFPLFPGENEVEQLACIMEVLGLPPKVLISVAR  426

Query  510  RSKSFFNPKGYPRYCTVRTMSDGMVVLIGGQSRRGKPRGPPCSKSLSKALDGCKDPLFLN  569
            R + FF+ +  PR C   T              +G+ R P  SKSL+  L  C+D  F++
Sbjct  427  RRRLFFDSRDAPR-CITNT--------------KGRKRSPG-SKSLAHILH-CQDRYFID  469

Query  570  FIRGCLEWDADKRLTPSEALKHPWLR  595
            F++ CLEWD  +R+TP EA  H +L+
Sbjct  470  FLQRCLEWDPAERMTPDEAAHHEFLQ  495


>MNB_DROME unnamed protein product
Length=908

 Score = 293 bits (750),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 158/355 (45%), Positives = 214/355 (60%), Gaps = 27/355 (8%)

Query  259  NSDYDNEQGAYIHVPHDHVAYRYEMLKIIGKGSFGQVIKAYDHKTHEHVALKIVRNEKRF  318
            N  YD++   YI    +    RYE+  +IGKGSFGQV+KAYDH+   HVA+KI++N+K F
Sbjct  142  NDGYDDDNHDYIIKNGEKFLDRYEIDSLIGKGSFGQVVKAYDHEEQCHVAIKIIKNKKPF  201

Query  319  HRQAQEEIRILHHLRRHDKYNTMNIIHMFDYFTFRNHTCITFELLSINLYELIKKNGFKG  378
              QAQ E+++L  + R D  N   I+ +  +F +RNH C+ FELLS NLY+L++   F+G
Sbjct  202  LNQAQIEVKLLEMMNRADAENKYYIVKLKRHFMWRNHLCLVFELLSYNLYDLLRNTNFRG  261

Query  379  FSLQLVRKFAHSLLQCLDALY--KNDIIHCDMKPENVLLKQQGRSGIKVIDFGSSCFENQ  436
             SL L RKFA  L   L  L   + +IIHCD+KPEN+LL    RS IK++DFGSSC   Q
Sbjct  262  VSLNLTRKFAQQLCTALLFLSTPELNIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQ  321

Query  437  RIYTYIQSRFYRAPEVILGAKYGRAIDMWSLGCILAELLSGHALFPGENESDQLACIIEV  496
            RIY YIQSRFYR+PEV+LG +Y  AIDMWSLGCIL E+ +G  LF G NE DQ+  I+EV
Sbjct  322  RIYHYIQSRFYRSPEVLLGIQYDLAIDMWSLGCILVEMHTGEPLFSGCNEVDQMNKIVEV  381

Query  497  LGMPNKNILANSKRSKSFFNPKGYPRYCTVRTMSDGMVVLIGGQSRR-------------  543
            LGMP K +L  + +++ FF+          + ++DG  VL   Q+ R             
Sbjct  382  LGMPPKYLLDQAHKTRKFFD----------KIVADGSYVLKKNQNGRKYKPPGSRKLHDI  431

Query  544  -GKPRGPPCSKSLSKALDGCKDPL-FLNFIRGCLEWDADKRLTPSEALKHPWLRR  596
             G   G P  + L +      D L F + I   L++D   R+TP  AL+H + +R
Sbjct  432  LGVETGGPGGRRLDEPGHSVSDYLKFKDLILRMLDFDPKTRVTPYYALQHNFFKR  486



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062666.1 plexin-A2 [Drosophila eugracilis]

Length=1945
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9V491_DROME  unnamed protein product                                 3924    0.0  
O96681_DROME  unnamed protein product                                 3907    0.0  
H9XVP3_DROME  unnamed protein product                                 3877    0.0  


>Q9V491_DROME unnamed protein product
Length=1945

 Score = 3924 bits (10177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1867/1945 (96%), Positives = 1915/1945 (98%), Gaps = 0/1945 (0%)

Query  1     MNFILSVLLLATLGDKNDFWLQSRKGCQILAANIRSDDTAFTNIPLNSTDANSKMKDSQN  60
             MNF+LSVLL+A L DK D+WL SR GCQ LAANI SD T   N P+N T+AN+ +K+++N
Sbjct  1     MNFVLSVLLIAILKDKYDYWLPSRTGCQTLAANIWSDKTTAQNEPINLTNANAPIKNAKN  60

Query  61    LSTTITNLATFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS  120
             L++TITN+A FDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
Sbjct  61    LNSTITNVAAFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS  120

Query  121   ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIVEHEVPDAVV  180
             ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSI+EHEVPDAVV
Sbjct  121   ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV  180

Query  181   ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS  240
             ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
Sbjct  181   ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS  240

Query  241   AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHPSSTKEYITKLVRICQE  300
             AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSH SS KEYITKLVRICQE
Sbjct  241   AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE  300

Query  301   DSNYYSYTEIPVECISDAQGGTKFNLVQAGYLGKPSSDLAQSLGISIQDDVLFAVFSKGD  360
             DSNYYSYTEIPVECISDAQGGTKFNLVQAG+LGKPSSDLAQSLGISIQDDVLFAVFSKG+
Sbjct  301   DSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKGE  360

Query  361   GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFC  420
             GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNG+GMRGLDFISPSMPCVLTKLQTIGEDFC
Sbjct  361   GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGSGMRGLDFISPSMPCVLTKLQTIGEDFC  420

Query  421   GLDVNSPLGGENPITSVPVAMFNTKITSVAATSTSGYTVVFVGTTDGYLKKVVVESSSVA  480
             GLDVNSPLGGE PITSVPVAMFNTK+TSVAATSTSGYTVVFVGT+DG+LKKVV+ESSS+A
Sbjct  421   GLDVNSPLGGETPITSVPVAMFNTKLTSVAATSTSGYTVVFVGTSDGFLKKVVIESSSIA  480

Query  481   NEYSSFSVDLGSAINQDMQFDNQNLYMYVMSETKVAKVKVFDCSDYKTCGECLGARDPYC  540
             NEY+SF+VDLGS IN+DMQFDNQNLY+YVMS+TKV+KVKVFDCSDYKTCG+CLGARDPYC
Sbjct  481   NEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYC  540

Query  541   GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP  600
             GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
Sbjct  541   GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP  600

Query  601   QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP  660
             QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
Sbjct  601   QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP  660

Query  661   DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS  720
             DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
Sbjct  661   DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS  720

Query  721   YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN  780
             YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
Sbjct  721   YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN  780

Query  781   AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI  840
             AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
Sbjct  781   AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI  840

Query  841   CLALAEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFEPKTGPWEGG  900
             CLAL+EKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTF+PKTGPWEGG
Sbjct  841   CLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFQPKTGPWEGG  900

Query  901   TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV  960
             TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
Sbjct  901   TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV  960

Query  961   QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK  1020
             QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
Sbjct  961   QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK  1020

Query  1021  ILKTDSSEAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTIEHVSSGPSGQIK  1080
             IL TDSS+AICRTS SPGIIEGRLKMSFDNGPREFNDYNFKYVLDPT+EHVSSGPSGQIK
Sbjct  1021  ILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIK  1080

Query  1081  VPKGIPSGGIRISVIGTQFTSIQSPNIYVIYNGKIYESQCRVQSDTEMECASPVINVDSK  1140
             VPKGIP+GGIRISV GTQFTSIQ+PNIYV+YNG++Y S CRVQSDTEMECASPV++VDS 
Sbjct  1081  VPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYASPCRVQSDTEMECASPVVDVDSH  1140

Query  1141  NIEAENPMLLEYGFLMDNVLRVQNLSKIHKNHFELYPNPEYFIFEERVKYFKSEYLTING  1200
              IEAE P+LLEYGFLMDNVLRVQNLSK+H NHFELYPNPEYFIFEERVKYFKSEYLTING
Sbjct  1141  VIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERVKYFKSEYLTING  1200

Query  1201  RNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPPEATATKSLNGPEVIVRIGTSLEY  1260
             RNLDRACKE+DVEVKIGNGFCNITSLSRQQLTCRPP EATATKS+NGPEVIVRIGTSLEY
Sbjct  1201  RNLDRACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEY  1260

Query  1261  RIGILSYESSNIILDWGENVFFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQM  1320
             RIGILSYESSNIILDWGENV FAVIATIVILLLIFVALLVAYKKKSSES+RVLRNMQEQM
Sbjct  1261  RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQM  1320

Query  1321  DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE  1380
             DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
Sbjct  1321  DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE  1380

Query  1381  RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC  1440
             RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
Sbjct  1381  RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC  1440

Query  1441  TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML  1500
             TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
Sbjct  1441  TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML  1500

Query  1501  FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS  1560
             FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
Sbjct  1501  FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS  1560

Query  1561  HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV  1620
             HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
Sbjct  1561  HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV  1620

Query  1621  TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS  1680
             TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS
Sbjct  1621  TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS  1680

Query  1681  SSPTFSRAGSPLNNDLHDNGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL  1740
             SSPTFSRAGSPLNND+H+NGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL
Sbjct  1681  SSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL  1740

Query  1741  QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW  1800
             QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
Sbjct  1741  QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW  1800

Query  1801  VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR  1860
             VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
Sbjct  1801  VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR  1860

Query  1861  KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL  1920
             KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
Sbjct  1861  KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL  1920

Query  1921  EEDEFSQKQRLAFKLEQVHNIMSAE  1945
             EEDEFSQKQRLAFKLEQVHNIMS+E
Sbjct  1921  EEDEFSQKQRLAFKLEQVHNIMSSE  1945


>O96681_DROME unnamed protein product
Length=1945

 Score = 3907 bits (10133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1860/1945 (96%), Positives = 1911/1945 (98%), Gaps = 0/1945 (0%)

Query  1     MNFILSVLLLATLGDKNDFWLQSRKGCQILAANIRSDDTAFTNIPLNSTDANSKMKDSQN  60
             MNF+LSVLL+A L DK D+WL SR GCQ LAANI SD T   N P+N T+AN+ +K+++N
Sbjct  1     MNFVLSVLLIAILKDKYDYWLPSRTGCQTLAANIWSDKTTAQNEPINLTNANAPIKNAKN  60

Query  61    LSTTITNLATFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS  120
             L++TITN+A FDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
Sbjct  61    LNSTITNVAAFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS  120

Query  121   ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIVEHEVPDAVV  180
             ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSI+EHEVPDAVV
Sbjct  121   ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV  180

Query  181   ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS  240
             ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
Sbjct  181   ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS  240

Query  241   AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHPSSTKEYITKLVRICQE  300
             AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSH SS KEYITKLVRICQE
Sbjct  241   AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE  300

Query  301   DSNYYSYTEIPVECISDAQGGTKFNLVQAGYLGKPSSDLAQSLGISIQDDVLFAVFSKGD  360
             DSNYYSYTEIPVECISDAQGGTKFNLVQAG+LGKPSS+LAQSLGISIQ+DVLFAVFSKG+
Sbjct  301   DSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSNLAQSLGISIQNDVLFAVFSKGE  360

Query  361   GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFC  420
             GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNG+GMRGL+FISPSMPCVLTKLQTIGEDFC
Sbjct  361   GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGSGMRGLNFISPSMPCVLTKLQTIGEDFC  420

Query  421   GLDVNSPLGGENPITSVPVAMFNTKITSVAATSTSGYTVVFVGTTDGYLKKVVVESSSVA  480
             GLDVNSPLGGE PITSVPVAMFNTK+TSVAATSTSGYTVVFVGT+DG+LKKVV+ESSS+A
Sbjct  421   GLDVNSPLGGETPITSVPVAMFNTKLTSVAATSTSGYTVVFVGTSDGFLKKVVIESSSIA  480

Query  481   NEYSSFSVDLGSAINQDMQFDNQNLYMYVMSETKVAKVKVFDCSDYKTCGECLGARDPYC  540
             NEY+SF+VDLGS IN+DMQFDNQNLY+YVMS+TKV+KVKVFDCSDYKTCG+CLGARDPYC
Sbjct  481   NEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYC  540

Query  541   GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP  600
             GWCSLENKCSPRSNCQDDANDP YWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
Sbjct  541   GWCSLENKCSPRSNCQDDANDPFYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP  600

Query  601   QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP  660
             QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
Sbjct  601   QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP  660

Query  661   DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS  720
             DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
Sbjct  661   DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS  720

Query  721   YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN  780
             YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
Sbjct  721   YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN  780

Query  781   AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI  840
             AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
Sbjct  781   AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI  840

Query  841   CLALAEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFEPKTGPWEGG  900
             CLAL+EKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTF+PKTGPWEGG
Sbjct  841   CLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFQPKTGPWEGG  900

Query  901   TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV  960
             TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
Sbjct  901   TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV  960

Query  961   QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK  1020
             QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
Sbjct  961   QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK  1020

Query  1021  ILKTDSSEAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTIEHVSSGPSGQIK  1080
             IL TDSS+AICRTS SPGIIEGRLKMSFDNGPREFNDYNFKYVLDPT+EHVSSGPSGQIK
Sbjct  1021  ILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIK  1080

Query  1081  VPKGIPSGGIRISVIGTQFTSIQSPNIYVIYNGKIYESQCRVQSDTEMECASPVINVDSK  1140
             VPKGIP+GGIRISV GTQFTSIQ+PNIYV+YNG++Y S CRVQSDTEMECASPV++VDS 
Sbjct  1081  VPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYASPCRVQSDTEMECASPVVDVDSH  1140

Query  1141  NIEAENPMLLEYGFLMDNVLRVQNLSKIHKNHFELYPNPEYFIFEERVKYFKSEYLTING  1200
              IEAE P+LLEYGFLMDNVLRVQNLSK+H NHFELYPNPEYFIFEERVKYFKS YLTING
Sbjct  1141  VIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERVKYFKSXYLTING  1200

Query  1201  RNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPPEATATKSLNGPEVIVRIGTSLEY  1260
             RNLDRACKE+DVEVKIGNGFCNITSLSRQQLTCRPP EATATKS+NGPEVIVRIGTSLEY
Sbjct  1201  RNLDRACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEY  1260

Query  1261  RIGILSYESSNIILDWGENVFFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQM  1320
             RIGILSYESSNIILDWGENV FAVIATIVILLLIFVALLVAYKKKSSES+RVLRNMQEQM
Sbjct  1261  RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQM  1320

Query  1321  DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE  1380
             DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
Sbjct  1321  DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE  1380

Query  1381  RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC  1440
             RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
Sbjct  1381  RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC  1440

Query  1441  TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML  1500
             TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
Sbjct  1441  TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML  1500

Query  1501  FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS  1560
             FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
Sbjct  1501  FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS  1560

Query  1561  HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV  1620
             HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSS RP KDDLDLEWRTGATGRVILYDEDV
Sbjct  1561  HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSPRPPKDDLDLEWRTGATGRVILYDEDV  1620

Query  1621  TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS  1680
             TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS
Sbjct  1621  TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS  1680

Query  1681  SSPTFSRAGSPLNNDLHDNGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL  1740
             SSPTFSRAGSPLNND+H+NGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL
Sbjct  1681  SSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL  1740

Query  1741  QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW  1800
             QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
Sbjct  1741  QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW  1800

Query  1801  VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR  1860
             VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
Sbjct  1801  VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR  1860

Query  1861  KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL  1920
             KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
Sbjct  1861  KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL  1920

Query  1921  EEDEFSQKQRLAFKLEQVHNIMSAE  1945
             EEDEFSQKQRLAFKLEQVHNIMS+E
Sbjct  1921  EEDEFSQKQRLAFKLEQVHNIMSSE  1945


>H9XVP3_DROME unnamed protein product
Length=1928

 Score = 3877 bits (10053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1849/1945 (95%), Positives = 1898/1945 (98%), Gaps = 17/1945 (1%)

Query  1     MNFILSVLLLATLGDKNDFWLQSRKGCQILAANIRSDDTAFTNIPLNSTDANSKMKDSQN  60
             MNF+LSVLL+A L DK D+WL SR GCQ LAANI SD T   N P+N T+AN+ +K+++N
Sbjct  1     MNFVLSVLLIAILKDKYDYWLPSRTGCQTLAANIWSDKTTAQNEPINLTNANAPIKNAKN  60

Query  61    LSTTITNLATFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS  120
             L++TITN+A FDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS
Sbjct  61    LNSTITNVAAFDTKLNHLLVDTITGRVFVGGVNRLYQLSPDLELSETVKTGPQNDSVECS  120

Query  121   ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIVEHEVPDAVV  180
             ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSI+EHEVPDAVV
Sbjct  121   ILDCPLNAVRSPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIIEHEVPDAVV  180

Query  181   ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS  240
             ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS
Sbjct  181   ANDANSSTVAFIAPGPPQHPVTNVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASS  240

Query  241   AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHPSSTKEYITKLVRICQE  300
             AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSH SS KEYITKLVRICQE
Sbjct  241   AVTTGTRTFINSYARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQE  300

Query  301   DSNYYSYTEIPVECISDAQGGTKFNLVQAGYLGKPSSDLAQSLGISIQDDVLFAVFSKGD  360
             DSNYYSYTEIPVECISDAQGGTKFNLVQAG+LGKPSSDLAQSLGISIQDDVLFAVFSKG+
Sbjct  301   DSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQSLGISIQDDVLFAVFSKGE  360

Query  361   GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGNGMRGLDFISPSMPCVLTKLQTIGEDFC  420
             GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNG+GMRGLDFISPSMPCVLTKLQTIGEDFC
Sbjct  361   GNTPTNNSALCIYSLKSIRRKFMQNIKSCFNGSGMRGLDFISPSMPCVLTKLQTIGEDFC  420

Query  421   GLDVNSPLGGENPITSVPVAMFNTKITSVAATSTSGYTVVFVGTTDGYLKKVVVESSSVA  480
             GLDVNSPLGGE PITSVPVAMFNTK+TSVAATSTSGYTVVFVGT+DG+LKKVV+ESSS+A
Sbjct  421   GLDVNSPLGGETPITSVPVAMFNTKLTSVAATSTSGYTVVFVGTSDGFLKKVVIESSSIA  480

Query  481   NEYSSFSVDLGSAINQDMQFDNQNLYMYVMSETKVAKVKVFDCSDYKTCGECLGARDPYC  540
             NEY+SF+VDLGS IN+DMQFDNQNLY+YVMS+TKV+KVKVFDCSDYKTCG+CLGARDPYC
Sbjct  481   NEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYC  540

Query  541   GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP  600
             GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP
Sbjct  541   GWCSLENKCSPRSNCQDDANDPLYWVSYKTGKCTTITSVVPHQLQRTTARTLELIIDHLP  600

Query  601   QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP  660
             QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP
Sbjct  601   QLKENLICAFTTEDKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGP  660

Query  661   DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS  720
             DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS
Sbjct  661   DLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPS  720

Query  721   YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN  780
             YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN
Sbjct  721   YRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLN  780

Query  781   AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI  840
             AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI
Sbjct  781   AQLLGDTIYCDSMEFQYTSRSPNLTATFAVIWGGSKPLDNPHNIHVVIYRCREMADSCGI  840

Query  841   CLALAEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFEPKTGPWEGG  900
             CLAL+EKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTF+PKTGPWEGG
Sbjct  841   CLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLNRSEICPNPEIHTFQPKTGPWEGG  900

Query  901   TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV  960
             TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV
Sbjct  901   TNITIRGINLGKNYNDIYSGVRIAGINCMPFPQFYIDTKQIVCTVDSPGEQMYRNGKIVV  960

Query  961   QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK  1020
             QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK
Sbjct  961   QIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASINDHLPCK  1020

Query  1021  ILKTDSSEAICRTSPSPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTIEHVSSGPSGQIK  1080
             IL TDSS+AICRTS SPGIIEGRLKMSFDNGPREFNDYNFKYVLDPT+EHVSSGPSGQIK
Sbjct  1021  ILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIK  1080

Query  1081  VPKGIPSGGIRISVIGTQFTSIQSPNIYVIYNGKIYESQCRVQSDTEMECASPVINVDSK  1140
             VPKGIP+GGIRISV GTQFTSIQ+PNIYV+YNG++Y S CRVQSDTEMECASPV++VDS 
Sbjct  1081  VPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYASPCRVQSDTEMECASPVVDVDSH  1140

Query  1141  NIEAENPMLLEYGFLMDNVLRVQNLSKIHKNHFELYPNPEYFIFEERVKYFKSEYLTING  1200
              IEAE P+LLEYGFLMDNVLRVQNLSK+H NHFELYPNPEYFIFEERVKYFKSEYLTING
Sbjct  1141  VIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERVKYFKSEYLTING  1200

Query  1201  RNLDRACKETDVEVKIGNGFCNITSLSRQQLTCRPPPEATATKSLNGPEVIVRIGTSLEY  1260
             RNLDRACKE+DVEVKIGNGFCNITSLSRQQLTCRPP EATATKS+NGPEVIVRIGTSLEY
Sbjct  1201  RNLDRACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEY  1260

Query  1261  RIGILSYESSNIILDWGENVFFAVIATIVILLLIFVALLVAYKKKSSESNRVLRNMQEQM  1320
             RIGILSYESSNIILDWGENV FAVIATIVILLLIFVALLVAYKKKSSES+RVLRNMQEQM
Sbjct  1261  RIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQM  1320

Query  1321  DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE  1380
             DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE
Sbjct  1321  DILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQWE  1380

Query  1381  RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC  1440
             RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC
Sbjct  1381  RPELLRKEKGLRIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYC  1440

Query  1441  TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML  1500
             TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML
Sbjct  1441  TDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGEPLYML  1500

Query  1501  FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS  1560
             FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS
Sbjct  1501  FRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPS  1560

Query  1561  HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV  1620
             HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV
Sbjct  1561  HTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDV  1620

Query  1621  TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTS  1680
             TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSH            
Sbjct  1621  TSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSH------------  1668

Query  1681  SSPTFSRAGSPLNNDLHDNGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL  1740
                  +RAGSPLNND+H+NGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL
Sbjct  1669  -----NRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTL  1723

Query  1741  QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW  1800
             QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW
Sbjct  1724  QKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFW  1783

Query  1801  VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR  1860
             VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR
Sbjct  1784  VNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYR  1843

Query  1861  KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL  1920
             KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL
Sbjct  1844  KWVDRYYRDIRDMSPISDQDMNAMLAEESRLHTTEFNTNCALHELYTYAVKYNEQLTVTL  1903

Query  1921  EEDEFSQKQRLAFKLEQVHNIMSAE  1945
             EEDEFSQKQRLAFKLEQVHNIMS+E
Sbjct  1904  EEDEFSQKQRLAFKLEQVHNIMSSE  1928



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062667.1 paired box protein Pax-6 isoform X1 [Drosophila
eugracilis]

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZC2_DROME  unnamed protein product                                 1010    0.0  
Q9V490_DROME  unnamed protein product                                 1009    0.0  
L0MPR7_DROME  unnamed protein product                                 971     0.0  


>Q9XZC2_DROME unnamed protein product
Length=543

 Score = 1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/544 (91%), Positives = 515/544 (95%), Gaps = 1/544 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS LIS+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALISNSLPEASNGPTVLGGEANTTHTSSESPPLQPSAPR  419

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  541  PRLQ  544
            PRLQ
Sbjct  540  PRLQ  543


>Q9V490_DROME unnamed protein product
Length=543

 Score = 1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/544 (91%), Positives = 515/544 (95%), Gaps = 1/544 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS L+S+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPR  419

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  541  PRLQ  544
            PRLQ
Sbjct  540  PRLQ  543


>L0MPR7_DROME unnamed protein product
Length=526

 Score = 971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/544 (89%), Positives = 500/544 (92%), Gaps = 18/544 (3%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPE    VWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPE----VWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  355

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS L             VLGG+AN   ++SESPPLQ  APR
Sbjct  356  SNNSTPGIVNSAINVAERTSSAL-------------VLGGEANTTHTSSESPPLQPAAPR  402

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  403  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  462

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  463  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  522

Query  541  PRLQ  544
            PRLQ
Sbjct  523  PRLQ  526



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062668.1 paired box protein Pax-6 isoform X1 [Drosophila
eugracilis]

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZC2_DROME  unnamed protein product                                 1010    0.0  
Q9V490_DROME  unnamed protein product                                 1009    0.0  
L0MPR7_DROME  unnamed protein product                                 971     0.0  


>Q9XZC2_DROME unnamed protein product
Length=543

 Score = 1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/544 (91%), Positives = 515/544 (95%), Gaps = 1/544 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS LIS+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALISNSLPEASNGPTVLGGEANTTHTSSESPPLQPSAPR  419

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  541  PRLQ  544
            PRLQ
Sbjct  540  PRLQ  543


>Q9V490_DROME unnamed protein product
Length=543

 Score = 1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/544 (91%), Positives = 515/544 (95%), Gaps = 1/544 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS L+S+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPR  419

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  541  PRLQ  544
            PRLQ
Sbjct  540  PRLQ  543


>L0MPR7_DROME unnamed protein product
Length=526

 Score = 971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/544 (89%), Positives = 500/544 (92%), Gaps = 18/544 (3%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPE    VWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPE----VWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  355

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS L             VLGG+AN   ++SESPPLQ  APR
Sbjct  356  SNNSTPGIVNSAINVAERTSSAL-------------VLGGEANTTHTSSESPPLQPAAPR  402

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  403  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  462

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  463  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  522

Query  541  PRLQ  544
            PRLQ
Sbjct  523  PRLQ  526



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062669.1 paired box protein Pax-6 isoform X1 [Drosophila
eugracilis]

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZC2_DROME  unnamed protein product                                 1010    0.0  
Q9V490_DROME  unnamed protein product                                 1009    0.0  
L0MPR7_DROME  unnamed protein product                                 971     0.0  


>Q9XZC2_DROME unnamed protein product
Length=543

 Score = 1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/544 (91%), Positives = 515/544 (95%), Gaps = 1/544 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS LIS+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALISNSLPEASNGPTVLGGEANTTHTSSESPPLQPSAPR  419

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  541  PRLQ  544
            PRLQ
Sbjct  540  PRLQ  543


>Q9V490_DROME unnamed protein product
Length=543

 Score = 1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/544 (91%), Positives = 515/544 (95%), Gaps = 1/544 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS L+S+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPR  419

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  541  PRLQ  544
            PRLQ
Sbjct  540  PRLQ  543


>L0MPR7_DROME unnamed protein product
Length=526

 Score = 971 bits (2510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/544 (89%), Positives = 500/544 (92%), Gaps = 18/544 (3%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  360
            KIGLPE    VWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPE----VWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  355

Query  361  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  420
            SNNSTPGI +SAINV++R SS L             VLGG+AN   ++SESPPLQ  APR
Sbjct  356  SNNSTPGIVNSAINVAERTSSAL-------------VLGGEANTTHTSSESPPLQPAAPR  402

Query  421  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  480
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  403  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  462

Query  481  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  540
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  463  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  522

Query  541  PRLQ  544
            PRLQ
Sbjct  523  PRLQ  526



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062670.1 paired box protein Pax-6 isoform X2 [Drosophila
eugracilis]

Length=540
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZC2_DROME  unnamed protein product                                 996     0.0  
Q9V490_DROME  unnamed protein product                                 996     0.0  
L0MPR7_DROME  unnamed protein product                                 977     0.0  


>Q9XZC2_DROME unnamed protein product
Length=543

 Score = 996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/544 (91%), Positives = 511/544 (94%), Gaps = 5/544 (1%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPE----VWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  356
            KIGLPE    VWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  357  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  416
            SNNSTPGI +SAINV++R SS LIS+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALISNSLPEASNGPTVLGGEANTTHTSSESPPLQPSAPR  419

Query  417  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  476
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  477  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  536
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  537  PRLQ  540
            PRLQ
Sbjct  540  PRLQ  543


>Q9V490_DROME unnamed protein product
Length=543

 Score = 996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/544 (90%), Positives = 511/544 (94%), Gaps = 5/544 (1%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPE----VWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTT  356
            KIGLPE    VWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV T
Sbjct  301  KIGLPEARIQVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVAT  359

Query  357  SNNSTPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPR  416
            SNNSTPGI +SAINV++R SS L+S+SLP+A N PTVLGG+AN   ++SESPPLQ  APR
Sbjct  360  SNNSTPGIVNSAINVAERTSSALVSNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPR  419

Query  417  LPLNTGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPP  476
            LPLN+GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  
Sbjct  420  LPLNSGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSA  479

Query  477  HHRNSACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYW  536
            HHRN+ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYW
Sbjct  480  HHRNTACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYW  539

Query  537  PRLQ  540
            PRLQ
Sbjct  540  PRLQ  543


>L0MPR7_DROME unnamed protein product
Length=526

 Score = 977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/540 (90%), Positives = 500/540 (93%), Gaps = 14/540 (3%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLAD  300

Query  301  KIGLPEVWFSNRRAKWRREEKMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTTSNNS  360
            KIGLPEVWFSNRRAKWRREEKMRTQRRSAD  V+GS R STANNPSGT A SSV TSNNS
Sbjct  301  KIGLPEVWFSNRRAKWRREEKMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVATSNNS  359

Query  361  TPGISSSAINVSDRASSVLISSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPRLPLN  420
            TPGI +SAINV++R SS L             VLGG+AN   ++SESPPLQ  APRLPLN
Sbjct  360  TPGIVNSAINVAERTSSAL-------------VLGGEANTTHTSSESPPLQPAAPRLPLN  406

Query  421  TGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPPHHRN  480
            +GFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  HHRN
Sbjct  407  SGFNTMYSSIPQPIATMAENYNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRN  466

Query  481  SACNPAAAHQQPPQHGVYTNSSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  540
            +ACNP+AAHQQPPQHGVYTNSSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ
Sbjct  467  TACNPSAAHQQPPQHGVYTNSSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  526



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


Query= XP_017062671.1 paired box protein Pax-6 isoform X3 [Drosophila
eugracilis]

Length=476
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZC2_DROME  unnamed protein product                                 832     0.0  
Q9V490_DROME  unnamed protein product                                 832     0.0  
L0MPR7_DROME  unnamed protein product                                 794     0.0  


>Q9XZC2_DROME unnamed protein product
Length=543

 Score = 832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/460 (90%), Positives = 431/460 (94%), Gaps = 1/460 (0%)

Query  17   YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS  76
            YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS
Sbjct  85   YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS  144

Query  77   VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLALPPTTSV  136
            VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHL LPP  SV
Sbjct  145  VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPAASV  204

Query  137  VSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDSTSDGNSEHNSSGDEDSQMRLRLKRK  196
            V++P NLSG  +RDDVQKR+LQ+S +VSH NSHDSTSDGNSEHNSSGDEDSQMRLRLKRK
Sbjct  205  VTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRK  264

Query  197  LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE  256
            LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE
Sbjct  265  LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE  324

Query  257  KMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTTSNNSTPGISSSAINVSDRASSVLI  316
            KMRTQRRSAD  V+GS R STANNPSGT A SSV TSNNSTPGI +SAINV++R SS LI
Sbjct  325  KMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALI  383

Query  317  SSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPRLPLNTGFNTMYSSIPQPIATMAEN  376
            S+SLP+A N PTVLGG+AN   ++SESPPLQ  APRLPLN+GFNTMYSSIPQPIATMAEN
Sbjct  384  SNSLPEASNGPTVLGGEANTTHTSSESPPLQPSAPRLPLNSGFNTMYSSIPQPIATMAEN  443

Query  377  YNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPPHHRNSACNPAAAHQQPPQHGVYTN  436
            YNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  HHRN+ACNP+AAHQQPPQHGVYTN
Sbjct  444  YNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTN  503

Query  437  SSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  476
            SSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ
Sbjct  504  SSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  543


>Q9V490_DROME unnamed protein product
Length=543

 Score = 832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/460 (90%), Positives = 431/460 (94%), Gaps = 1/460 (0%)

Query  17   YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS  76
            YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS
Sbjct  85   YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS  144

Query  77   VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLALPPTTSV  136
            VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHL LPP  SV
Sbjct  145  VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPAASV  204

Query  137  VSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDSTSDGNSEHNSSGDEDSQMRLRLKRK  196
            V++P NLSG  +RDDVQKR+LQ+S +VSH NSHDSTSDGNSEHNSSGDEDSQMRLRLKRK
Sbjct  205  VTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRK  264

Query  197  LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE  256
            LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE
Sbjct  265  LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE  324

Query  257  KMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTTSNNSTPGISSSAINVSDRASSVLI  316
            KMRTQRRSAD  V+GS R STANNPSGT A SSV TSNNSTPGI +SAINV++R SS L+
Sbjct  325  KMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSALV  383

Query  317  SSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPRLPLNTGFNTMYSSIPQPIATMAEN  376
            S+SLP+A N PTVLGG+AN   ++SESPPLQ  APRLPLN+GFNTMYSSIPQPIATMAEN
Sbjct  384  SNSLPEASNGPTVLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAEN  443

Query  377  YNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPPHHRNSACNPAAAHQQPPQHGVYTN  436
            YNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  HHRN+ACNP+AAHQQPPQHGVYTN
Sbjct  444  YNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTN  503

Query  437  SSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  476
            SSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ
Sbjct  504  SSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  543


>L0MPR7_DROME unnamed protein product
Length=526

 Score = 794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/460 (87%), Positives = 416/460 (90%), Gaps = 18/460 (4%)

Query  17   YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS  76
            YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS
Sbjct  85   YYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECPSIFAWEIRDRLLSEQVCNSDNIPS  144

Query  77   VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLALPPTTSV  136
            VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHL LPP  SV
Sbjct  145  VSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQTGGWAWYPSNTTTAHLTLPPAASV  204

Query  137  VSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDSTSDGNSEHNSSGDEDSQMRLRLKRK  196
            V++P NLSG  +RDDVQKR+LQ+S +VSH NSHDSTSDGNSEHNSSGDEDSQMRLRLKRK
Sbjct  205  VTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDSTSDGNSEHNSSGDEDSQMRLRLKRK  264

Query  197  LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPEARIQVWFSNRRAKWRREE  256
            LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPE    VWFSNRRAKWRREE
Sbjct  265  LQRNRTSFSNEQIDSLEKEFERTHYPDVFARERLADKIGLPE----VWFSNRRAKWRREE  320

Query  257  KMRTQRRSADNVVEGSVRPSTANNPSGTAAPSSVTTSNNSTPGISSSAINVSDRASSVLI  316
            KMRTQRRSAD  V+GS R STANNPSGT A SSV TSNNSTPGI +SAINV++R SS L 
Sbjct  321  KMRTQRRSAD-TVDGSGRTSTANNPSGTTASSSVATSNNSTPGIVNSAINVAERTSSAL-  378

Query  317  SSSLPDAPNVPTVLGGDANAAQSNSESPPLQAVAPRLPLNTGFNTMYSSIPQPIATMAEN  376
                        VLGG+AN   ++SESPPLQ  APRLPLN+GFNTMYSSIPQPIATMAEN
Sbjct  379  ------------VLGGEANTTHTSSESPPLQPAAPRLPLNSGFNTMYSSIPQPIATMAEN  426

Query  377  YNSSLGSMTPSCLQQRDTYPYMFHDPLSLGSPYVPPHHRNSACNPAAAHQQPPQHGVYTN  436
            YNSSLGSMTPSCLQQRD YPYMFHDPLSLGSPYV  HHRN+ACNP+AAHQQPPQHGVYTN
Sbjct  427  YNSSLGSMTPSCLQQRDAYPYMFHDPLSLGSPYVSAHHRNTACNPSAAHQQPPQHGVYTN  486

Query  437  SSPMASSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  476
            SSPM SSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ
Sbjct  487  SSPMPSSNTGVISAGVSVPVQISTQNVSDLTGSNYWPRLQ  526



Lambda      K        H
   0.316    0.132    0.385 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 19499266600


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062672.1 paired box protein Pax-6 isoform X4 [Drosophila
eugracilis]

Length=290
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZC2_DROME  unnamed protein product                                 546     0.0  
Q9V490_DROME  unnamed protein product                                 546     0.0  
L0MPR7_DROME  unnamed protein product                                 546     0.0  


>Q9XZC2_DROME unnamed protein product
Length=543

 Score = 546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/282 (95%), Positives = 274/282 (97%), Gaps = 0/282 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK  282
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK  282


>Q9V490_DROME unnamed protein product
Length=543

 Score = 546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/282 (95%), Positives = 274/282 (97%), Gaps = 0/282 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK  282
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK  282


>L0MPR7_DROME unnamed protein product
Length=526

 Score = 546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/282 (95%), Positives = 274/282 (97%), Gaps = 0/282 (0%)

Query  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60
            MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS
Sbjct  1    MMLTTEHIMHGHPHSSVGQSTLFGCSTAGHSGINQLGGVYVNGRPLPDSTRQKIVELAHS  60

Query  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120
            GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP
Sbjct  61   GARPCDISRILQVSNGCVSKILGRYYETGSIKPRAIGGSKPRVATTPVVQKIADYKRECP  120

Query  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180
            SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ
Sbjct  121  SIFAWEIRDRLLSEQVCNSDNIPSVSSINRVLRNLASQKEQQAQQQNESVYEKLRMFNGQ  180

Query  181  TGGWAWYPSNTTTAHLALPPTTSVVSAPTNLSGHVNRDDVQKRDLQYSADVSHPNSHDST  240
            TGGWAWYPSNTTTAHL LPP  SVV++P NLSG  +RDDVQKR+LQ+S +VSH NSHDST
Sbjct  181  TGGWAWYPSNTTTAHLTLPPAASVVTSPANLSGQADRDDVQKRELQFSVEVSHTNSHDST  240

Query  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK  282
            SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK
Sbjct  241  SDGNSEHNSSGDEDSQMRLRLKRKLQRNRTSFSNEQIDSLEK  282



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062674.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062675.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062676.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062677.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062678.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062679.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


Query= XP_017062680.1 protein Gawky [Drosophila eugracilis]

Length=1390
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GAWKY_DROME  unnamed protein product                                  2032    0.0  


>GAWKY_DROME unnamed protein product
Length=1384

 Score = 2032 bits (5265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1157/1398 (83%), Positives = 1235/1398 (88%), Gaps = 22/1398 (2%)

Query  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPTNKDAAGPPMWKPSINNGTDLWESNLRNGG  60
             MREALFSQDGWGCQHVNQDTNWEVPSSPEP NKDA GPPMWKPSINNGTDLWESNLRNGG
Sbjct  1     MREALFSQDGWGCQHVNQDTNWEVPSSPEPANKDAPGPPMWKPSINNGTDLWESNLRNGG  60

Query  61    QPTAQQVQKPSWGHTPSSNLGGTWGEDDDGTDSSSVWTGGSVSNAGSGAAVVVNQGGVNV  120
             QP AQQV KPSWGHTPSSNLGGTWGEDDDG DSSSVWTGG+VSNAGSGAAV VNQ GVNV
Sbjct  61    QPAAQQVPKPSWGHTPSSNLGGTWGEDDDGADSSSVWTGGAVSNAGSGAAVGVNQAGVNV  120

Query  121   GPGGVSTSGP-QWGQGVVGVGLGSTG-NGSSNLTGTAGVVSGASGNSSSTGNGWGDPREI  178
             GPGGV +SG  QWGQGVVGVGLGSTG NGSSN+TG++GV +G+SGNSS+ GNGWGDPREI
Sbjct  121   GPGGVVSSGGPQWGQGVVGVGLGSTGGNGSSNITGSSGVATGSSGNSSNAGNGWGDPREI  180

Query  179   RPLAGGNSMDIRNVDHRGVNNSVANSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  238
             RPL  G SMDIRNV+HRG N S A SSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG
Sbjct  181   RPLGVGGSMDIRNVEHRGGNGSGATSSDPRDIRMIDPRDPIRGDPRGISGRLNGTSEMWG  240

Query  239   HHPQMSHNQMQNINKMVGQTVATVSTNVGGTSGTGIGPGVPGSGSVSGNIPTQWGPAQAV  298
             HHPQMSHNQ+Q INKMVGQ+VAT ST+VG +       G  G  +VSGNIPTQWGPAQ V
Sbjct  241   HHPQMSHNQLQGINKMVGQSVATASTSVGTSGSGIGPGGP-GPSTVSGNIPTQWGPAQPV  299

Query  299   AAGVSGPKDISKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPGATGHWKDMTDSIG  358
             + GVSGPKD+SKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVP A+GHWKDMTDSIG
Sbjct  300   SVGVSGPKDMSKQISGWEEPSPPPQRRSIPNYDDGTSLWGQQTRVPAASGHWKDMTDSIG  359

Query  359   RGGHPMRGQNQSGGIGIAGVGNSNVPVGANPNNPMNSVVGPQARIPSVGGVQHKQDGGTM  418
             R  H MRGQ+Q+GGIGIAGVGNSNVPVGANP+NP++SVVGPQARIPSVGGVQHK DGG M
Sbjct  360   RSSHLMRGQSQTGGIGIAGVGNSNVPVGANPSNPISSVVGPQARIPSVGGVQHKPDGGAM  419

Query  419   WVHSNNVSGRNNVAAVNTWGDDTHNVNVSAPSSANVSTSNWVDDKSNATLAPNSWSDAA-  477
             WVHS NV GRNNVAAV TWGDDTH+VNV APSS +VS++NWVDDKSN+TLA NSWSD A 
Sbjct  420   WVHSGNVGGRNNVAAVTTWGDDTHSVNVGAPSSGSVSSNNWVDDKSNSTLAQNSWSDPAP  479

Query  478   -GVSWGNKQSKLPSTGTSSGWSTAAGVGVADGVDLGSDWNAHGGIIGKSQQQQKLPGLSV  536
              GVSWGNKQSK PS   SSGWSTAA  GV DGVDLGS+WN HGGIIGKSQQQQKL GL+V
Sbjct  480   VGVSWGNKQSKPPSNSASSGWSTAA--GVVDGVDLGSEWNTHGGIIGKSQQQQKLAGLNV  537

Query  537   GMVNVINAEMIKQSKQYRILVENGFKKEDVERALVTANMNIEEAADMLRASSSLAMEGWR  596
             GMVNVINAE+IKQSKQYRILVENGFKKEDVERALV ANMNIEEAADMLRA+SSL+M+GWR
Sbjct  538   GMVNVINAEIIKQSKQYRILVENGFKKEDVERALVIANMNIEEAADMLRANSSLSMDGWR  597

Query  597   RHEESIGSYSDHTSSTSSSGFVGRYPVSSGQPSMAFTHNNLLNNIGGTAVTGGGNNNTSM  656
             RH+ES+GSY+DH SSTSS GF GRYPV+SGQPSM+F HNNL+NN+GGTAVT GGNNNT+M
Sbjct  598   RHDESLGSYADHNSSTSSGGFAGRYPVNSGQPSMSFPHNNLMNNMGGTAVT-GGNNNTNM  656

Query  657   STLQVQKYLNQGQHSVAVGPQTVGNSSAVSVGFGQNTSNAAVASTASVNLAANT-NQPSG  715
             + LQVQKYLNQGQH VAVGPQ VGNSSAVSVGFGQNTSNAAVA  ASVN+AANT NQPSG
Sbjct  657   TALQVQKYLNQGQHGVAVGPQAVGNSSAVSVGFGQNTSNAAVAGAASVNIAANTNNQPSG  716

Query  716   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLARGGNAN  775
             QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSL RGGN N
Sbjct  717   QQIRMLGQQIQLAIHSGFISSQILTQPLTQTTLNLLNQLLSNIKHLQAAQQSLTRGGNVN  776

Query  776   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQPSMQQTSQQQPQQQPQQQQHPSSHLNNS  835
             PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQ +MQ TSQQQ  QQ Q     S HL+NS
Sbjct  777   PMAVNVAISKYKQQIQNLQNQINAQQAVYVKQQNMQPTSQQQQPQQQQLP---SVHLSNS  833

Query  836   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKDMNSDNTEFSR  895
             GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDK++NSD+TEFSR
Sbjct  834   GNDYLRGHDAINNLQSNFSELNINKPSGYQGASNQQSRLNQWKLPVLDKEINSDSTEFSR  893

Query  896   APGTTKQSLTNNSSNISSLGLQNDGTWSTGRNIGDGWPDPQPDNENKDWSVAQPTSAATA  955
             APG TKQ+LT N+SNI+SLGLQND TWSTGR+IGDGWPDP  DNENKDWSVAQPTSAATA
Sbjct  894   APGATKQNLTANTSNINSLGLQNDSTWSTGRSIGDGWPDPSSDNENKDWSVAQPTSAATA  953

Query  956   YTDMVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFASTGKNSPTD  1015
             YTD+VQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFA+TGKNSPTD
Sbjct  954   YTDLVQEFEPGKPWKGSQIKSIEDDPSITPGSVARSPLSINSTPKDADIFANTGKNSPTD  1013

Query  1016  L-PLSLSSSTWSFNPNQNFP--SWSDNSQQCATTSELWTSPLNKSSSRGPPPGLTANSNK  1072
             L PLSLSSSTWSFNPNQN+P  SWSDNSQQC  TSELWTSPLNKSSSRGPPPGLTANSNK
Sbjct  1014  LPPLSLSSSTWSFNPNQNYPSHSWSDNSQQCTATSELWTSPLNKSSSRGPPPGLTANSNK  1073

Query  1073  SGNGGNASTPTPSNVTGGANGWLQTRSGSVQTTNTTWTSGNSSWGSSWLLLKNLTAQIDG  1132
             S N  NASTPT   +TGGANGWLQ RSG VQTTNT WT GN++WGSSWLLLKNLTAQIDG
Sbjct  1074  SAN-SNASTPT--TITGGANGWLQPRSGGVQTTNTNWTGGNTTWGSSWLLLKNLTAQIDG  1130

Query  1133  PTLRTLCMQHGPLVSFHLYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1192
             PTLRTLCMQHGPLVSFH YLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN
Sbjct  1131  PTLRTLCMQHGPLVSFHPYLNQGIALCKYTTREEANKAQMALNNCVLANTTIFAESPSEN  1190

Query  1193  DVQNIMQHLPQIASSASSSGTSAGNGGAVGTPSNNGASSSGASLSGNTSNGNSNGNTSAS  1252
             +VQ+IMQHLPQ  SS SSSGTS GN G VGT +NN  S S A LSGN S   +   + A 
Sbjct  1191  EVQSIMQHLPQTPSSTSSSGTSGGNVGGVGTSANNANSGSAACLSGNNSGNGNGSASGAG  1250

Query  1253  GGGSGNNGNNTGTSSGGGICNQNTTSLTNSNLLGSSGGTASNSSGGAVSSGTGSVGAGTS  1312
              G +GN+  N   + GG   N   T++ NSNL+GSSG  +++S   A SS T SV + T+
Sbjct  1251  SGNNGNSSCNNSAAGGGSSSNNTITTVANSNLVGSSGSVSNSSGVTANSS-TVSVVSCTA  1309

Query  1313  SSNSINGGPGSANTTVSKSSSNNLNITGGQSSASNLTNSTNSTWRQTSQTQALQGQSRSS  1372
             S NSING  G+AN++ SKSS+NNL    GQSSASNLTNSTNSTWRQTSQ QALQ QSR S
Sbjct  1310  SGNSINGA-GTANSSGSKSSANNL--ASGQSSASNLTNSTNSTWRQTSQNQALQSQSRPS  1366

Query  1373  GREADFDYISLVYSIVDD  1390
             GREADFDYISLVYSIVDD
Sbjct  1367  GREADFDYISLVYSIVDD  1384



Lambda      K        H
   0.313    0.128    0.371 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 2768641722


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 1, 2021  8:32 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017062682.1 slo-interacting protein 1 isoform X1 [Drosophila
eugracilis]

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIP1_DROME  unnamed protein product                                  942     0.0  
G5ECZ8_CAEEL  unnamed protein product                                 43.5    8e-04
INAD_DROME  unnamed protein product                                   42.4    0.002


>SLIP1_DROME unnamed protein product
Length=767

 Score = 942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/774 (65%), Positives = 607/774 (78%), Gaps = 39/774 (5%)

Query  5    IVEVEYQYVVLKNMFQVNGFDISNMPRYEAVQKFLQAKETLVVELCRQKHNALGLQEDAY  64
            I +VEY+YVVLK    +NG+DIS++ RYEAVQKFLQ+KETLVVE+ RQKHNAL L+    
Sbjct  3    IADVEYEYVVLK----INGYDISHLSRYEAVQKFLQSKETLVVEIRRQKHNALDLELKHG  58

Query  65   TEQSDANKTVPNVLQLKNSELENATSESVTKISSASQPVKVIPAQPTTNSASEVTGTKSP  124
            +    +    P  L    S L + ++E     +SASQ +      P++ S  E+  TK+P
Sbjct  59   SNAKISKVDNPGEL----SVLTDKSAEGTITAASASQQINC----PSSTSLKEIE-TKTP  109

Query  125  IVLTLRALGHEEGLESCTVLAASKETQTLNSVDSEVLRDSDMVQTIADHFIEQEHHLFEQ  184
            +VLTLRA  HE+ L S  + AASKETQT + V ++VL+D+D+V TI D+FIE EHHLFEQ
Sbjct  110  VVLTLRARSHEDRLGS--LQAASKETQTQSVVGTDVLKDNDLVNTITDNFIEHEHHLFEQ  167

Query  185  CLEPDIDFEEVTLIKAVENSTSDQIGLIVCSSGFQSSNIDANKGDILCTDLEQGEDVFIS  244
            CLEP+ID EEVTL+K VE S+S+QIGLIV SSG Q S+ D NKGDIL   LE  EDVFIS
Sbjct  168  CLEPEIDIEEVTLVKGVEQSSSNQIGLIVTSSGIQQSSTDTNKGDILGNVLEHSEDVFIS  227

Query  245  GIQLHSIAHRDGRLRQGDQILRINGMDVKNQEEVETQIAESTTSVTLLVSRILYPEDEDD  304
            G+Q  SIA+RDGRLRQGDQILRING+DVKNQEE+ETQIA S+TSVTLLVSRILYPED+DD
Sbjct  228  GVQPESIAYRDGRLRQGDQILRINGLDVKNQEELETQIARSSTSVTLLVSRILYPEDDDD  287

Query  305  EDINFDYANSFLPDDYTNVVDKLDRVLLNHVQSMEDLSKEDDERSDK-YHLPSEQHPLES  363
            EDI+F+YAN+FLPDDYTNVVDKLD+VLL HV+S+E+LS +   +SD+ YH+P E++  +S
Sbjct  288  EDIHFEYANTFLPDDYTNVVDKLDKVLLTHVKSLEELSNKSAMQSDECYHIP-EKNSSDS  346

Query  364  NVRTSSLPKKIIDQT----SEIKLHSDACRDHRKSLNRSLTQNQINLRYEYDESEHIYET  419
            NV+ SSL K II+Q+    S+IKL  +A  D++K  N  L+Q +++L+YEYDESEHIYET
Sbjct  347  NVKISSLAKNIIEQSTKSCSKIKLRPNANLDYKKKFNLPLSQEEVHLQYEYDESEHIYET  406

Query  420  IPEDFESEPLYCSPYQSSNGKTSMGSCSTEIA-----STETTMQQQTHRVAQWLGLKPQY  474
            IPED ESEP+YCSPYQ SN KTS+G CS+ IA     S E TMQQQT RVAQWLGLKPQY
Sbjct  407  IPEDSESEPVYCSPYQRSNDKTSIG-CSSPIASRPAESLERTMQQQTQRVAQWLGLKPQY  465

Query  475  PK---TLVGR-PPLKLTQQPTCSRVFTLRSTLTNTSGSSSSGVAYSADGPNNIVSGN-MA  529
             K   TLVGR PPLKL QQPTCSRVFTLRSTLTNTS SSSSGVAYS+ G NN+V+GN  A
Sbjct  466  QKTRQTLVGRPPPLKLVQQPTCSRVFTLRSTLTNTSASSSSGVAYSSYGQNNVVTGNAAA  525

Query  530  PGEELDNSSSAYNTGGSNNSASPHQNTKNVNDIITVSHKLENTEIDGPKGALDSTAINSM  589
            PGEE+DNSSSAYNTG SNNSASPHQNT N ++ I    KL++T ID P   LD+T +++M
Sbjct  526  PGEEVDNSSSAYNTGDSNNSASPHQNTTNPDEAIATGRKLDSTVIDSPNDHLDATGVSTM  585

Query  590  LLIPFGKSGRIGLCSSNLPTAYVSERQRKVAYENENHQPKNHLKLLTVKPTE--AGNCPE  647
            LL+PFGKSGRIGLCSSNLPTAYVSER   V  ENE H  K+ +++L VKPT+    +CP+
Sbjct  586  LLLPFGKSGRIGLCSSNLPTAYVSERYTNVGSENEIHPLKSDIEILRVKPTDDSYSHCPQ  645

Query  648  FNAPNLSSYQFVSSQEVTNRCQSFTSQKQNT-----ENSDEIPMVWKVKRRPDGTRYIVK  702
            FNAPNLSSY FVSSQEV NRC   TS ++N      E+++EIPMVWKVKRRPDGTRYIVK
Sbjct  646  FNAPNLSSYHFVSSQEVANRCHISTSLQKNATLLNGESAEEIPMVWKVKRRPDGTRYIVK  705

Query  703  RPVRNRTEVGFRRSMRFNELTTTEEDTVSEVKIGRYWTKEERKRHIERARERRH  756
            RPVRNR +V  R++MR+NE+TTTE+DT+SEVKIGRYWTKEERKRHIERARE+RH
Sbjct  706  RPVRNRPQVALRKNMRYNEVTTTEDDTISEVKIGRYWTKEERKRHIERAREKRH  759


>G5ECZ8_CAEEL unnamed protein product
Length=2491

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 2/57 (4%)

Query  241   VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKN--QEEVETQIAESTTSVTLLVSR  295
             V++S I    +A  DGRL  GDQIL +NG DV+   QE+V   +   T  V L + R
Sbjct  2184  VYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR  2240


 Score = 35.4 bits (80),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 26/52 (50%), Gaps = 5/52 (10%)

Query  228   GDILCTDLEQGEDVFISGIQLHSI-----AHRDGRLRQGDQILRINGMDVKN  274
             G  L   +  G D  +  + +H +     A  DGRL+ GDQ+L +NG  ++ 
Sbjct  2067  GKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRG  2118


 Score = 32.7 bits (73),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 99/226 (44%), Gaps = 29/226 (13%)

Query  65    TEQSDANKTVPNVLQLKNSELENATSESVTKIS---SASQPVKVIPAQP-------TTNS  114
             TE+     T P+  + K+SE+  + S S  K++   +A + ++V+  Q        T  +
Sbjct  1404  TEEEVLQATPPSSPENKSSEVPPSISPSGIKLAGEVTAPEEIEVVKEQAENVDRAETAAT  1463

Query  115   ASEVTGTKSPIVLTLRALGHEEGLESCTVLAASK----ETQTLNS--VDSEVLRDSDMVQ  168
              +EV  T +P   T  A+G+ +  ES T   + +    +TQ LNS  V+S + R +    
Sbjct  1464  GAEVEATSTP---TAEAIGNSKDDESTTTSISQQSVGLQTQALNSTEVNSNMSRVTSRTP  1520

Query  169   TIADHFIEQEHHLFEQCLEPDIDFEEVTLIKAVENSTSDQIGLIVCSSGFQSSNIDANKG  228
             +     ++ +     Q +      E  T+    E + S  I ++               G
Sbjct  1521  STGSESLQNQAR---QLVRSKYWGEARTVTLVREPNKSFGISIVGGRVEVSQKGGLPGTG  1577

Query  229   DILCTDLEQGEDVFISGIQLHSIAHRDGRLRQGDQILRINGMDVKN  274
             + +C        +FI  +  +S A R G++  GD+++ +N +D+++
Sbjct  1578  NTVC-------GIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRD  1616


 Score = 30.4 bits (67),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query  241  VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKNQ--EEVETQIAESTTSVTLLVSR-IL  297
            V +  I   S A +DGRL+ GD IL+I  ++      ++V T +     +V ++V R I 
Sbjct  341  VVVKTILPGSPADKDGRLQPGDHILQIGNINSHGMSSQQVATILRHQHPTVDMIVGRPIA  400

Query  298  YPEDEDDEDINFDYA  312
            Y +   D    F  A
Sbjct  401  YADKPIDTPECFTLA  415


>INAD_DROME unnamed protein product
Length=674

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  241  VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKNQEE  277
            +FI GI   S AH  GRL+ GD+IL +NG DV+N  E
Sbjct  48   IFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTE  84



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062683.1 slo-interacting protein 1 isoform X2 [Drosophila
eugracilis]

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIP1_DROME  unnamed protein product                                  948     0.0  
G5ECZ8_CAEEL  unnamed protein product                                 43.5    8e-04
Q8IMT8_DROME  unnamed protein product                                 41.2    0.002


>SLIP1_DROME unnamed protein product
Length=767

 Score = 948 bits (2451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/770 (65%), Positives = 607/770 (79%), Gaps = 35/770 (5%)

Query  5    IVEVEYQYVVLKVNGFDISNMPRYEAVQKFLQAKETLVVELCRQKHNALGLQEDAYTEQS  64
            I +VEY+YVVLK+NG+DIS++ RYEAVQKFLQ+KETLVVE+ RQKHNAL L+    +   
Sbjct  3    IADVEYEYVVLKINGYDISHLSRYEAVQKFLQSKETLVVEIRRQKHNALDLELKHGSNAK  62

Query  65   DANKTVPNVLQLKNSELENATSESVTKISSASQPVKVIPAQPTTNSASEVTGTKSPIVLT  124
             +    P  L    S L + ++E     +SASQ +      P++ S  E+  TK+P+VLT
Sbjct  63   ISKVDNPGEL----SVLTDKSAEGTITAASASQQINC----PSSTSLKEIE-TKTPVVLT  113

Query  125  LRALGHEEGLESCTVLAASKETQTLNSVDSEVLRDSDMVQTIADHFIEQEHHLFEQCLEP  184
            LRA  HE+ L S  + AASKETQT + V ++VL+D+D+V TI D+FIE EHHLFEQCLEP
Sbjct  114  LRARSHEDRLGS--LQAASKETQTQSVVGTDVLKDNDLVNTITDNFIEHEHHLFEQCLEP  171

Query  185  DIDFEEVTLIKAVENSTSDQIGLIVCSSGFQSSNIDANKGDILCTDLEQGEDVFISGIQL  244
            +ID EEVTL+K VE S+S+QIGLIV SSG Q S+ D NKGDIL   LE  EDVFISG+Q 
Sbjct  172  EIDIEEVTLVKGVEQSSSNQIGLIVTSSGIQQSSTDTNKGDILGNVLEHSEDVFISGVQP  231

Query  245  HSIAHRDGRLRQGDQILRINGMDVKNQEEVETQIAESTTSVTLLVSRILYPEDEDDEDIN  304
             SIA+RDGRLRQGDQILRING+DVKNQEE+ETQIA S+TSVTLLVSRILYPED+DDEDI+
Sbjct  232  ESIAYRDGRLRQGDQILRINGLDVKNQEELETQIARSSTSVTLLVSRILYPEDDDDEDIH  291

Query  305  FDYANSFLPDDYTNVVDKLDRVLLNHVQSMEDLSKEDDERSDK-YHLPSEQHPLESNVRT  363
            F+YAN+FLPDDYTNVVDKLD+VLL HV+S+E+LS +   +SD+ YH+P E++  +SNV+ 
Sbjct  292  FEYANTFLPDDYTNVVDKLDKVLLTHVKSLEELSNKSAMQSDECYHIP-EKNSSDSNVKI  350

Query  364  SSLPKKIIDQT----SEIKLHSDACRDHRKSLNRSLTQNQINLRYEYDESEHIYETIPED  419
            SSL K II+Q+    S+IKL  +A  D++K  N  L+Q +++L+YEYDESEHIYETIPED
Sbjct  351  SSLAKNIIEQSTKSCSKIKLRPNANLDYKKKFNLPLSQEEVHLQYEYDESEHIYETIPED  410

Query  420  FESEPLYCSPYQSSNGKTSMGSCSTEIA-----STETTMQQQTHRVAQWLGLKPQYPK--  472
             ESEP+YCSPYQ SN KTS+G CS+ IA     S E TMQQQT RVAQWLGLKPQY K  
Sbjct  411  SESEPVYCSPYQRSNDKTSIG-CSSPIASRPAESLERTMQQQTQRVAQWLGLKPQYQKTR  469

Query  473  -TLVGR-PPLKLTQQPTCSRVFTLRSTLTNTSGSSSSGVAYSADGPNNIVSGN-MAPGEE  529
             TLVGR PPLKL QQPTCSRVFTLRSTLTNTS SSSSGVAYS+ G NN+V+GN  APGEE
Sbjct  470  QTLVGRPPPLKLVQQPTCSRVFTLRSTLTNTSASSSSGVAYSSYGQNNVVTGNAAAPGEE  529

Query  530  LDNSSSAYNTGGSNNSASPHQNTKNVNDIITVSHKLENTEIDGPKGALDSTAINSMLLIP  589
            +DNSSSAYNTG SNNSASPHQNT N ++ I    KL++T ID P   LD+T +++MLL+P
Sbjct  530  VDNSSSAYNTGDSNNSASPHQNTTNPDEAIATGRKLDSTVIDSPNDHLDATGVSTMLLLP  589

Query  590  FGKSGRIGLCSSNLPTAYVSERQRKVAYENENHQPKNHLKLLTVKPTE--AGNCPEFNAP  647
            FGKSGRIGLCSSNLPTAYVSER   V  ENE H  K+ +++L VKPT+    +CP+FNAP
Sbjct  590  FGKSGRIGLCSSNLPTAYVSERYTNVGSENEIHPLKSDIEILRVKPTDDSYSHCPQFNAP  649

Query  648  NLSSYQFVSSQEVTNRCQSFTSQKQNT-----ENSDEIPMVWKVKRRPDGTRYIVKRPVR  702
            NLSSY FVSSQEV NRC   TS ++N      E+++EIPMVWKVKRRPDGTRYIVKRPVR
Sbjct  650  NLSSYHFVSSQEVANRCHISTSLQKNATLLNGESAEEIPMVWKVKRRPDGTRYIVKRPVR  709

Query  703  NRTEVGFRRSMRFNELTTTEEDTVSEVKIGRYWTKEERKRHIERARERRH  752
            NR +V  R++MR+NE+TTTE+DT+SEVKIGRYWTKEERKRHIERARE+RH
Sbjct  710  NRPQVALRKNMRYNEVTTTEDDTISEVKIGRYWTKEERKRHIERAREKRH  759


>G5ECZ8_CAEEL unnamed protein product
Length=2491

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 2/57 (4%)

Query  237   VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKN--QEEVETQIAESTTSVTLLVSR  291
             V++S I    +A  DGRL  GDQIL +NG DV+   QE+V   +   T  V L + R
Sbjct  2184  VYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR  2240


 Score = 35.4 bits (80),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 26/52 (50%), Gaps = 5/52 (10%)

Query  224   GDILCTDLEQGEDVFISGIQLHSI-----AHRDGRLRQGDQILRINGMDVKN  270
             G  L   +  G D  +  + +H +     A  DGRL+ GDQ+L +NG  ++ 
Sbjct  2067  GKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRG  2118


 Score = 32.7 bits (73),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 99/226 (44%), Gaps = 29/226 (13%)

Query  61    TEQSDANKTVPNVLQLKNSELENATSESVTKIS---SASQPVKVIPAQP-------TTNS  110
             TE+     T P+  + K+SE+  + S S  K++   +A + ++V+  Q        T  +
Sbjct  1404  TEEEVLQATPPSSPENKSSEVPPSISPSGIKLAGEVTAPEEIEVVKEQAENVDRAETAAT  1463

Query  111   ASEVTGTKSPIVLTLRALGHEEGLESCTVLAASK----ETQTLNS--VDSEVLRDSDMVQ  164
              +EV  T +P   T  A+G+ +  ES T   + +    +TQ LNS  V+S + R +    
Sbjct  1464  GAEVEATSTP---TAEAIGNSKDDESTTTSISQQSVGLQTQALNSTEVNSNMSRVTSRTP  1520

Query  165   TIADHFIEQEHHLFEQCLEPDIDFEEVTLIKAVENSTSDQIGLIVCSSGFQSSNIDANKG  224
             +     ++ +     Q +      E  T+    E + S  I ++               G
Sbjct  1521  STGSESLQNQAR---QLVRSKYWGEARTVTLVREPNKSFGISIVGGRVEVSQKGGLPGTG  1577

Query  225   DILCTDLEQGEDVFISGIQLHSIAHRDGRLRQGDQILRINGMDVKN  270
             + +C        +FI  +  +S A R G++  GD+++ +N +D+++
Sbjct  1578  NTVC-------GIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRD  1616


 Score = 30.4 bits (67),  Expect = 7.4, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query  237  VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKNQ--EEVETQIAESTTSVTLLVSR-IL  293
            V +  I   S A +DGRL+ GD IL+I  ++      ++V T +     +V ++V R I 
Sbjct  341  VVVKTILPGSPADKDGRLQPGDHILQIGNINSHGMSSQQVATILRHQHPTVDMIVGRPIA  400

Query  294  YPEDEDDEDINFDYA  308
            Y +   D    F  A
Sbjct  401  YADKPIDTPECFTLA  415


>Q8IMT8_DROME unnamed protein product
Length=246

 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 50/99 (51%), Gaps = 13/99 (13%)

Query  210  CSSGFQSSNIDANKGDILCTDLEQGEDVFISGIQLHSIAHRDGRLRQGDQILRINGMDV-  268
            C SG    N+   K        EQ   ++IS I    +A R G L++GDQ+L +NG+ V 
Sbjct  150  CFSGL-GFNVMGGK--------EQNSPIYISRIIPGGVADRHGGLKRGDQLLSVNGVSVE  200

Query  269  -KNQEEVETQIAESTTSVTLLVSRILYPEDEDDEDINFD  306
             +N E+    + ++  SV L+V     P+  ++ ++ FD
Sbjct  201  GENHEKAVELLKQAVGSVKLVVRYT--PKVLEEMEMRFD  237



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062684.1 slo-interacting protein 1 isoform X3 [Drosophila
eugracilis]

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIP1_DROME  unnamed protein product                                  928     0.0  
G5ECZ8_CAEEL  unnamed protein product                                 43.5    8e-04
INAD_DROME  unnamed protein product                                   42.4    0.002


>SLIP1_DROME unnamed protein product
Length=767

 Score = 928 bits (2399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/774 (64%), Positives = 603/774 (78%), Gaps = 44/774 (6%)

Query  5    IVEVEYQYVVLKNMFQVNGFDISNMPRYEAVQKFLQAKETLVVELCRQKHNALGLQEDAY  64
            I +VEY+YVVLK    +NG+DIS++ RYEAVQKFLQ+KETLVVE+ RQKHNAL L+    
Sbjct  3    IADVEYEYVVLK----INGYDISHLSRYEAVQKFLQSKETLVVEIRRQKHNALDLELKHG  58

Query  65   TEQSDANKTVPNVLQLKNSELENATSESVTKISSASQPVKVIPAQPTTNSASEVTGTKSP  124
            +    +    P  L    S L + ++E     +SASQ +      P++ S  E+  TK+P
Sbjct  59   SNAKISKVDNPGEL----SVLTDKSAEGTITAASASQQINC----PSSTSLKEIE-TKTP  109

Query  125  IVLTLRALGHEEGLESCTVLAASKETQTLNSVDSEVLRDSDMVQTIADHFIEQEHHLFEQ  184
            +VLTLRA  HE+ L S  + AASKETQT + V ++VL+D+D+V TI D+FIE EHHLFEQ
Sbjct  110  VVLTLRARSHEDRLGS--LQAASKETQTQSVVGTDVLKDNDLVNTITDNFIEHEHHLFEQ  167

Query  185  CLEPDIDFEEVTLIKAVENSTSDQIGLIVCSSGFQSSNIDANKGDILCTDLEQGEDVFIS  244
            CLEP+ID EEVTL+K VE S+S+QIGLIV SSG Q S+ D NKGDIL   LE  EDVFIS
Sbjct  168  CLEPEIDIEEVTLVKGVEQSSSNQIGLIVTSSGIQQSSTDTNKGDILGNVLEHSEDVFIS  227

Query  245  GIQLHSIAHRDGRLRQGDQILRINGMDVKNQEEVETQIAESTTSVTLLVSRILYPEDEDD  304
            G+Q  SIA+RDGRLRQGDQILRING+DVKNQEE+ETQIA S+TSVTLLVSRILYPED+DD
Sbjct  228  GVQPESIAYRDGRLRQGDQILRINGLDVKNQEELETQIARSSTSVTLLVSRILYPEDDDD  287

Query  305  EDINFDYANSFLPDDYTNVVDKLDRVLLNHVQSMEDLSKEDDERSDK-YHLPSEQHPLES  363
            EDI+F+YAN+FLPDDYTNVVDKLD+VLL HV+S+E+LS +   +SD+ YH+P E++  +S
Sbjct  288  EDIHFEYANTFLPDDYTNVVDKLDKVLLTHVKSLEELSNKSAMQSDECYHIP-EKNSSDS  346

Query  364  NVRTSSLPKKIIDQT----SEIKLHSDACRDHRKSLNRSLTQNQINLRYEYDESEHIYET  419
            NV+ SSL K II+Q+    S+IKL  +A  D++K  N  L+Q +++L+YEYDESEHIYET
Sbjct  347  NVKISSLAKNIIEQSTKSCSKIKLRPNANLDYKKKFNLPLSQEEVHLQYEYDESEHIYET  406

Query  420  IPEDFESEPLYCSPYQSSNGKTSMGSCSTEIA-----STETTMQQQTHRVAQWLGLKPQY  474
            IPED ESEP+YCSPYQ SN KTS+G CS+ IA     S E TMQQQT RVAQWLGLKPQY
Sbjct  407  IPEDSESEPVYCSPYQRSNDKTSIG-CSSPIASRPAESLERTMQQQTQRVAQWLGLKPQY  465

Query  475  PK---TLVGR-PPLKLTQQPTCSRVFTLRSTLTNTSGSSSSGVAYSADGPNNIVSGN-MA  529
             K   TLVGR PPLKL QQPTCSRVFTLRSTLTNTS SSSSGVAYS+ G NN+V+GN  A
Sbjct  466  QKTRQTLVGRPPPLKLVQQPTCSRVFTLRSTLTNTSASSSSGVAYSSYGQNNVVTGNAAA  525

Query  530  PGEELDNSSSAYNTGGSNNSASPHQNTKNVNDIITVSHKLENTEIDGPKGALDSTAINSM  589
            PGEE+DNSSSAYNTG SNNSASPHQNT N ++ I    KL++T ID P   LD+T +++M
Sbjct  526  PGEEVDNSSSAYNTGDSNNSASPHQNTTNPDEAIATGRKLDSTVIDSPNDHLDATGVSTM  585

Query  590  LLIPFGKSGRIGLCSSNLPTAYVSERQRKVAYENENHQPKNHLKLLTVKPTE--AGNCPE  647
            LL+PFGKSGRIGLCSSNLPTAYVSER   V  ENE H  K+ +++L VKPT+    +CP+
Sbjct  586  LLLPFGKSGRIGLCSSNLPTAYVSERYTNVGSENEIHPLKSDIEILRVKPTDDSYSHCPQ  645

Query  648  FNAPNLSSYQFVT-----NRCQSFTSQKQNT-----ENSDEIPMVWKVKRRPDGTRYIVK  697
            FNAPNLSSY FV+     NRC   TS ++N      E+++EIPMVWKVKRRPDGTRYIVK
Sbjct  646  FNAPNLSSYHFVSSQEVANRCHISTSLQKNATLLNGESAEEIPMVWKVKRRPDGTRYIVK  705

Query  698  RPVRNRTEVGFRRSMRFNELTTTEEDTVSEVKIGRYWTKEERKRHIERARERRH  751
            RPVRNR +V  R++MR+NE+TTTE+DT+SEVKIGRYWTKEERKRHIERARE+RH
Sbjct  706  RPVRNRPQVALRKNMRYNEVTTTEDDTISEVKIGRYWTKEERKRHIERAREKRH  759


>G5ECZ8_CAEEL unnamed protein product
Length=2491

 Score = 43.5 bits (101),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 32/57 (56%), Gaps = 2/57 (4%)

Query  241   VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKN--QEEVETQIAESTTSVTLLVSR  295
             V++S I    +A  DGRL  GDQIL +NG DV+   QE+V   +   T  V L + R
Sbjct  2184  VYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR  2240


 Score = 35.4 bits (80),  Expect = 0.24, Method: Compositional matrix adjust.
 Identities = 16/52 (31%), Positives = 26/52 (50%), Gaps = 5/52 (10%)

Query  228   GDILCTDLEQGEDVFISGIQLHSI-----AHRDGRLRQGDQILRINGMDVKN  274
             G  L   +  G D  +  + +H +     A  DGRL+ GDQ+L +NG  ++ 
Sbjct  2067  GKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRG  2118


 Score = 33.1 bits (74),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 99/226 (44%), Gaps = 29/226 (13%)

Query  65    TEQSDANKTVPNVLQLKNSELENATSESVTKIS---SASQPVKVIPAQP-------TTNS  114
             TE+     T P+  + K+SE+  + S S  K++   +A + ++V+  Q        T  +
Sbjct  1404  TEEEVLQATPPSSPENKSSEVPPSISPSGIKLAGEVTAPEEIEVVKEQAENVDRAETAAT  1463

Query  115   ASEVTGTKSPIVLTLRALGHEEGLESCTVLAASK----ETQTLNS--VDSEVLRDSDMVQ  168
              +EV  T +P   T  A+G+ +  ES T   + +    +TQ LNS  V+S + R +    
Sbjct  1464  GAEVEATSTP---TAEAIGNSKDDESTTTSISQQSVGLQTQALNSTEVNSNMSRVTSRTP  1520

Query  169   TIADHFIEQEHHLFEQCLEPDIDFEEVTLIKAVENSTSDQIGLIVCSSGFQSSNIDANKG  228
             +     ++ +     Q +      E  T+    E + S  I ++               G
Sbjct  1521  STGSESLQNQAR---QLVRSKYWGEARTVTLVREPNKSFGISIVGGRVEVSQKGGLPGTG  1577

Query  229   DILCTDLEQGEDVFISGIQLHSIAHRDGRLRQGDQILRINGMDVKN  274
             + +C        +FI  +  +S A R G++  GD+++ +N +D+++
Sbjct  1578  NTVC-------GIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRD  1616


 Score = 30.4 bits (67),  Expect = 7.7, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 36/75 (48%), Gaps = 3/75 (4%)

Query  241  VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKNQ--EEVETQIAESTTSVTLLVSR-IL  297
            V +  I   S A +DGRL+ GD IL+I  ++      ++V T +     +V ++V R I 
Sbjct  341  VVVKTILPGSPADKDGRLQPGDHILQIGNINSHGMSSQQVATILRHQHPTVDMIVGRPIA  400

Query  298  YPEDEDDEDINFDYA  312
            Y +   D    F  A
Sbjct  401  YADKPIDTPECFTLA  415


>INAD_DROME unnamed protein product
Length=674

 Score = 42.4 bits (98),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (68%), Gaps = 0/37 (0%)

Query  241  VFISGIQLHSIAHRDGRLRQGDQILRINGMDVKNQEE  277
            +FI GI   S AH  GRL+ GD+IL +NG DV+N  E
Sbjct  48   IFIKGIVPDSPAHLCGRLKVGDRILSLNGKDVRNSTE  84



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062686.2 apolipophorins [Drosophila eugracilis]

Length=3344
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

APLP_DROME  unnamed protein product                                   5202    0.0  
VIT_PENME  unnamed protein product                                    210     1e-53
Q7KTG2_DROME  unnamed protein product                                 167     1e-40


>APLP_DROME unnamed protein product
Length=3351

 Score = 5202 bits (13495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2511/3355 (75%), Positives = 2895/3355 (86%), Gaps = 15/3355 (0%)

Query  1     MTRKKYSLPLVGVLIYVFFYVAVNAENACNLGCPKSDNGLLKYTPGNSYDYSFDSILTIG  60
             M R KY++ L+G+L  V   +AVNAENACNLGCPKSDNGLLKY PGN YDYSFDSILTIG
Sbjct  1     MARMKYNIALIGILASVLLTIAVNAENACNLGCPKSDNGLLKYIPGNYYDYSFDSILTIG  60

Query  61    LSSNVLSESADTSLKVSGSAKIFSKGNCGYTLQLSSVKVSNTKESVEKKILSSIQKPVQF  120
              SS+V ++S DTSLKVSGSAKIF+KGNCGYTLQLSSVKV+NTKESVEKKIL+SIQKPVQF
Sbjct  61    ASSDVPNDSDDTSLKVSGSAKIFAKGNCGYTLQLSSVKVTNTKESVEKKILNSIQKPVQF  120

Query  121   TLVNGLLEPQICSDSGDLEYSLNIKRAVISLLQSGLNTEHEIDVFGQCPTHTSTSNVGNA  180
             TLV+G+LEPQICSDS DL+YSLNIKRAV+SLLQSG+  EHE+DVFG CPTHTSTS VGNA
Sbjct  121   TLVSGILEPQICSDSSDLDYSLNIKRAVVSLLQSGIEAEHEVDVFGMCPTHTSTSKVGNA  180

Query  181   NIITKVRNLNSCVHREQIINGLVSGKVNEKAGITSSLLLQATYIKESKIVNGLIDNVHLT  240
             NIITK RNLNSC HREQI +GLVSGKVNEKAGITSSLLLQA YIKES+IVN LI+NV LT
Sbjct  181   NIITKARNLNSCSHREQINSGLVSGKVNEKAGITSSLLLQANYIKESRIVNHLIENVQLT  240

Query  241   ETYKFIGTTKESSDINGKVVTTLKLKNPSGTKSNSPLTGSIVKSVIFQRPETYTAKNINA  300
             ETYKFIG TK +SDI+ KVVT LKLKNPSGTK+NSP TGS V+S+IFQRPETYT+KNINA
Sbjct  241   ETYKFIGNTKRNSDISAKVVTILKLKNPSGTKANSPGTGSTVRSLIFQRPETYTSKNINA  300

Query  301   LKTVLSDLVDSTGDYVKKESAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARKVYLDG  360
             LKT+LSDLVDSTGDYVKKE+AKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARKVYLDG
Sbjct  301   LKTILSDLVDSTGDYVKKETAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARKVYLDG  360

Query  361   LFRTGTAESARVILKQLAKFNEKEKLLAILALNLVKSVDKETLNQAAAQLLPNVPKELYL  420
             LFRT TAESARVILKQL+KF+EKEKLLAIL+LN+VKSVDKETLNQAA+QLLPN PKELY+
Sbjct  361   LFRTSTAESARVILKQLSKFDEKEKLLAILSLNIVKSVDKETLNQAASQLLPNAPKELYI  420

Query  421   SVGSLVAKFCTGRNCQGPEIEAISKKFSDGLKHCKPNTKKEEERIIYILKGIGNAKSLAG  480
             +VG+LVAK+C    CQGPEI+AISKKFSDGLKHCKPNTK+EEERI+YILKG+GNAKSL+G
Sbjct  421   AVGNLVAKYCLKNYCQGPEIDAISKKFSDGLKHCKPNTKREEERIVYILKGLGNAKSLSG  480

Query  481   NTAAALSECSSTGRSNRIRVAALQAFLTVGCDKTLQTKSLELLKDRNEDSELRIEAYLSL  540
             NT AALSEC+STGRSNRIRVAAL AF  V C++TLQ+KSLELLK+RNEDSELRIEAYLS 
Sbjct  481   NTVAALSECASTGRSNRIRVAALHAFSKVKCEETLQSKSLELLKNRNEDSELRIEAYLSA  540

Query  541   ISCPDADVANQISEIVNSETVNQVGGFISSNLKAIRDSTDASREQQRYHLSNIRVTKKFP  600
             ISCP+A+VANQISEIVNSETVNQVGGFISSNLKAIRDSTD SR+QQ+YHL+NIRVTK FP
Sbjct  541   ISCPNAEVANQISEIVNSETVNQVGGFISSNLKAIRDSTDVSRDQQKYHLANIRVTKTFP  600

Query  601   ADYRRYSFNNEVSYNLESLGVGASSDYQLIYSQHGFLPRSSRVNITTEIFGTSFNVLEAS  660
              DYRRYSFNNEVSY LESLGVGAS+DYQ+IYSQHGFLPRSSR+N+TTE FGT++NV EAS
Sbjct  601   VDYRRYSFNNEVSYKLESLGVGASTDYQIIYSQHGFLPRSSRINVTTEFFGTNYNVFEAS  660

Query  661   VRQENFEGVLEYYLGPKGLLNKDFDEIVKTIEVGNNATAGVGGRARRSIADDVAKTSKRY  720
             VRQEN E VLEYYLGPKGL+NKDFDEIVK IEVGNN  A  GGRARRSI DDV+K SK+Y
Sbjct  661   VRQENVEDVLEYYLGPKGLVNKDFDEIVKLIEVGNNGVAA-GGRARRSIVDDVSKISKKY  719

Query  721   KTYGSKNVQDLNLDISLKLFGSELAFLSLGDSIPSNLEDIINEFSNSIEKAKQGLNSFEK  780
             K YG KNVQDLNLD+SLKLFGSELAFLSLGD+IPS+L+DIIN FS S EKAKQ L+SFEK
Sbjct  720   KMYGVKNVQDLNLDVSLKLFGSELAFLSLGDNIPSSLDDIINYFSTSFEKAKQELSSFEK  779

Query  781   QISSHNLVLDTDLAYPTSIGIPLELVAQSFAATKTDLAVNLDINSILEQNWQKTKYRLKV  840
             Q SSH+L LDTDLAYPTSIG+PLELVAQ FAATK DLAV+LDIN+ILEQNWQK KYRLK 
Sbjct  780   QFSSHHLFLDTDLAYPTSIGVPLELVAQGFAATKVDLAVSLDINAILEQNWQKAKYRLKF  839

Query  841   VPSIDLSVNLQVGFNAQVLSTGFRVVSTAHSATGNDITVAAISDGEGFTVDVELPREKLE  900
             VPS+D++ N+Q+GFNAQVLSTG RVVS+AHSATG+DITVA ISDGEGF VD+ELPREKLE
Sbjct  840   VPSVDINANVQIGFNAQVLSTGLRVVSSAHSATGSDITVAVISDGEGFNVDLELPREKLE  899

Query  901   LIDIKIDTELYVSEQDKQISASFKGNKKVKNSQPSEICFNQLEVVGLNICIESSTSLSEL  960
             LI+  +DTELYV+EQDKQ + + KGNKK KNSQPSEICFNQLE+VGLNICI+SSTSLSE+
Sbjct  900   LINFNVDTELYVAEQDKQKAIALKGNKKNKNSQPSEICFNQLELVGLNICIKSSTSLSEV  959

Query  961   QAGNSNDAERGLAVSNQFHLSKPFSFAISLTAERKLTFKGIHSIEPSSQKWKLYYSTPGS  1020
             QAGN N AERGL+VS +FHLS+PF+FA+ LT ERK TFKGIH+ E  SQKWKL YSTPGS
Sbjct  960   QAGNGNVAERGLSVSEKFHLSRPFNFAVYLTTERKFTFKGIHTQEAFSQKWKLDYSTPGS  1019

Query  1021  KVSHDTSVVFEVGNKPRIFGKLSFDNSQYHLGVEAGLKNDNTELVIYGQFEQDKEVKTSK  1080
             KVSHDT+VV+E+GNKP+ F +LSFDNSQ H  VE G+ ND  ELV+YGQ+EQDKE+K SK
Sbjct  1020  KVSHDTTVVYELGNKPKTFSRLSFDNSQCHFAVEGGINNDKNELVVYGQYEQDKEIKKSK  1079

Query  1081  IGLKKQGNEYKPLIEIQDNNGISNSINGYRAEGKIVVKEINDKQTRYNFENFQVSNANNV  1140
             IG  K GNEYKPLIEIQDNNGISNSINGY A+GKIVVK+ ++   RYNFENFQVSN+NN 
Sbjct  1080  IGFSKNGNEYKPLIEIQDNNGISNSINGYHADGKIVVKKNSNNIERYNFENFQVSNSNNA  1139

Query  1141  RIIVNGWTDIGQQFLNSELQIASDQQSFLVKGNIELESGQYAAGFFINNERTPENIYGSS  1200
              + VNGW+D+G   L SEL+I+ D Q+FL+K N++LE+G Y AGFFIN+E +PENIYGSS
Sbjct  1140  HVAVNGWSDVGTNSLTSELRISLDHQTFLIKENLKLENGLYEAGFFINDEHSPENIYGSS  1199

Query  1201  VHLTIADHSYALKINGKAYTWSIENDASFDFEGDNDSSSIRAGSFGENLQVYNKNKRVGA  1260
             +HLTIAD SYALK NGKA  WSI +D SF+F+   DS+S RAGS  EN+++  KNK+VG 
Sbjct  1200  IHLTIADQSYALKTNGKAAAWSIGSDGSFNFQKLADSNSARAGSLVENVEIQYKNKQVGG  1259

Query  1261  LKIKSSFNVNKLDFDVEISRDQKIGSLNLKYKGNQRHTQDYSLEASAKLNKHSIDVLSKS  1320
             +KI S+F+VNK+D DVEISR+QKIGS+ +KY+ NQRH QDYSLEASAK+NKHSIDV+SK 
Sbjct  1260  IKIMSNFDVNKMDVDVEISREQKIGSIIVKYESNQRHAQDYSLEASAKINKHSIDVISKC  1319

Query  1321  DFNGNAYLVDNAISTSWGTLLSAKGEIGQRYTTQDIKIDLQGNVQINSKDKSTQWLLKVI  1380
             DFNGN Y+VDN++ TSWGTLLSAKGEIGQRY+ QDI I++QGNVQI+ KDK TQW+LKVI
Sbjct  1320  DFNGNVYVVDNSLVTSWGTLLSAKGEIGQRYSAQDININIQGNVQISGKDKVTQWILKVI  1379

Query  1381  GSPDKTISELRISQDTTELVKLTSESQHPQDKISAAKLNLIVKNQLTAKGEFRVAKNGKG  1440
             G+PDKT S+ RIS+DT+EL+KLTSESQHPQDKIS AKLNLIVKNQLTAKGEFRVAKNGKG
Sbjct  1380  GTPDKTNSDFRISRDTSELIKLTSESQHPQDKISFAKLNLIVKNQLTAKGEFRVAKNGKG  1439

Query  1441  DLIATIETLKTNPKHKLDVESKFQILAPKYDIDTTLALDGEKKLHFRSENTIDKLKFSTK  1500
             D  A+I+TLKT PKHKL++ESKF I +PKYDID +L LDG++K+H +SENTI+KLKFSTK
Sbjct  1440  DFTASIDTLKTEPKHKLEIESKFHIQSPKYDIDASLTLDGKRKVHLKSENTIEKLKFSTK  1499

Query  1501  NIGESNEKKIMFEANGSVKGDLRANGELLGTFTLTTPDGRVIDGSANRKFSTNAKTGIAQ  1560
             NIGE+N+K I FEANGS+KG+LR NGE+ GTF    PDGRVIDGS NRK STNAK+G++Q
Sbjct  1500  NIGEANDKIIAFEANGSLKGELRGNGEIQGTFIFNAPDGRVIDGSINRKISTNAKSGLSQ  1559

Query  1561  GTLDAQLSDTLSDSKKKRSITLKGKLDRLNQKTKDFSANSNLVYTAFNGEKSELSFQTKQ  1620
             G +DAQLSDT   S KKRSI+L GKLDRLN KTK+FSANSNLVYTAFNGEKSE+S+Q KQ
Sbjct  1560  GNIDAQLSDTPFGSNKKRSISLIGKLDRLNTKTKEFSANSNLVYTAFNGEKSEISYQIKQ  1619

Query  1621  EPNGEAKNLNINLKVNGNPLPQPIEVAVVVGEYTQQKAVASITGRYGDLFSVIANGNYNN  1680
             +PNG+AKN++ +LK  GNPLPQP E+A  +G+Y+ Q AV SIT +YG++FSV ANGNYNN
Sbjct  1620  QPNGDAKNIDFSLKAYGNPLPQPFEIAFALGDYSAQHAVVSITSKYGEIFSVSANGNYNN  1679

Query  1681  KQGNLPAEYGFKANFEIPKSNFKFVEITSRVK-----LSSPSTSNNAEIFIESKTGQDHY  1735
              Q     EYG +AN EIPKS  K +EI S  K     + + + + N E F++SKT    Y
Sbjct  1680  NQA---LEYGLQANIEIPKSTLKSLEINSHGKVLKSLIGNENAAYNVEFFLDSKTSLGQY  1736

Query  1736  VRVDTEWNGSPNDGSYKFEAQTHKMEFPFKFNGNYQRQQ-----NGDLNAKQNYIFNAQY  1790
              RV+T WNG+ NDGSY FEAQT+ ME P KFNG Y R+Q     +GDL  KQ Y+ NAQY
Sbjct  1737  ARVNTVWNGTANDGSYDFEAQTNNMESPLKFNGKYHRKQTGNIKDGDLTGKQTYVLNAQY  1796

Query  1791  GKQYVKTDASISYEAENVNIVYALDSSYESAKDIKVNIHTIQSDDDLTLVVSVHANQ-DK  1849
             G QYVK DAS+ Y AE V+I Y +DSS++S KDIKVNI T +  DD T VV+    Q DK
Sbjct  1797  GAQYVKMDASLGYGAEKVDIAYVIDSSFDSVKDIKVNIRTFKPLDDSTYVVTALFKQTDK  1856

Query  1850  SYGLNTKLYRSAYKKGVDLRLNLLKETPIIINSIAEILGERKGKVTFEIQNLANLDIKFN  1909
             SYGL+T  Y SA+KKGVD+RL+LLKE PIII+SIAE+LG+RKGKV FEI NLA+LDIK N
Sbjct  1857  SYGLDTTFYHSAHKKGVDIRLDLLKEKPIIISSIAELLGDRKGKVLFEILNLADLDIKIN  1916

Query  1910  SEASFVSIDDSYIVAHWNSNKLKLDSYELDARTQGKNIKIQLNNVNGVVFLGTATYSLKK  1969
             SEAS+VSID+ YI+ +W+S KLKLD YEL+AR Q KNIKIQL N NG++F GTATY+LKK
Sbjct  1917  SEASYVSIDEFYIIVNWSSKKLKLDGYELEARAQSKNIKIQLKNENGIIFSGTATYALKK  1976

Query  1970  EQNKEIIDGQGQIQFHGKLHNGSFKLTRQHFDINTDKEVGFSYTLNGNFGSKNGLSTIKI  2029
             E NK IIDGQG++Q+ GK  +G+FKLTRQHFD  TD+EVGFSYT  GN GSKNGL T+KI
Sbjct  1977  ELNKTIIDGQGKVQYQGKALSGNFKLTRQHFDFGTDREVGFSYTFMGNLGSKNGLGTLKI  2036

Query  2030  TNQEFNTKFSICEEKRQCTNIQVQSLVTIDDQKLDAVKLSTLILIDLRELGYPYELELKS  2089
             TN+EFNTKFS+CEEKRQCTN+ VQS+V+ID+QKLDAV+ +TLI++DLR+ GYPYE ELKS
Sbjct  2037  TNKEFNTKFSVCEEKRQCTNLIVQSIVSIDEQKLDAVEHTTLIIVDLRDFGYPYEFELKS  2096

Query  2090  QSTRHGFKYQYNLDSFINTGNNFKYQLNAIVQPTLSTVKLTLPKRQILFEAVQKIPTDGN  2149
             Q+TR G KYQY+LDSFI TGNNFKYQ  A VQPT ST+KL LPKRQILFE  QKIP DG+
Sbjct  2097  QNTRQGLKYQYHLDSFIITGNNFKYQFTANVQPTSSTIKLALPKRQILFETTQKIPADGS  2156

Query  2150  IFGHYEQSASFFIDKLQKPEDVFRVSAVVHVSGIDRTALNADGELKLEHPTIRPFTISGR  2209
             +FG YEQ+ASFFIDKLQKP+DV R SA+V V+G +R A NA+G+LK EHPTIRP +ISG+
Sbjct  2157  LFGRYEQTASFFIDKLQKPDDVARFSAIVDVTGTERVAFNANGKLKFEHPTIRPLSISGQ  2216

Query  2210  FNGNVDQQIANAEIIFDIFKLPEQKVVGKSELRNSRSKNGVNIASTTTVKSDGFQFQYQI  2269
              NG+V+QQIA+AE+IFDIF+LPEQKVVG SELRNSRS+NG NIA  TTVKS G QFQYQI
Sbjct  2217  LNGDVNQQIASAEVIFDIFRLPEQKVVGNSELRNSRSQNGFNIAYITTVKSAGLQFQYQI  2276

Query  2270  NSNAAIDIENQEFNIGLEVNNGDIDIKAVTILNREKLEMSLGESNKPIIQIVGDFNRQKR  2329
             NSNAA+DIE  E+NIGLE+NNG+ID+KA++ LN+EK E+SL ESNK II IVGDF++Q  
Sbjct  2277  NSNAAVDIEAHEYNIGLELNNGEIDVKAISFLNKEKFEISLSESNKHIIYIVGDFSKQNH  2336

Query  2330  YAKFNTTFQIVDKSPLEITSEIQPTYAKISLKSQGFFDGNAEIKLGKEFKFDASGSGKQF  2389
             YAK NT  QI+DK+P+EITSE+QP  AKI LK Q F DG AE+KLGKEFK D  GSGKQ 
Sbjct  2337  YAKLNTKVQILDKNPIEITSEVQPNSAKIILKRQDFIDGTAEVKLGKEFKVDVIGSGKQL  2396

Query  2390  VNGRVALDPTNFLQTKYTCNDEDLNSFLLNVETEINKDAEHVSKYLKERFEKLRLSSELN  2449
              NGRVALD TNFLQT Y  N++ LN F   VE+EINKD+E++S+ +KER +K R  ++  
Sbjct  2397  FNGRVALDATNFLQTNYFINEDHLNGFWHIVESEINKDSEYISENIKERLKKSRQVTDKI  2456

Query  2450  AKLAKDASPDFSKLKGKLIENIKGLIEELEADPSIAPIIDGIRNLFAKISNIVNDLGKAV  2509
              KLAK+A PDFSKL+GKL++    +++ELEAD SIAPIIDGIR LF KI+ IV+D+ KA+
Sbjct  2457  VKLAKEAGPDFSKLQGKLLDYKNDIVQELEADQSIAPIIDGIRTLFKKIAGIVDDINKAI  2516

Query  2510  SETFEKAHKAFDDVFDKLQALWKDSLLKAWEDFILTANKLIGALYKEIVSVYTKTIKILL  2569
             SE  EKA K+  D++DKLQALWKDSLLKAWEDFI+T  KLI  L  E + + T++ K LL
Sbjct  2517  SEILEKAQKSIVDIYDKLQALWKDSLLKAWEDFIITVQKLISTLKTEFIKICTQSFKDLL  2576

Query  2570  SEVEKYGTALKNYSKAIAETLKPINEAVQEIIKVLVQTAESVIDEIKQYAASLPSFESIR  2629
             S +EKYG ALKNY KAI E +KPIN+A QE+IK++V  AE V  E KQY ASLPSFESIR
Sbjct  2577  SALEKYGPALKNYGKAIGEIVKPINDAAQEVIKIVVNAAEGVTHEFKQYVASLPSFESIR  2636

Query  2630  KEVNEKVKNLKLIEKTIEFVNSLFDQLNILPQTPETTEFLKKIHEYINAKLNQQKINDEK  2689
              E N+KVK LKL EK  E  NSLFDQ+NILPQTPET+EFL+K+H+Y+ AKL Q+ I++EK
Sbjct  2637  NEFNDKVKVLKLFEKATELTNSLFDQINILPQTPETSEFLQKLHDYLIAKLKQEHIDNEK  2696

Query  2690  TLDDLGKLLIKAIRSIWVSMKNSPSKSYAPTIDFQTCFSSLSRSLDSLALLPTILSFRSS  2749
              +++LG+LLIKA+RSIWVS++++   S    IDFQ+   SL+ S DSLA+LP+ILSFRSS
Sbjct  2697  YIEELGQLLIKAVRSIWVSIRSTYPGSSDHVIDFQSWIGSLTHSFDSLAVLPSILSFRSS  2756

Query  2750  ILNYILNENWDDVFNKNLLNSWIFFNDFELRGHVVDGQHIFTFDGQNFAYPGNCKYILAQ  2809
             ILN +LNENWD VFNK LL SWIFFNDFELRGHVVDG+HIFTFDG NFAYPGNCKYILAQ
Sbjct  2757  ILNCLLNENWDVVFNKKLLYSWIFFNDFELRGHVVDGKHIFTFDGLNFAYPGNCKYILAQ  2816

Query  2810  DSVDNNFTIIGQLTNGKLKSITIVDRDGNYAEVADNLALKINGNLVEYPQHLSGLHAWRK  2869
             DSVDNNFTIIGQLTNGKLKSIT++DR+G+Y EVADNLALK+NGNLVEYPQHLSGLHAWR+
Sbjct  2817  DSVDNNFTIIGQLTNGKLKSITLIDREGSYFEVADNLALKLNGNLVEYPQHLSGLHAWRR  2876

Query  2870  FYTVHLHSEYGVSVVCTTDLKVCHFNINGFYTSKTRGLLGNGNAEPYDDYLRIDGTIASD  2929
             FYT+HL+SEYGV +VCT+DLKVCH NINGFYTSKTRGLLGNGNAEPYDD+L IDGT+A +
Sbjct  2877  FYTIHLYSEYGVGIVCTSDLKVCHININGFYTSKTRGLLGNGNAEPYDDFLLIDGTLAEN  2936

Query  2930  SAALGNDYGVGKCAAVAFGKDQVESPKREEICSELFGIQSTLAINFITVDHRPYRKSCDI  2989
             SAALGNDYGVGKC A+ F  +Q +S KR+E+CSELFGI+STLA NFIT+D RPYRK+CDI
Sbjct  2937  SAALGNDYGVGKCTAIEFDNNQFKSSKRQEMCSELFGIESTLAFNFITLDSRPYRKACDI  2996

Query  2990  ALAKVAEKDKEAIACTFALAYGSAVKQFSNLVLLPPRCIKCVGAVGQRDFGDEFTVKLPN  3049
             ALAKVAEK+KEA ACTFALAYGSAVKQ +  VLLPPRCIKC G  GQ DFGDEFTVKLPN
Sbjct  2997  ALAKVAEKEKEATACTFALAYGSAVKQINKWVLLPPRCIKCAGPAGQHDFGDEFTVKLPN  3056

Query  3050  NKADVVFVVDMNVTPVVLSNLIAPAINDIRESLKSRGFTDVQVGVVVFDESKRYPALLTS  3109
             NK DVVFVVD+NVTP VLSNLIAPAINDIRESL+SRGF+DVQVGV+VF+E+KRYPALLTS
Sbjct  3057  NKVDVVFVVDINVTPGVLSNLIAPAINDIRESLRSRGFSDVQVGVIVFEETKRYPALLTS  3116

Query  3110  DNGKINYKGRVTDVKLNGIKNFCDNCVEQILTEKRILDIYNLLKKIVEDIAPQSDEKAFQ  3169
             D GKINYKG V DVKL GIK+FCDNCVEQI+TEKRILDIYN LK+IV+ IAPQ+DEKAFQ
Sbjct  3117  DGGKINYKGNVADVKLAGIKSFCDNCVEQIITEKRILDIYNSLKEIVKGIAPQADEKAFQ  3176

Query  3170  LALDYPFRAGAAKSIIGVRSDSLEYGNWWKFLRAQWTGSITKFDGALLHLIAPVKGLTLE  3229
             LALDYPFRAGAAKSIIGVRSDSLEY NWWKF+RAQ TGSITKFDGAL+HLIAPVKGL+LE
Sbjct  3177  LALDYPFRAGAAKSIIGVRSDSLEYKNWWKFVRAQLTGSITKFDGALIHLIAPVKGLSLE  3236

Query  3230  GVSAEKLIGFNSRLSATIDGKDSKKRTKLQFDNDMGIDFVLNNGGWVFATQNFEKLKGSD  3289
             GV +EKLIGFNSRL AT+DGKDSKKRTKLQFDNDMGIDFVLNNGGWVFATQNFEKLK SD
Sbjct  3237  GVLSEKLIGFNSRLVATVDGKDSKKRTKLQFDNDMGIDFVLNNGGWVFATQNFEKLKASD  3296

Query  3290  QKKMLNQIVTSVADTLFKTELVSECRCLPFEGLHGHHKCIIKSSTFVPNKKPKAA  3344
             QKKMLNQI +S+ADTLFKTE+VS+CRCLP  GLHG HKC+IKSSTFV NKK K+A
Sbjct  3297  QKKMLNQITSSLADTLFKTEIVSDCRCLPIHGLHGQHKCVIKSSTFVANKKAKSA  3351


>VIT_PENME unnamed protein product
Length=2586

 Score = 210 bits (534),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 228/981 (23%), Positives = 422/981 (43%), Gaps = 103/981 (10%)

Query  29   CNLGCPKSDNGLLKYTPGNSYDYSFDSILTIGLSSNVLSESADTSLKVSGSAKIFSKGNC  88
            C+  CP + +  L Y P  +Y Y++    T+ L      ++ DT  + +    +     C
Sbjct  28   CSTECPVTGSPKLAYQPDKTYAYAYSGKSTVQLKG---VDNGDTETEWTAGVDLTWISPC  84

Query  89   GYTLQLSSVKVSNTKESVEKKILSSIQKPVQFTLVNGLLEPQICSDSGDLEYSLNIKRAV  148
               +   + K+   +     + L   + P+   +V+G ++  +C+   D  +++N+K+ V
Sbjct  85   DMAISFRNTKMDGARGPTAARTLE--RYPLVVAVVDGRVQ-HVCAHPEDEAWAINLKKGV  141

Query  149  ISLLQSGLN---------TEHEIDVFGQCPTHTSTSNVGNANIITKVRNLNSCVHREQII  199
             S  Q+ +          T  E DV G+CPT       G   I+ K +N   C  R    
Sbjct  142  ASAFQNSIPSLSAVSSGITVTETDVVGKCPTKYEIETEGEKVIVVKEKNHRHCQERYPTP  201

Query  200  NGLVSGKVNEKAGITSSL----------LLQATYIKESKIVNGLIDNVHLTE-----TYK  244
              L +  +     I  S           +  A   ++  IV   I      E     T +
Sbjct  202  AALPAPWLKAPLPIEESKSQCRQEIANGIYTAITCQDKNIVRPAIGIYKYVEASQYSTLR  261

Query  245  FIGTTKESSDINGKVVTTLKLKNPSGTKSNSPLTGSIVKSVIFQRPETYTAKNINALKTV  304
            FI  + ++S I+G          PSG  +        ++S+++        +    L  +
Sbjct  262  FISESSDTSAISGI---------PSGELN--------IESLLYNHETMKDPQLAPELDEL  304

Query  305  LSDLVDSTGDYVKKESAKKFVEFIRLLRQSDSETLLELAAFPHPNKVLARKVYLDGLFRT  364
            + ++ D T D V+ E+     + + +LR+     ++E A         +    L+ +F  
Sbjct  305  MKEICDKTKDTVEAEAGALVAKALHVLRRIPDTVVVETAQKVRQGHYCSDSARLESIFLD  364

Query  365  GTA-----ESARVILKQLAKFNEKEKLLAIL--ALNLVKSVDKETLNQAAAQLL--PNVP  415
              A      + +V++ ++         LA+   AL L+   + E + +A   L   P   
Sbjct  365  AVAFIHESGAVKVMVNEIENGRATGGRLALYTAALYLIPRPNIEAV-KALTPLFESPRPM  423

Query  416  KELYLSVGSLVAKFC--TGRNCQGPEIEAISKKFSDGLK-HCKPNTKKEEERI-IYILKG  471
              L L+  ++V  +C  T    +   +  I++  ++ ++ HC P+   E+  + + I K 
Sbjct  424  PSLLLAAATMVNHYCRHTPACYEKAPVARIAEILANRVQTHCSPSAGVEDNEVALAIFKT  483

Query  472  IGN-AKSLAGNTAAALSECSSTGRSNRIRVAALQAFLTVGCDKTLQTKSLELLKDRNEDS  530
            IGN   +    T AA+      G    +RVAA +AF    C +    K +++      ++
Sbjct  484  IGNMGVATPAVTRAAVHCIEVEGLETSVRVAAAEAFRQANCFRPAVEKLVDIAVRPAFET  543

Query  531  ELRIEAYLSLISCPDADVANQISEIVNSETVNQVGGFISSNLKAIRDSTDASREQQRYHL  590
            E+RI +YL+ + C + +    I E ++ E   QV GF+  +L  I++ST  ++E  RY L
Sbjct  544  EVRIASYLAAVRCAEQEHLETIIEKISKEENTQVRGFVLGHLINIQESTCPAKENLRYLL  603

Query  591  SNIRVTKKFPADYRRYSFNNEVSYNLESLGVGASSDYQLIYSQHGFLPRSSRVNITTEIF  650
            +N+ +   F  D+R++S N +V+Y+  + G+GA  +  +IY+   F+PR+  + +  ++ 
Sbjct  604  ANV-IPTDFERDFRKFSRNIDVAYHAPAFGMGAGLESNIIYAPGSFVPRAVNLKMKADVD  662

Query  651  GTSFNVLEASVRQENFEGVLEYYLGPKGLL-NKDFDEIVKTIEVGNNATAGVGG------  703
             T  ++ E   R    E ++E  LGP+G L    F +I++ I       AG  G      
Sbjct  663  ETHMDIAEIGARFVGIESIIEEPLGPQGYLRTATFGKIMEDI----TGFAGEKGYKVMEQ  718

Query  704  -----RARRSIADDVAKTSKRYKTYGSKNVQDLNLDISLKLFGSELAFLSLGDSIPSNLE  758
                 R RRSI D         K YG K+    + ++  +  G E+ +  +  S+     
Sbjct  719  LKHTLRTRRSI-DSSVIADFFGKLYG-KSRSHTHAELFARFMGHEITYADVAGSLKGVTA  776

Query  759  DIINE-----FSNSIEKAKQ-GLNSFEKQISSHNLVLDTDLAYPTSIGIPLELVAQSFAA  812
            D + E     F NS+E  K   LN      ++    L  D + PT  G PL L     A 
Sbjct  777  DTLIETFFSFFENSLEHMKDLNLN------TARTAQLSMDYSLPTIQGTPLRLRLAGTAV  830

Query  813  TKTDLAVNLDINSILEQNWQKTKYRLKVVPSIDLSVNLQVGFNAQVLSTGFRVVSTAHSA  872
                +  N++I  IL  +   ++  +K  P + +     VGF+  +   G  + +T  SA
Sbjct  831  AGLKMEGNVNIAQIL-SDLGNSQTGVKFFPGLSVHATGFVGFDWLLARVGIEMQNTISSA  889

Query  873  TGNDITVAAISDGEGFTVDVELPREKLELIDIKIDTELY--VSEQDKQISASFKGNKKVK  930
            TG  I +   ++ +   +++E+P EK+EL++IK +T L   V ++  +IS S   + +++
Sbjct  890  TGAAIKIRT-TENKKIEMELEVP-EKMELLNIKAETYLVKAVGKKMTEISPSSMRDVRIQ  947

Query  931  NSQPSEICFNQLE-VVGLNIC  950
             +     C   LE V GL +C
Sbjct  948  RNS----CIGALEPVFGLKVC  964


>Q7KTG2_DROME unnamed protein product
Length=4333

 Score = 167 bits (424),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 233/1002 (23%), Positives = 420/1002 (42%), Gaps = 140/1002 (14%)

Query  118   VQFTLVNGLLEPQICSDSGDLEYSLNIKRAVISLLQSGL-------NTEHEIDVFGQCPT  170
             ++F   +GL+  ++C    +  + LNIK+ ++S  Q+ +       NT  E DV GQC  
Sbjct  155   LRFAFHDGLIS-EVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTT-ETDVSGQCQV  212

Query  171   HTSTSNVGNANI-ITKVRNLNSCVHREQIINGLVSGKVNEKAGITSSLLLQATYIKESKI  229
               +  +  ++ + I K +++NSC  R    + L +     +   T   +L++       I
Sbjct  213   QYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTI  272

Query  230   VNGLIDNVHLTETYKFIGTTKESSDINGKVVTTLKL-------------KNPSGTKSNSP  276
              N +   +   ET+  +  +  SS       + LKL             +NP   +  + 
Sbjct  273   DNNVYKEIKCLETHLLVPFSNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRAT  332

Query  277   LTGSIVKSVIFQRPETYTAKNINALKTVLSDLVDSTGDYVKKESAKKFVEFIRLLRQSDS  336
             L      +V   +P   +   I A + +L ++       +++E    F  F++  +  D 
Sbjct  333   LVFDHTPAV---KP---SHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDY  386

Query  337   ETLLELAAFPHPNKVLARKVYLDGLFRTGTAESARVILKQLAKFNEK-EKLLA---ILAL  392
             +TL  L           R   L+ L   G+  S +V+  Q+   NEK  K +A   + AL
Sbjct  387   KTLSVLLQRSASTCEQGRNHLLESLPFIGSTASYKVMRDQI--INEKLTKQMAHDWMTAL  444

Query  393   NLVKSVDKETLNQAAAQL---LPNVPKELYLSVGSLVAKFCTGR-----NCQGPEIEAIS  444
             + +   D+ETL    + L      +  E  L   ++V  FC        N +  +I  + 
Sbjct  445   SFITRPDEETLETFHSILEYAKNRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLL  504

Query  445   KKFSDGLKHCKPNTKKEEERIIYILKGIGNAKSLAGNTAAALSECSSTGRSN-RIRVAAL  503
             +     L +     ++  ER++ +LKG+GN   ++   A  L        +   IR+  +
Sbjct  505   ETEFLNLYNLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHGI  564

Query  504   QAFLTVGCDKTLQTKSLELLKDRNEDSELRIEAYLSLISCPDADVANQISEIVNSETVNQ  563
              AF  V C +  ++  L+   +   +SELRI +YL  + CPD      I  I+  E +NQ
Sbjct  565   LAFRRVDCARH-RSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEEINQ  623

Query  564   VGGFISSNLKAIRDSTDASREQQRYHLSNIRVTKKFPADYRRYSFNNEVSYNLESLGVGA  623
             VG F+ S+L  +  S    R + +  L N  ++++F  D R++S N E S   +    G 
Sbjct  624   VGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGT  683

Query  624   SSDYQLIYSQHGFLPRSSRVNITTEIFGTSFNVLEASVRQENFEGVLEYYLGPKG-----  678
             ++D  +I+    +LPR + VN T ++FG S N  E + R E  E +     GPKG     
Sbjct  684   TTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQ  743

Query  679   LLNKDFDEIVKTIEVGNNAT--------------------AGVGGRARRSIAD-------  711
             LL K    + + +  GN +                     A    RA     D       
Sbjct  744   LLRKKLSFLNRWL--GNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEE  801

Query  712   ----------DVAKTSKR-----YKTYGSKNVQDLN---LDISLKLFGSELAFLSLGDSI  753
                       DV+ T K+       + G K   D N       L++FG++L +       
Sbjct  802   SLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYF------  855

Query  754   PSNLEDIINEFS-----NSIEKAKQGLNSFEKQISSHNLVLDTDLAYPTSIGIPLELVAQ  808
               N+E ++   +     N  ++AK  L+  E   +   + LD     P ++G+PL +   
Sbjct  856   --NVESLVEVMALAAKFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAI--H  911

Query  809   SFAATKTDLAVNLDINSI-LEQNWQ-KTKYRLKVVPSIDLSVNLQVGFNAQVLSTGFRVV  866
             +F A+  DL V+ +++ +    +W    + + K   S+D+   +Q     +   +G +V 
Sbjct  912   AFGASSIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDMFWE--QSGIKVK  969

Query  867   STAHSATGNDITVAAIS-DGEGF-TVDVELPREKLELIDIKIDTELYVSEQDKQISASFK  924
             S  +S   N   VA +   G    +   +LPR+K E+  ++  +EL V ++++Q+  +  
Sbjct  970   SNLYS---NSELVAKLKVRGRNLVSFSFDLPRDKNEIFSVR--SELLVQKREEQLPQAGI  1024

Query  925   GNKKVKNSQPSEICFNQLEVVGLNICIESSTSLSELQAGNSNDAERGLAVSNQFHLSKPF  984
              N+   NS  +    +Q   +GL +C  S  S+ +L    SN  E    +     L+ P 
Sbjct  1025  ANRSA-NSTCTWPVLDQ--AIGLQMC--SHYSVPDL----SNATE----IYPSLLLAGPL  1071

Query  985   SFAISLT----AERKLTFKGIHSIEPSSQKWKLYYSTPGSKV  1022
             +F++ L     + +K  F+     +     + L ++TPGSKV
Sbjct  1072  NFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKV  1113


 Score = 104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 94/353 (27%), Positives = 156/353 (44%), Gaps = 43/353 (12%)

Query  2780  RGHVVDGQHIFTFDGQ------NFAYPGN------CKYILAQDSVDNNFTII--------  2819
             R  ++D +H  TFD +      NF   GN      C Y+LA D    NFT++        
Sbjct  3745  RALLIDSRHYMTFDQRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLLLEPASKSL  3804

Query  2820  -GQLTNGKLKSITIVDRDGNYAEV-ADNLALKINGNLVE-YPQHLSGLHAWRKFYTVHLH  2876
              GQ    KL  I     +G   E+  +   + INGN     P  L  ++  R    + + 
Sbjct  3805  AGQGLTRKLSFIA----NGQLIEIDLETDHISINGNPQPILPLKLGDVNIHRDLDVLSIT  3860

Query  2877  SEYGVSVVCTTDLKVCHFNINGFYTSKTRGLLGNGNAEPYDDYLRIDGTIASDSAALGND  2936
             S+   S+ C     +C F ++G+Y  +T GLLG  N EPYD+Y    G I++++    + 
Sbjct  3861  SDTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGVISNETQLFTDS  3920

Query  2937  YGVGKCAAVAFGKDQVESPKREEICSELF--GIQSTLAINFITVDHRPYRKSC-DIAL-A  2992
             + + +C      + Q  S +  + C+  F  GI +T +     +D  P+ + C D+ + +
Sbjct  3921  WSLKQCRQNKLAQTQEVSQEVSDACTSFFRTGILATCS---AVLDPTPFYEMCMDLGMKS  3977

Query  2993  KVAEKDKEAI--ACTFALAYGSAVKQFSNLVLLPPRCIKCV----GAVGQRDFGDEFTVK  3046
                 K   A+  AC  ALAY  A       + +P +C+ C       V +  F +    +
Sbjct  3978  PPIRKGHPAVKGACAAALAYIEACTALKVPMRVPSQCVFCQLSNGSYVPEGTFMELSGPE  4037

Query  3047  LPNNKADVVFVVDMNVTPVVL--SNLIAPAINDIRESLKSRGFTDVQVGVVVF  3097
             +P + +DVVF+V+       L  S  I   ++ I E L++   T+ +  VV F
Sbjct  4038  IPKS-SDVVFIVEAKECNANLKTSKNIMTVVSSIEEQLQAAKITNNRYAVVAF  4089



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062687.1 calcium/calmodulin-dependent protein kinase type II
alpha chain isoform X1 [Drosophila eugracilis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KCC2A_DROME  unnamed protein product                                  1092    0.0  
G5EDZ5_CAEEL  unnamed protein product                                 728     0.0  
KCC2D_CAEEL  unnamed protein product                                  568     0.0  


>KCC2A_DROME unnamed protein product
Length=530

 Score = 1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/531 (98%), Positives = 526/531 (99%), Gaps = 1/531 (0%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER
Sbjct  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY
Sbjct  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
Sbjct  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
Sbjct  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300

Query  301  KGAILTTMLATRNFSSRSMITKKGDGSQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVI  360
            KGAILTTMLATRNFSSRSMITKKG+GSQVKESTDSSSTTLEDDDIKEDKKG VDRSTTV+
Sbjct  301  KGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVV  360

Query  361  SKEPEDIRILCPAKTCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPH  420
            SKEPEDIRILCPAKT  QN GNSQCSS ARRQEIIKITEQLIEAINSGDFDGYTKICDPH
Sbjct  361  SKEPEDIRILCPAKTYQQNIGNSQCSS-ARRQEIIKITEQLIEAINSGDFDGYTKICDPH  419

Query  421  LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ  480
            LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ
Sbjct  420  LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ  479

Query  481  YIDKQGHAHTHQSEETRVWHKRDSKWQNVHFHRSASAKISGATTFDFIPQK  531
            YIDKQGHAHTHQSEETRVWHKRD+KWQNVHFHRSASAKISGATTFDFIPQK
Sbjct  480  YIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASAKISGATTFDFIPQK  530


>G5EDZ5_CAEEL unnamed protein product
Length=681

 Score = 728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/569 (63%), Positives = 429/569 (75%), Gaps = 63/569 (11%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            +A   A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLER
Sbjct  109  LAMMNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLER  168

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  169  EARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  228

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LES+ +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGY
Sbjct  229  LESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGY  287

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDT
Sbjct  288  LSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDT  347

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAK+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKL
Sbjct  348  VTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKL  407

Query  301  K---------------------------------------------------GAILTTML  309
            K                                                   GAILTTM+
Sbjct  408  KAAISAVKMVTRMSGVLRTSDSTGSVASNGSTTHDASQVAGTSSQPTSPAAEGAILTTMI  467

Query  310  ATRNFSS--RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPE  365
            ATRN S+  R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +  
Sbjct  468  ATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGA  525

Query  366  DIRILCPAKTCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFE  425
               +     +    + ++  S  A++Q+I+++T+ L++AI+  DF+ YT++CD  +T FE
Sbjct  526  TGIVSSSNSSTASKSSSTNLS--AQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFE  583

Query  426  PEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQ  485
            PEALGNL+EGI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ 
Sbjct  584  PEALGNLIEGIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRN  640

Query  486  GHAHTHQSEETRVWHKRDSKWQNVHFHRS  514
            G AHT QS+E+RVW K+  +W  VH HRS
Sbjct  641  GEAHTRQSQESRVWSKKQGRWVCVHVHRS  669


>KCC2D_CAEEL unnamed protein product
Length=720

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/307 (86%), Positives = 283/307 (92%), Gaps = 1/307 (0%)

Query  6    ACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARIC  65
            A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLEREARIC
Sbjct  4    ASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARIC  63

Query  66   RKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVN  125
            RKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILES+ 
Sbjct  64   RKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIA  123

Query  126  HCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEV  185
            +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGYLSPEV
Sbjct  124  YCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGYLSPEV  182

Query  186  LKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEA  245
            LKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDTVTPEA
Sbjct  183  LKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEA  242

Query  246  KNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAIL  305
            K+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKLK AI 
Sbjct  243  KSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKAAIS  302

Query  306  TTMLATR  312
               + TR
Sbjct  303  AVKMVTR  309


 Score = 173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 135/200 (68%), Gaps = 9/200 (5%)

Query  317  RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPEDIRILCPAK  374
            R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +     +     
Sbjct  516  RNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGATGIVSSSNS  573

Query  375  TCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVE  434
            +    + ++  S  A++Q+I+++T+ L++AI+  DF+ YT++CD  +T FEPEALGNL+E
Sbjct  574  STASKSSSTNLS--AQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIE  631

Query  435  GIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSE  494
            GI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ G AHT QS+
Sbjct  632  GIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQ  688

Query  495  ETRVWHKRDSKWQNVHFHRS  514
            E+RVW K+  +W  VH HRS
Sbjct  689  ESRVWSKKQGRWVCVHVHRS  708



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062688.1 calcium/calmodulin-dependent protein kinase type II
alpha chain isoform X1 [Drosophila eugracilis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KCC2A_DROME  unnamed protein product                                  1092    0.0  
G5EDZ5_CAEEL  unnamed protein product                                 728     0.0  
KCC2D_CAEEL  unnamed protein product                                  568     0.0  


>KCC2A_DROME unnamed protein product
Length=530

 Score = 1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/531 (98%), Positives = 526/531 (99%), Gaps = 1/531 (0%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER
Sbjct  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY
Sbjct  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
Sbjct  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
Sbjct  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300

Query  301  KGAILTTMLATRNFSSRSMITKKGDGSQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVI  360
            KGAILTTMLATRNFSSRSMITKKG+GSQVKESTDSSSTTLEDDDIKEDKKG VDRSTTV+
Sbjct  301  KGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVV  360

Query  361  SKEPEDIRILCPAKTCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPH  420
            SKEPEDIRILCPAKT  QN GNSQCSS ARRQEIIKITEQLIEAINSGDFDGYTKICDPH
Sbjct  361  SKEPEDIRILCPAKTYQQNIGNSQCSS-ARRQEIIKITEQLIEAINSGDFDGYTKICDPH  419

Query  421  LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ  480
            LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ
Sbjct  420  LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ  479

Query  481  YIDKQGHAHTHQSEETRVWHKRDSKWQNVHFHRSASAKISGATTFDFIPQK  531
            YIDKQGHAHTHQSEETRVWHKRD+KWQNVHFHRSASAKISGATTFDFIPQK
Sbjct  480  YIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASAKISGATTFDFIPQK  530


>G5EDZ5_CAEEL unnamed protein product
Length=681

 Score = 728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/569 (63%), Positives = 429/569 (75%), Gaps = 63/569 (11%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            +A   A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLER
Sbjct  109  LAMMNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLER  168

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  169  EARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  228

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LES+ +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGY
Sbjct  229  LESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGY  287

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDT
Sbjct  288  LSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDT  347

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAK+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKL
Sbjct  348  VTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKL  407

Query  301  K---------------------------------------------------GAILTTML  309
            K                                                   GAILTTM+
Sbjct  408  KAAISAVKMVTRMSGVLRTSDSTGSVASNGSTTHDASQVAGTSSQPTSPAAEGAILTTMI  467

Query  310  ATRNFSS--RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPE  365
            ATRN S+  R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +  
Sbjct  468  ATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGA  525

Query  366  DIRILCPAKTCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFE  425
               +     +    + ++  S  A++Q+I+++T+ L++AI+  DF+ YT++CD  +T FE
Sbjct  526  TGIVSSSNSSTASKSSSTNLS--AQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFE  583

Query  426  PEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQ  485
            PEALGNL+EGI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ 
Sbjct  584  PEALGNLIEGIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRN  640

Query  486  GHAHTHQSEETRVWHKRDSKWQNVHFHRS  514
            G AHT QS+E+RVW K+  +W  VH HRS
Sbjct  641  GEAHTRQSQESRVWSKKQGRWVCVHVHRS  669


>KCC2D_CAEEL unnamed protein product
Length=720

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/307 (86%), Positives = 283/307 (92%), Gaps = 1/307 (0%)

Query  6    ACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARIC  65
            A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLEREARIC
Sbjct  4    ASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARIC  63

Query  66   RKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVN  125
            RKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILES+ 
Sbjct  64   RKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIA  123

Query  126  HCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEV  185
            +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGYLSPEV
Sbjct  124  YCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGYLSPEV  182

Query  186  LKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEA  245
            LKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDTVTPEA
Sbjct  183  LKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEA  242

Query  246  KNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAIL  305
            K+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKLK AI 
Sbjct  243  KSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKAAIS  302

Query  306  TTMLATR  312
               + TR
Sbjct  303  AVKMVTR  309


 Score = 173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 135/200 (68%), Gaps = 9/200 (5%)

Query  317  RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPEDIRILCPAK  374
            R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +     +     
Sbjct  516  RNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGATGIVSSSNS  573

Query  375  TCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVE  434
            +    + ++  S  A++Q+I+++T+ L++AI+  DF+ YT++CD  +T FEPEALGNL+E
Sbjct  574  STASKSSSTNLS--AQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIE  631

Query  435  GIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSE  494
            GI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ G AHT QS+
Sbjct  632  GIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQ  688

Query  495  ETRVWHKRDSKWQNVHFHRS  514
            E+RVW K+  +W  VH HRS
Sbjct  689  ESRVWSKKQGRWVCVHVHRS  708



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062689.1 calcium/calmodulin-dependent protein kinase type II
alpha chain isoform X1 [Drosophila eugracilis]

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KCC2A_DROME  unnamed protein product                                  1092    0.0  
G5EDZ5_CAEEL  unnamed protein product                                 728     0.0  
KCC2D_CAEEL  unnamed protein product                                  568     0.0  


>KCC2A_DROME unnamed protein product
Length=530

 Score = 1092 bits (2824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/531 (98%), Positives = 526/531 (99%), Gaps = 1/531 (0%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER
Sbjct  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY
Sbjct  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
Sbjct  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
Sbjct  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300

Query  301  KGAILTTMLATRNFSSRSMITKKGDGSQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVI  360
            KGAILTTMLATRNFSSRSMITKKG+GSQVKESTDSSSTTLEDDDIKEDKKG VDRSTTV+
Sbjct  301  KGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVV  360

Query  361  SKEPEDIRILCPAKTCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPH  420
            SKEPEDIRILCPAKT  QN GNSQCSS ARRQEIIKITEQLIEAINSGDFDGYTKICDPH
Sbjct  361  SKEPEDIRILCPAKTYQQNIGNSQCSS-ARRQEIIKITEQLIEAINSGDFDGYTKICDPH  419

Query  421  LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ  480
            LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ
Sbjct  420  LTAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQ  479

Query  481  YIDKQGHAHTHQSEETRVWHKRDSKWQNVHFHRSASAKISGATTFDFIPQK  531
            YIDKQGHAHTHQSEETRVWHKRD+KWQNVHFHRSASAKISGATTFDFIPQK
Sbjct  480  YIDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASAKISGATTFDFIPQK  530


>G5EDZ5_CAEEL unnamed protein product
Length=681

 Score = 728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/569 (63%), Positives = 429/569 (75%), Gaps = 63/569 (11%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            +A   A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLER
Sbjct  109  LAMMNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLER  168

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  169  EARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  228

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LES+ +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGY
Sbjct  229  LESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGY  287

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDT
Sbjct  288  LSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDT  347

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAK+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKL
Sbjct  348  VTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKL  407

Query  301  K---------------------------------------------------GAILTTML  309
            K                                                   GAILTTM+
Sbjct  408  KAAISAVKMVTRMSGVLRTSDSTGSVASNGSTTHDASQVAGTSSQPTSPAAEGAILTTMI  467

Query  310  ATRNFSS--RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPE  365
            ATRN S+  R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +  
Sbjct  468  ATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGA  525

Query  366  DIRILCPAKTCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFE  425
               +     +    + ++  S  A++Q+I+++T+ L++AI+  DF+ YT++CD  +T FE
Sbjct  526  TGIVSSSNSSTASKSSSTNLS--AQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFE  583

Query  426  PEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQ  485
            PEALGNL+EGI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ 
Sbjct  584  PEALGNLIEGIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRN  640

Query  486  GHAHTHQSEETRVWHKRDSKWQNVHFHRS  514
            G AHT QS+E+RVW K+  +W  VH HRS
Sbjct  641  GEAHTRQSQESRVWSKKQGRWVCVHVHRS  669


>KCC2D_CAEEL unnamed protein product
Length=720

 Score = 568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/307 (86%), Positives = 283/307 (92%), Gaps = 1/307 (0%)

Query  6    ACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARIC  65
            A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLEREARIC
Sbjct  4    ASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARIC  63

Query  66   RKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVN  125
            RKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILES+ 
Sbjct  64   RKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIA  123

Query  126  HCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEV  185
            +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGYLSPEV
Sbjct  124  YCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGYLSPEV  182

Query  186  LKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEA  245
            LKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDTVTPEA
Sbjct  183  LKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEA  242

Query  246  KNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAIL  305
            K+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKLK AI 
Sbjct  243  KSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKAAIS  302

Query  306  TTMLATR  312
               + TR
Sbjct  303  AVKMVTR  309


 Score = 173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 135/200 (68%), Gaps = 9/200 (5%)

Query  317  RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPEDIRILCPAK  374
            R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +     +     
Sbjct  516  RNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGATGIVSSSNS  573

Query  375  TCHQNTGNSQCSSAARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVE  434
            +    + ++  S  A++Q+I+++T+ L++AI+  DF+ YT++CD  +T FEPEALGNL+E
Sbjct  574  STASKSSSTNLS--AQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIE  631

Query  435  GIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSE  494
            GI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ G AHT QS+
Sbjct  632  GIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQ  688

Query  495  ETRVWHKRDSKWQNVHFHRS  514
            E+RVW K+  +W  VH HRS
Sbjct  689  ESRVWSKKQGRWVCVHVHRS  708



Lambda      K        H
   0.311    0.127    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 9431863740


Query= XP_017062691.1 calcium/calmodulin-dependent protein kinase type II
alpha chain isoform X2 [Drosophila eugracilis]

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KCC2A_DROME  unnamed protein product                                  1097    0.0  
G5EDZ5_CAEEL  unnamed protein product                                 730     0.0  
KCC2D_CAEEL  unnamed protein product                                  567     0.0  


>KCC2A_DROME unnamed protein product
Length=530

 Score = 1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/530 (99%), Positives = 526/530 (99%), Gaps = 0/530 (0%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER
Sbjct  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY
Sbjct  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT
Sbjct  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL
Sbjct  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300

Query  301  KGAILTTMLATRNFSSRSMITKKGDGSQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVI  360
            KGAILTTMLATRNFSSRSMITKKG+GSQVKESTDSSSTTLEDDDIKEDKKG VDRSTTV+
Sbjct  301  KGAILTTMLATRNFSSRSMITKKGEGSQVKESTDSSSTTLEDDDIKEDKKGTVDRSTTVV  360

Query  361  SKEPEDIRILCPAKTCHQNTGNSQCSSARRQEIIKITEQLIEAINSGDFDGYTKICDPHL  420
            SKEPEDIRILCPAKT  QN GNSQCSSARRQEIIKITEQLIEAINSGDFDGYTKICDPHL
Sbjct  361  SKEPEDIRILCPAKTYQQNIGNSQCSSARRQEIIKITEQLIEAINSGDFDGYTKICDPHL  420

Query  421  TAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQY  480
            TAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQY
Sbjct  421  TAFEPEALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQY  480

Query  481  IDKQGHAHTHQSEETRVWHKRDSKWQNVHFHRSASAKISGATTFDFIPQK  530
            IDKQGHAHTHQSEETRVWHKRD+KWQNVHFHRSASAKISGATTFDFIPQK
Sbjct  481  IDKQGHAHTHQSEETRVWHKRDNKWQNVHFHRSASAKISGATTFDFIPQK  530


>G5EDZ5_CAEEL unnamed protein product
Length=681

 Score = 730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/568 (63%), Positives = 431/568 (76%), Gaps = 62/568 (11%)

Query  1    MAAPAACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLER  60
            +A   A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLER
Sbjct  109  LAMMNASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLER  168

Query  61   EARICRKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  120
            EARICRKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI
Sbjct  169  EARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQI  228

Query  121  LESVNHCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGY  180
            LES+ +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGY
Sbjct  229  LESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGY  287

Query  181  LSPEVLKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDT  240
            LSPEVLKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDT
Sbjct  288  LSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDT  347

Query  241  VTPEAKNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKL  300
            VTPEAK+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKL
Sbjct  348  VTPEAKSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKL  407

Query  301  K---------------------------------------------------GAILTTML  309
            K                                                   GAILTTM+
Sbjct  408  KAAISAVKMVTRMSGVLRTSDSTGSVASNGSTTHDASQVAGTSSQPTSPAAEGAILTTMI  467

Query  310  ATRNFSS--RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPE  365
            ATRN S+  R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +  
Sbjct  468  ATRNLSNLGRNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGA  525

Query  366  DIRILCPAKTCHQNTGNSQCSSARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEP  425
               I+  + +   +  +S   SA++Q+I+++T+ L++AI+  DF+ YT++CD  +T FEP
Sbjct  526  -TGIVSSSNSSTASKSSSTNLSAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEP  584

Query  426  EALGNLVEGIDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQG  485
            EALGNL+EGI+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ G
Sbjct  585  EALGNLIEGIEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNG  641

Query  486  HAHTHQSEETRVWHKRDSKWQNVHFHRS  513
             AHT QS+E+RVW K+  +W  VH HRS
Sbjct  642  EAHTRQSQESRVWSKKQGRWVCVHVHRS  669


>KCC2D_CAEEL unnamed protein product
Length=720

 Score = 567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/307 (86%), Positives = 283/307 (92%), Gaps = 1/307 (0%)

Query  6    ACTRFSDNYDIKEELGKGAFSIVKRCVQKSTGFEFAAKIINTKKLTARDFQKLEREARIC  65
            A T+FSDNYD+KEELGKGAFS+V+RCV K+TG EFAAKIINTKKL+ARDFQKLEREARIC
Sbjct  4    ASTKFSDNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQKLEREARIC  63

Query  66   RKLHHPNIVRLHDSIQEENYHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESVN  125
            RKL HPNIVRLHDSIQEE++HYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILES+ 
Sbjct  64   RKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIA  123

Query  126  HCHQNGVVHRDLKPENLLLASKAKGAAVKLADFGLAIEVQGDHQAWFGFAGTPGYLSPEV  185
            +CH NG+VHRDLKPENLLLASKAKGAAVKLADFGLAIEV  D +AW GFAGTPGYLSPEV
Sbjct  124  YCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEV-NDSEAWHGFAGTPGYLSPEV  182

Query  186  LKKEPYGKSVDIWACGVILYILLVGYPPFWDEDQHRLYSQIKAGAYDYPSPEWDTVTPEA  245
            LKK+PY K VDIWACGVILYILLVGYPPFWDEDQHRLY+QIKAGAYDYPSPEWDTVTPEA
Sbjct  183  LKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEA  242

Query  246  KNLINQMLTVNPNKRITAAEALKHPWICQRERVASVVHRQETVDCLKKFNARRKLKGAIL  305
            K+LI+ MLTVNP KRITA +ALK PWIC RERVAS +HRQ+TVDCLKKFNARRKLK AI 
Sbjct  243  KSLIDSMLTVNPKKRITADQALKVPWICNRERVASAIHRQDTVDCLKKFNARRKLKAAIS  302

Query  306  TTMLATR  312
               + TR
Sbjct  303  AVKMVTR  309


 Score = 176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 137/199 (69%), Gaps = 8/199 (4%)

Query  317  RSMITKKGDG--SQVKESTDSSSTTLEDDDIKEDKKGVVDRSTTVISKEPEDIRILCPAK  374
            R+++ KK  G  S +KES++SS T   DD+  E   G +    TV+  +     I+  + 
Sbjct  516  RNLLNKKEQGPPSTIKESSESSQTI--DDNDSEKGGGQLKHENTVVRADGA-TGIVSSSN  572

Query  375  TCHQNTGNSQCSSARRQEIIKITEQLIEAINSGDFDGYTKICDPHLTAFEPEALGNLVEG  434
            +   +  +S   SA++Q+I+++T+ L++AI+  DF+ YT++CD  +T FEPEALGNL+EG
Sbjct  573  SSTASKSSSTNLSAQKQDIVRVTQTLLDAISCKDFETYTRLCDTSMTCFEPEALGNLIEG  632

Query  435  IDFHKFYFENVLGKNCKAINTTILNPHVHLLGEEAACIAYVRLTQYIDKQGHAHTHQSEE  494
            I+FH+FYF+   G     ++TT+LNP+VH++GE+AAC+AYV+LTQ++D+ G AHT QS+E
Sbjct  633  IEFHRFYFD---GNRKNQVHTTMLNPNVHIIGEDAACVAYVKLTQFLDRNGEAHTRQSQE  689

Query  495  TRVWHKRDSKWQNVHFHRS  513
            +RVW K+  +W  VH HRS
Sbjct  690  SRVWSKKQGRWVCVHVHRS  708



Lambda      K        H
   0.311    0.127    0.354 

Gapped
La