BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016312.2 protein enabled homolog [Drosophila kikkawai]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PC45_DROME  unnamed protein product                                 30.0    5.2  
M9PEH5_DROME  unnamed protein product                                 30.0    5.3  
M9PEI1_DROME  unnamed protein product                                 30.0    5.3  


>M9PC45_DROME unnamed protein product
Length=22300

 Score = 30.0 bits (66),  Expect = 5.2, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 3/43 (7%)

Query  289    IPMPPRPM-PMPG-PMPMPG-VMRVPGPVPVPMNVPPVPGRAY  328
              IP PPRP+ P+P  P+ +P  V+ +P P PV  N+P VP   Y
Sbjct  18566  IPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTY  18608


>M9PEH5_DROME unnamed protein product
Length=20710

 Score = 30.0 bits (66),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 3/43 (7%)

Query  289    IPMPPRPM-PMPG-PMPMPG-VMRVPGPVPVPMNVPPVPGRAY  328
              IP PPRP+ P+P  P+ +P  V+ +P P PV  N+P VP   Y
Sbjct  16976  IPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTY  17018


>M9PEI1_DROME unnamed protein product
Length=21657

 Score = 30.0 bits (66),  Expect = 5.3, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 27/43 (63%), Gaps = 3/43 (7%)

Query  289    IPMPPRPM-PMPG-PMPMPG-VMRVPGPVPVPMNVPPVPGRAY  328
              IP PPRP+ P+P  P+ +P  V+ +P P PV  N+P VP   Y
Sbjct  17923  IPSPPRPVYPVPQQPIYVPAPVLHIPAPRPVIHNIPSVPQPTY  17965



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016313.1 uncharacterized protein LOC108070375 [Drosophila
kikkawai]

Length=439
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VAU2_DROME  unnamed protein product                                 43.9    2e-04
NUCG_CAEEL  unnamed protein product                                   39.3    0.004
TERA1_CAEEL  unnamed protein product                                  30.0    4.6  


>Q9VAU2_DROME unnamed protein product
Length=370

 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 80/198 (40%), Gaps = 20/198 (10%)

Query  171  YRVGYDIGDGRFVATMELCHDPYLLRTHYARHQLTPASVHFQRNVKRTKFSPAGHFTGVD  230
            + VG+   +GRF+     C D Y L   ++ ++    +  +   V R   +         
Sbjct  111  FAVGFSF-NGRFMELYRNCFDGYSLAFQHSIYK----AYRYVNTVPRPNPTWQSDQLSGG  165

Query  231  IARIYSHRNQEKVMDAGLIDVKAGLFLARGHLAAKADLIYASQQRSSFNYVNVAPQWQTF  290
                Y  R  +  +   L  V+      RGH+   +  I    ++S+F Y+N  PQ++  
Sbjct  166  FDNAYEGRATQACLLTNLGAVQPQCKFDRGHMTPASAFISTELKKSTFRYLNAIPQYRGV  225

Query  291  NGGRWANLE----EATRRYVASSGISATVYTGTYGQMKVA-GSRVLH-LATDANNNGV--  342
            N G+W  +E       R    +  I+      TY  +KV  G+  +H L  + NNN +  
Sbjct  226  NRGKWKAVETWVNNMVRGLYDNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPI  285

Query  343  -------LAVPQLFYRVL  353
                   + VP+  Y+++
Sbjct  286  YLLDNNKIPVPEWMYKIV  303


>NUCG_CAEEL unnamed protein product
Length=308

 Score = 39.3 bits (90),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 51/111 (46%), Gaps = 15/111 (14%)

Query  259  RGHLAAKADLIYASQQRSS-------FNYVNVAPQ-WQTFNGGRWANLEEATRRYVASSG  310
            RGHLAA      A   R S       F   N++PQ  + FN  +W +LE   RR VA   
Sbjct  146  RGHLAA------AGNHRKSQLAVDQTFYLSNMSPQVGRGFNRDKWNDLEMHCRR-VAKKM  198

Query  311  ISATVYTGTYGQMKVAGSRVLHLATDANNNGVLAVPQLFYRVLIDEGQPTR  361
            I++ + TG     K+ G    ++      +  +AVP  F++V + E  P +
Sbjct  199  INSYIITGPLYLPKLEGDGKKYIKYQVIGDNNVAVPTHFFKVALFEVTPGK  249


>TERA1_CAEEL unnamed protein product
Length=809

 Score = 30.0 bits (66),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 56/141 (40%), Gaps = 20/141 (14%)

Query  35   VGQIIKDLDGLHIDGTGFEPGAPCRVDVQKELPRPDQVQPLYLRPG--TDLYWLPNVDGQ  92
            + Q++ ++DG++     F  GA  R         PD + P  LRPG    L ++P  D  
Sbjct  608  INQVLTEMDGMNAKKNVFIIGATNR---------PDIIDPAVLRPGRLDQLIYIPLPD--  656

Query  93   LEIPRGASIELHCSHSFASMDTD-----QRSIRVQCLENTTFAWKGSKMKFRDFTCRQAI  147
             E  R   ++     +  S D D     + ++     + T    +  K+  R+ +  + I
Sbjct  657  -EASRHQILKASLRKTPLSKDLDLTFLAKNTVGFSGADLTEICQRACKLAIRE-SIEKEI  714

Query  148  PYTVERLDRRCGDESLQHPAA  168
                ER DR+   E L    A
Sbjct  715  RIEKERQDRQARGEELMEDDA  735



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016316.1 uncharacterized protein LOC108086263 isoform X1
[Drosophila kikkawai]

Length=1105
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJX3_DROME  unnamed protein product                                 1376    0.0  
O16865_DROME  unnamed protein product                                 1363    0.0  


>Q9VJX3_DROME unnamed protein product
Length=1107

 Score = 1376 bits (3562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 830/1143 (73%), Positives = 912/1143 (80%), Gaps = 74/1143 (6%)

Query  1     MSETFKLSG--MQRSNIELERRRHLANWLLNSSPHM--------AAAAASTATPTAAAAA  50
             M+ET KLSG  MQR+NIELER+RHLANWL+NS PHM          +AA+  TPTA+A  
Sbjct  1     MNETLKLSGLGMQRTNIELERQRHLANWLMNSRPHMPGGPAAATTTSAAAATTPTASATK  60

Query  51    APTGSAQPTTNTGSTGGVAAAVGGAAAAGA-------PSNSVAAASAAACNGGTTTGPHH  103
               T +   TTN GST G A A        A       PSNSVAAA+AAACNGG   G HH
Sbjct  61    GATTTTATTTNPGSTVGGAGAGPVGGNGVATAAAAGAPSNSVAAAAAAACNGGAAVGAHH  120

Query  104   GHHPLAGGAGARKPKLRRFNSHDTSSNMFSVAEFENARLARRNEIELSQRLARRLRSSAK  163
             GHH     AGARKPKLRRFNSHDTSSNMFSVA+FENARLARRNEIEL+QR ARR+R    
Sbjct  121   GHH---SAAGARKPKLRRFNSHDTSSNMFSVADFENARLARRNEIELNQRRARRVR----  173

Query  164   WELGAAAVISGSGSGPRAAAGGGYSGFCGGLNGSGDYSTGDSKASKGSNESQQEALPADV  223
                G+A   +          GG +SG+C  LNGSGDYSTGDSKASKGS+E    AL A  
Sbjct  174   ---GSANNSTYGLGSGSGLLGGAHSGYCDALNGSGDYSTGDSKASKGSSEG---ALTAIE  227

Query  224   FLERNTLPRVARILHTSKNSNETLQSSSSHGSSTAASSSSSVEVKPVVSGAGNIS-----  278
             FLERN+LPRV RILH SK+SNETLQSSSSHGSSTAASSSSS    P  SG          
Sbjct  228   FLERNSLPRVVRILHASKSSNETLQSSSSHGSSTAASSSSSTGANPFGSGGSGGGNISSG  287

Query  279   --NGRIDTCTGTGNHSSSSGGSVTGIGSGSGSVLAPGQQTKKSQNSSHGGIPPGHDELFL  336
               +    + +  G+ + +  GS  G+ SGSGS    G Q    ++SS+GG PPGHDELFL
Sbjct  288   NIDTGTHSSSSGGSATGNGTGSGPGLSSGSGSGSGSGHQNNNGRHSSNGGTPPGHDELFL  347

Query  337   LYRLVRQRNIYHGHNAKSQAAQRKKTVLIPQEFSGYFSLLSEKGLPTATQYGSLMQLVRE  396
             LYRLVRQRNIYHGHNAK+QA+QRKKT+LIPQEF GYFS+LSEKGLPTATQYGSL+QLVRE
Sbjct  348   LYRLVRQRNIYHGHNAKTQASQRKKTLLIPQEFPGYFSMLSEKGLPTATQYGSLIQLVRE  407

Query  397   RVYKFASVDNMPAFTESSTSTSATSPTHEGCLPIIIKGRPQYIKTTARGGQVFRLLAVFE  456
             RVYKF SVDNMPAFTESS +++++  THEGCLP I KGRPQY+KTTARGGQVFRLLAVFE
Sbjct  408   RVYKFVSVDNMPAFTESSPNSTSSP-THEGCLP-INKGRPQYVKTTARGGQVFRLLAVFE  465

Query  457   DGKQEQHHANLSQHCNASNASKSHSSGGYLGREKEKNRYAQLLNDNRQVFYVPLSTKGKF  516
             DGKQ+Q   N+SQH N  NA++SH S GY+GREKEKNRYAQLLN+NRQV YVPLSTKGKF
Sbjct  466   DGKQDQ--VNMSQHGNG-NATRSHGS-GYMGREKEKNRYAQLLNENRQVLYVPLSTKGKF  521

Query  517   YEIEPGIPQLLQKLGDAQRKLNPECVHRLGALVAAAKQLPLTLRYISGPGSGSEIPEQLC  576
             YEIEPGIPQLLQKLGDAQRKLNPECVHRL ALV AAKQLPLTLRYISGPG G +IPEQLC
Sbjct  522   YEIEPGIPQLLQKLGDAQRKLNPECVHRLSALVTAAKQLPLTLRYISGPG-GPDIPEQLC  580

Query  577   ISQVSKEDVVIGCSIEDVDAQTPLQLKKFYPSRDVQLVKSFLGFDTEQRMLANTNVQNML  636
             ISQVSKEDVV+GCSIEDVD QTPLQL+KFYPSRD+QLVKS+LGFD+EQRMLANTNVQNML
Sbjct  581   ISQVSKEDVVVGCSIEDVDTQTPLQLRKFYPSRDIQLVKSYLGFDSEQRMLANTNVQNML  640

Query  637   KFCQFNCDSFLKLVEIDTAQRADRSGSKSSREGLRILKPLHLPKILRREKSSMAAGHEKE  696
             KFCQFNCD FLKLVEI+  QR++RSGSK +REGLRILKPLH PKILRREKSSMAA HEKE
Sbjct  641   KFCQFNCDPFLKLVEIELIQRSERSGSK-NREGLRILKPLHFPKILRREKSSMAAAHEKE  699

Query  697   DSIIFLSKSDLENLEEAKEAASA--------NRISERMKVFQSTKKKWFGK-NQPQHQQH  747
             DSIIFLSKSDLENLE  + AASA        NRISERM+VFQSTKKKWFGK +  Q Q  
Sbjct  700   DSIIFLSKSDLENLEAKEAAASAAAHSESSLNRISERMRVFQSTKKKWFGKHHPQQQQPQ  759

Query  748   LEKQQSNLDLDEQAKRMSMERYTDMSKLLQERFGSEHPDQPDKDDGISLNSTGASDTETT  807
             +EK QS+LDLDEQAKRMSMERYTDMSKLLQERFGS +P+QP++ D ISLNST ASDTETT
Sbjct  760   IEKHQSDLDLDEQAKRMSMERYTDMSKLLQERFGS-NPEQPEQ-DAISLNSTAASDTETT  817

Query  808   TLTTMEHKSLDTLLQKSMSLQDIELLNGGQRKSARPDLLVSHSHADVDAISEAGTELDDV  867
              LTTME +SLDT++QKSMSLQDIELLNG  ++  RPDLL SH+H   DAISEAGTEL+DV
Sbjct  818   MLTTMEPRSLDTMMQKSMSLQDIELLNGQCKQ--RPDLLASHNHN--DAISEAGTELEDV  873

Query  868   ENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQMRHFSLPQKLQLHEAEREKRHLMQL  927
             ENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQ+  FSLPQKLQLHEAE+EKRHLM L
Sbjct  874   ENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQLPLFSLPQKLQLHEAEKEKRHLMLL  933

Query  928   KAKQLSSAKEPVAGRRAAGGVCLLGGGLNQLPGSPSPFSLVEDDLPYSSVRDSLVTAGDG  987
             KA+Q +  KEPV GRRAAGGV LLGGGLNQL  SP+  SLVEDDLPYSSVRDSLV +G  
Sbjct  934   KAQQQALTKEPVTGRRAAGGVSLLGGGLNQLAISPA--SLVEDDLPYSSVRDSLVISGGD  991

Query  988   CLRSAEIATRPRSTPVVDYTKENIYAEICPPLHTV----GTPPFNGAPDDDGDYASLKYP  1043
             CLRS E A+RP   P VDYTKENIYAEICP  HTV    G   F   PDDDGDYASLKY 
Sbjct  992   CLRS-ESASRP--VPAVDYTKENIYAEICPS-HTVDTFSGATQFTHVPDDDGDYASLKY-  1046

Query  1044  SASSGPQSVSRIEVNG-DATKSGAAISYHTVYLGEMPLGERHTAQHITTVELAGEDNIYN  1102
              + +GPQSVSRIEVNG  A    +AISYHTVYLGE PLGERH A HITTVELAGEDNIYN
Sbjct  1047  -SVNGPQSVSRIEVNGATAAVKSSAISYHTVYLGEEPLGERHAA-HITTVELAGEDNIYN  1104

Query  1103  TLK  1105
             TLK
Sbjct  1105  TLK  1107


>O16865_DROME unnamed protein product
Length=1096

 Score = 1363 bits (3528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 824/1134 (73%), Positives = 905/1134 (80%), Gaps = 76/1134 (7%)

Query  10    MQRSNIELERRRHLANWLLNSSPHMAAAAASTATPTAAAAA--------APTGSAQPTTN  61
             MQR+NIELER+RHLANWL+NS PHM    A+  T +AAAA           T +   TTN
Sbjct  1     MQRTNIELERQRHLANWLMNSRPHMPGGPAAATTTSAAAATTPAASATKGATTTTTTTTN  60

Query  62    TGSTGGVAAAVGGAAAAGA-------PSNSVAAASAAACNGGTTTGPHHGHHPLAGGAGA  114
              GST G A A        A       PSNSVAAA+AAACNGG   G HHGHH     AGA
Sbjct  61    PGSTVGGAGAGTVGGNGVATAAAAGAPSNSVAAAAAAACNGGAAVGAHHGHH---SAAGA  117

Query  115   RKPKLRRFNSHDTSSNMFSVAEFENARLARRNEIELSQRLARRLRSSAKWELGAAAVISG  174
             RKPKLRRFNSHDTSSNMFSVA+FENARLARRNEIEL+QR ARR+R       G+A   + 
Sbjct  118   RKPKLRRFNSHDTSSNMFSVADFENARLARRNEIELNQRRARRVR-------GSANNSTY  170

Query  175   SGSGPRAAAGGGYSGFCGGLNGSGDYSTGDSKASKGSNESQQEALPADVFLERNTLPRVA  234
                      GG +SG+C  LNGSGDYSTGDSKASKGS+E    AL A  FLERN+LPRV 
Sbjct  171   GLGSGSGLLGGAHSGYCDALNGSGDYSTGDSKASKGSSEG---ALTAIEFLERNSLPRVV  227

Query  235   RILHTSKNSNETLQSSSSHGSSTAASSSSSVEVKPVVSGAGNIS-------NGRIDTCTG  287
             RILH SK+SNETLQSSSSHGSSTAASSSSS    P  SG            +    + + 
Sbjct  228   RILHASKSSNETLQSSSSHGSSTAASSSSSTGANPFGSGGSGGGNISSGNIDTGTHSSSS  287

Query  288   TGNHSSSSGGSVTGIGSGSGSVLAPGQQTKKSQNSSHGGIPPGHDELFLLYRLVRQRNIY  347
              G+ + +  GS  G+ SGSGS    G Q    ++SS+GG PPGHDELFLLYRLVRQRNIY
Sbjct  288   GGSATGNGTGSGPGLSSGSGSGSGSGHQNNNGRHSSNGGTPPGHDELFLLYRLVRQRNIY  347

Query  348   HGHNAKSQAAQRKKTVLIPQEFSGYFSLLSEKGLPTATQYGSLMQLVRERVYKFASVDNM  407
             HGHNAK+QA+QRKKT+LIPQEF GYFS+LSEKGLPTATQYGSL+QLVRERVYKF SVDNM
Sbjct  348   HGHNAKTQASQRKKTLLIPQEFPGYFSMLSEKGLPTATQYGSLIQLVRERVYKFVSVDNM  407

Query  408   PAFTESSTSTSATSPTHEGCLPIIIKGRPQYIKTTARGGQVFRLLAVFEDGKQEQHHANL  467
             PAFTESS +++++  THEGCLP I KGRPQY+KTTARGGQVFRLLAVFEDGKQ+Q   N+
Sbjct  408   PAFTESSPNSTSSP-THEGCLP-INKGRPQYVKTTARGGQVFRLLAVFEDGKQDQ--VNM  463

Query  468   SQHCNASNASKSHSSGGYLGREKEKNRYAQLLNDNRQVFYVPLSTKGKFYEIEPGIPQLL  527
             SQH N  NA++SH S GY+GREKEKNRYAQLLN+NRQV YVPLSTKGKFYEIEPGIPQLL
Sbjct  464   SQHGNG-NATRSHGS-GYMGREKEKNRYAQLLNENRQVLYVPLSTKGKFYEIEPGIPQLL  521

Query  528   QKLGDAQRKLNPECVHRLGALVAAAKQLPLTLRYISGPGSGSEIPEQLCISQVSKEDVVI  587
             QKLGDAQRKLNPECVHRL ALV AAKQLPLTLRYISGPG G +IPEQLCISQVSKEDVV+
Sbjct  522   QKLGDAQRKLNPECVHRLSALVTAAKQLPLTLRYISGPG-GPDIPEQLCISQVSKEDVVV  580

Query  588   GCSIEDVDAQTPLQLKKFYPSRDVQLVKSFLGFDTEQRMLANTNVQNMLKFCQFNCDSFL  647
             GCSIEDVD QTPLQL+KFYPSRD+QLVKS+LGFD+EQRMLANTNVQNMLKFCQFNCD FL
Sbjct  581   GCSIEDVDTQTPLQLRKFYPSRDIQLVKSYLGFDSEQRMLANTNVQNMLKFCQFNCDPFL  640

Query  648   KLVEIDTAQRADRSGSKSSREGLRILKPLHLPKILRREKSSMAAGHEKEDSIIFLSKSDL  707
             KLVEI+  QR++RSGSK +REGLRILKPLH PKILRREKSSMAA HEKEDSIIFLSKSDL
Sbjct  641   KLVEIELIQRSERSGSK-NREGLRILKPLHFPKILRREKSSMAAAHEKEDSIIFLSKSDL  699

Query  708   ENLEEAKEAASA--------NRISERMKVFQSTKKKWFGK-NQPQHQQHLEKQQSNLDLD  758
             ENLE  + AASA        NRISERM+VFQSTKKKWFGK +  Q Q  +EK QS+LDLD
Sbjct  700   ENLEAKEAAASAAAHSESSLNRISERMRVFQSTKKKWFGKHHPQQQQPQIEKHQSDLDLD  759

Query  759   EQAKRMSMERYTDMSKLLQERFGSEHPDQPDKDDGISLNSTGASDTETTTLTTMEHKSLD  818
             EQAKRMSMERYTDMSKLLQERFGS +P+QP++ D ISLNST ASDTETT LTTME +SLD
Sbjct  760   EQAKRMSMERYTDMSKLLQERFGS-NPEQPEQ-DAISLNSTAASDTETTMLTTMEPRSLD  817

Query  819   TLLQKSMSLQDIELLNGGQRKSARPDLLVSHSHADVDAISEAGTELDDVENQTPPPQSFI  878
             T++QKSMSLQDIELLNG  ++  RPDLL SH+H   DAISEAGTEL+DVENQTPPPQSFI
Sbjct  818   TMMQKSMSLQDIELLNGQCKQ--RPDLLASHNHN--DAISEAGTELEDVENQTPPPQSFI  873

Query  879   TEKLYNEFHVKTRQYSKSSSSLHQMRHFSLPQKLQLHEAEREKRHLMQLKAKQLSSAKEP  938
             TEKLYNEFHVKTRQYSKSSSSLHQ+  FSLPQKLQLHEAE+EKRHLM LKA+Q +  KEP
Sbjct  874   TEKLYNEFHVKTRQYSKSSSSLHQLPLFSLPQKLQLHEAEKEKRHLMLLKAQQQALTKEP  933

Query  939   VAGRRAAGGVCLLGGGLNQLPGSPSPFSLVEDDLPYSSVRDSLVTAGDGCLRSAEIATRP  998
             V GRRAAGGV LLGGGLNQL  SP+  SLVEDDLPYSSVRDSLV +G  CLRS E A+RP
Sbjct  934   VTGRRAAGGVSLLGGGLNQLAISPA--SLVEDDLPYSSVRDSLVISGGDCLRS-ESASRP  990

Query  999   RSTPVVDYTKENIYAEICPPLHTVGTPPFNGA------PDDDGDYASLKYPSASSGPQSV  1052
                P VDYTKENIYAEICP  HTV T  F+GA      PDDDGDYASLKY  + +GPQSV
Sbjct  991   --VPAVDYTKENIYAEICPS-HTVDT--FSGATQLTHVPDDDGDYASLKY--SVNGPQSV  1043

Query  1053  SRIEVNG-DATKSGAAISYHTVYLGEMPLGERHTAQHITTVELAGEDNIYNTLK  1105
             SRIEVNG  A    +AISYHTVYLGE PLGERH A HITTVELAGEDNIYNTLK
Sbjct  1044  SRIEVNGATAAVKSSAISYHTVYLGEEPLGERHAA-HITTVELAGEDNIYNTLK  1096



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016317.2 putative odorant receptor 69a [Drosophila kikkawai]

Length=665
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR85C_DROME  unnamed protein product                                  65.5    4e-11
OR85B_DROME  unnamed protein product                                  59.3    4e-09
OR67C_DROME  unnamed protein product                                  57.8    1e-08


>OR85C_DROME unnamed protein product
Length=389

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 66/276 (24%), Positives = 118/276 (43%), Gaps = 24/276 (9%)

Query  29   SSGKKRTLAKDILLGLGALQLVYHNFGFLVY-GI-YIDGSSKDPLLYLSEWSTVVSMLAF  86
            S  KK +L   +L     + L    FG ++Y G+ Y DG   D +       TV+S + F
Sbjct  23   SRSKKASLWSHLLFWANVINLSVIVFGEILYLGVAYSDGKFIDAV-------TVLSYIGF  75

Query  87   TIVGTLNLWMLLYNKPQIEEIFQDFEELYK--YAAQKKYRTQQYYEAYTRYLRNLVVFYG  144
             IVG   ++ + + K  + ++ ++ E +Y    A ++ YR  +Y  + +R      + Y 
Sbjct  76   VIVGMSKMFFIWWKKTDLSDLVKELEHIYPNGKAEEEMYRLDRYLRSCSRISITYALLYS  135

Query  145  IAIVYYNLLPFILMLWEHFLTESRHLSYTVQSNTWYPWSVTGSIIGFSAAYVQQ-----A  199
            + I  +NL   +  L    L + R +  T+    ++PW+   +   +   + Q      +
Sbjct  136  VLIWTFNLFSIMQFLVYEKLLKIRVVGQTLPYLMYFPWNWHENWTYYVLLFCQNFAGHTS  195

Query  200  TSCQIFMVTIVLAQFLVNFFGTQLEIHFDGLARQLE--TIDARGPRAKDQLRSLVVYQCR  257
             S QI          L+    TQ+ +HFD LAR +E   +D         L   V Y  R
Sbjct  196  ASGQI------STDLLLCAVATQVVMHFDYLARVVEKQVLDRDWSENSRFLAKTVQYHQR  249

Query  258  LFKVADRVNSMFDLTFFVGLSASALSLGFLAIQMTT  293
            + ++ D +N +F +   +    S   + F+  QMT 
Sbjct  250  ILRLMDVLNDIFGIPLLLNFMVSTFVICFVGFQMTV  285


 Score = 42.4 bits (98),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/252 (20%), Positives = 108/252 (43%), Gaps = 21/252 (8%)

Query  352  ESPRQRQTLFQKVIFIMACINLLYYNISLCVYCYLLDRNSMDTLSYVAEISDTGSMLGFT  411
            +S  ++ +L+  ++F    INL     S+ V+  +L      +     +     S +GF 
Sbjct  22   DSRSKKASLWSHLLFWANVINL-----SVIVFGEILYLGVAYSDGKFIDAVTVLSYIGFV  76

Query  412  VLGTLNMFVLLKCRPPIEEMLSGLQELFEQRGKCNHQTL---YYMEKSSLLMKKFTVFYM  468
            ++G   MF +   +  + +++  L+ ++   GK   +      Y+   S +   + + Y 
Sbjct  77   IVGMSKMFFIWWKKTDLSDLVKELEHIYPN-GKAEEEMYRLDRYLRSCSRISITYALLYS  135

Query  469  VSNCYYNVVPTL-VMVYETLSESQELSYRIQTSCWYPWEVVGS----MRGFCASYISQIF  523
            V    +N+   +  +VYE L + + +   +    ++PW    +    +  FC ++     
Sbjct  136  VLIWTFNLFSIMQFLVYEKLLKIRVVGQTLPYLMYFPWNWHENWTYYVLLFCQNFAGHTS  195

Query  524  SSAQNIGFIAIMKFLVNVCTTQLELHFDGLVNQLEN-LNARDFRSKDK-LKSLIFYHHKL  581
            +S Q          L+    TQ+ +HFD L   +E  +  RD+    + L   + YH ++
Sbjct  196  ASGQ-----ISTDLLLCAVATQVVMHFDYLARVVEKQVLDRDWSENSRFLAKTVQYHQRI  250

Query  582  LQLAENINRIFN  593
            L+L + +N IF 
Sbjct  251  LRLMDVLNDIFG  262


>OR85B_DROME unnamed protein product
Length=390

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 111/264 (42%), Gaps = 34/264 (13%)

Query  76   EWSTVVSMLAFTIVGTLNLWMLLYNKPQIEEIFQDFEELYKYA--AQKKYRTQQYYEAYT  133
            E  T +S + F  VG   ++ + + K  I E+  + +E+Y      +++Y    Y    +
Sbjct  66   EAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCS  125

Query  134  RYLRNLVVFYGIAIVYYNLLP----FILMLWEHFLTESRHLSYTV------QSN-TWYPW  182
            R      + Y + I  +NL      ++   W +     + L Y +      Q N ++YP 
Sbjct  126  RISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPL  185

Query  183  SVTGSIIGFSAAYVQQATSCQIFMVTIVLAQFLVNFFGTQLEIHFDGLARQLETIDARGP  242
              + +  G+++A  Q +T   +  V             TQL +HFD L+  +E  +  G 
Sbjct  186  LFSQNFAGYTSAAGQISTDVLLCAV------------ATQLVMHFDFLSNSMERHELSGD  233

Query  243  RAKDQ--LRSLVVYQCRLFKVADRVNSMFDLTFFVGLSASALSLGFLAIQMTTLDFGSAV  300
              KD   L  +V Y  R+ +++D VN +F +   +    S+  + F+  QMT    G   
Sbjct  234  WKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTV---GVPP  290

Query  301  KNFIGLLIMLIYSFS----MCRNG  320
               + L + L+ S S    +C  G
Sbjct  291  DIVVKLFLFLVSSMSQVYLICHYG  314


 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 83/387 (21%), Positives = 156/387 (40%), Gaps = 92/387 (24%)

Query  349  KGRESPRQRQTLFQKVIFIMACINLLYYNI--SLCVYCYLLDRNSMDTLSYVAEISDTGS  406
             G ES   +  L   ++F    INL +  +  S+ VY   +D   ++ ++ +       S
Sbjct  22   NGEESKMNK--LIFHIVFWSNVINLSFVGLFESIYVYSAFMDNKFLEAVTAL-------S  72

Query  407  MLGFTVLGTLNMFVLLKCRPPIEEMLSGLQELF------EQR-------GKCNHQTLYYM  453
             +GF  +G   MF +   +  I E+++ L+E++      E+R       G C+  +L Y 
Sbjct  73   YIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLPMYLGTCSRISLIYS  132

Query  454  EKSSLLMKKFTVFYMVSNCYYNVVPTLVMVYETLSESQELSYRIQTS-CWYPWEVVGSMR  512
               S+L+  F +F ++    Y+    + +V + L     + ++ Q +  +YP     +  
Sbjct  133  LLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFA  192

Query  513  GFCASYISQIFSSAQNIGFIAIMKFLVNVCTTQLELHFDGLVNQLENLNARDFRSKDK--  570
            G+         S+A  I        L+    TQL +HFD L N +E         KD   
Sbjct  193  GYT--------SAAGQIS----TDVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSRF  240

Query  571  LKSLIFYHHKLLQLAENINRIFN---------------------------------FTF-  596
            L  ++ YH ++L+L++ +N IF                                  F F 
Sbjct  241  LVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVICFVGFQMTVGVPPDIVVKLFLFL  300

Query  597  ------------FSEKVMPAAF------YN-NWYEGDLAYRKMLLILMMRSTKPYMWRTY  637
                        + + V  A++      YN  WY+ D+ Y++ L+I++ RS K    +  
Sbjct  301  VSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRYKRALVIIIARSQKVTFLKAT  360

Query  638  KLAPVSVTTYMATLKFSYQMFTCVRSL  664
                ++ +T    L+ SY+ F  +R++
Sbjct  361  IFLDITRSTMTDLLQISYKFFALLRTM  387


>OR67C_DROME unnamed protein product
Length=404

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 73/181 (40%), Gaps = 55/181 (30%)

Query  538  LVNVCTTQLELHFDGLVNQLENLNARDFRSKDKLK---SLIFYHHKLLQLAENINRIFNF  594
            L+ V  TQ+ +HF+ +  +LE+        K+ ++    +I YH K L+L E++N +++F
Sbjct  219  LLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIRYHDKCLKLCEHVNDLYSF  278

Query  595  TFF----------------------------------------------------SEKVM  602
            +                                                      S KV 
Sbjct  279  SLLLNFLMASMQICFIAFQVTESTVEVIIIYCIFLMTSMVQVFMVCYYGDTLIAASLKVG  338

Query  603  PAAFYNNWYEGDLAYRKMLLILMMRSTKPYMWRTYKLAPVSVTTYMATLKFSYQMFTCVR  662
             AA+   W++   +Y  ML +L+MRS KP   R     P+S+ TYM  +  SYQ F  +R
Sbjct  339  DAAYNQKWFQCSKSYCTMLKLLIMRSQKPASIRPPTFPPISLVTYMKVISMSYQFFALLR  398

Query  663  S  663
            +
Sbjct  399  T  399


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 61/313 (19%), Positives = 129/313 (41%), Gaps = 23/313 (7%)

Query  26   GRRSSGKKRTLAKDILLGLGALQLVYHNFGFLVYG--IYIDGSSKDPLLYLSEWSTVVSM  83
              RS+   ++L   I L  G     + NF  LV G  ++   S +D    +     V   
Sbjct  32   AHRSTNPLKSLLFKIYLYAG-----FINFNLLVIGELVFFYNSIQD-FETIRLAIAVAPC  85

Query  84   LAFTIVGTLNLWMLLYNKPQIEEIFQDFEELYK--YAAQKKYRTQQYYEAYTRYLRNLVV  141
            + F++V       ++  K  +  +  D E ++    A Q +Y+   + +   R + N+  
Sbjct  86   IGFSLVADFKQAAMIRGKKTLIMLLDDLENMHPKTLAKQMEYKLPDFEKTMKRVI-NIFT  144

Query  142  FYGIA-IVYYNLLPFILMLWE-HFL---TESRHLSYTVQSNTWYPWSVTGSIIGFSAAYV  196
            F  +A    ++  P I    + +FL   T  R+  + +    W+P+  T + + +   Y 
Sbjct  145  FLCLAYTTTFSFYPAIKASVKFNFLGYDTFDRNFGFLI----WFPFDATRNNLIYWIMYW  200

Query  197  QQATSCQIFMVTIVLAQFLVNFFGTQLEIHFDGLARQLETIDARGPRAKDQLR---SLVV  253
              A    +  +  + A  L+    TQ+ +HF+ ++ +LE         K+ +     ++ 
Sbjct  201  DIAHGAYLAGIAFLCADLLLVVVITQICMHFNYISMRLEDHPCNSNEDKENIEFLIGIIR  260

Query  254  YQCRLFKVADRVNSMFDLTFFVGLSASALSLGFLAIQMTTLDFGSAVKNFIGLLIMLIYS  313
            Y  +  K+ + VN ++  +  +    +++ + F+A Q+T       +   I L+  ++  
Sbjct  261  YHDKCLKLCEHVNDLYSFSLLLNFLMASMQICFIAFQVTESTVEVIIIYCIFLMTSMVQV  320

Query  314  FSMCRNGTRLTLA  326
            F +C  G  L  A
Sbjct  321  FMVCYYGDTLIAA  333



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016318.1 putative odorant receptor 69a [Drosophila kikkawai]

Length=386
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR85C_DROME  unnamed protein product                                  35.4    0.070
MYLKA_DICDI  unnamed protein product                                  31.6    0.93 
DLPB_DICDI  unnamed protein product                                   30.4    3.5  


>OR85C_DROME unnamed protein product
Length=389

 Score = 35.4 bits (80),  Expect = 0.070, Method: Compositional matrix adjust.
 Identities = 53/251 (21%), Positives = 101/251 (40%), Gaps = 41/251 (16%)

Query  76   EFMKYPDWLCRMALLPKYHWRGRQSSAEHFSLAKRIVLMVGLLHLAYHNFGCIMYGYHVD  135
            +FMKY  +      +  Y    R   A   SL   ++    +++L+   FG I+Y     
Sbjct  2    KFMKYAVFFYTSVGIEPYTIDSRSKKA---SLWSHLLFWANVINLSVIVFGEILYLGVAY  58

Query  136  RTSKDPFRYVAELATVGSMLGFTVVGTLNLWKLLYFKPEIEDMLGDFEELFK--LADTNT  193
               K       +  TV S +GF +VG   ++ + + K ++ D++ + E ++    A+   
Sbjct  59   SDGK-----FIDAVTVLSYIGFVIVGMSKMFFIWWKKTDLSDLVKELEHIYPNGKAEEEM  113

Query  194  HRASMYYQGYTRFIKGLVFKHEHVIAFSSSIVYYDSLPLTLMLWE-------HFMTESKE  246
            +R   Y +  +R                 SI Y  +L  ++++W         F+   K 
Sbjct  114  YRLDRYLRSCSRI----------------SITY--ALLYSVLIWTFNLFSIMQFLVYEKL  155

Query  247  LSYQIQSST-----WYPWQIQGSVLGFGAAFILQTFSCQLLMASIMISQYLVSFCGTQLE  301
            L  ++   T     ++PW    +   +   F  Q F+     +  + +  L+    TQ+ 
Sbjct  156  LKIRVVGQTLPYLMYFPWNWHENWTYYVLLFC-QNFAGHTSASGQISTDLLLCAVATQVV  214

Query  302  IHFDGLARQLE  312
            +HFD LAR +E
Sbjct  215  MHFDYLARVVE  225


>MYLKA_DICDI unnamed protein product
Length=295

 Score = 31.6 bits (70),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 24/76 (32%), Positives = 34/76 (45%), Gaps = 7/76 (9%)

Query  51   DYPTNYDQKNELGKAVLIPNQMRLEEFMKYPDWL-------CRMALLPKYHWRGRQSSAE  103
            DY  N   + ++ K V  PN + L+E    P+ L           L  K   +G  S A+
Sbjct  47   DYEKNLKMEVDILKKVNHPNIIALKELFDTPEKLYLVMELVTGGELFDKIVEKGSYSEAD  106

Query  104  HFSLAKRIVLMVGLLH  119
              +L K+IV  VG LH
Sbjct  107  AANLVKKIVSAVGYLH  122


>DLPB_DICDI unnamed protein product
Length=808

 Score = 30.4 bits (67),  Expect = 3.5, Method: Compositional matrix adjust.
 Identities = 48/223 (22%), Positives = 87/223 (39%), Gaps = 22/223 (10%)

Query  30   VICYFGTEVTIASNQLSVHTVDYPTNYDQKNELGKAVLIPNQMRLEEFMKYPDWLCRMAL  89
             I   G  +T  +NQL+             N++ K + I N+M  E   +Y     R  +
Sbjct  161  AITIQGQSMTSPANQLA-------------NKIAK-LSIGNEMG-EMITQYTKSNNRTLV  205

Query  90   LPKYHWRGRQSSAEHFSLAKRIVLMVGLLHLAYHNFGCIMYGYHVDRTSKDPFRYVAELA  149
              +    G  +S+E   LAK++   +      ++ F  ++ G       +D  R++    
Sbjct  206  FVETSTNGGTNSSEMLELAKKLDYKLDRSIFVFNKFHSLLTGDQPFTNGRDANRFLGS-P  264

Query  150  TVGSMLGFTVVGTLNLWKLLYFKPEIEDMLGDFEELFKLADTNTHRASMYYQGYTRFIKG  209
            ++G+   FT + +         K    D L    +  +  D N      + + Y R +  
Sbjct  265  SIGAPTFFTTLPSTAQRSQCNSK----DQLSQLCDQLQQTDLNILEQLQFDKKYERNVGL  320

Query  210  LVFKHEHVIAFSSSIVYYDSLPLTLMLWEHFMTESKELSYQIQ  252
              F+H   I+  +   Y DS+P  L     F T S++  YQI+
Sbjct  321  SAFRH--WISEFTWRKYLDSVPEVLKRLNSFRTTSEDQLYQIR  361



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016319.2 putative odorant receptor 69a [Drosophila kikkawai]

Length=417
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OR67A_DROME  unnamed protein product                                  47.0    2e-05
OR1_ANOGA  unnamed protein product                                    46.2    3e-05
OR85C_DROME  unnamed protein product                                  45.8    4e-05


>OR67A_DROME unnamed protein product
Length=407

 Score = 47.0 bits (110),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/277 (21%), Positives = 120/277 (43%), Gaps = 44/277 (16%)

Query  67   VKDTKSFVAELSEMCGYLMLTFVGIGNILTFTLNRPQIEVAFKNLQDLYPRPGQRHYRCQ  126
            ++D ++F+ E   +  Y+    +G+  I      +P++    + L+  +P P  +    Q
Sbjct  70   LRDNENFL-ESCILLSYVSFVVMGLSKIGAVMKKKPKMTALVRQLETCFPSPSAK---VQ  125

Query  127  HYFDLPLFLMKLQYW---FYVMFLVYYNGFPILLL-------VWEYLTEAKTLSYRAQTK  176
              + +  +L +   +   F  +F++ Y    ++ L       V  +  +AK +    Q +
Sbjct  126  EEYAVKSWLKRCHIYTKGFGGLFMIMYFAHALIPLFIYFIQRVLLHYPDAKQIMPFYQLE  185

Query  177  AW--------YPWKIYGSAIGYSASLCCQALGCLIGVGMSLAALNIVSVFTFQLKLHYDA  228
             W        YP   + S+ GY+A+  C   G + G  M  A +        Q+ +HY+ 
Sbjct  186  PWEFRDSWLFYPSYFHQSSAGYTAT--C---GSIAGDLMIFAVV-------LQVIMHYER  233

Query  229  MASQLLSLDSRHPKAH-------KKLKSLIAYHCRILQLGEQFNHILNFYFVATLIGSTI  281
            +A  L     +   A        +KL+SL+A H  IL+L +  N +     +   I S +
Sbjct  234  LAKVLREFKIQAHNAPNGAKEDIRKLQSLVANHIDILRLTDLMNEVFGIPLLLNFIASAL  293

Query  282  AICMTSVAVLLLDLASAF--KAILGIVAFVLYHFVIC  316
             +C+  V  L + L+  +  K +L +++ +L  +++C
Sbjct  294  LVCLVGVQ-LTIALSPEYFCKQMLFLISVLLEVYLLC  329


>OR1_ANOGA unnamed protein product
Length=417

 Score = 46.2 bits (108),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 63/291 (22%), Positives = 109/291 (37%), Gaps = 42/291 (14%)

Query  62   IYGRTVKDTKSFVAELSEMCGYLMLTFVGIGNILTFTLNRPQIEVAFKNLQDLYPRPGQR  121
            +Y + VKD    + +++     LM     I  +  F  N  +I+   + L      P QR
Sbjct  66   LYFKDVKD----INDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNCTLYHPKQR  121

Query  122  HYRCQHYFDLPLFLMKLQYWFYVMFLVYYNGFPILLLVWEYLTEAKTLSYRAQTKAWYPW  181
                   F   L  M   +W  ++FL++   F I++ V   ++ A     R    AW+P 
Sbjct  122  EE-----FSPVLQSMSGVFWL-MIFLMFVAIFTIIMWV---MSPAFDNERRLPVPAWFPV  172

Query  182  KIYGSAIGYSASLCCQALGCLIGVGMSLAALNIVSVFTFQL------------KLHYDAM  229
              + S I Y      Q +G ++    + +   + S     +            KL +D  
Sbjct  173  DYHHSDIVYGVLFLYQTIGIVMSATYNFSTDTMFSGLMLHINGQIVRLGSMVKKLGHDVP  232

Query  230  AS-QLLSLDSRHPKAHK--------------KLKSLIAYHCRILQLGEQFNHILNFYFVA  274
               QL++ D+   +  K              K+   + +H  IL  G++   I      A
Sbjct  233  PERQLVATDAEWKEMRKRIDHHSKVYGTMYAKVTECVLFHKDILSFGDEVQDIFQGSIFA  292

Query  275  TLIGSTIAICMTSVAVLLLDLASAFKAILGIVAFVLYH--FVICYMGTEVN  323
             +  S I ICMT +     D+  A     G    V+    F+ CY+G E++
Sbjct  293  QVCASVIIICMTLLQATGDDVTMADLLGCGFYLLVMTSQVFIFCYVGNEIS  343


>OR85C_DROME unnamed protein product
Length=389

 Score = 45.8 bits (107),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/237 (22%), Positives = 93/237 (39%), Gaps = 6/237 (3%)

Query  53   NIGVIIYWYIYGRTVKDTKSFVAELSEMCGYLMLTFVGIGNILTFTLNRPQIEVAFKNLQ  112
            N+ VI++  I    V  +     +   +  Y+    VG+  +      +  +    K L+
Sbjct  42   NLSVIVFGEILYLGVAYSDGKFIDAVTVLSYIGFVIVGMSKMFFIWWKKTDLSDLVKELE  101

Query  113  DLYP--RPGQRHYRCQHYFDLPLFLMKLQYWFYVMFLVYYNGFPIL-LLVWEYLTEAKTL  169
             +YP  +  +  YR   Y      +       Y + +  +N F I+  LV+E L + + +
Sbjct  102  HIYPNGKAEEEMYRLDRYLRSCSRISITYALLYSVLIWTFNLFSIMQFLVYEKLLKIRVV  161

Query  170  SYRAQTKAWYPWKIYGSAIGYSASLCCQALGCLIGVGMSLAALNIVSVFTFQLKLHYDAM  229
                    ++PW  + +   Y    C    G     G     L + +V T Q+ +H+D +
Sbjct  162  GQTLPYLMYFPWNWHENWTYYVLLFCQNFAGHTSASGQISTDLLLCAVAT-QVVMHFDYL  220

Query  230  ASQLLS--LDSRHPKAHKKLKSLIAYHCRILQLGEQFNHILNFYFVATLIGSTIAIC  284
            A  +    LD    +  + L   + YH RIL+L +  N I     +   + ST  IC
Sbjct  221  ARVVEKQVLDRDWSENSRFLAKTVQYHQRILRLMDVLNDIFGIPLLLNFMVSTFVIC  277



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016320.1 P protein [Drosophila kikkawai]

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

E9AFX7_LEIMA  unnamed protein product                                 35.0    0.21 
Q4GZ10_TRYB2  unnamed protein product                                 30.0    8.0  


>E9AFX7_LEIMA unnamed protein product
Length=560

 Score = 35.0 bits (79),  Expect = 0.21, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 43/94 (46%), Gaps = 9/94 (10%)

Query  495  GLIHWLSEQT-----VALIGSADQRYQTMVAILLILWI--SGILAAIVGNVPVTTMMLKL  547
            G +H+  E +     V + G+AD   +   A+ +  +I  +  LAA+V N   T + +K 
Sbjct  156  GFVHFKDETSAKDAIVKMNGAADHASEDKKALYVANFIRRNARLAALVANF--TNVYIKQ  213

Query  548  ILRLVNSDKISVPLSPLVWALSFGACYGANGTLF  581
            +L  VN D I    +      S  AC   +G +F
Sbjct  214  VLPTVNKDVIEKFFAKFGGITSAAACKDKSGRVF  247


>Q4GZ10_TRYB2 unnamed protein product
Length=682

 Score = 30.0 bits (66),  Expect = 8.0, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 32/67 (48%), Gaps = 12/67 (18%)

Query  64   DVPMVGVRVEWRDLGMNQTIHRTAMWNVYLLKEPDG-YDETAKLFHIDNRERSGLEAVVS  122
            D P   +RVE    G N  I   A+ N  L+K PDG Y  T  ++         LE  V 
Sbjct  67   DTPSNQMRVEVI-FGANSAI--KALGNTSLIKLPDGSYKGTVTVYP--------LETEVF  115

Query  123  LEGKCDT  129
            +EGKCDT
Sbjct  116  VEGKCDT  122



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016321.1 P protein-like [Drosophila kikkawai]

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

NAD1_CAEEL  unnamed protein product                                   35.4    0.16 
NAD3_CAEEL  unnamed protein product                                   33.5    0.68 
TBA2_CAEEL  unnamed protein product                                   33.1    0.78 


>NAD1_CAEEL unnamed protein product
Length=582

 Score = 35.4 bits (80),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 51/225 (23%), Positives = 87/225 (39%), Gaps = 49/225 (22%)

Query  328  VVIYSNFGGALTLVGEPLNMIL---------ATHTGLDFIKFSVHMVPGILCAVLMGFPV  378
            V   +N GGA T+ G   N++L            TG++F+ + +   P + C ++  + V
Sbjct  228  VCFSANIGGAATITGTASNLVLVGQLNELFPGADTGVNFLSWLIFAFPMVFCCLIYCWCV  287

Query  379  IYLTMRRNLDRLEDNQIMVSAKRKATRPRLSREVARTMA-----------W-LRENQPSR  426
            +YL   R+  +     I+V+ K +     L       MA           W LRE Q   
Sbjct  288  LYLLYLRDAPK---GSIIVTRKLQQKYNELHAFSFAEMAVIFCFALLLVLWILREPQ---  341

Query  427  QCIRPSPKYFGTLAYLQTHHGIRDKLLLAKSLFVLLFVEIGFILNSQPFLPGAAHFKTAL  486
              + P    +G +         +D+ +   +  + + + +  +    P   G++  + A 
Sbjct  342  --VVPG---WGEM--------FKDEFVSDATSAMFIVILLFTLPEKLPSSRGSSEQRKAS  388

Query  487  LGAILLVIMAKLDDLDTVFQYLDWSVVLFLGGHFVFIAVQRELGL  531
             G         L D  TV     WSV+  LGG F   A  +E GL
Sbjct  389  SG---------LLDWATVQDRFPWSVLFLLGGGFALAAGVKESGL  424


>NAD3_CAEEL unnamed protein product
Length=566

 Score = 33.5 bits (75),  Expect = 0.68, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 27/50 (54%), Gaps = 4/50 (8%)

Query  498  LDDLDTVFQYLDWSVVLFLGGHFVFIAVQRELGLIPWLGNQAFKVISSVE  547
            L D  T+ +   WSVVL LGG F   A  +E GL   +GN     +SS+E
Sbjct  392  LMDWKTMQETFPWSVVLLLGGGFALAAGVKESGLSLLIGNS----LSSIE  437


>TBA2_CAEEL unnamed protein product
Length=448

 Score = 33.1 bits (74),  Expect = 0.78, Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 23/50 (46%), Gaps = 10/50 (20%)

Query  339  TLVGEPLNMILATHTGLDFIKFSVHMVPGILCAVLMGFPVIYLTMRRNLD  388
            T V EP N IL THT L+             CA ++    IY   RRNLD
Sbjct  177  TAVVEPYNSILTTHTTLEHSD----------CAFMVDNEAIYDICRRNLD  216



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016322.1 angiopoietin-1-like [Drosophila kikkawai]

Length=203
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

TL5A_TACTR  unnamed protein product                                   44.7    2e-05
SCA_DROME  unnamed protein product                                    43.9    5e-05
TL5B_TACTR  unnamed protein product                                   38.5    0.002


>TL5A_TACTR unnamed protein product
Length=292

 Score = 44.7 bits (104),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 6/75 (8%)

Query  84   GWTVIQCRQSGRYENLAD----SYKNALCGFGEIDGDYWIGFEKLSSIMASHSHVLGIQL  139
            GWTVIQ R  G Y N +D     +KN   GFG I+ D+W+G +++ ++    ++++   L
Sbjct  111  GWTVIQRR--GNYGNPSDYFYKPWKNYKLGFGNIEKDFWLGNDRIFALTNQRNYMIRFDL  168

Query  140  TYSDGSKTYSQYDDF  154
               +    Y+ Y DF
Sbjct  169  KDKENDTRYAIYQDF  183


>SCA_DROME unnamed protein product
Length=799

 Score = 43.9 bits (102),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 48/102 (47%), Gaps = 2/102 (2%)

Query  84   GWTVIQCRQSGRYENLADSYKNALCGFGEIDGDYWIGFEKLSSIMASHSHVLGIQLTYSD  143
            GWT +Q R  G  +    S+ +   GFG   G++WIG E+L  +   +   L +Q+    
Sbjct  572  GWTTVQRRFDGSAD-FNRSWADYAQGFGAPGGEFWIGNEQLHHLTLDNCSRLQVQMQDIY  630

Query  144  GSKTYSQYDDFKLGRGGDRFRIESLGYYMGNDRDFLRYYKDL  185
             +   ++Y  F +    D +R+  +  Y GN  D L Y + +
Sbjct  631  DNVWVAEYKRFYISSRADGYRLH-IAEYSGNASDALNYQQGM  671


>TL5B_TACTR unnamed protein product
Length=316

 Score = 38.5 bits (88),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 29/109 (27%), Positives = 53/109 (49%), Gaps = 9/109 (8%)

Query  84   GWTVIQCRQS-----GRYENLADSYKNALCGFGEIDGDYWIGFEKLSSIMASHSHVLGIQ  138
            GWTVIQ R         +    +SYKN   GFG +  ++W+G + +  +    S VL + 
Sbjct  132  GWTVIQRRGDFGQPIQNFYQTWESYKN---GFGNLTKEFWLGNDIIFVLTNQDSVVLRVD  188

Query  139  LTYSDGSKTYSQYDDFKLGRGGDRFRIESLGYYMGNDRDFLRYYKDLPL  187
            L   +G + Y++  +F +    + +++ S   Y G+  D L  + ++P 
Sbjct  189  LEDFEGGRRYAEAVEFLVRSEIELYKM-SFKTYKGDAGDSLSQHNNMPF  236



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016323.1 uncharacterized protein LOC108086263 isoform X2
[Drosophila kikkawai]

Length=1041
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJX3_DROME  unnamed protein product                                 1322    0.0  
O16865_DROME  unnamed protein product                                 1321    0.0  
Q965D9_DROME  unnamed protein product                                 38.5    0.035


>Q9VJX3_DROME unnamed protein product
Length=1107

 Score = 1322 bits (3422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 768/1025 (75%), Positives = 841/1025 (82%), Gaps = 57/1025 (6%)

Query  38    HHGHHPLAGGAGARKPKLRRFNSHDTSSNMFSVAEFENARLARRNEIELSQRLARRLRSS  97
             HHGHH     AGARKPKLRRFNSHDTSSNMFSVA+FENARLARRNEIEL+QR ARR+R  
Sbjct  119   HHGHH---SAAGARKPKLRRFNSHDTSSNMFSVADFENARLARRNEIELNQRRARRVR--  173

Query  98    AKWELGAAAVISGSGSGPRAAAGGGYSGFCGGLNGSGDYSTGDSKASKGSNESQQEALPA  157
                  G+A   +          GG +SG+C  LNGSGDYSTGDSKASKGS+E    AL A
Sbjct  174   -----GSANNSTYGLGSGSGLLGGAHSGYCDALNGSGDYSTGDSKASKGSSEG---ALTA  225

Query  158   DVFLERNTLPRVARILHTSKNSNETLQSSSSHGSSTAASSSSSVEVKPVVSGAGNIS---  214
               FLERN+LPRV RILH SK+SNETLQSSSSHGSSTAASSSSS    P  SG        
Sbjct  226   IEFLERNSLPRVVRILHASKSSNETLQSSSSHGSSTAASSSSSTGANPFGSGGSGGGNIS  285

Query  215   ----NGRIDTCTGTGNHSSSSGGSVTGIGSGSGSVLAPGQQTKKSQNSSHGGIPPGHDEL  270
                 +    + +  G+ + +  GS  G+ SGSGS    G Q    ++SS+GG PPGHDEL
Sbjct  286   SGNIDTGTHSSSSGGSATGNGTGSGPGLSSGSGSGSGSGHQNNNGRHSSNGGTPPGHDEL  345

Query  271   FLLYRLVRQRNIYHGHNAKSQAAQRKKTVLIPQEFSGYFSLLSEKGLPTATQYGSLMQLV  330
             FLLYRLVRQRNIYHGHNAK+QA+QRKKT+LIPQEF GYFS+LSEKGLPTATQYGSL+QLV
Sbjct  346   FLLYRLVRQRNIYHGHNAKTQASQRKKTLLIPQEFPGYFSMLSEKGLPTATQYGSLIQLV  405

Query  331   RERVYKFASVDNMPAFTESSTSTSATSPTHEGCLPIIIKGRPQYIKTTARGGQVFRLLAV  390
             RERVYKF SVDNMPAFTESS +++++  THEGCLP I KGRPQY+KTTARGGQVFRLLAV
Sbjct  406   RERVYKFVSVDNMPAFTESSPNSTSSP-THEGCLP-INKGRPQYVKTTARGGQVFRLLAV  463

Query  391   FEDGKQEQHHANLSQHCNASNASKSHSSGGYLGREKEKNRYAQLLNDNRQVFYVPLSTKG  450
             FEDGKQ+Q   N+SQH N  NA++SH S GY+GREKEKNRYAQLLN+NRQV YVPLSTKG
Sbjct  464   FEDGKQDQ--VNMSQHGNG-NATRSHGS-GYMGREKEKNRYAQLLNENRQVLYVPLSTKG  519

Query  451   KFYEIEPGIPQLLQKLGDAQRKLNPECVHRLGALVAAAKQLPLTLRYISGPGSGSEIPEQ  510
             KFYEIEPGIPQLLQKLGDAQRKLNPECVHRL ALV AAKQLPLTLRYISGPG G +IPEQ
Sbjct  520   KFYEIEPGIPQLLQKLGDAQRKLNPECVHRLSALVTAAKQLPLTLRYISGPG-GPDIPEQ  578

Query  511   LCISQVSKEDVVIGCSIEDVDAQTPLQLKKFYPSRDVQLVKSFLGFDTEQRMLANTNVQN  570
             LCISQVSKEDVV+GCSIEDVD QTPLQL+KFYPSRD+QLVKS+LGFD+EQRMLANTNVQN
Sbjct  579   LCISQVSKEDVVVGCSIEDVDTQTPLQLRKFYPSRDIQLVKSYLGFDSEQRMLANTNVQN  638

Query  571   MLKFCQFNCDSFLKLVEIDTAQRADRSGSKSSREGLRILKPLHLPKILRREKSSMAAGHE  630
             MLKFCQFNCD FLKLVEI+  QR++RSGSK +REGLRILKPLH PKILRREKSSMAA HE
Sbjct  639   MLKFCQFNCDPFLKLVEIELIQRSERSGSK-NREGLRILKPLHFPKILRREKSSMAAAHE  697

Query  631   KEDSIIFLSKSDLENLEEAKEAASA--------NRISERMKVFQSTKKKWFGK-NQPQHQ  681
             KEDSIIFLSKSDLENLE  + AASA        NRISERM+VFQSTKKKWFGK +  Q Q
Sbjct  698   KEDSIIFLSKSDLENLEAKEAAASAAAHSESSLNRISERMRVFQSTKKKWFGKHHPQQQQ  757

Query  682   QHLEKQQSNLDLDEQAKRMSMERYTDMSKLLQERFGSEHPDQPDKDDGISLNSTGASDTE  741
               +EK QS+LDLDEQAKRMSMERYTDMSKLLQERFGS +P+QP++ D ISLNST ASDTE
Sbjct  758   PQIEKHQSDLDLDEQAKRMSMERYTDMSKLLQERFGS-NPEQPEQ-DAISLNSTAASDTE  815

Query  742   TTTLTTMEHKSLDTLLQKSMSLQDIELLNGGQRKSARPDLLVSHSHADVDAISEAGTELD  801
             TT LTTME +SLDT++QKSMSLQDIELLNG  ++  RPDLL SH+H   DAISEAGTEL+
Sbjct  816   TTMLTTMEPRSLDTMMQKSMSLQDIELLNGQCKQ--RPDLLASHNHN--DAISEAGTELE  871

Query  802   DVENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQMRHFSLPQKLQLHEAEREKRHLM  861
             DVENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQ+  FSLPQKLQLHEAE+EKRHLM
Sbjct  872   DVENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQLPLFSLPQKLQLHEAEKEKRHLM  931

Query  862   QLKAKQLSSAKEPVAGRRAAGGVCLLGGGLNQLPGSPSPFSLVEDDLPYSSVRDSLVTAG  921
              LKA+Q +  KEPV GRRAAGGV LLGGGLNQL  SP+  SLVEDDLPYSSVRDSLV +G
Sbjct  932   LLKAQQQALTKEPVTGRRAAGGVSLLGGGLNQLAISPA--SLVEDDLPYSSVRDSLVISG  989

Query  922   DGCLRSAEIATRPRSTPVVDYTKENIYAEICPPLHTV----GTPPFNGAPDDDGDYASLK  977
               CLRS E A+RP   P VDYTKENIYAEICP  HTV    G   F   PDDDGDYASLK
Sbjct  990   GDCLRS-ESASRP--VPAVDYTKENIYAEICPS-HTVDTFSGATQFTHVPDDDGDYASLK  1045

Query  978   YPSASSGPQSVSRIEVNG-DATKSGAAISYHTVYLGEMPLGERHTAQHITTVELAGEDNI  1036
             Y  + +GPQSVSRIEVNG  A    +AISYHTVYLGE PLGERH A HITTVELAGEDNI
Sbjct  1046  Y--SVNGPQSVSRIEVNGATAAVKSSAISYHTVYLGEEPLGERHAA-HITTVELAGEDNI  1102

Query  1037  YNTLK  1041
             YNTLK
Sbjct  1103  YNTLK  1107


>O16865_DROME unnamed protein product
Length=1096

 Score = 1321 bits (3419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 770/1027 (75%), Positives = 844/1027 (82%), Gaps = 61/1027 (6%)

Query  38    HHGHHPLAGGAGARKPKLRRFNSHDTSSNMFSVAEFENARLARRNEIELSQRLARRLRSS  97
             HHGHH     AGARKPKLRRFNSHDTSSNMFSVA+FENARLARRNEIEL+QR ARR+R  
Sbjct  108   HHGHH---SAAGARKPKLRRFNSHDTSSNMFSVADFENARLARRNEIELNQRRARRVR--  162

Query  98    AKWELGAAAVISGSGSGPRAAAGGGYSGFCGGLNGSGDYSTGDSKASKGSNESQQEALPA  157
                  G+A   +          GG +SG+C  LNGSGDYSTGDSKASKGS+E    AL A
Sbjct  163   -----GSANNSTYGLGSGSGLLGGAHSGYCDALNGSGDYSTGDSKASKGSSEG---ALTA  214

Query  158   DVFLERNTLPRVARILHTSKNSNETLQSSSSHGSSTAASSSSSVEVKPVVSGAGNIS---  214
               FLERN+LPRV RILH SK+SNETLQSSSSHGSSTAASSSSS    P  SG        
Sbjct  215   IEFLERNSLPRVVRILHASKSSNETLQSSSSHGSSTAASSSSSTGANPFGSGGSGGGNIS  274

Query  215   ----NGRIDTCTGTGNHSSSSGGSVTGIGSGSGSVLAPGQQTKKSQNSSHGGIPPGHDEL  270
                 +    + +  G+ + +  GS  G+ SGSGS    G Q    ++SS+GG PPGHDEL
Sbjct  275   SGNIDTGTHSSSSGGSATGNGTGSGPGLSSGSGSGSGSGHQNNNGRHSSNGGTPPGHDEL  334

Query  271   FLLYRLVRQRNIYHGHNAKSQAAQRKKTVLIPQEFSGYFSLLSEKGLPTATQYGSLMQLV  330
             FLLYRLVRQRNIYHGHNAK+QA+QRKKT+LIPQEF GYFS+LSEKGLPTATQYGSL+QLV
Sbjct  335   FLLYRLVRQRNIYHGHNAKTQASQRKKTLLIPQEFPGYFSMLSEKGLPTATQYGSLIQLV  394

Query  331   RERVYKFASVDNMPAFTESSTSTSATSPTHEGCLPIIIKGRPQYIKTTARGGQVFRLLAV  390
             RERVYKF SVDNMPAFTESS +++++  THEGCLP I KGRPQY+KTTARGGQVFRLLAV
Sbjct  395   RERVYKFVSVDNMPAFTESSPNSTSSP-THEGCLP-INKGRPQYVKTTARGGQVFRLLAV  452

Query  391   FEDGKQEQHHANLSQHCNASNASKSHSSGGYLGREKEKNRYAQLLNDNRQVFYVPLSTKG  450
             FEDGKQ+Q   N+SQH N  NA++SH S GY+GREKEKNRYAQLLN+NRQV YVPLSTKG
Sbjct  453   FEDGKQDQ--VNMSQHGNG-NATRSHGS-GYMGREKEKNRYAQLLNENRQVLYVPLSTKG  508

Query  451   KFYEIEPGIPQLLQKLGDAQRKLNPECVHRLGALVAAAKQLPLTLRYISGPGSGSEIPEQ  510
             KFYEIEPGIPQLLQKLGDAQRKLNPECVHRL ALV AAKQLPLTLRYISGPG G +IPEQ
Sbjct  509   KFYEIEPGIPQLLQKLGDAQRKLNPECVHRLSALVTAAKQLPLTLRYISGPG-GPDIPEQ  567

Query  511   LCISQVSKEDVVIGCSIEDVDAQTPLQLKKFYPSRDVQLVKSFLGFDTEQRMLANTNVQN  570
             LCISQVSKEDVV+GCSIEDVD QTPLQL+KFYPSRD+QLVKS+LGFD+EQRMLANTNVQN
Sbjct  568   LCISQVSKEDVVVGCSIEDVDTQTPLQLRKFYPSRDIQLVKSYLGFDSEQRMLANTNVQN  627

Query  571   MLKFCQFNCDSFLKLVEIDTAQRADRSGSKSSREGLRILKPLHLPKILRREKSSMAAGHE  630
             MLKFCQFNCD FLKLVEI+  QR++RSGSK +REGLRILKPLH PKILRREKSSMAA HE
Sbjct  628   MLKFCQFNCDPFLKLVEIELIQRSERSGSK-NREGLRILKPLHFPKILRREKSSMAAAHE  686

Query  631   KEDSIIFLSKSDLENLEEAKEAASA--------NRISERMKVFQSTKKKWFGK-NQPQHQ  681
             KEDSIIFLSKSDLENLE  + AASA        NRISERM+VFQSTKKKWFGK +  Q Q
Sbjct  687   KEDSIIFLSKSDLENLEAKEAAASAAAHSESSLNRISERMRVFQSTKKKWFGKHHPQQQQ  746

Query  682   QHLEKQQSNLDLDEQAKRMSMERYTDMSKLLQERFGSEHPDQPDKDDGISLNSTGASDTE  741
               +EK QS+LDLDEQAKRMSMERYTDMSKLLQERFGS +P+QP++ D ISLNST ASDTE
Sbjct  747   PQIEKHQSDLDLDEQAKRMSMERYTDMSKLLQERFGS-NPEQPEQ-DAISLNSTAASDTE  804

Query  742   TTTLTTMEHKSLDTLLQKSMSLQDIELLNGGQRKSARPDLLVSHSHADVDAISEAGTELD  801
             TT LTTME +SLDT++QKSMSLQDIELLNG  ++  RPDLL SH+H   DAISEAGTEL+
Sbjct  805   TTMLTTMEPRSLDTMMQKSMSLQDIELLNGQCKQ--RPDLLASHNHN--DAISEAGTELE  860

Query  802   DVENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQMRHFSLPQKLQLHEAEREKRHLM  861
             DVENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQ+  FSLPQKLQLHEAE+EKRHLM
Sbjct  861   DVENQTPPPQSFITEKLYNEFHVKTRQYSKSSSSLHQLPLFSLPQKLQLHEAEKEKRHLM  920

Query  862   QLKAKQLSSAKEPVAGRRAAGGVCLLGGGLNQLPGSPSPFSLVEDDLPYSSVRDSLVTAG  921
              LKA+Q +  KEPV GRRAAGGV LLGGGLNQL  SP+  SLVEDDLPYSSVRDSLV +G
Sbjct  921   LLKAQQQALTKEPVTGRRAAGGVSLLGGGLNQLAISPA--SLVEDDLPYSSVRDSLVISG  978

Query  922   DGCLRSAEIATRPRSTPVVDYTKENIYAEICPPLHTVGTPPFNGA------PDDDGDYAS  975
               CLRS E A+RP   P VDYTKENIYAEICP  HTV T  F+GA      PDDDGDYAS
Sbjct  979   GDCLRS-ESASRP--VPAVDYTKENIYAEICPS-HTVDT--FSGATQLTHVPDDDGDYAS  1032

Query  976   LKYPSASSGPQSVSRIEVNG-DATKSGAAISYHTVYLGEMPLGERHTAQHITTVELAGED  1034
             LKY  + +GPQSVSRIEVNG  A    +AISYHTVYLGE PLGERH A HITTVELAGED
Sbjct  1033  LKY--SVNGPQSVSRIEVNGATAAVKSSAISYHTVYLGEEPLGERHAA-HITTVELAGED  1089

Query  1035  NIYNTLK  1041
             NIYNTLK
Sbjct  1090  NIYNTLK  1096


>Q965D9_DROME unnamed protein product
Length=778

 Score = 38.5 bits (88),  Expect = 0.035, Method: Compositional matrix adjust.
 Identities = 61/314 (19%), Positives = 131/314 (42%), Gaps = 46/314 (15%)

Query  358  PTHEGCLPIIIKGRPQYIKTTARGGQVFRLL-AVFEDGKQEQHHANLSQHCNASNASKSH  416
            PT+ G   +I +    Y +  +  G+  R + +V E  ++      + +       +++ 
Sbjct  83   PTNVGAKVLIPETYGGYFELLSEDGRSTRCIDSVLELSRRRNARVLVRETFRCQQMNRTI  142

Query  417  SSGGYLGREKEKNRYAQLLNDNRQVFYVPLSTKGKFYEIEPGIPQLLQKLGDAQRKLNPE  476
             +G  L    +  +Y Q  N   ++  +PL TK KF  I               R+ +  
Sbjct  143  HAGELLTTMNDNGKYLQCRNIKDEIINLPLDTKAKFSPIA--------------REDSIS  188

Query  477  CVHRLGALVAAAKQLPLTLRYISGPGSGSE----IPEQLCISQVSKEDVVIGCSIEDVD-  531
             VH +  L+   K++P+ +R + G          +PE   +  V  + +      +D D 
Sbjct  189  GVHTVKNLL--LKRMPVIVRLVHGSAPKGLKQPFVPELRLLGCVEIDRIFALPLQKDTDL  246

Query  532  AQTPLQLK-KFYPSRDVQLVKSFLGF----DTEQRMLANTNVQNMLKFCQFNCDSFLKLV  586
               PL  K K   +++++ ++ F+ +    D  QR+LA+   +             L++V
Sbjct  247  VPVPLNAKIKLQRAKNMEQLEHFIEYSRFLDKAQRLLADARDR-------------LQIV  293

Query  587  EIDTAQRADRSGSKSSREGLRILKPLHLPKILRREKSSMAAGHEKEDSIIFLSKSDLENL  646
            ++  +++  +    +SR G R      LP ++    + MA+G  +   ++  S S     
Sbjct  294  DLKLSEKEKKDSKFNSRNGGR------LPVVMLPSAAGMASGLAESGYVLRKSASCDSWS  347

Query  647  EEAKEAASANRISE  660
            ++ ++A S++ I+E
Sbjct  348  KQQQQALSSSEIAE  361


 Score = 33.1 bits (74),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 17/35 (49%), Positives = 22/35 (63%), Gaps = 1/35 (3%)

Query  299  VLIPQEFSGYFSLLSEKGLPTATQYGSLMQLVRER  333
            VLIP+ + GYF LLSE G  T     S+++L R R
Sbjct  90   VLIPETYGGYFELLSEDGRSTRC-IDSVLELSRRR  123



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016324.1 probable chitinase 10 [Drosophila kikkawai]

Length=327
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OBSTE_DROME  unnamed protein product                                  52.8    8e-08
Q9VST9_DROME  unnamed protein product                                 52.8    2e-07
E1JI93_DROME  unnamed protein product                                 52.8    3e-07


>OBSTE_DROME unnamed protein product
Length=249

 Score = 52.8 bits (125),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 75/196 (38%), Gaps = 35/196 (18%)

Query  81   DDCDKYIECQNGKIAKIGSCLELERATPTLCLEEGKSCNLG---FDPVFQVCTYRSKVQC  137
            D CD Y ECQ+G          +E+  P   L   ++   G   + P +  C  R+++Q 
Sbjct  36   DQCDSYTECQDG--------TPVEKLCPDGLLFHQRTKATGECTYAP-YSTCKERARLQP  86

Query  138  LPTCESFALSSFCYDN----TCTKYVLCYYGRPVLRQCHDQLQYNNMTDRCDFPQFVD-C  192
                E        Y N     C  Y  C +G   L +C + L +N  T +CD+P  V+ C
Sbjct  87   ANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESC  146

Query  193  VANDCSATNNP------------------NNITYIASKASCSKYFVCSNGRPWEQECSAG  234
             A      N P                    + Y     +C KYFVC NG P    C   
Sbjct  147  NAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKY  206

Query  235  LLYNPECQCCDYAKNV  250
            L +N + + CD+   V
Sbjct  207  LAFNSQTKLCDFYNKV  222


 Score = 35.8 bits (81),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 53/213 (25%), Positives = 77/213 (36%), Gaps = 29/213 (14%)

Query  133  SKVQCLPTCESFALSS---------FCYDNTCTKYVLCYYGRPVLRQCHDQL---QYNNM  180
            S + C+    S AL S         F   + C  Y  C  G PV + C D L   Q    
Sbjct  7    SALLCVAMFGSMALGSPECPTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKA  66

Query  181  TDRCDFPQFVDCVANDCSATNNPNNIT---------YIASKAS-CSKYFVCSNGRPWEQE  230
            T  C +  +  C      A   P N T         Y    A+ C  Y  C++G     +
Sbjct  67   TGECTYAPYSTCKER---ARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVASLTK  123

Query  231  CSAGLLYNPECQCCDYAKNVE-CSIDATARNIKP---YSRSPLRRADIQCPQVGIHFYPH  286
            C  GL +N E   CD+   VE C+ +A      P    +      A    P+  + +Y H
Sbjct  124  CPEGLAFNEETYQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRYYRH  183

Query  287  KYRQDAYYYCVDGRGVTLDCTPGLHYDPKVAEC  319
                  Y+ CV+G     +C   L ++ +   C
Sbjct  184  PQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLC  216


 Score = 32.3 bits (72),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 46/122 (38%), Gaps = 15/122 (12%)

Query  209  IASKASCSKYFVCSNGRPWEQECSAGLLYNPECQC---CDYAKNVECSIDATARNIKPYS  265
             AS   C  Y  C +G P E+ C  GLL++   +    C YA    C         K  +
Sbjct  32   FASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTC---------KERA  82

Query  266  RSPLRRADIQCPQVGIHFYPH--KYRQDAYYYCVDGRGVTLDCTPGLHYDPKVAECREPQ  323
            R        +CP+    FYP+    +   Y  C  G      C  GL ++ +  +C  P 
Sbjct  83   RLQPANGTEECPRQ-FGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPD  141

Query  324  NV  325
             V
Sbjct  142  LV  143


>Q9VST9_DROME unnamed protein product
Length=563

 Score = 52.8 bits (125),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 51/119 (43%), Gaps = 6/119 (5%)

Query  203  PNNITYIASKASCSKYFVCSNGRPWEQECSAGLLYNPECQCCDYAKNVECSIDATARNIK  262
            P+    +A    C +Y  C +G P  Q CS G L+N   Q CD+  NV C    +A    
Sbjct  67   PHFTGLVAYPHDCHRYVNCFDGSPTIQTCSPGTLFNDRTQVCDHPSNVVCPSAESAST--  124

Query  263  PYSRSPLRRADIQCP-QVGIH-FYPHKYRQDAYYYCVDGRGVTLDCTPGLHYDPKVAEC  319
                  LR+ D +   Q G++   PH      +  C +G+   +DC PG  + P    C
Sbjct  125  --RLGRLRQLDSEPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFSPASLVC  181


 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 72/184 (39%), Gaps = 27/184 (15%)

Query  151  YDNTCTKYVLCYYGRPVLRQCHDQLQYNNMTDRCDFPQFVDCVANDCSATN---------  201
            Y + C +YV C+ G P ++ C     +N+ T  CD P  V C + + ++T          
Sbjct  75   YPHDCHRYVNCFDGSPTIQTCSPGTLFNDRTQVCDHPSNVVCPSAESASTRLGRLRQLDS  134

Query  202  ----NPNNITYIASKASCSKYFVCSNGRPWEQECSAGLLYNPECQCCDYAKNVEC-SIDA  256
                 P         + CSK+  C+NG+ +  +C+ G  ++P    C +    +C S   
Sbjct  135  EPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFSPASLVCVHKDLAKCGSGTG  194

Query  257  TARNIKPYSRSP-LRRADIQCPQVGIHFYPHKYRQDAYYYCVDGRGVTLDCTPGLHYDPK  315
              R+    +  P L   D+ CP       PH +    Y  C            G+   P+
Sbjct  195  AVRDDTSGTGYPALPFDDLGCPPGTRGLRPHPHDVHKYLRC------------GIGVKPQ  242

Query  316  VAEC  319
            V +C
Sbjct  243  VEQC  246


 Score = 32.0 bits (71),  Expect = 0.81, Method: Compositional matrix adjust.
 Identities = 49/268 (18%), Positives = 92/268 (34%), Gaps = 64/268 (24%)

Query  79   YVDDCDKYIECQNGKIAKIGSCLELERATPTLCLEEGKSCNLG--FDPVFQVCTYRSKVQ  136
            Y  DC +Y+ C +G              +PT+     ++C+ G  F+   QVC + S V 
Sbjct  75   YPHDCHRYVNCFDG--------------SPTI-----QTCSPGTLFNDRTQVCDHPSNVV  115

Query  137  CL------------------PTCESFALSSFCYDNTCTKYVLCYYGRPVLRQCHDQLQYN  178
            C                   P C+        + + C+K++ C  G+  +  C     ++
Sbjct  116  CPSAESASTRLGRLRQLDSEPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFS  175

Query  179  NMTDRCDFPQFVDC------VANDCSATN-----------NPNNITYIASKASCSKYFVC  221
              +  C       C      V +D S T             P             KY  C
Sbjct  176  PASLVCVHKDLAKCGSGTGAVRDDTSGTGYPALPFDDLGCPPGTRGLRPHPHDVHKYLRC  235

Query  222  SNG-RPWEQECSAGLLYNPECQCCDYAKNVECSIDATARNIKPYSRSPLRRADIQCPQVG  280
              G +P  ++C  G +++     C Y+        +   +   ++ + ++   + CP   
Sbjct  236  GIGVKPQVEQCPRGHIFDGSSSVCVYSD-------SPRTSSSSFTSAEIQVNYLLCPVGA  288

Query  281  IHFYPHKYRQDAYYYCVDGRGVTLDCTP  308
            +  + H + Q  +  C DG+    +C P
Sbjct  289  VGQFVHPFDQTKFLSCKDGKSAVQNCQP  316


 Score = 32.0 bits (71),  Expect = 0.83, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 27/62 (44%), Gaps = 4/62 (6%)

Query  266  RSPLRRADIQCPQ--VGIHFYPHKYRQDAYYYCVDGRGVTLDCTPGLHYDPKVAECREPQ  323
            + P+   D  CP    G+  YPH   +  Y  C DG      C+PG  ++ +   C  P 
Sbjct  55   QQPIYHRDSACPPHFTGLVAYPHDCHR--YVNCFDGSPTIQTCSPGTLFNDRTQVCDHPS  112

Query  324  NV  325
            NV
Sbjct  113  NV  114


>E1JI93_DROME unnamed protein product
Length=2379

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/184 (23%), Positives = 72/184 (39%), Gaps = 27/184 (15%)

Query  151  YDNTCTKYVLCYYGRPVLRQCHDQLQYNNMTDRCDFPQFVDCVANDCSATN---------  201
            Y + C +YV C+ G P ++ C     +N+ T  CD P  V C + + ++T          
Sbjct  75   YPHDCHRYVNCFDGSPTIQTCSPGTLFNDRTQVCDHPSNVVCPSAESASTRLGRLRQLDS  134

Query  202  ----NPNNITYIASKASCSKYFVCSNGRPWEQECSAGLLYNPECQCCDYAKNVEC-SIDA  256
                 P         + CSK+  C+NG+ +  +C+ G  ++P    C +    +C S   
Sbjct  135  EPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFSPASLVCVHKDLAKCGSGTG  194

Query  257  TARNIKPYSRSP-LRRADIQCPQVGIHFYPHKYRQDAYYYCVDGRGVTLDCTPGLHYDPK  315
              R+    +  P L   D+ CP       PH +    Y  C            G+   P+
Sbjct  195  AVRDDTSGTGYPALPFDDLGCPPGTRGLRPHPHDVHKYLRC------------GIGVKPQ  242

Query  316  VAEC  319
            V +C
Sbjct  243  VEQC  246


 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 51/119 (43%), Gaps = 6/119 (5%)

Query  203  PNNITYIASKASCSKYFVCSNGRPWEQECSAGLLYNPECQCCDYAKNVECSIDATARNIK  262
            P+    +A    C +Y  C +G P  Q CS G L+N   Q CD+  NV C    +A    
Sbjct  67   PHFTGLVAYPHDCHRYVNCFDGSPTIQTCSPGTLFNDRTQVCDHPSNVVCPSAESAST--  124

Query  263  PYSRSPLRRADIQCP-QVGIH-FYPHKYRQDAYYYCVDGRGVTLDCTPGLHYDPKVAEC  319
                  LR+ D +   Q G++   PH      +  C +G+   +DC PG  + P    C
Sbjct  125  --RLGRLRQLDSEPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFSPASLVC  181


 Score = 43.5 bits (101),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 70/308 (23%), Positives = 112/308 (36%), Gaps = 56/308 (18%)

Query  53   DISIKYDMYNSSINICENVADEVYLPYVDDCDKYIECQNGKIAKIGSCLELE--RATPTL  110
            +IS +Y +    +N C    + ++L Y  D  KY++C +G    I SC        +   
Sbjct  345  EISYEYSLI---LNACPGNINGIFL-YPYDAKKYVQCSSGGRMSILSCGPQMAFSVSQRS  400

Query  111  CLEEGK---SCNLGFDPVFQVCT----------YRSKVQCLPTCESFALSSFCYDNTCTK  157
            CL   +   S  + F    QV T           +S++  L +C      ++ Y      
Sbjct  401  CLPSHQVHISDRVQFWQEVQVQTTYTSQDLRGNVQSQLSSLRSCPPNVQKNYPYPFHAGH  460

Query  158  YVLCYYGRPVL-------------RQC--------HDQLQYNNMTDRCDFPQFVDCVAND  196
            YV C YG   +             RQC        HD L Y+ ++        VD     
Sbjct  461  YVRCQYGALEIICCPTGQLYSLSQRQCVPRSLLSAHDYLDYSYISAELSTEFMVDRSTLS  520

Query  197  CSATNNPNNITYIASKASCSKYFVCSNGRPWEQECSAGLLYN-------PECQCCDYAKN  249
            C     P           C+KY  C N + + + C+ G +++       P+ QC     +
Sbjct  521  CP----PQAQGLYLHPFDCTKYVRCWNQQTFIESCTPGEIFSFSNQKCVPKEQCKGPTDH  576

Query  250  VECSIDATARNI----KPYSRSPL-RRADIQCPQVGIHFYPHKYRQDAYYYCVDGRGVTL  304
            VE  I+ T         P S S L +  DI CP      + H +    +  C +G+    
Sbjct  577  VEYLIETTTVTTYDSDGPESASSLAKTGDISCPPGASGNHAHPFDCTKFLECSNGQTFVK  636

Query  305  DCTPGLHY  312
            +C PG  +
Sbjct  637  NCGPGTAF  644


 Score = 42.7 bits (99),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 75/231 (32%), Gaps = 57/231 (25%)

Query  132  RSKVQCLPTCESFALSSFCYDNTCTKYVLCYYGRPVLRQCHDQLQYNNMTDRC-------  184
            RS + C P  +   L  F     CTKYV C+  +  +  C     ++    +C       
Sbjct  516  RSTLSCPPQAQGLYLHPF----DCTKYVRCWNQQTFIESCTPGEIFSFSNQKCVPKEQCK  571

Query  185  --------------------DFPQFVDCVANDCSATNNPNNITYIASKASCSKYFVCSNG  224
                                D P+    +A     +  P      A    C+K+  CSNG
Sbjct  572  GPTDHVEYLIETTTVTTYDSDGPESASSLAKTGDISCPPGASGNHAHPFDCTKFLECSNG  631

Query  225  RPWEQECSAGLLYNPECQCCDYAKNVECSID--------------ATARNIKPYSRSPLR  270
            + + + C  G  ++     CD+A  V+CS                AT+   KP    P+ 
Sbjct  632  QTFVKNCGPGTAFSTAKHICDHANQVDCSGRNSLPEQSQVTQNNIATSYPTKPLDILPIL  691

Query  271  R------------ADIQCPQVGIHFYPHKYRQDAYYYCVDGRGVTLDCTPG  309
            +             D+ CP      + H + Q  +  C  G+     C  G
Sbjct  692  KTSPPSYPHAEHLTDLLCPSGVNGQFVHPFDQTKFLLCQAGKLAVQSCQSG  742


 Score = 32.7 bits (73),  Expect = 0.52, Method: Compositional matrix adjust.
 Identities = 50/268 (19%), Positives = 93/268 (35%), Gaps = 64/268 (24%)

Query  79   YVDDCDKYIECQNGKIAKIGSCLELERATPTLCLEEGKSCNLG--FDPVFQVCTYRSKVQ  136
            Y  DC +Y+ C +G              +PT+     ++C+ G  F+   QVC + S V 
Sbjct  75   YPHDCHRYVNCFDG--------------SPTI-----QTCSPGTLFNDRTQVCDHPSNVV  115

Query  137  CL------------------PTCESFALSSFCYDNTCTKYVLCYYGRPVLRQCHDQLQYN  178
            C                   P C+        + + C+K++ C  G+  +  C     ++
Sbjct  116  CPSAESASTRLGRLRQLDSEPKCQPGVNGLQPHPSDCSKFLNCANGQAFIMDCAPGTAFS  175

Query  179  NMTDRCDFPQFVDC------VANDCSATN-----------NPNNITYIASKASCSKYFVC  221
              +  C       C      V +D S T             P             KY  C
Sbjct  176  PASLVCVHKDLAKCGSGTGAVRDDTSGTGYPALPFDDLGCPPGTRGLRPHPHDVHKYLRC  235

Query  222  SNG-RPWEQECSAGLLYNPECQCCDYAKNVECSIDATARNIKPYSRSPLRRADIQCPQVG  280
              G +P  ++C  G +++     C Y+ +   S  +       ++ + ++   + CP   
Sbjct  236  GIGVKPQVEQCPRGHIFDGSSSVCVYSDSPRTSSSS-------FTSAEIQVNYLLCPVGA  288

Query  281  IHFYPHKYRQDAYYYCVDGRGVTLDCTP  308
            +  + H + Q  +  C DG+    +C P
Sbjct  289  VGQFVHPFDQTKFLSCKDGKSAVQNCQP  316


 Score = 31.6 bits (70),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 19/62 (31%), Positives = 27/62 (44%), Gaps = 4/62 (6%)

Query  266  RSPLRRADIQCPQ--VGIHFYPHKYRQDAYYYCVDGRGVTLDCTPGLHYDPKVAECREPQ  323
            + P+   D  CP    G+  YPH   +  Y  C DG      C+PG  ++ +   C  P 
Sbjct  55   QQPIYHRDSACPPHFTGLVAYPHDCHR--YVNCFDGSPTIQTCSPGTLFNDRTQVCDHPS  112

Query  324  NV  325
            NV
Sbjct  113  NV  114



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016325.1 protein obstructor-E [Drosophila kikkawai]

Length=270
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

OBSTE_DROME  unnamed protein product                                  64.3    5e-12
Q9VNL0_DROME  unnamed protein product                                 61.6    6e-11
A8JQU3_DROME  unnamed protein product                                 61.2    6e-11


>OBSTE_DROME unnamed protein product
Length=249

 Score = 64.3 bits (155),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 88/222 (40%), Gaps = 39/222 (18%)

Query  6    ITLLAIVALIGSFGATDADINICSNVVDNLFLPHVSNCTKYYLCMSETAIPRECPKDYYF  65
            I+ L  VA+ GS      +         N        C  Y  C   T + + CP    F
Sbjct  6    ISALLCVAMFGSMALGSPEC-----PTPNGRFASGDQCDSYTECQDGTPVEKLCPDGLLF  60

Query  66   DSRDQ---ECVGVMEASCIPSCK---ARGLE----SFSY----DRT-CNKYVLCFDGTPV  110
              R +   EC     ++C    +   A G E     F +    D T C  Y  C  G   
Sbjct  61   HQRTKATGECTYAPYSTCKERARLQPANGTEECPRQFGFYPNGDATKCGVYRNCAHGVAS  120

Query  111  VRACSDGLQYNSQTDRCDYPQYVD-CADNLCIRENNPE------------------DIVF  151
            +  C +GL +N +T +CD+P  V+ C     +  N P                   ++ +
Sbjct  121  LTKCPEGLAFNEETYQCDWPDLVESCNAEAYLGFNCPAADSADDSAAAAVDVSPEGELRY  180

Query  152  IPSKASCSKYYVCLNGLPTVQNCSNGLQYNSKTESCDFASKV  193
                 +C KY+VC+NG P + NC   L +NS+T+ CDF +KV
Sbjct  181  YRHPQTCKKYFVCVNGHPRLYNCGKYLAFNSQTKLCDFYNKV  222


 Score = 64.3 bits (155),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 78/185 (42%), Gaps = 14/185 (8%)

Query  92   FSYDRTCNKYVLCFDGTPVVRACSDGLQYNSQTD---RCDYPQYVDCADNLCIRENN---  145
            F+    C+ Y  C DGTPV + C DGL ++ +T     C Y  Y  C +   ++  N   
Sbjct  32   FASGDQCDSYTECQDGTPVEKLCPDGLLFHQRTKATGECTYAPYSTCKERARLQPANGTE  91

Query  146  --PEDIVFIPS--KASCSKYYVCLNGLPTVQNCSNGLQYNSKTESCDFASKV-NCTVESL  200
              P    F P+     C  Y  C +G+ ++  C  GL +N +T  CD+   V +C  E+ 
Sbjct  92   ECPRQFGFYPNGDATKCGVYRNCAHGVASLTKCPEGLAFNEETYQCDWPDLVESCNAEAY  151

Query  201  QRNILP---FARAPPRSADIKCPSEGAHFIAHQKRPDAYYYCLNGRGVILDCTPGLVFDA  257
                 P    A     +A    P     +  H +    Y+ C+NG   + +C   L F++
Sbjct  152  LGFNCPAADSADDSAAAAVDVSPEGELRYYRHPQTCKKYFVCVNGHPRLYNCGKYLAFNS  211

Query  258  QRGEC  262
            Q   C
Sbjct  212  QTKLC  216


>Q9VNL0_DROME unnamed protein product
Length=258

 Score = 61.6 bits (148),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 76/201 (38%), Gaps = 39/201 (19%)

Query  92   FSYDRTCNKYVLCFDGTPVVRACSDGLQYNSQ-----TDRCDYPQYVDCADNLCIRENNP  146
            + +D +C+KY  C +G   ++ C +GL +++      T+ CDY   VDC D     E  P
Sbjct  30   YPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRT---ELEP  86

Query  147  EDIV--------FIPSKASCSKYYVCLNGLPTVQNCSNGLQYNSKTESCDFASKVNCTVE  198
                          P +  C  ++ C NG P+   CS GL Y+     C +A +V     
Sbjct  87   PITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQV-----  141

Query  199  SLQRNILPFARAPPRSADIKCPSEG-----AHFIAHQKRPD--AYYYCLNGRGVILDCTP  251
                   P  +    +    CP+ G       F  H    D   YY CL G      C  
Sbjct  142  -------PECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPI  194

Query  252  GLVFDA----QRGECREPRFV  268
            G VF        G C +P  V
Sbjct  195  GTVFKIGDSDGTGNCEDPEDV  215


 Score = 56.2 bits (134),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 54/118 (46%), Gaps = 19/118 (16%)

Query  146  PEDIVFIPSKASCSKYYVCLNGLPTVQNCSNGLQYNSK-----TESCDFASKVNCTVESL  200
            P+D  F P   SC KY+ C NG+  ++ C NGL +++      TE+CD+   V+C     
Sbjct  24   PDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCG----  79

Query  201  QRNILPFARAPPRSADIKCP--SEGAHFIAHQKRPDAYYYCLNGRGVILDCTPGLVFD  256
             R  L     PP    I  P  S        + + D ++ C NG      C+PGL +D
Sbjct  80   DRTEL----EPP----ITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYD  129


 Score = 43.5 bits (101),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 75/206 (36%), Gaps = 48/206 (23%)

Query  11   IVALIGSFGATDADINI-CSNVVDNLFLPHVSNCTKYYLCMSETAIPRECPKDYYFDSRD  69
            +V  +  FGA  A  +  C +  D  F PH ++C KY+ C +  +  + C     FD+ D
Sbjct  5    LVVFVALFGAAVAQSSFKCPD--DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATD  62

Query  70   -----QECVGVMEASC-----------IPSCKARGLESFSYDRTCNKYVLCFDGTPVVRA  113
                 + C  +    C            P C +R    F  +  C+ +  C++G P    
Sbjct  63   SKYLTENCDYLHNVDCGDRTELEPPITTPHC-SRLYGIFPDENKCDVFWNCWNGEPSRYQ  121

Query  114  CSDGLQYNSQTDRCDYPQYVDCADNLCI-------------------RENNPEDIVFIPS  154
            CS GL Y+     C +   V    N  +                   R  +PED      
Sbjct  122  CSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPED------  175

Query  155  KASCSKYYVCLNGLPTVQNCSNGLQY  180
               C KYY+CL G+     C  G  +
Sbjct  176  ---CRKYYICLEGVAREYGCPIGTVF  198


>A8JQU3_DROME unnamed protein product
Length=235

 Score = 61.2 bits (147),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 76/201 (38%), Gaps = 39/201 (19%)

Query  92   FSYDRTCNKYVLCFDGTPVVRACSDGLQYNSQ-----TDRCDYPQYVDCADNLCIRENNP  146
            + +D +C+KY  C +G   ++ C +GL +++      T+ CDY   VDC D     E  P
Sbjct  30   YPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRT---ELEP  86

Query  147  EDIV--------FIPSKASCSKYYVCLNGLPTVQNCSNGLQYNSKTESCDFASKVNCTVE  198
                          P +  C  ++ C NG P+   CS GL Y+     C +A +V     
Sbjct  87   PITTPHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQV-----  141

Query  199  SLQRNILPFARAPPRSADIKCPSEG-----AHFIAHQKRPD--AYYYCLNGRGVILDCTP  251
                   P  +    +    CP+ G       F  H    D   YY CL G      C  
Sbjct  142  -------PECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPI  194

Query  252  GLVFDA----QRGECREPRFV  268
            G VF        G C +P  V
Sbjct  195  GTVFKIGDSDGTGNCEDPEDV  215


 Score = 56.2 bits (134),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (45%), Gaps = 15/116 (13%)

Query  146  PEDIVFIPSKASCSKYYVCLNGLPTVQNCSNGLQYNSK-----TESCDFASKVNCTVESL  200
            P+D  F P   SC KY+ C NG+  ++ C NGL +++      TE+CD+   V+C     
Sbjct  24   PDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCG----  79

Query  201  QRNILPFARAPPRSADIKCPSEGAHFIAHQKRPDAYYYCLNGRGVILDCTPGLVFD  256
             R  L      P  + +            + + D ++ C NG      C+PGL +D
Sbjct  80   DRTELEPPITTPHCSRL------YGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYD  129


 Score = 43.1 bits (100),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 49/206 (24%), Positives = 75/206 (36%), Gaps = 48/206 (23%)

Query  11   IVALIGSFGATDADINI-CSNVVDNLFLPHVSNCTKYYLCMSETAIPRECPKDYYFDSRD  69
            +V  +  FGA  A  +  C +  D  F PH ++C KY+ C +  +  + C     FD+ D
Sbjct  5    LVVFVALFGAAVAQSSFKCPD--DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATD  62

Query  70   -----QECVGVMEASC-----------IPSCKARGLESFSYDRTCNKYVLCFDGTPVVRA  113
                 + C  +    C            P C +R    F  +  C+ +  C++G P    
Sbjct  63   SKYLTENCDYLHNVDCGDRTELEPPITTPHC-SRLYGIFPDENKCDVFWNCWNGEPSRYQ  121

Query  114  CSDGLQYNSQTDRCDYPQYVDCADNLCI-------------------RENNPEDIVFIPS  154
            CS GL Y+     C +   V    N  +                   R  +PED      
Sbjct  122  CSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPED------  175

Query  155  KASCSKYYVCLNGLPTVQNCSNGLQY  180
               C KYY+CL G+     C  G  +
Sbjct  176  ---CRKYYICLEGVAREYGCPIGTVF  198



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016326.1 protein obstructor-E [Drosophila kikkawai]

Length=299
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNL0_DROME  unnamed protein product                                 52.8    6e-08
A8JQU3_DROME  unnamed protein product                                 52.4    7e-08
O97377_DROME  unnamed protein product                                 51.2    2e-07


>Q9VNL0_DROME unnamed protein product
Length=258

 Score = 52.8 bits (125),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 75/189 (40%), Gaps = 43/189 (23%)

Query  117  NFTTFSYQRTCTKYVLCYYGRPVLRECHDGLQYNSR-----TDRCDFPKNVDCVES----  167
            +F  + +  +C KY  C  G   L+ C +GL +++      T+ CD+  NVDC +     
Sbjct  26   DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELE  85

Query  168  ------ECSIYYNAYHLRYVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTKCDCCDIPSK  221
                   CS  Y  +     P +  C+ ++ C NG P    C+PGL +      C     
Sbjct  86   PPITTPHCSRLYGIF-----PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWAD-  139

Query  222  SDCQIP--ADQRKAQIFSPLRSGVVKGICPSAG-----AHFIAHESRQD--AYYYCVEGH  272
               Q+P   ++  A  FS          CP+AG       F  H   +D   YY C+EG 
Sbjct  140  ---QVPECKNEEVANGFS----------CPAAGELANAGSFSRHAHPEDCRKYYICLEGV  186

Query  273  GLVLDCSPG  281
                 C  G
Sbjct  187  AREYGCPIG  195


 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 21/120 (18%)

Query  180  YVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTK-----CDCCDIPSKSDCQIPADQRKAQ  234
            + P   SC+KY+ C NGV + +TC  GL F         + CD     DC       + +
Sbjct  29   FYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDC-----GDRTE  83

Query  235  IFSPLRS---GVVKGICPSAGAHFIAHESRQDAYYYCVEGHGLVLDCSPGLWYDPKIQEC  291
            +  P+ +     + GI P         E++ D ++ C  G      CSPGL YD   + C
Sbjct  84   LEPPITTPHCSRLYGIFPD--------ENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVC  135


 Score = 41.6 bits (96),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 68/194 (35%), Gaps = 31/194 (16%)

Query  62   DNVFLPFVGDCNKYYLCRSGQAIALQCEWPYEFDAP-----SQSCVNAGQAEC-------  109
            D  F P    C+KY+ C +G +    C     FDA      +++C      +C       
Sbjct  26   DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELE  85

Query  110  ----LPTCEAFNFTTFSYQRTCTKYVLCYYGRPVLRECHDGLQYNSRTDRCDFPKNV-DC  164
                 P C    +  F  +  C  +  C+ G P   +C  GL Y+     C +   V +C
Sbjct  86   PPITTPHCSRL-YGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPEC  144

Query  165  VESECSIYY---------NAYHLRYVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTKCDC  215
               E +  +         NA           C KY++C  GV +E  C  G  F      
Sbjct  145  KNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIG---  201

Query  216  CDIPSKSDCQIPAD  229
             D     +C+ P D
Sbjct  202  -DSDGTGNCEDPED  214


>A8JQU3_DROME unnamed protein product
Length=235

 Score = 52.4 bits (124),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 75/189 (40%), Gaps = 43/189 (23%)

Query  117  NFTTFSYQRTCTKYVLCYYGRPVLRECHDGLQYNSR-----TDRCDFPKNVDCVES----  167
            +F  + +  +C KY  C  G   L+ C +GL +++      T+ CD+  NVDC +     
Sbjct  26   DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELE  85

Query  168  ------ECSIYYNAYHLRYVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTKCDCCDIPSK  221
                   CS  Y  +     P +  C+ ++ C NG P    C+PGL +      C     
Sbjct  86   PPITTPHCSRLYGIF-----PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWAD-  139

Query  222  SDCQIP--ADQRKAQIFSPLRSGVVKGICPSAG-----AHFIAHESRQD--AYYYCVEGH  272
               Q+P   ++  A  FS          CP+AG       F  H   +D   YY C+EG 
Sbjct  140  ---QVPECKNEEVANGFS----------CPAAGELANAGSFSRHAHPEDCRKYYICLEGV  186

Query  273  GLVLDCSPG  281
                 C  G
Sbjct  187  AREYGCPIG  195


 Score = 42.7 bits (99),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 21/120 (18%)

Query  180  YVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTK-----CDCCDIPSKSDCQIPADQRKAQ  234
            + P   SC+KY+ C NGV + +TC  GL F         + CD     DC       + +
Sbjct  29   FYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDC-----GDRTE  83

Query  235  IFSPLRS---GVVKGICPSAGAHFIAHESRQDAYYYCVEGHGLVLDCSPGLWYDPKIQEC  291
            +  P+ +     + GI P         E++ D ++ C  G      CSPGL YD   + C
Sbjct  84   LEPPITTPHCSRLYGIFPD--------ENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVC  135


 Score = 41.2 bits (95),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 68/194 (35%), Gaps = 31/194 (16%)

Query  62   DNVFLPFVGDCNKYYLCRSGQAIALQCEWPYEFDAP-----SQSCVNAGQAEC-------  109
            D  F P    C+KY+ C +G +    C     FDA      +++C      +C       
Sbjct  26   DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELE  85

Query  110  ----LPTCEAFNFTTFSYQRTCTKYVLCYYGRPVLRECHDGLQYNSRTDRCDFPKNV-DC  164
                 P C    +  F  +  C  +  C+ G P   +C  GL Y+     C +   V +C
Sbjct  86   PPITTPHCSRL-YGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPEC  144

Query  165  VESECSIYY---------NAYHLRYVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTKCDC  215
               E +  +         NA           C KY++C  GV +E  C  G  F      
Sbjct  145  KNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIG---  201

Query  216  CDIPSKSDCQIPAD  229
             D     +C+ P D
Sbjct  202  -DSDGTGNCEDPED  214


>O97377_DROME unnamed protein product
Length=218

 Score = 51.2 bits (121),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/189 (26%), Positives = 75/189 (40%), Gaps = 43/189 (23%)

Query  117  NFTTFSYQRTCTKYVLCYYGRPVLRECHDGLQYNSR-----TDRCDFPKNVDCVES----  167
            +F  + +  +C KY  C  G   L+ C +GL +++      T+ CD+  NVDC +     
Sbjct  26   DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELE  85

Query  168  ------ECSIYYNAYHLRYVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTKCDCCDIPSK  221
                   CS  Y  +     P +  C+ ++ C NG P    C+PGL +      C     
Sbjct  86   PPITTPHCSRLYGIF-----PDENKCDVFWNCWNGEPSRYQCSPGLVYDRDARVCMWAD-  139

Query  222  SDCQIP--ADQRKAQIFSPLRSGVVKGICPSAG-----AHFIAHESRQD--AYYYCVEGH  272
               Q+P   ++  A  FS          CP+AG       F  H   +D   Y+ C+EG 
Sbjct  140  ---QVPECKNEEVANGFS----------CPAAGELANAGSFSRHAHPEDCRKYHICLEGV  186

Query  273  GLVLDCSPG  281
                 C  G
Sbjct  187  AREYGCPIG  195


 Score = 43.1 bits (100),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 51/120 (43%), Gaps = 21/120 (18%)

Query  180  YVPSKVSCEKYFLCGNGVPKEQTCTPGLYFSTK-----CDCCDIPSKSDCQIPADQRKAQ  234
            + P   SC+KY+ C NGV + +TC  GL F         + CD     DC       + +
Sbjct  29   FYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDC-----GDRTE  83

Query  235  IFSPLRS---GVVKGICPSAGAHFIAHESRQDAYYYCVEGHGLVLDCSPGLWYDPKIQEC  291
            +  P+ +     + GI P         E++ D ++ C  G      CSPGL YD   + C
Sbjct  84   LEPPITTPHCSRLYGIFPD--------ENKCDVFWNCWNGEPSRYQCSPGLVYDRDARVC  135


 Score = 38.1 bits (87),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 41/174 (24%), Positives = 61/174 (35%), Gaps = 27/174 (16%)

Query  62   DNVFLPFVGDCNKYYLCRSGQAIALQCEWPYEFDAP-----SQSCVNAGQAEC-------  109
            D  F P    C+KY+ C +G +    C     FDA      +++C      +C       
Sbjct  26   DFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELE  85

Query  110  ----LPTCEAFNFTTFSYQRTCTKYVLCYYGRPVLRECHDGLQYNSRTDRCDFPKNV-DC  164
                 P C    +  F  +  C  +  C+ G P   +C  GL Y+     C +   V +C
Sbjct  86   PPITTPHCSRL-YGIFPDENKCDVFWNCWNGEPSRYQCSPGLVYDRDARVCMWADQVPEC  144

Query  165  VESECSIYY---------NAYHLRYVPSKVSCEKYFLCGNGVPKEQTCTPGLYF  209
               E +  +         NA           C KY +C  GV +E  C  G  F
Sbjct  145  KNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYHICLEGVAREYGCPIGTVF  198



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016327.1 protein ABHD18 [Drosophila kikkawai]

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W3R8_DROME  unnamed protein product                                 35.0    0.13 
MYOJ_DICDI  unnamed protein product                                   30.0    6.5  
Q0E996_DROME  unnamed protein product                                 29.6    7.8  


>Q9W3R8_DROME unnamed protein product
Length=308

 Score = 35.0 bits (79),  Expect = 0.13, Method: Compositional matrix adjust.
 Identities = 17/66 (26%), Positives = 34/66 (52%), Gaps = 1/66 (2%)

Query  424  VPFDTSLIIAVCAKDDAYVPREGCSSLEDIWPGAEVRYLDAGHVSAYVLHQKLFRSCIIE  483
            +P  T     +C     Y+ RE    ++ ++P +E+ +LDAGH+  +   Q+ F + + E
Sbjct  244  LPPYTGPTTFICGTRSPYMRREQWPQIQKMFPNSEIHWLDAGHLVHFEKPQE-FLTIVSE  302

Query  484  AFDRAK  489
              +R +
Sbjct  303  FLNRTE  308


>MYOJ_DICDI unnamed protein product
Length=2245

 Score = 30.0 bits (66),  Expect = 6.5, Method: Compositional matrix adjust.
 Identities = 37/179 (21%), Positives = 78/179 (44%), Gaps = 26/179 (15%)

Query  242   NWDMLETQYFSDGQYRERLSKMVTVID-------DAFSAGQSFIKNFNQSLHELKEDISD  294
             N +++E    S   Y+++L +  + ID       +  S  Q  ++  NQ LH+LKE+++ 
Sbjct  1626  NQELIE----SSALYKQQLLQQTSTIDSTIKEKENEISKLQQQLETSNQQLHQLKEELNS  1681

Query  295   TR---KIQEDERNSNTCGDIYETQAGGSCPQDADSSIFLTKSLKNSKLDSDNLTIDNSKQ  351
              +   +++  E++      I E Q   S   +      ++K L ++  ++  +     +Q
Sbjct  1682  MKQSNQLESTEQSKQLNQLIQENQQLKSVTNE------ISKQLDDAVFENQKINNTIKEQ  1735

Query  352   DLSQKVNAIEKEGLPKEPTKSTLTNLMKFILPLSAQNKSDKIDITKTNWWEREALQFMR  410
             ++  K  ++E +    E  +  +  L   I  L  Q +S+      T+  E+E  Q  R
Sbjct  1736  EIKSKRMSVELQQHIDEGKQQEIQQLQSTIAQLKQQQQSE------TDRLEKEIQQMKR  1788


>Q0E996_DROME unnamed protein product
Length=918

 Score = 29.6 bits (65),  Expect = 7.8, Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query  457  AEVRYLDAGHVSAYVLHQKLFRSCIIEAFDRAKKVYG--KDTGEDLKCDTTYQQLLKKYD  514
             E+  LD   +S  VLHQ     CI+E FD+ KK     ++  ED++C     QLLK   
Sbjct  78   GELNKLDM--LSKNVLHQ-----CIMELFDKKKKRTAGTQEMCEDMEC---LAQLLKTCG  127

Query  515  KNI  517
            KN+
Sbjct  128  KNL  130



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016328.1 extensin [Drosophila kikkawai]

Length=241
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8I5B3_PLAF7  unnamed protein product                                 43.1    1e-04
Q960G6_DROME  unnamed protein product                                 28.5    7.3  


>Q8I5B3_PLAF7 unnamed protein product
Length=822

 Score = 43.1 bits (100),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 25/42 (60%), Gaps = 1/42 (2%)

Query  87   GPPPVVEEP-AEVYGPPDQVYGPPDQTYGPPDQTYGPPDQPA  127
            GPP  + EP  ++ GPP Q+ GPP Q  GPP Q   PP  PA
Sbjct  480  GPPGQMNEPPGQMNGPPSQMNGPPSQMNGPPSQITVPPTPPA  521


 Score = 35.8 bits (81),  Expect = 0.031, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 11/55 (20%)

Query  97   EVYGPPDQVYGPPDQTYGPPDQTYGPPDQPANDDNANGQPQSAAIIDLASLPLPP  151
            ++ GPP Q+  PP Q  GPP Q  GPP Q       NG P    +      P PP
Sbjct  477  QMKGPPGQMNEPPGQMNGPPSQMNGPPSQ------MNGPPSQITVP-----PTPP  520


>Q960G6_DROME unnamed protein product
Length=2409

 Score = 28.5 bits (62),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 29/98 (30%), Positives = 39/98 (40%), Gaps = 19/98 (19%)

Query  48   QAPYPPAGLVPDPP-----FELPTEEAVEFPQPDETYGPPADTY----GPPPVVEEPAEV  98
            QAPY   G  P P      ++ P++    + +P +  G    +Y    G  P  + P E 
Sbjct  656  QAPYYSNGGYPTPSQNNGGYQTPSQNNGGYQEPSQNNGGYQPSYQGNEGYTPTYQNPFEG  715

Query  99   YGPPDQVYG----------PPDQTYGPPDQTYGPPDQP  126
            Y  P+Q             PP   Y PP QTYG   QP
Sbjct  716  YHQPNQSSYQTNGGYQPPLPPHGGYQPPSQTYGGFQQP  753



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016329.1 DNA-directed RNA polymerases I, II, and III subunit
RPABC3 [Drosophila kikkawai]

Length=149
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPAB3_CAEEL  unnamed protein product                                  198     2e-66
Q384M6_TRYB2  unnamed protein product                                 85.1    1e-21
Q9VYY8_DROME  unnamed protein product                                 28.9    1.6  


>RPAB3_CAEEL unnamed protein product
Length=148

 Score = 198 bits (504),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 120/149 (81%), Gaps = 1/149 (1%)

Query  1    MAGVLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVL  60
            MAG++F+D+F VK +DP+GKKFDRVSR  C++ESFKM+LI+DINS +YP++  DK RLVL
Sbjct  1    MAGIIFDDMFKVKSVDPDGKKFDRVSRYFCDAESFKMELIIDINSQIYPLKQNDKVRLVL  60

Query  61   ATTLREDGCPDSGEYNPMEHEGTRADSFEYVMYGKIYRIEGDEAHNEASRLSAYVSFGGL  120
            ATTLREDG  D GEY+P + E  R   +EYVMYGK+YR+E D+   +  +L+AY SFGGL
Sbjct  61   ATTLREDGLADEGEYDP-KAEYPRIKQYEYVMYGKVYRLEDDDTGTDGGKLAAYASFGGL  119

Query  121  LMRLQGDANNLHGFEVDQHMYLLMKRLAF  149
            LMRL+G+A NLHGFEVD ++YLLMK+  F
Sbjct  120  LMRLKGEAINLHGFEVDMNLYLLMKKTDF  148


>Q384M6_TRYB2 unnamed protein product
Length=149

 Score = 85.1 bits (209),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 79/144 (55%), Gaps = 4/144 (3%)

Query  4    VLFEDIFNVKDMDPEGKKFDRVSRLHCESESFKMDLILDINSWLYPMELGDKFRLVLATT  63
            V+ ED F V  ++ EG  + RVSR+ C  E   + +  D+N+  +P+  GD+  ++L  +
Sbjct  6    VILEDTFTVAAVNEEGTVYSRVSRVRCTGEGGGLIITSDVNTGEFPLHSGDRLTIILTDS  65

Query  64   LREDGCPDSGEYN-PMEHEGTRADSFEYVMYGKIYRIEGDEAHNEASRLSAYVSFGGLLM  122
            +       S  Y+  + H  TR D  +Y M+G++Y +E +E+  +   ++ ++S GGLL 
Sbjct  66   IELSEQAGSKHYDQSVYHRSTRLDDCDYAMHGRVYSMEVNESSLD---VTVHISCGGLLT  122

Query  123  RLQGDANNLHGFEVDQHMYLLMKR  146
            ++ G   +L     +  +Y+LMKR
Sbjct  123  QIVGKPQSLKDVHYNSDVYILMKR  146


>Q9VYY8_DROME unnamed protein product
Length=641

 Score = 28.9 bits (63),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 16/28 (57%), Gaps = 0/28 (0%)

Query  96   IYRIEGDEAHNEASRLSAYVSFGGLLMR  123
            +YR   D  H+  SR +AY S GG  MR
Sbjct  455  VYRQHADSWHSAMSRRTAYYSLGGPSMR  482



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016330.1 clavesin-1 [Drosophila kikkawai]

Length=333
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VM12_DROME  unnamed protein product                                 105     5e-26
PINTA_DROME  unnamed protein product                                  70.1    1e-13
Q8IRM7_DROME  unnamed protein product                                 58.2    4e-09


>Q9VM12_DROME unnamed protein product
Length=294

 Score = 105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 77/252 (31%), Positives = 124/252 (49%), Gaps = 6/252 (2%)

Query  30   LSPAMKQVAKEELHEDENIRRQALAQFREWIDKHPHIRKCRTDAIFLLRFLRTKKFSVPA  89
            L P   ++A+ EL E E ++ +A+ + RE +   P +     DA FL  FLR   F    
Sbjct  18   LKPETVEIARVELRETEEVKAEAIIKLRELLKATPELNYKDDDA-FLTVFLRACHFYPEG  76

Query  90   ACEMLERYLTIRQLFPQWFQNLDINDPAINEIFENGYLVP-LPQRDATGRQVLFSVAAK-  147
            A E ++   + R+ +    + L +    + E F  G ++  L   D  GR+VL     K 
Sbjct  77   ALEKMKTTASFRKEYASLVRGLLVEQ--VKEKFVKGSVINVLKNCDQKGRRVLIVNCGKL  134

Query  148  FDPYKFTSVQMARVHSLICEALLDDEDSQVAGYVYINDESGMNMGFVSLWSLTDLRSIVK  207
            +DP   TS +M R+  ++  A   +E++QV G V I D  G++M  V   S +  + ++ 
Sbjct  135  WDPSDITSDEMFRMLYMVHLAAQLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLT  194

Query  208  CIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVH-KNVDILKTKIDPAIL  266
             IQ + P+R KE HFV  P   N +  L    +  KL  R+  H  ++  L+  +DP++L
Sbjct  195  FIQEAMPLRMKEVHFVKQPFIFNMVWSLFKPFVKQKLNNRMHFHGSDMKSLQKFLDPSVL  254

Query  267  PKEYGGTVPIAD  278
            P  Y GT+P  D
Sbjct  255  PANYKGTLPAID  266


>PINTA_DROME unnamed protein product
Length=273

 Score = 70.1 bits (170),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 58/218 (27%), Positives = 97/218 (44%), Gaps = 12/218 (6%)

Query  58   EWIDKHPHIRKCRTDAIFLLRFLRTKKFSVPAACEMLERYLTIRQLFPQWFQNLDINDPA  117
            +W+  +P I  C T       FLRT KF V  A + L+ +  +R    +WF N D   P 
Sbjct  31   DWLVANPQINGCNTFENLHF-FLRTSKFDVERAKKKLKTFYQMRAERTEWFDNRDPQLPE  89

Query  118  INEIFENGYLVPLPQRDATGRQVLFSVAAKFDPYKFTSVQMARVHSLICEALLD-DEDSQ  176
            I ++ + G  +P+   DA  R V+    A  DP   +   + +   +I + LL  D ++ 
Sbjct  90   IQDLLKLGVFLPIGP-DAEQRMVVVIRTAAHDPKLHSQNNVFKTSKMILDLLLKLDPETC  148

Query  177  VAGYVYINDESGMNMGFVSLWSLTDLRSIVKCIQNST--PMRHKETHFVNIPHYANRIIE  234
              G V I D  G+ +G        + + I + +++ T  P + K   F N P + N  + 
Sbjct  149  ARGMVAILDMQGVQLGHA---LQMNPKLIKRSVESWTAYPCQPKLLEFTNAPRHVNFFLN  205

Query  235  LGVSMLSDKLKKRIIVHKNVDILKTKIDPAILPKEYGG  272
                 ++ K++ R+ V +      T +    LPKE GG
Sbjct  206  TFRIFMTPKIRSRLFVRRE----GTSVSCDQLPKELGG  239


>Q8IRM7_DROME unnamed protein product
Length=797

 Score = 58.2 bits (139),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 51/225 (23%), Positives = 97/225 (43%), Gaps = 14/225 (6%)

Query  77   LRFLRTKKFSVPAACEMLERYLTIRQLFPQWFQNLDINDPAINEIFENGYLVPLPQRDAT  136
            ++FL  +KF +P A  + E++  IR    ++  N+D +   +    + G    LP R ++
Sbjct  94   VKFLYARKFDIPRAVSLYEQHEQIR--LKEYLYNIDPDVEPLRSELQTGKFTILPARTSS  151

Query  137  GRQVLFSVAAKFDPYKFTSVQMARVHSLICEALLDDEDSQVAGYVYINDESGMNMGFVSL  196
            G  +    A +  P   +     +      ++ L D ++Q AG V+I D SG      S 
Sbjct  152  GAAIALFTANRHSPLSVSHTTTLQGIVYQLDSALQDSETQRAGLVFIYDMSG------SK  205

Query  197  WSLTDL---RSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSDKLKKRIIVHKN  253
            +S  D    + I+  ++   P R K+   V  P +     ++    + +KL++R+    +
Sbjct  206  YSNFDYDLSQKILTLLKGGYPARLKKVLIVTAPLWFKAPFKILRLFVREKLRERVFT-VS  264

Query  254  VDILKTKIDPAILPKEYGGTVPI--ADMIAEFKAKLLKRRAAILA  296
            V  L   +    LP   GGT+ +  A  +   +  +  R   +LA
Sbjct  265  VPQLALHVPRKALPIHLGGTLEVDHATWLLSCRQSMTNREDELLA  309



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016331.1 protein embryonic gonad isoform X1 [Drosophila
kikkawai]

Length=378
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EGON_DROME  unnamed protein product                                   626     0.0  
KNRL_DROME  unnamed protein product                                   192     1e-55
KNIR_DROME  unnamed protein product                                   187     2e-55


>EGON_DROME unnamed protein product
Length=373

 Score = 626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/380 (87%), Positives = 347/380 (91%), Gaps = 9/380 (2%)

Query  1    MNQLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKA  60
            MNQLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKA
Sbjct  1    MNQLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKA  60

Query  61   CRLRKCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQTTAGAGGGGASGGGGGGNGGVSSAS  120
            CRLRKCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQTT+G GGG + G G GG   VSSAS
Sbjct  61   CRLRKCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQTTSGLGGGSSVGSGSGGG--VSSAS  118

Query  121  LEQLARLQQASNQARQTYQDKTNPCIKSAT-STSPRIEGAAVGAGVGVGAASPSFLQAAK  179
            LEQLARLQQASNQARQTYQDKTNPCIKSAT +TSPRIEGAAVG G+G G ASPSFLQAAK
Sbjct  119  LEQLARLQQASNQARQTYQDKTNPCIKSATATTSPRIEGAAVGTGIG-GGASPSFLQAAK  177

Query  180  FHHHHQHQRHLKLESRLSNTPSDSGASSAGDPNEDGATSVLSGHIAT-TTTNAGNHPRFD  238
             HH    QR LKL+SRLSNTPSDSGASSAGDPNEDG TSVL G IAT ++TNA + P+ D
Sbjct  178  LHH----QRQLKLDSRLSNTPSDSGASSAGDPNEDGVTSVLGGQIATPSSTNATSLPKLD  233

Query  239  LRNPSFPASSEPDADLQRQRHQELLEIFRSHSEPLYSSFAPFSHLPPVLLAAGVPPLPIF  298
            LR+P+FPA+SEPDAD+QRQRHQELLEIFRSHSEPLYSSFAPFSHLPPVLLAAGVP LPIF
Sbjct  234  LRHPNFPATSEPDADMQRQRHQELLEIFRSHSEPLYSSFAPFSHLPPVLLAAGVPQLPIF  293

Query  299  KDQFKAELLFPTSSSPELEEPIDLSLRSRPDPASPVARSSNSPSLSEPAAGSHCLGESPT  358
            KDQFKAELLFPT+SSPELEEPIDLS RSR DPASP+A +SNSPSLSEPAA SHCLGES  
Sbjct  294  KDQFKAELLFPTTSSPELEEPIDLSFRSRADPASPMAHNSNSPSLSEPAAASHCLGESTN  353

Query  359  FARKTTPLDLTLVRSQTLTG  378
            F RK+TPLDLTLVRSQTLTG
Sbjct  354  FVRKSTPLDLTLVRSQTLTG  373


>KNRL_DROME unnamed protein product
Length=647

 Score = 192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 89/91 (98%), Gaps = 0/91 (0%)

Query  1   MNQLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKA  60
           MNQ CKVCGEPAAGFHFGAFTCEGCKSFFGR+YNN+++I+ CK+NG+C+INKKNRTACKA
Sbjct  10  MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNLSSISDCKNNGECIINKKNRTACKA  69

Query  61  CRLRKCLLVGMSKSGSRYGRRSNWFKIHCLL  91
           CRL+KCL+VGMSKSGSRYGRRSNWFKIHCLL
Sbjct  70  CRLKKCLMVGMSKSGSRYGRRSNWFKIHCLL  100


>KNIR_DROME unnamed protein product
Length=429

 Score = 187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 95/120 (79%), Gaps = 0/120 (0%)

Query  1    MNQLCKVCGEPAAGFHFGAFTCEGCKSFFGRTYNNIAAIAGCKHNGDCVINKKNRTACKA  60
            MNQ CKVCGEPAAGFHFGAFTCEGCKSFFGR+YNNI+ I+ CK+ G C+I+KKNRT CKA
Sbjct  1    MNQTCKVCGEPAAGFHFGAFTCEGCKSFFGRSYNNISTISECKNEGKCIIDKKNRTTCKA  60

Query  61   CRLRKCLLVGMSKSGSRYGRRSNWFKIHCLLQEQQTTAGAGGGGASGGGGGGNGGVSSAS  120
            CRLRKC  VGMSK GSRYGRRSNWFKIHCLLQE +  A A G      GG   GG  SAS
Sbjct  61   CRLRKCYNVGMSKGGSRYGRRSNWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSAS  120



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016332.1 protein embryonic gonad isoform X2 [Drosophila
kikkawai]

Length=308
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EGON_DROME  unnamed protein product                                   473     1e-168
KNIR_DROME  unnamed protein product                                   60.1    5e-10 
KNRL_DROME  unnamed protein product                                   53.1    1e-07 


>EGON_DROME unnamed protein product
Length=373

 Score = 473 bits (1216),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 260/310 (84%), Positives = 277/310 (89%), Gaps = 9/310 (3%)

Query  1    MSKSGSRYGRRSNWFKIHCLLQEQQTTAGAGGGGASGGGGGGNGGVSSASLEQLARLQQA  60
            MSKSGSRYGRRSNWFKIHCLLQEQQTT+G GGG + G G GG   VSSASLEQLARLQQA
Sbjct  71   MSKSGSRYGRRSNWFKIHCLLQEQQTTSGLGGGSSVGSGSGGG--VSSASLEQLARLQQA  128

Query  61   SNQARQTYQDKTNPCIKSAT-STSPRIEGAAVGAGVGVGAASPSFLQAAKFHHHHQHQRH  119
            SNQARQTYQDKTNPCIKSAT +TSPRIEGAAVG G+G G ASPSFLQAAK HH    QR 
Sbjct  129  SNQARQTYQDKTNPCIKSATATTSPRIEGAAVGTGIG-GGASPSFLQAAKLHH----QRQ  183

Query  120  LKLESRLSNTPSDSGASSAGDPNEDGATSVLSGHIAT-TTTNAGNHPRFDLRNPSFPASS  178
            LKL+SRLSNTPSDSGASSAGDPNEDG TSVL G IAT ++TNA + P+ DLR+P+FPA+S
Sbjct  184  LKLDSRLSNTPSDSGASSAGDPNEDGVTSVLGGQIATPSSTNATSLPKLDLRHPNFPATS  243

Query  179  EPDADLQRQRHQELLEIFRSHSEPLYSSFAPFSHLPPVLLAAGVPPLPIFKDQFKAELLF  238
            EPDAD+QRQRHQELLEIFRSHSEPLYSSFAPFSHLPPVLLAAGVP LPIFKDQFKAELLF
Sbjct  244  EPDADMQRQRHQELLEIFRSHSEPLYSSFAPFSHLPPVLLAAGVPQLPIFKDQFKAELLF  303

Query  239  PTSSSPELEEPIDLSLRSRPDPASPVARSSNSPSLSEPAAGSHCLGESPTFARKTTPLDL  298
            PT+SSPELEEPIDLS RSR DPASP+A +SNSPSLSEPAA SHCLGES  F RK+TPLDL
Sbjct  304  PTTSSPELEEPIDLSFRSRADPASPMAHNSNSPSLSEPAAASHCLGESTNFVRKSTPLDL  363

Query  299  TLVRSQTLTG  308
            TLVRSQTLTG
Sbjct  364  TLVRSQTLTG  373


>KNIR_DROME unnamed protein product
Length=429

 Score = 60.1 bits (144),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 0/50 (0%)

Query  1    MSKSGSRYGRRSNWFKIHCLLQEQQTTAGAGGGGASGGGGGGNGGVSSAS  50
            MSK GSRYGRRSNWFKIHCLLQE +  A A G      GG   GG  SAS
Sbjct  71   MSKGGSRYGRRSNWFKIHCLLQEHEQAAAAAGKAPPLAGGVSVGGAPSAS  120


>KNRL_DROME unnamed protein product
Length=647

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/21 (100%), Positives = 21/21 (100%), Gaps = 0/21 (0%)

Query  1   MSKSGSRYGRRSNWFKIHCLL  21
           MSKSGSRYGRRSNWFKIHCLL
Sbjct  80  MSKSGSRYGRRSNWFKIHCLL  100



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016333.1 uncharacterized protein LOC108070391 [Drosophila
kikkawai]

Length=310
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q385H6_TRYB2  unnamed protein product                                 30.4    2.0  
Q383G3_TRYB2  unnamed protein product                                 28.5    7.0  
Q7KTZ4_DROME  unnamed protein product                                 28.9    7.3  


>Q385H6_TRYB2 unnamed protein product
Length=726

 Score = 30.4 bits (67),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 30/66 (45%), Gaps = 5/66 (8%)

Query  92   ANTQNEAAVTVETYPASTVARRAYNSDGMNTETE---RMRNILDLLHRFSYNLDAIEERL  148
            A+  NE     E YPA  VA    N +G + ET+   R  N LD     S  L  +EER 
Sbjct  436  ADAVNEGVNCAEKYPAEAVAAAEGNLEGGSVETDSECRAANQLDF--DSSRQLCEVEERC  493

Query  149  QAPQQY  154
             A  +Y
Sbjct  494  DAEYRY  499


>Q383G3_TRYB2 unnamed protein product
Length=326

 Score = 28.5 bits (62),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 26/52 (50%), Gaps = 2/52 (4%)

Query  58   TDRTNSDATQNNEMESKPVSFGVQCEPSTSRNCTANTQNEAAVTVETYPAST  109
            T  +NSD +  + + S+  +    C PS++R CTA  Q    V V    AST
Sbjct  58   TSHSNSDPSHVSRISSEGPAIVAACFPSSTRLCTA--QGNGRVGVWDIEAST  107


>Q7KTZ4_DROME unnamed protein product
Length=1503

 Score = 28.9 bits (63),  Expect = 7.3, Method: Compositional matrix adjust.
 Identities = 22/77 (29%), Positives = 32/77 (42%), Gaps = 16/77 (21%)

Query  229  FAAFCLCLQVNKDCIFCLGFFVAFVVSVSFLTAFFYRTINFKPSVSRVTAIPMTGSPQYE  288
            FAA CL L +    IFCLG    FV SV  +             + R+ A  + G    +
Sbjct  554  FAAECLALNLCNQNIFCLGSSDVFVYSVGGVV------------LHRIQASDIEG----K  597

Query  289  LTPLRFSGGYYYIYNKN  305
            +  +  SG Y  ++  N
Sbjct  598  IIGMDLSGCYLSVFTMN  614



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016334.1 uncharacterized protein LOC108070394 [Drosophila
kikkawai]

Length=248
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961X4_DROME  unnamed protein product                                 46.2    1e-05
Q9VU76_DROME  unnamed protein product                                 45.8    2e-05
M9PFE5_DROME  unnamed protein product                                 45.8    2e-05


>Q961X4_DROME unnamed protein product
Length=809

 Score = 46.2 bits (108),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 26/123 (21%)

Query  124  LQEKLNEIAQLKAQFKRVQHMVDTTKMIEEHMSSRQTTQISSSSTSSRQSTTSEVRVAAA  183
            + +K  +I  LKAQ  R++ M+ T   IEE       +  S  ST  R+S          
Sbjct  253  INQKTADIEALKAQMARLKGMLYTVSQIEE-------STPSMGSTLERRS----------  295

Query  184  ESEESIEGPSSSQSPPADNAELLNSMLNMFTDFTSDLRGQAESLREERDRIRALKEEIIQ  243
            E   S+E     +  PA+ A+ + ++     D TS+LR +A SL++ERDRI ALK EI +
Sbjct  296  EERTSVE-----RELPAEIAQRVFAL----NDVTSELRAEAASLQKERDRILALKAEIER  346

Query  244  RKQ  246
            RKQ
Sbjct  347  RKQ  349


 Score = 30.4 bits (67),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 11/67 (16%)

Query  16   LSERLAASNRQLQEMQEEHRELLQ----------EMETLRLRAAELTL-LNAQRHQQRQS  64
            L +RL ASNR +Q + +E  +LLQ          EME LR +A  L   +N     + +S
Sbjct  58   LQQRLEASNRNMQHLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYES  117

Query  65   VRMVQEE  71
            V+ VQ++
Sbjct  118  VQQVQDD  124


>Q9VU76_DROME unnamed protein product
Length=1657

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 26/123 (21%)

Query  124  LQEKLNEIAQLKAQFKRVQHMVDTTKMIEEHMSSRQTTQISSSSTSSRQSTTSEVRVAAA  183
            + +K  +I  LKAQ  R++ M+ T   IEE       +  S  ST  R+S          
Sbjct  531  INQKTADIEALKAQMARLKGMLYTVSQIEE-------STPSMGSTLERRS----------  573

Query  184  ESEESIEGPSSSQSPPADNAELLNSMLNMFTDFTSDLRGQAESLREERDRIRALKEEIIQ  243
            E   S+E     +  PA+ A+ + ++     D TS+LR +A SL++ERDRI ALK EI +
Sbjct  574  EERTSVE-----RELPAEIAQRVFAL----NDVTSELRAEAASLQKERDRILALKAEIER  624

Query  244  RKQ  246
            RKQ
Sbjct  625  RKQ  627


 Score = 30.8 bits (68),  Expect = 1.3, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 11/67 (16%)

Query  16   LSERLAASNRQLQEMQEEHRELLQ----------EMETLRLRAAELTL-LNAQRHQQRQS  64
            L +RL ASNR +Q + +E  +LLQ          EME LR +A  L   +N     + +S
Sbjct  336  LQQRLEASNRNMQHLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYES  395

Query  65   VRMVQEE  71
            V+ VQ++
Sbjct  396  VQQVQDD  402


>M9PFE5_DROME unnamed protein product
Length=1624

 Score = 45.8 bits (107),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 26/123 (21%)

Query  124  LQEKLNEIAQLKAQFKRVQHMVDTTKMIEEHMSSRQTTQISSSSTSSRQSTTSEVRVAAA  183
            + +K  +I  LKAQ  R++ M+ T   IEE       +  S  ST  R+S          
Sbjct  531  INQKTADIEALKAQMARLKGMLYTVSQIEE-------STPSMGSTLERRS----------  573

Query  184  ESEESIEGPSSSQSPPADNAELLNSMLNMFTDFTSDLRGQAESLREERDRIRALKEEIIQ  243
            E   S+E     +  PA+ A+ + ++     D TS+LR +A SL++ERDRI ALK EI +
Sbjct  574  EERTSVE-----RELPAEIAQRVFAL----NDVTSELRAEAASLQKERDRILALKAEIER  624

Query  244  RKQ  246
            RKQ
Sbjct  625  RKQ  627


 Score = 30.8 bits (68),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 11/67 (16%)

Query  16   LSERLAASNRQLQEMQEEHRELLQ----------EMETLRLRAAELTL-LNAQRHQQRQS  64
            L +RL ASNR +Q + +E  +LLQ          EME LR +A  L   +N     + +S
Sbjct  336  LQQRLEASNRNMQHLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYES  395

Query  65   VRMVQEE  71
            V+ VQ++
Sbjct  396  VQQVQDD  402



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016335.1 hsp70 nucleotide exchange factor FES1 [Drosophila
kikkawai]

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SIL1_DROME  unnamed protein product                                   46.2    2e-05
IMA2_CAEEL  unnamed protein product                                   31.2    1.1  
Q9U1H6_DROME  unnamed protein product                                 30.8    1.5  


>SIL1_DROME unnamed protein product
Length=429

 Score = 46.2 bits (108),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 67/142 (47%), Gaps = 6/142 (4%)

Query  66   LNSEEATTDDKLESLDVIRSHIDDIDNANALVKLGGT--VTLLRYVKDSENEIRVSALNT  123
            L SE  +  D LE+L+ +   +  IDNA   +  GG   V L   V D+   +RVSA+  
Sbjct  156  LESEMRSKLDCLENLEYL---LHQIDNALMFIDNGGLDDVLLPIVVNDTSTSLRVSAMRV  212

Query  124  VAEMAQNNTFCQNALITEKFLPVLTKNL-SEVNEDVVRSSIYAISSLIRNFQPGYAEFKR  182
            +  +A NN   Q  +  + F   L + L S  N   + ++++A  +L+R F         
Sbjct  213  LGSLASNNPKAQIKVFEKNFGSHLAQILTSSGNVGEISAALHAFGALLRKFPLAQQRVLS  272

Query  183  IKGIKALVPCLKSSNSNIYIKA  204
              G +AL+  L+S +  +  KA
Sbjct  273  TSGTQALIKVLQSPDVELRSKA  294


>IMA2_CAEEL unnamed protein product
Length=531

 Score = 31.2 bits (69),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 56/119 (47%), Gaps = 9/119 (8%)

Query  105  LLRYVKDSENEIRVSALNTVAEMAQNNTFCQN-ALITEKFLPVLTKNLSEVNEDVVRSSI  163
            L+  +K  +++ +  A   ++ +AQ  T  Q  A++ +  +P L + L + N D++ +++
Sbjct  392  LINVLKSGDHKCQFEASWALSNLAQGGTNRQVVAMLEDNVVPALCQALLQTNTDMLNNTL  451

Query  164  YAISSLIRNFQPGYA--------EFKRIKGIKALVPCLKSSNSNIYIKAAFLIASISRD  214
              + +L+   Q GY         + +   G+ +L    +S +  IY +A  +I     D
Sbjct  452  ETLYTLMLTVQNGYPHKVDILHDQVEENGGLDSLERLQESQSEQIYTQAYRIITQFFTD  510


>Q9U1H6_DROME unnamed protein product
Length=542

 Score = 30.8 bits (68),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 109/240 (45%), Gaps = 14/240 (6%)

Query  23   NTDQNAEEKPIEAADDVEKKQFLESALSAMTDAPTALKAALV-ILNSEEATTDDKLESLD  81
            NTD   +   +  AD     Q  E+A S     P+ +   ++ +L SE    +++LE+  
Sbjct  61   NTDNEQQAADMHMADSSTGGQNEEAAGSGAQ--PSVINEEMIQMLFSER--ENEQLEATQ  116

Query  82   VIRSHIDDIDNA--NALVKLGGTVTLLRYVKDSENE-IRVSALNTVAEMAQNNTFCQNAL  138
              R  +    N     +++ G     + ++++S N  ++  A  T+  +A   +     +
Sbjct  117  KFRKLLSRDPNPPIEEVIQKGIVPQFVTFLRNSANATLQFEAAWTLTNIASGTSQQTKVV  176

Query  139  ITEKFLPVLTKNLSEVNEDVVRSSIYAISSLIRNFQPGYAEFKRIKGI-KALVPCLKSSN  197
            I    +P+    LS  ++DV   +++A+ ++  +  P   +     GI + L+  L +S+
Sbjct  177  IEAGAVPIFIDLLSSPHDDVQEQAVWALGNIAGD-SPMCRDHLLGSGILEPLLHVLSNSD  235

Query  198  SNIYIK-AAFLIASISRDKNIRDDFVK-AEVFPVLLENLRPVIEFDVKQETTLFALSSLS  255
                I+ A + ++++ R K+   DF K +   P+L   L+   + DV Q  T +A+  LS
Sbjct  236  RITMIRNAVWTLSNLCRGKSPPADFAKISHGLPILARLLK-YTDADV-QSDTCWAIGYLS  293



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016336.1 nuclear pore complex protein DDB_G0274915 [Drosophila
kikkawai]

Length=240


***** No hits found *****



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


Query= XP_017016337.1 malate dehydrogenase [Drosophila kikkawai]

Length=351
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEB1_DROME  unnamed protein product                                 349     9e-120
MDHM_CAEEL  unnamed protein product                                   309     5e-104
Q4Q3J2_LEIMA  unnamed protein product                                 287     2e-95 


>Q9VEB1_DROME unnamed protein product
Length=336

 Score = 349 bits (895),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 227/315 (72%), Gaps = 0/315 (0%)

Query  22   SRRTFKVAIVGAGGGIGQPLSLLLRSGPGIKELALHDLVEMKGIATDLSHVSKSGMVTSF  81
             +  +KV + GA GGIGQPLSLLL+  P + +LAL+D+V   G+A DLSH+        F
Sbjct  21   QQNNYKVTVCGAAGGIGQPLSLLLKQNPLVTDLALYDIVHTPGVAADLSHIDTKSKTAGF  80

Query  82   SGENMLEPAVSCADLVVVAAGMPRLPGMQRDQLMAANGQVAVKVATAVSVACPEALLAFI  141
             G + L  ++  +D+VV+ AG+PR PGM RD L   N  +   ++ +++  CP+AL+A I
Sbjct  81   IGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCPKALVAII  140

Query  142  TNPVNMIVPAAAEVLKVNGIYDPCRLFGITTLDVVRSEKFIGDFMKISPDNVKIPVIGGH  201
            TNPVN  VP AAE+LK  G+YDP RLFG++TLDVVR+  FIG  + + P  V+IPVIGGH
Sbjct  141  TNPVNTCVPIAAEILKKAGVYDPKRLFGVSTLDVVRARAFIGHALGVDPQTVQIPVIGGH  200

Query  202  AGITILPLFSQCQPEFHGDKAVIKEMTHRIQEAGTEVVKAKAGKGSATLSMAFAGARFVD  261
            +G+TILP+ SQ QP F G++  I+++T RIQEAGTEVVKAKAG GSATLSMA+AGARF  
Sbjct  201  SGVTILPVLSQSQPLFKGNQDTIEKLTVRIQEAGTEVVKAKAGAGSATLSMAYAGARFAG  260

Query  262  SLLRGLKGEKGIVECAYVASELTDAPFFASPLELGKDGIERFLPLPTMSSTEEEAVAKLI  321
            SLL+GL GEK ++EC+YV S +T+A FF++PL LGK+G++  L LP ++  E++ +   I
Sbjct  261  SLLKGLNGEKNVIECSYVQSTVTEATFFSTPLVLGKNGVQENLGLPKLNDYEKKLLEAAI  320

Query  322  PVVQENAKEGIDFAR  336
            P +++N ++GIDFA 
Sbjct  321  PELKKNIQKGIDFAN  335


>MDHM_CAEEL unnamed protein product
Length=341

 Score = 309 bits (792),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 219/322 (68%), Gaps = 2/322 (1%)

Query  16   AAPWRLSRRTFKVAIVGAGGGIGQPLSLLLRSGPGIKELALHDLVEMKGIATDLSHVSKS  75
            A   R S +  KVA++GA GGIGQPL LLL+  P +  LAL+D+V   G+A DLSH+  +
Sbjct  19   AVSVRHSSQAPKVALLGAAGGIGQPLGLLLKQDPLVAHLALYDVVNTPGVAADLSHIDSN  78

Query  76   GMVTSFSGENMLEPAVSCADLVVVAAGMPRLPGMQRDQLMAANGQVAVKVATAVSVACPE  135
              VT+ +G   L  AV  AD++V+ AG+PR PGM RD L   N  +   +A  ++ A P+
Sbjct  79   AKVTAHTGPKELYAAVENADVIVIPAGVPRKPGMTRDDLFNTNAGIVRDLAAVIAKASPK  138

Query  136  ALLAFITNPVNMIVPAAAEVLKVNGIYDPCRLFGITTLDVVRSEKFIGDFMKISPDNVKI  195
            AL+A ITNPVN  VP A+EVLK  G+YDP R+FG+TTLDVVRS+ F+ +          +
Sbjct  139  ALIAIITNPVNSTVPIASEVLKKAGVYDPKRVFGVTTLDVVRSQAFVSELKGHDASKTVV  198

Query  196  PVIGGHAGITILPLFSQCQPEFHGDKAVIKEMTHRIQEAGTEVVKAKAGKGSATLSMAFA  255
            PV+GGHAGITI+PL SQ +P     +  I ++T RIQ+AGTEVV AKAG GSATLSMA A
Sbjct  199  PVVGGHAGITIIPLLSQVKPSTKFSEEEISKLTPRIQDAGTEVVNAKAGAGSATLSMALA  258

Query  256  GARFVDSLLRGLKGEKGIVECAYVASE-LTDAPFFASPLELGKDGIERFLPLPTMSSTEE  314
            GARF ++L+RG+KGEK  V+CAYVAS+ +    +F++P+ELG +G+E+ L +  +S+ E+
Sbjct  259  GARFANALVRGIKGEKN-VQCAYVASDAVKGVEYFSTPVELGPNGVEKILGVGKVSAYEQ  317

Query  315  EAVAKLIPVVQENAKEGIDFAR  336
            + +   +P + +N  +G+ F +
Sbjct  318  KLIDASVPELNKNIAKGVAFVK  339


>Q4Q3J2_LEIMA unnamed protein product
Length=325

 Score = 287 bits (734),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/317 (48%), Positives = 211/317 (67%), Gaps = 8/317 (3%)

Query  24   RTFKVAIVGAGGGIGQPLSLLLRSGPGIKELALHDLVEMKGIATDLSHVSKSGMVTSFS-  82
            R F+VA++GA GGIGQPLSLLL+  P +  L+L+D+    G+A DLSH+     V  FS 
Sbjct  7    RLFRVAVLGAAGGIGQPLSLLLKCSPLVTSLSLYDIRGGPGVAADLSHIPSPAEVIGFSS  66

Query  83   GENMLEPAVSCADLVVVAAGMPRLPGMQRDQLMAANGQVAVKVATAVSVACPEALLAFIT  142
            GE  LE AV  ADLV+V AG+PR PGM RD L+  N  +   +A AV    P+A++  IT
Sbjct  67   GE--LEKAVKGADLVLVVAGIPRKPGMTRDDLLHTNASIVRDLAIAVGTHAPKAIVGIIT  124

Query  143  NPVNMIVPAAAEVLKVNGIYDPCRLFGITTLDVVRSEKFIGDFMKISPDNVKIPVIGGHA  202
            NPVN  VP AAE LK  G+YDP RLFG+TTLDVVR+  F+ + +  SP +V +PVIGGH+
Sbjct  125  NPVNSTVPVAAEALKKVGVYDPARLFGVTTLDVVRARTFVAEALGASPYDVDVPVIGGHS  184

Query  203  GITILPLFSQCQPEFHGDKAVIKEMTHRIQEAGTEVVKAKAGKGSATLSMAFAGARFVDS  262
            G TI+PL S   P    ++  ++++THRIQ  G EVVKAK G GSATLSMA+A + +  S
Sbjct  185  GETIVPLLSGF-PSLSEEQ--VRQLTHRIQFGGDEVVKAKDGAGSATLSMAYAASEWSIS  241

Query  263  LLRGLKGEKGIVECAYVASELTD--APFFASPLELGKDGIERFLPLPTMSSTEEEAVAKL  320
            +L+ L+G++GIVE A V S++    + FF   +ELG  G+ER LP+P +++ E++ +   
Sbjct  242  MLKALRGDRGIVEYALVESDMQQPHSRFFGCAVELGTHGVERVLPMPKLNAYEQQLLDAC  301

Query  321  IPVVQENAKEGIDFARK  337
            +P +    ++G+D A K
Sbjct  302  VPALSAEFRKGVDLAVK  318



Lambda      K        H
   0.315    0.136    0.430 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 5039390086


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016338.1 malate dehydrogenase [Drosophila kikkawai]

Length=344
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VEB1_DROME  unnamed protein product                                 355     3e-122
MDHM_CAEEL  unnamed protein product                                   297     2e-99 
Q4Q3J2_LEIMA  unnamed protein product                                 288     4e-96 


>Q9VEB1_DROME unnamed protein product
Length=336

 Score = 355 bits (911),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 233/326 (71%), Gaps = 11/326 (3%)

Query  18   SQSNRRGLKVAVVGAAGGIGQPLSLLLKLNPHIEHLALHDLRNTQGVAMDLSHIDTPATV  77
            S   +   KV V GAAGGIGQPLSLLLK NP +  LAL+D+ +T GVA DLSHIDT +  
Sbjct  18   SVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLVTDLALYDIVHTPGVAADLSHIDTKSKT  77

Query  78   CPFEGGD--GKSLRRAMFMADIVVVPAGLPRQPGMSRTDLVKVNASVAADVAFAASEVCP  135
              F G D  G SL+ +    D+VV+PAG+PR+PGM+R DL  VNA +  D++ + ++ CP
Sbjct  78   AGFIGADQLGDSLKGS----DVVVIPAGVPRKPGMTRDDLFNVNAGIIKDISNSIAKNCP  133

Query  136  RAFIAFITNPVNVVVPLAATVLKAKCNYDPNRLFGVTSLDLVRARTFVGDALNVNPLKVE  195
            +A +A ITNPVN  VP+AA +LK    YDP RLFGV++LD+VRAR F+G AL V+P  V+
Sbjct  134  KALVAIITNPVNTCVPIAAEILKKAGVYDPKRLFGVSTLDVVRARAFIGHALGVDPQTVQ  193

Query  196  VPVIGGHTGKTILPILSQCTPAYNGTDEEVEELIKRIQGAGTEVVNAKKGEGSATLSMAH  255
            +PVIGGH+G TILP+LSQ  P + G  + +E+L  RIQ AGTEVV AK G GSATLSMA+
Sbjct  194  IPVIGGHSGVTILPVLSQSQPLFKGNQDTIEKLTVRIQEAGTEVVKAKAGAGSATLSMAY  253

Query  256  AANLFVGNLIKAIKGSDKPIVECAYVESEVTEAQFFATPFVLGPQGIKENLGLPDMNDVE  315
            A   F G+L+K + G +K ++EC+YV+S VTEA FF+TP VLG  G++ENLGLP +ND E
Sbjct  254  AGARFAGSLLKGLNG-EKNVIECSYVQSTVTEATFFSTPLVLGKNGVQENLGLPKLNDYE  312

Query  316  MEALEKMLPELKANIEAGIKLGKDFA  341
             + LE  +PELK NI+ GI    DFA
Sbjct  313  KKLLEAAIPELKKNIQKGI----DFA  334


>MDHM_CAEEL unnamed protein product
Length=341

 Score = 297 bits (760),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/324 (50%), Positives = 216/324 (67%), Gaps = 9/324 (3%)

Query  16   HSSQSNRRGLKVAVVGAAGGIGQPLSLLLKLNPHIEHLALHDLRNTQGVAMDLSHIDTPA  75
            HSSQ+     KVA++GAAGGIGQPL LLLK +P + HLAL+D+ NT GVA DLSHID+ A
Sbjct  24   HSSQAP----KVALLGAAGGIGQPLGLLLKQDPLVAHLALYDVVNTPGVAADLSHIDSNA  79

Query  76   TVCPFEGGDGKSLRRAMFMADIVVVPAGLPRQPGMSRTDLVKVNASVAADVAFAASEVCP  135
             V    G   K L  A+  AD++V+PAG+PR+PGM+R DL   NA +  D+A   ++  P
Sbjct  80   KVTAHTGP--KELYAAVENADVIVIPAGVPRKPGMTRDDLFNTNAGIVRDLAAVIAKASP  137

Query  136  RAFIAFITNPVNVVVPLAATVLKAKCNYDPNRLFGVTSLDLVRARTFVGDALNVNPLKVE  195
            +A IA ITNPVN  VP+A+ VLK    YDP R+FGVT+LD+VR++ FV +    +  K  
Sbjct  138  KALIAIITNPVNSTVPIASEVLKKAGVYDPKRVFGVTTLDVVRSQAFVSELKGHDASKTV  197

Query  196  VPVIGGHTGKTILPILSQCTPAYNGTDEEVEELIKRIQGAGTEVVNAKKGEGSATLSMAH  255
            VPV+GGH G TI+P+LSQ  P+   ++EE+ +L  RIQ AGTEVVNAK G GSATLSMA 
Sbjct  198  VPVVGGHAGITIIPLLSQVKPSTKFSEEEISKLTPRIQDAGTEVVNAKAGAGSATLSMAL  257

Query  256  AANLFVGNLIKAIKGSDKPIVECAYVESE-VTEAQFFATPFVLGPQGIKENLGLPDMNDV  314
            A   F   L++ IKG     V+CAYV S+ V   ++F+TP  LGP G+++ LG+  ++  
Sbjct  258  AGARFANALVRGIKGEKN--VQCAYVASDAVKGVEYFSTPVELGPNGVEKILGVGKVSAY  315

Query  315  EMEALEKMLPELKANIEAGIKLGK  338
            E + ++  +PEL  NI  G+   K
Sbjct  316  EQKLIDASVPELNKNIAKGVAFVK  339


>Q4Q3J2_LEIMA unnamed protein product
Length=325

 Score = 288 bits (737),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 217/320 (68%), Gaps = 9/320 (3%)

Query  19   QSNRRGLKVAVVGAAGGIGQPLSLLLKLNPHIEHLALHDLRNTQGVAMDLSHIDTPATVC  78
             S  R  +VAV+GAAGGIGQPLSLLLK +P +  L+L+D+R   GVA DLSHI +PA V 
Sbjct  3    SSATRLFRVAVLGAAGGIGQPLSLLLKCSPLVTSLSLYDIRGGPGVAADLSHIPSPAEVI  62

Query  79   PFEGGDGKSLRRAMFMADIVVVPAGLPRQPGMSRTDLVKVNASVAADVAFAASEVCPRAF  138
             F  G+   L +A+  AD+V+V AG+PR+PGM+R DL+  NAS+  D+A A     P+A 
Sbjct  63   GFSSGE---LEKAVKGADLVLVVAGIPRKPGMTRDDLLHTNASIVRDLAIAVGTHAPKAI  119

Query  139  IAFITNPVNVVVPLAATVLKAKCNYDPNRLFGVTSLDLVRARTFVGDALNVNPLKVEVPV  198
            +  ITNPVN  VP+AA  LK    YDP RLFGVT+LD+VRARTFV +AL  +P  V+VPV
Sbjct  120  VGIITNPVNSTVPVAAEALKKVGVYDPARLFGVTTLDVVRARTFVAEALGASPYDVDVPV  179

Query  199  IGGHTGKTILPILSQCTPAYNGTDEEVEELIKRIQGAGTEVVNAKKGEGSATLSMAHAAN  258
            IGGH+G+TI+P+LS   P+   ++E+V +L  RIQ  G EVV AK G GSATLSMA+AA+
Sbjct  180  IGGHSGETIVPLLSGF-PSL--SEEQVRQLTHRIQFGGDEVVKAKDGAGSATLSMAYAAS  236

Query  259  LFVGNLIKAIKGSDKPIVECAYVESEVTE--AQFFATPFVLGPQGIKENLGLPDMNDVEM  316
             +  +++KA++G D+ IVE A VES++ +  ++FF     LG  G++  L +P +N  E 
Sbjct  237  EWSISMLKALRG-DRGIVEYALVESDMQQPHSRFFGCAVELGTHGVERVLPMPKLNAYEQ  295

Query  317  EALEKMLPELKANIEAGIKL  336
            + L+  +P L A    G+ L
Sbjct  296  QLLDACVPALSAEFRKGVDL  315



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016339.1 uncharacterized protein LOC108070399 isoform X2
[Drosophila kikkawai]

Length=278
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q961T2_DROME  unnamed protein product                                 33.1    0.30 
Q494G8_DROME  unnamed protein product                                 32.7    0.31 
Q9U3W5_DROME  unnamed protein product                                 30.8    1.2  


>Q961T2_DROME unnamed protein product
Length=720

 Score = 33.1 bits (74),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 62/135 (46%), Gaps = 21/135 (16%)

Query  106  NKWSLFLCHQDTRNHLTRIFDFLASKRRLEVLRIKGEINADNEA---KSLAN-IKTLKS-  160
            + W  F     T +HLT + D +   +RL++  I  E+NA   A    SL N ++T+ S 
Sbjct  398  SGWKGF-----TSDHLTYLVDNMHKLQRLDLSSINVEMNASKSAVGVNSLCNALQTMGSR  452

Query  161  LDCSFANPNFVIYLTELTSLRSLRITSLHGMDISATYLQVI-----------RSCKDLKF  209
            L   +   N +  + ++  + S    +L  +D+S    Q             R C+ LK 
Sbjct  453  LTHLYLAHNRLAGIPQIVGILSTHCPNLTLLDLSNVTTQATSHGVLHIEKLQRGCQKLKV  512

Query  210  LRIFDYNISPNFVSL  224
            LR+ + +I+P+  S+
Sbjct  513  LRVTNSHITPSTASM  527


>Q494G8_DROME unnamed protein product
Length=720

 Score = 32.7 bits (73),  Expect = 0.31, Method: Compositional matrix adjust.
 Identities = 35/135 (26%), Positives = 62/135 (46%), Gaps = 21/135 (16%)

Query  106  NKWSLFLCHQDTRNHLTRIFDFLASKRRLEVLRIKGEINADNEA---KSLAN-IKTLKS-  160
            + W  F     T +HLT + D +   +RL++  I  E+NA   A    SL N ++T+ S 
Sbjct  398  SGWKGF-----TSDHLTYLVDNMHKLQRLDLSSINVEMNASKSAVGVNSLCNALQTMGSR  452

Query  161  LDCSFANPNFVIYLTELTSLRSLRITSLHGMDISATYLQVI-----------RSCKDLKF  209
            L   +   N +  + ++  + S    +L  +D+S    Q             R C+ LK 
Sbjct  453  LTHLYLAHNRLAGIPQIVGILSTHCPNLTLLDLSNVTTQATSHGVLHIEKLQRGCQKLKV  512

Query  210  LRIFDYNISPNFVSL  224
            LR+ + +I+P+  S+
Sbjct  513  LRVTNSHITPSTASM  527


>Q9U3W5_DROME unnamed protein product
Length=326

 Score = 30.8 bits (68),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 71/158 (45%), Gaps = 28/158 (18%)

Query  46   LSRSYRLNLFWTPRDLLRHCRSLCNLRTL---HLSDD--VSSSNLRDIVKQMPHLK--DL  98
            L+R  RL L W   +L++   +L +L+TL    L D+      NL D    +PHL+  D+
Sbjct  60   LTRIERLFLRW---NLIKKIENLSSLKTLIELELYDNQITKIENLDD----LPHLEVLDI  112

Query  99   SF----YIDRSNKWSLFLCHQDTRNHLTRI--FDFLASKRRLEVLRIKGEINADNEAKSL  152
            SF     I+  +K           N +T+I   D L +   LE+         DN+ K +
Sbjct  113  SFNRLTKIENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLEL--------GDNKLKKI  164

Query  153  ANIKTLKSLDCSFANPNFVIYLTELTSLRSLRITSLHG  190
             NI+ L +L   F   N +  +  L +L +L I SL  
Sbjct  165  ENIEMLVNLRQLFLGKNKIAKIENLDTLVNLEILSLQA  202



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016340.2 uncharacterized protein LOC108070399 isoform X3
[Drosophila kikkawai]

Length=141
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CUP15_CAEEL  unnamed protein product                                  29.6    0.91 
Q57UU4_TRYB2  unnamed protein product                                 28.1    3.4  
Q54DW1_DICDI  unnamed protein product                                 27.7    3.7  


>CUP15_CAEEL unnamed protein product
Length=322

 Score = 29.6 bits (65),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 21/97 (22%), Positives = 45/97 (46%), Gaps = 6/97 (6%)

Query  12   DYCLQRILHYVDIKGQISFAQTCARFRDVFHVWSRCEYSYVSIVGDVEPRELT----LLS  67
            D C+    ++   K ++SF++   +F++  + W  C  +Y S  G V    LT    + +
Sbjct  132  DSCITIKWNFPQNKSEVSFSERTMQFQNRMYEWRNCVVNYTS--GGVLDDNLTNGSKICN  189

Query  68   LVASSVRKLNIFADDLHGLPEVHQAMAGESTSDRQAH  104
            L  ++  +L  +   ++  P+V   +  E+T +   H
Sbjct  190  LCKTTFDELFGYYWKIYTTPDVDFCVDVETTMNDTIH  226


>Q57UU4_TRYB2 unnamed protein product
Length=6613

 Score = 28.1 bits (61),  Expect = 3.4, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 48/111 (43%), Gaps = 28/111 (25%)

Query  11    NDYCLQRILHYV----------DIKGQISFAQTCARFRDVFHVWSRCEYSYVSIVGDVEP  60
             N Y L+R  H+           D+KG +    +CA+   +F  +  CE  + S  G +E 
Sbjct  4871  NVYTLRRYDHFASPQLQRQGTRDMKGDL---WSCAQLLRMFSTFLICEEGFRSAAGMLEK  4927

Query  61    RELTLLSLVASSVRKLNIFADDLHGLPEVHQAMAGEST----SDRQAHTEG  107
               +T +S +   +R+   FADD        +  AGE T    + RQA   G
Sbjct  4928  GNMT-ISYILDQLRE---FADD-------AKKSAGEETIFLQTGRQACIPG  4967


>Q54DW1_DICDI unnamed protein product
Length=1736

 Score = 27.7 bits (60),  Expect = 3.7, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 19/35 (54%), Gaps = 0/35 (0%)

Query  6    GILDLNDYCLQRILHYVDIKGQISFAQTCARFRDV  40
            GI  LN   L  I  Y+DIK     AQTC+ +R V
Sbjct  416  GISVLNGEVLVCIFQYLDIKEICCLAQTCSWWRIV  450



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016341.1 uncharacterized protein LOC108070400 [Drosophila
kikkawai]

Length=406
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q583Y7_TRYB2  unnamed protein product                                 36.6    0.028
Q9VY46_DROME  unnamed protein product                                 33.1    0.51 
ITPR_CAEEL  unnamed protein product                                   32.3    0.87 


>Q583Y7_TRYB2 unnamed protein product
Length=364

 Score = 36.6 bits (83),  Expect = 0.028, Method: Compositional matrix adjust.
 Identities = 59/222 (27%), Positives = 92/222 (41%), Gaps = 37/222 (17%)

Query  133  FDQVLAAVRHLPELKRLEFQATQDFSVDRLHQLQNLETLQLLIPKVPPACLVKCFKSNSN  192
             +QVL        L  L  +      V+ L ++ +L+ L L+   V  + +V    SNS 
Sbjct  115  VEQVLQGALAFRTLVELSLRRVSIKDVNVLGKMPSLQKLDLVEASVADSGIVGLGDSNS-  173

Query  193  LRSLHLGYSCCQKNLVDIIVTHCKDLEVLKFGMTAEPADYKPLAKLPKLREL--SHFGIR  250
                          LV I +  C+D+           AD   L K+P LREL  +   + 
Sbjct  174  --------------LVSINLWGCEDI-----------ADVSVLGKIPTLRELVVAETKVT  208

Query  251  RSGSFEPLLSSLAVKSQLKHLSIDG-GSLT-QGEVCQLVCIQSLRHLTCFCASNECVEML  308
              G+     + L     L+ L+++   S+T  G V +L  +Q L  +T    S   +  L
Sbjct  209  DCGT-----AGLVDCVNLRELNMEACPSITCVGAVSELPVLQRLLLVTTAVTSAG-IASL  262

Query  309  GRLKNLEEICLWMSRPLDISHGLLTIIASCKRLKLLRLAVGN  350
            G  ++L EI LW  R +D S   L  I + +RL L   +V N
Sbjct  263  GNSRSLVEIDLWGCRGVD-SVNTLGKIPTLRRLDLFGTSVTN  303


>Q9VY46_DROME unnamed protein product
Length=669

 Score = 33.1 bits (74),  Expect = 0.51, Method: Compositional matrix adjust.
 Identities = 42/153 (27%), Positives = 66/153 (43%), Gaps = 22/153 (14%)

Query  206  NLVDIIVTHCKDLEVLKFGMTAEPA--DYKPLAKLPKLRELSHFGIRRSGSFEPLLSSLA  263
            NL+++ + +C            EP   ++  LA L  L  L  F  +     E LLS L 
Sbjct  448  NLIELSLRNC----------ATEPPLLNFSCLANLKNLERLDLF--QTYFETELLLSMLE  495

Query  264  VKSQLKHLSID--GGSLTQGEVCQLVCIQ-----SLRHLTCFCASNECVEMLGRLKNLEE  316
               +LKHL++   G S+    V   +        SL        S+  ++ L RL  LEE
Sbjct  496  GNRKLKHLNLAFCGVSVNMDNVAAHLATYNTQLISLDLWKAHFLSSRGLQSLARLHQLEE  555

Query  317  ICL-WMSRPLDISHGLLTIIASCKRLKLLRLAV  348
            + L W  R   +  GL  ++++C +LK L L+ 
Sbjct  556  LDLGWCMREASLGDGLFQLLSNCPKLKKLFLSA  588


>ITPR_CAEEL unnamed protein product
Length=2892

 Score = 32.3 bits (72),  Expect = 0.87, Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (51%), Gaps = 0/51 (0%)

Query  106   HTLSGMNRLKHLVVKQLKFYIAPIDKPFDQVLAAVRHLPELKRLEFQATQD  156
             HT + +    H+++ + KFY+ P+      VL  V H PEL   E  A +D
Sbjct  1754  HTSANVVTCYHMMIGEFKFYLHPLHAAEGSVLVEVLHTPELLFPEGSALRD  1804



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016342.1 uncharacterized protein LOC108070402 [Drosophila
kikkawai]

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38F29_TRYB2  unnamed protein product                                 37.7    0.012
ABCA5_DICDI  unnamed protein product                                  37.7    0.012
ABCA6_DICDI  unnamed protein product                                  31.6    1.1  


>Q38F29_TRYB2 unnamed protein product
Length=935

 Score = 37.7 bits (86),  Expect = 0.012, Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 8/70 (11%)

Query  157  RISDLPESYYSDEGFLQIINAITAFLSQPDSNQAHKNSDVTIASHPFI--LDGKYKNYLN  214
            R+  LPE++Y+       +N I +    P  N    N+ VT+ + PFI  +D     YL 
Sbjct  275  RLCGLPEAFYTP------LNTILSLHHGPTVNGEEDNNSVTVCTSPFIGSIDDSIAEYLK  328

Query  215  RVLFDPTKRR  224
               FD T R+
Sbjct  329  PSRFDTTFRK  338


>ABCA5_DICDI unnamed protein product
Length=1662

 Score = 37.7 bits (86),  Expect = 0.012, Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 1/64 (2%)

Query  231  FYLGVLYIYPFIRLVMHMTREKTRQQVDLMNMAGSNRFLHYLCWFISTFVVLFIINLLTI  290
            F    L I+ F RLV  +  EK  +  + M++ G N++ +++ W I++ V    I+L+ I
Sbjct  244  FVSAALLIFTF-RLVTELVVEKETKIREGMSIMGLNQYCYFISWIITSLVTALPIDLIII  302

Query  291  FLLK  294
             +LK
Sbjct  303  VILK  306


>ABCA6_DICDI unnamed protein product
Length=1631

 Score = 31.6 bits (70),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 39/88 (44%), Gaps = 13/88 (15%)

Query  219  DP-TKRREEYILG-----------FYLGVLYIYPFIRLVMHMTREKTRQQVDLMNMAGSN  266
            DP T+  +E+I G           F    L ++ F RLV  +  EK  + V+ M M   N
Sbjct  220  DPYTELWQEWITGRDAIIKSAGSVFITAALMMFSF-RLVTDVVIEKETKIVEAMRMMSLN  278

Query  267  RFLHYLCWFISTFVVLFIINLLTIFLLK  294
               ++  W I++ +    + LL + + K
Sbjct  279  SLAYFSSWIITSLITSLPVTLLIVVIFK  306



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016343.1 endocuticle structural protein SgAbd-6 [Drosophila
kikkawai]

Length=134
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

LCP52_DROME  unnamed protein product                                  47.4    1e-07
LCP51_DROME  unnamed protein product                                  47.4    1e-07
Q9VTC8_DROME  unnamed protein product                                 42.7    8e-06


>LCP52_DROME unnamed protein product
Length=104

 Score = 47.4 bits (111),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 53/104 (51%), Gaps = 11/104 (11%)

Query  2    FKIVFISLALCLAVVLSAPVDHVDQPPVAILESTHEKHEDGSYNFSYLGEDGTHRHEEAV  61
            F IVF++L   +AV          +P +A +       E   ++      DGT   +E V
Sbjct  3    FLIVFVAL-FAMAVA---------RPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGV  52

Query  62   VRNQGTENEYLEISGSYSYFD-ANGKEVVVNYKADDHGFVPEGG  104
            ++N GT+NE   + GS+++ D   G++  + Y AD++G+ P+G 
Sbjct  53   LKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGA  96


>LCP51_DROME unnamed protein product
Length=104

 Score = 47.4 bits (111),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 53/104 (51%), Gaps = 11/104 (11%)

Query  2    FKIVFISLALCLAVVLSAPVDHVDQPPVAILESTHEKHEDGSYNFSYLGEDGTHRHEEAV  61
            F IVF++L   +AV          +P +A +       E   ++      DGT   +E V
Sbjct  3    FLIVFVAL-FAMAVA---------RPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGV  52

Query  62   VRNQGTENEYLEISGSYSYFD-ANGKEVVVNYKADDHGFVPEGG  104
            ++N GT+NE   + GS+++ D   G++  + Y AD++G+ P+G 
Sbjct  53   LKNAGTDNEAAVVHGSFTWVDEKTGEKFTITYVADENGYQPQGA  96


>Q9VTC8_DROME unnamed protein product
Length=122

 Score = 42.7 bits (99),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/98 (28%), Positives = 44/98 (45%), Gaps = 8/98 (8%)

Query  6    FISLALCLAVVLSAPVDHVDQPPVAILESTHEKHEDGSYNFSYLGEDGTHRHEEAVVRNQ  65
             I  AL +++ L A +   D+      +  +E   DGSY++ Y   +G    E  V   Q
Sbjct  1    MIKTALIISLFLVAAIRAADESQAETTKYRNEIKPDGSYSWEYGTSNGIDAQESGVGGVQ  60

Query  66   GTENEYLEISGSYSYFDANGKEVVVNYKADDHGFVPEG  103
                     +GS SY   +G  + + Y AD++G+ P G
Sbjct  61   A--------AGSVSYAAPDGTPIQLEYTADENGYRPTG  90



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016344.1 extensin [Drosophila kikkawai]

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

YYT6_CAEEL  unnamed protein product                                   32.0    0.22 


>YYT6_CAEEL unnamed protein product
Length=171

 Score = 32.0 bits (71),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 45/161 (28%), Positives = 68/161 (42%), Gaps = 22/161 (14%)

Query  1    MIKASSTTALVLVLSL------VALSTAEPLRRRFVARQVEAPASPAPTGYPEAGITPSV  54
            M     TT+ ++ ++L      V+   +   RR++VA Q  A    AP G    G  PS+
Sbjct  1    MFSKLFTTSCLVAIALTTAQEEVSGKVSSTKRRQYVAAQQPAVPVVAPVGQCPGG--PSL  58

Query  55   PFDLPSSTAKPENTYLPPDNTYGPPDNTYGPPDNTYGPPDNTYGP------PEADFVPAP  108
            P +       P+     P  +Y    N+         P  +TYG       P  ++VP  
Sbjct  59   PIECDPKRPWPQC----PPQSYCYATNSVDIGPYFCCPVWSTYGAAWRPATPFYNYVP--  112

Query  109  EPEPEAQPENPIETDDIPAAAEDEPVDAKLQPSDEDAEEDE  149
             P P   P+    T + PAAA   PV A+ +P+  D EE+E
Sbjct  113  -PVPANWPDVAKMTANWPAAAVSVPVKAR-KPTKSDDEEEE  151



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016345.1 uncharacterized protein LOC108070401 [Drosophila
kikkawai]

Length=265
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A0A0B4KHJ4_DROME  unnamed protein product                             35.4    0.057
Q5LJN5_DROME  unnamed protein product                                 33.9    0.14 
CNP2_CAEEL  unnamed protein product                                   33.5    0.17 


>A0A0B4KHJ4_DROME unnamed protein product
Length=4496

 Score = 35.4 bits (80),  Expect = 0.057, Method: Compositional matrix adjust.
 Identities = 18/80 (23%), Positives = 39/80 (49%), Gaps = 3/80 (4%)

Query  136   WSAVDQRQVDIKDLETQLAGIGGSASVDYGAEKPSKT---LQHTIHIEVESVTSATDMQR  192
             W     R+VD+++++ +         +     +P  T   L+ T+   + S+ +  ++Q 
Sbjct  1319  WKTTPWRKVDVENMDIECKKFAKDIRLLDKEMRPWDTFINLESTVKNMLTSLRAVGELQN  1378

Query  193   PPLRQRMWNVLTQTSDSIVA  212
             P +R+R WN L  ++ S+ A
Sbjct  1379  PAIRERHWNQLMNSTKSLAA  1398


>Q5LJN5_DROME unnamed protein product
Length=4559

 Score = 33.9 bits (76),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 38/78 (49%), Gaps = 9/78 (12%)

Query  136   WSAVDQRQVDIKDLETQLAGIGGSASVDYGAEKPSKTLQHTIHIE------VESVTSATD  189
             W     +++DI++++ +    G       G +K  +T +  I +E      + S+ + T+
Sbjct  1392  WKKTPWKKIDIENMDQECKKFGRELR---GLDKAMRTWEPFIFMEASLKNLMTSLRAVTE  1448

Query  190   MQRPPLRQRMWNVLTQTS  207
             +Q P +R R W  L QT+
Sbjct  1449  LQNPAIRDRHWIELMQTT  1466


>CNP2_CAEEL unnamed protein product
Length=732

 Score = 33.5 bits (75),  Expect = 0.17, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 7/66 (11%)

Query  32   NIHKNGDSTVPSYLSEVHLSHQQITRRFGDLLNLFEDYTKILKSEHERVNVPFHLKRVLS  91
            NI K   S +PS  +   + H   +RRF          T IL+ EHE V VP H  + L 
Sbjct  325  NIPKTSTSRIPSSENPKTMEHTTTSRRFPTQ-------TSILRKEHEIVQVPLHRSQSLR  377

Query  92   DLVLNE  97
               ++E
Sbjct  378  QSRISE  383



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016346.1 transcription initiation factor IIA subunit 2-like
[Drosophila kikkawai]

Length=110
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

T2AG_DROME  unnamed protein product                                   121     4e-37
T2AH_DROME  unnamed protein product                                   88.2    5e-24
Q27499_CAEEL  unnamed protein product                                 30.0    0.30 


>T2AG_DROME unnamed protein product
Length=106

 Score = 121 bits (304),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 76/109 (70%), Gaps = 5/109 (5%)

Query  1    MAYKMYRGTTLGETLQETLDYLIQFGDLNPNLAEDVLDQFDRSVNRLLRHNDKPQLTFKG  60
            M+Y++YR TTLG TLQE+LD LIQ+G + P LA  VL QFD+S+N  L    K ++TFK 
Sbjct  1    MSYQLYRNTTLGNTLQESLDELIQYGQITPGLAFKVLLQFDKSINNALNQRVKARVTFKA  60

Query  61   DKLDVYRFCDKVWILILKDVVFYERDGREKHEILHVGKMKIVACETRIG  109
             KL+ YRFCD VW L+L DV F     RE HEI+ V K+KIVAC+ + G
Sbjct  61   GKLNTYRFCDNVWTLMLNDVEF-----REVHEIVKVDKVKIVACDGKSG  104


>T2AH_DROME unnamed protein product
Length=107

 Score = 88.2 bits (217),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 65/104 (63%), Gaps = 5/104 (5%)

Query  1    MAYKMYRGTTLGETLQETLDYLIQFGDLNPNLAEDVLDQFDRSVNRLLRHNDKPQLTFKG  60
            M Y+ YR TTLG TLQ+TLD +++ GD+   +A  VL ++D+S++  L+ +    ++F  
Sbjct  1    MNYQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTALKDHGTSNMSFTA  60

Query  61   DKLDVYRFCDKVWILILKDVVFYERDGREKHEILHVGKMKIVAC  104
            ++L+ +R CD VW LILKD  F     RE    L V  +KIVAC
Sbjct  61   ERLETFRCCDNVWTLILKDAEF-----REDQHSLKVDVVKIVAC  99


>Q27499_CAEEL unnamed protein product
Length=494

 Score = 30.0 bits (66),  Expect = 0.30, Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query  13   ETLQETLDYLIQFGDLNPNLAEDVLDQFDRSV--NRLLRHNDKPQLTF  58
            ET   TL++ + +   NP + + V ++ DR +  +R++  +DKP+L +
Sbjct  304  ETTSNTLNWALLYVLRNPEVRQKVYEELDREIGSDRIITTSDKPKLNY  351



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016347.1 uncharacterized protein LOC108070406 [Drosophila
kikkawai]

Length=257
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q7K275_DROME  unnamed protein product                                 30.0    2.0  
Q2XXT6_DROME  unnamed protein product                                 29.3    4.6  


>Q7K275_DROME unnamed protein product
Length=389

 Score = 30.0 bits (66),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 32/66 (48%), Gaps = 5/66 (8%)

Query  88   TTTTELPADDLSTSTTDSDLSTTTNWDSVDATTTTAPPPAFESRSGRAFE---KAPYPPA  144
            +TTT  P  +LS      D     N  S   TTTT P P F +R   +F+    AP PPA
Sbjct  184  STTTADPRPELSLMQRFGDFVKQYNLWSGQVTTTTTPAP-FIARPSGSFQPVFVAP-PPA  241

Query  145  GYRPSR  150
            G +P R
Sbjct  242  GLKPFR  247


>Q2XXT6_DROME unnamed protein product
Length=1873

 Score = 29.3 bits (64),  Expect = 4.6, Method: Compositional matrix adjust.
 Identities = 23/97 (24%), Positives = 42/97 (43%), Gaps = 10/97 (10%)

Query  155   PTEQNPEEQQQISNSLKNNSTDSNADHPVCGVSTDPLKPTPQPGSK----------DEPD  204
             P E  P E+ ++S+  +N+ +   AD  +   S+  L+    PG +          DEP 
Sbjct  1169  PAEPKPNEEHEVSDHTQNHVSKLMADAVIDVESSPNLRAMKSPGGREEGIEIFYFPDEPK  1228

Query  205   AESVVFTANLGPAVVVARAPSSIPVAIPLRSQPLLQA  241
              +    +A L    ++  +PS I   +   S  +LQ+
Sbjct  1229  EKRKSTSAKLQTKSLMVESPSVIGDILDFESNVILQS  1265



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016348.1 uncharacterized protein LOC108070407 [Drosophila
kikkawai]

Length=169
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38B68_TRYB2  unnamed protein product                                 32.0    0.26 
Q38DY2_TRYB2  unnamed protein product                                 26.6    7.0  
Q38CH8_TRYB2  unnamed protein product                                 27.3    8.1  


>Q38B68_TRYB2 unnamed protein product
Length=4142

 Score = 32.0 bits (71),  Expect = 0.26, Method: Composition-based stats.
 Identities = 31/111 (28%), Positives = 43/111 (39%), Gaps = 10/111 (9%)

Query  15   LLAVSEAQQQRQRYSQRLSRGRSRYSARQEVAPAPADGGDVDAVTPYPSAD----ELKPE  70
            L+A+  A   RQ  +  LS GRS   A Q  A +      VD V+P    +    E  PE
Sbjct  8    LIALRRAHLARQGQNAPLSPGRSELQASQVGASSETAVVRVDDVSPQLEIEGRPQETLPE  67

Query  71   VPFDEAAPSAA------DPTPDAVYGPPDAAPNAVPDEVYGPPDATGNDLP  115
               DE  P+          + +  Y   +  P A   +V  P +    DLP
Sbjct  68   WLVDEQQPTVGLSHLPWSQSVEGRYTTEEEVPRAEEPKVMVPHETIKGDLP  118


>Q38DY2_TRYB2 unnamed protein product
Length=125

 Score = 26.6 bits (57),  Expect = 7.0, Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 4/44 (9%)

Query  61   YPSADELKPEVPFDEAAPSAADPTPDAVYGPPDAAPNAVPDEVY  104
            +PSA E +P  PF  AAP   +P P     PP  +P  VP  VY
Sbjct  3    FPSAAEPQPTQPFFLAAPMMYNPLPPT---PPQTSP-VVPQCVY  42


>Q38CH8_TRYB2 unnamed protein product
Length=534

 Score = 27.3 bits (59),  Expect = 8.1, Method: Compositional matrix adjust.
 Identities = 19/58 (33%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query  52   GGDVDAVTPYPSADELKPEVPFDEAAPSAADPTPDAVYGPPDAAPNAVPDEVYGPPDA  109
            G  + A TP+P+A  L+P++     A    DP  D  + PP AA + +P  +  P  A
Sbjct  125  GAGLTAPTPFPAA-ALRPKL-----AEVPRDPAEDGTWYPPAAATHVLPTHLMRPVHA  176



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016350.1 ataxin-2 homolog [Drosophila kikkawai]

Length=278


***** No hits found *****



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016351.1 uncharacterized protein LOC108070409 [Drosophila
kikkawai]

Length=207


***** No hits found *****



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016352.1 predicted GPI-anchored protein 58 [Drosophila
kikkawai]

Length=170
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9W4M4_DROME  unnamed protein product                                 41.6    2e-04


>Q9W4M4_DROME unnamed protein product
Length=1357

 Score = 41.6 bits (96),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 26/80 (33%), Positives = 32/80 (40%), Gaps = 8/80 (10%)

Query  55    IAPTPASAPYP---PAGVTPEVPFDLPTETEAQPDLTYGPPAEPDNTYGPPAEPDNTYGP  111
             +APT +    P   P G   + P   PTET      TYGPP     T  PP     T  P
Sbjct  1222  VAPTQSPTESPTESPTGSPTDSPTQSPTETP-----TYGPPTNEPPTNQPPTNQPPTVQP  1276

Query  112   PADSVAVDQAPVEDNPAAEP  131
             P +    +Q P    P  +P
Sbjct  1277  PTNQPPTNQPPTNQPPTNQP  1296


 Score = 27.7 bits (60),  Expect = 5.4, Method: Composition-based stats.
 Identities = 23/90 (26%), Positives = 31/90 (34%), Gaps = 5/90 (6%)

Query  46    AAPAD-PAADIAPTPASAPYPPAGVTPEVPFDLPTETEA---QPDLTYGPPAEPDNTYGP  101
              +P D P      TP   P      T + P + P   +    QP  T  PP     T  P
Sbjct  1238  GSPTDSPTQSPTETPTYGPPTNEPPTNQPPTNQPPTVQPPTNQPP-TNQPPTNQPPTNQP  1296

Query  102   PAEPDNTYGPPADSVAVDQAPVEDNPAAEP  131
             P     T  PP +    ++ P    P+  P
Sbjct  1297  PTNQPPTNQPPTNQPPTNEPPTNRPPSPSP  1326



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016354.1 MICAL-like protein 1 [Drosophila kikkawai]

Length=986
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

A1ZAN2_DROME  unnamed protein product                                 112     5e-25
A4UZL2_DROME  unnamed protein product                                 112     6e-25
Q8MR93_DROME  unnamed protein product                                 112     6e-25


>A1ZAN2_DROME unnamed protein product
Length=965

 Score = 112 bits (280),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 2/107 (2%)

Query  9    LEHWCRLITSGYEGVKVENMTTSWRDGLAFCAIIHYFRPDLIKFDQLKAADIYENNSLAF  68
            L  WC+ +T  Y  VKV N+TTSWR+G+AFCAIIH+F P+LI   +L A D+  N  + F
Sbjct  442  LLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGF  501

Query  69   ATAEKYLGIPALLEADDMVSYEVPDRLSILTYLSQF-YRVLGKNFKL  114
              AE  LGIP ++E  DM    VPD+L+++TYL Q      GK  K+
Sbjct  502  DAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLKI  547


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 16/148 (11%)

Query  756  LQEIRHEFEIIAVQQLGLEKQGVILEKMIRDRCEVMENINDEGSAAPGGETQAANSKEVE  815
            L  I  E E +  +Q  ++++   LE  +R              A  GG  +   ++E  
Sbjct  807  LSYIDSELEALEREQEAIDQKASNLEAKLR--------------AVMGGNPKTEETEE--  850

Query  816  DLILQLFELVNEKNELFRRQAELMYLRRQHRLEQEQADIEHEIRVLMGQPERNKTDSDKA  875
             L+ Q F LVN+KN L RRQ +L  L ++  LE++   +  E+R      +  KT+  + 
Sbjct  851  QLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVEDWRKTEVQRE  910

Query  876  HEEVLIGRLVKIVEMRNAVIDSLETDRV  903
             E +L+  L+ IV+ R+ ++  L    +
Sbjct  911  KERLLLEELMTIVDKRDQLVQHLHNQEI  938


>A4UZL2_DROME unnamed protein product
Length=987

 Score = 112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 2/107 (2%)

Query  9    LEHWCRLITSGYEGVKVENMTTSWRDGLAFCAIIHYFRPDLIKFDQLKAADIYENNSLAF  68
            L  WC+ +T  Y  VKV N+TTSWR+G+AFCAIIH+F P+LI   +L A D+  N  + F
Sbjct  464  LLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGF  523

Query  69   ATAEKYLGIPALLEADDMVSYEVPDRLSILTYLSQF-YRVLGKNFKL  114
              AE  LGIP ++E  DM    VPD+L+++TYL Q      GK  K+
Sbjct  524  DAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLKI  569


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 16/148 (11%)

Query  756  LQEIRHEFEIIAVQQLGLEKQGVILEKMIRDRCEVMENINDEGSAAPGGETQAANSKEVE  815
            L  I  E E +  +Q  ++++   LE  +R              A  GG  +   ++E  
Sbjct  829  LSYIDSELEALEREQEAIDQKASNLEAKLR--------------AVMGGNPKTEETEE--  872

Query  816  DLILQLFELVNEKNELFRRQAELMYLRRQHRLEQEQADIEHEIRVLMGQPERNKTDSDKA  875
             L+ Q F LVN+KN L RRQ +L  L ++  LE++   +  E+R      +  KT+  + 
Sbjct  873  QLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVEDWRKTEVQRE  932

Query  876  HEEVLIGRLVKIVEMRNAVIDSLETDRV  903
             E +L+  L+ IV+ R+ ++  L    +
Sbjct  933  KERLLLEELMTIVDKRDQLVQHLHNQEI  960


>Q8MR93_DROME unnamed protein product
Length=987

 Score = 112 bits (280),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 2/107 (2%)

Query  9    LEHWCRLITSGYEGVKVENMTTSWRDGLAFCAIIHYFRPDLIKFDQLKAADIYENNSLAF  68
            L  WC+ +T  Y  VKV N+TTSWR+G+AFCAIIH+F P+LI   +L A D+  N  + F
Sbjct  464  LLEWCKEVTKDYPNVKVTNLTTSWRNGMAFCAIIHHFVPELIDMSKLSAHDVVGNCRIGF  523

Query  69   ATAEKYLGIPALLEADDMVSYEVPDRLSILTYLSQF-YRVLGKNFKL  114
              AE  LGIP ++E  DM    VPD+L+++TYL Q      GK  K+
Sbjct  524  DAAES-LGIPRVIEPRDMNMLTVPDKLAVMTYLHQLRAHFTGKQLKI  569


 Score = 43.9 bits (102),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (47%), Gaps = 16/148 (11%)

Query  756  LQEIRHEFEIIAVQQLGLEKQGVILEKMIRDRCEVMENINDEGSAAPGGETQAANSKEVE  815
            L  I  E E +  +Q  ++++   LE  +R              A  GG  +   ++E  
Sbjct  829  LSYIDSELEALEREQEAIDQKASNLEAKLR--------------AVMGGNPKTEETEE--  872

Query  816  DLILQLFELVNEKNELFRRQAELMYLRRQHRLEQEQADIEHEIRVLMGQPERNKTDSDKA  875
             L+ Q F LVN+KN L RRQ +L  L ++  LE++   +  E+R      +  KT+  + 
Sbjct  873  QLLSQWFTLVNKKNALLRRQMQLNILEQEKDLERKYTMLNQELRAAQSVEDWRKTEVQRE  932

Query  876  HEEVLIGRLVKIVEMRNAVIDSLETDRV  903
             E +L+  L+ IV+ R+ ++  L    +
Sbjct  933  KERLLLEELMTIVDKRDQLVQHLHNQEI  960



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016355.1 zinc finger MYND domain-containing protein 10 homolog
[Drosophila kikkawai]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ZMY10_DROME  unnamed protein product                                  777     0.0  
Q384J6_TRYB2  unnamed protein product                                 150     1e-40
Q7K561_DROME  unnamed protein product                                 45.1    9e-05


>ZMY10_DROME unnamed protein product
Length=451

 Score = 777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/452 (84%), Positives = 422/452 (93%), Gaps = 2/452 (0%)

Query  1    MVNFVYPEELYLFVESIRPFQVRDVGTSKWLEVHEMVIKLSQQAALELAQNREEEVKEFL  60
            MVNFV+PEE+YLFVESIRPF+VR+VG+ KWLEVHEM++ LSQQAALEL+QNREEEVKEFL
Sbjct  1    MVNFVHPEEMYLFVESIRPFEVREVGSPKWLEVHEMILGLSQQAALELSQNREEEVKEFL  60

Query  61   ISRDKLRLLIHEAYCVTLWKTRVLPHLLEIDPNPQATFLIYTVLYHEASVVALLDMCLYH  120
            ISRDKLR+LIHEAYCVTLWKTRVLPHLLEIDPNPQATFLIYTVLYHEA++VALLD+CLYH
Sbjct  61   ISRDKLRVLIHEAYCVTLWKTRVLPHLLEIDPNPQATFLIYTVLYHEAALVALLDVCLYH  120

Query  121  PSGCETLQESVMDLVDYCAQAVAQVIGLVSMGYHENESKMDVDEAVLTELERQKRDLIYK  180
            PSGCETLQESV+DL+DYCAQA++QVIGLVSMGYHENE+K+DVDEAVLTELERQKRD IYK
Sbjct  121  PSGCETLQESVLDLIDYCAQAISQVIGLVSMGYHENETKLDVDEAVLTELERQKRDFIYK  180

Query  181  IGLRCISILNYLADNLALFHLSAARRMLVTHDIPWLMVDVLCFRPWQRKTSKGLQKFIDE  240
            IGLRCIS+LNY+ADN+ LFHLSAARR+LVTHDIPWLM DVL FRPWQRKTSKG+QKFIDE
Sbjct  181  IGLRCISVLNYIADNVTLFHLSAARRLLVTHDIPWLMADVLSFRPWQRKTSKGIQKFIDE  240

Query  241  KWTNVEDSAKIVKPEAQAWFCVRQLLLNAQAMENYALNEARCQQLSKLLGLMHETLLDQL  300
            KWTNV+D  KIVKPEAQAWFCVRQLLLN Q MENYA NEARC+QL KLLGLMHE LLDQL
Sbjct  241  KWTNVDDVTKIVKPEAQAWFCVRQLLLNPQIMENYAFNEARCKQLHKLLGLMHEPLLDQL  300

Query  301  PPLIDLKQFLSRLTLSGNTASKQQTLLLEDVPQIQEELMKEVHKDGGFYQIAQAQDSVFL  360
            PPLI+LK FLSRLTLSGNTA K Q LLLED+PQIQEEL+K+V ++GGFYQIAQ QDSVFL
Sbjct  301  PPLIELKVFLSRLTLSGNTA-KTQPLLLEDIPQIQEELLKDVEENGGFYQIAQDQDSVFL  359

Query  361  SKNRADICALASRLSGAYGTDLLCELEQNLEDLKLGEPQDTQAGGDAEPDHNSCAMCQAK  420
            SKN+ +ICALA+RLS AYGTDLLCELEQN++DLK+GE +D  AGGD + DH +CA CQAK
Sbjct  360  SKNKENICALATRLSKAYGTDLLCELEQNMDDLKMGEAKDAGAGGDGDTDH-TCATCQAK  418

Query  421  AKKKCANCKQVYYCSRDCQLKDWPQHKELCLK  452
            AKKKCA CK+V+YCSRDCQLKDWPQHK +CLK
Sbjct  419  AKKKCACCKKVHYCSRDCQLKDWPQHKLVCLK  450


>Q384J6_TRYB2 unnamed protein product
Length=397

 Score = 150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/354 (29%), Positives = 184/354 (52%), Gaps = 21/354 (6%)

Query  14   VESIRPFQVRDVGTSKWLEVHEMVIKLSQQAALELAQNREEEVKEFLISRDKLRLLIHEA  73
            V  +RPF ++D+GT++W    E V +L+          +++ VK FLI  +KL +L+HE 
Sbjct  17   VRQLRPFPLQDIGTAEWKNQREAVERLNMCTHSNAVLKKDDTVKAFLIEHEKLPVLLHEL  76

Query  74   YCVTLWKTRVLPHLLEIDPNPQATFLIYTVLYHEASVVALLDMCLYHPSGCETLQESVMD  133
              + +W+ RVLP  L  D   Q    IY  + +E  ++ L +   +H      L E V++
Sbjct  77   LVMEVWRQRVLP--LIKDQIVQHPAGIYMYVQYEMVLLNLFECIAFHEEVVVALDEDVLE  134

Query  134  LVDYCAQAVAQVIGLVSMGYHENESK---MDVDEA------VLTELERQKRDLIYKIGLR  184
            L+DYC +  +++        +E +SK    DV  A      VL   +RQ    IY+  + 
Sbjct  135  LIDYCWRQASRLFA--EQNVNEVQSKPTARDVSNAANTVEEVLKSADRQMLHAIYQRAMA  192

Query  185  CISILNYLADNLALFHLSAARRMLVTHDIPWLMVDVLCFRPWQRKTSKGLQKFIDEKWTN  244
             +SIL ++ D L    L+A+  +LV +D+   + +V+  +PW R++S+  QKF + ++ +
Sbjct  193  SLSILWFIIDRLNQLPLAASNSVLVKNDLILGLTEVMLLQPWLRRSSEATQKFFNGEFKD  252

Query  245  VE--DSAKIVKPEAQAWFCVRQLLLNAQAMENYALNEARCQQLSKLLGLMHETLLDQLPP  302
            +   D   +  PEA  WF + +LL + +    Y+  +++ + + ++   +++TL+DQ+P 
Sbjct  253  IPRADVLLVCTPEAHTWFSLHKLLCDPECRRRYSYTQSKKELILRIRHFLNDTLVDQIPA  312

Query  303  LIDLKQFLSRLTL----SGNTASKQQTLLLEDVPQIQEELMKEVHKDGGFYQIA  352
            L  L++ L  L+     SG     + TL +E VP+I    + EV + G +  +A
Sbjct  313  LASLQRALEELSFLQPPSGTEEKFKSTLTIEQVPRIMT--LVEVERKGSWDDLA  364


>Q7K561_DROME unnamed protein product
Length=513

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 23/39 (59%), Gaps = 0/39 (0%)

Query  412  NSCAMCQAKAKKKCANCKQVYYCSRDCQLKDWPQHKELC  450
            N C +C+   K KC+NC QV YCS   Q +DW  HK  C
Sbjct  2    NPCHVCEEPTKNKCSNCNQVSYCSVQHQKQDWKVHKPSC  40


 Score = 28.9 bits (63),  Expect = 9.5, Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (54%), Gaps = 1/65 (2%)

Query  1    MVNFVYPEELYLFVESIRPFQVRDVGTSKWLEVHEMVIKLSQQAALELAQNREEEVKEFL  60
            ++   +  EL    E + P +VR +GT    E+H  + + +++ ALE + + ++ ++E L
Sbjct  417  LLKLNFARELVELYEKLTPCEVRTLGTL-CFELHSAIAEQTRRVALETSLSPKDRLEESL  475

Query  61   ISRDK  65
               DK
Sbjct  476  FYVDK  480



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016356.1 adenosine kinase isoform X1 [Drosophila kikkawai]

Length=346
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU38_DROME  unnamed protein product                                 635     0.0  
Q86NZ5_DROME  unnamed protein product                                 635     0.0  
Q9VU39_DROME  unnamed protein product                                 627     0.0  


>Q9VU38_DROME unnamed protein product
Length=345

 Score = 635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/346 (91%), Positives = 334/346 (97%), Gaps = 1/346 (0%)

Query  1    MCDRNVREGILVGCGNPLLDISAIVPLEFLKKYAMKEDDAILAEERHMPIYQELVDGFQA  60
            MCDR VREGILVGCGNPLLDISA+VPL FL+KY+M EDDAILAE+RHMPIY ELV+G+QA
Sbjct  1    MCDR-VREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQA  59

Query  61   EFLAGGSVQNSLRIAQWILGQPKVAVFFGCVGQDKYADILAEKARSAGLDVHYQVKKDVP  120
            EFLAGGSVQNSLRIAQWIL QP+VAVFFGCVG+D+YA+IL EKA++AGLDVHYQVKKDVP
Sbjct  60   EFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVP  119

Query  121  TGTCAVLITGTHRSLCANLAAANNFTIDHLEEPGNKALVDNALYYYISGFFLTVNPPSIM  180
            TGTCAVLITGTHRSLCANLAAANNFTIDHLEEP NKALVDNA YYYISGFFLTVNPPSIM
Sbjct  120  TGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIM  179

Query  181  KVAATAHANQRPFLMNLSAPFISQFYMAPLLAVLPYVDIIFGNEAEAQAFAEAQKWPSED  240
            +VAATAHA QRPFLMNLSAPFISQFYMAPLLA LPYVDIIFGNEAEAQAFAEAQ+WPS D
Sbjct  180  QVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGD  239

Query  241  LREIGKRLVAMDKLNPSRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGD  300
            LREIGKRLVAM+K NP+RPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGD
Sbjct  240  LREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGD  299

Query  301  AFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYNGKPEFVE  346
            AFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY+G+PEFVE
Sbjct  300  AFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE  345


>Q86NZ5_DROME unnamed protein product
Length=348

 Score = 635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/346 (91%), Positives = 334/346 (97%), Gaps = 1/346 (0%)

Query  1    MCDRNVREGILVGCGNPLLDISAIVPLEFLKKYAMKEDDAILAEERHMPIYQELVDGFQA  60
            MCDR VREGILVGCGNPLLDISA+VPL FL+KY+M EDDAILAE+RHMPIY ELV+G+QA
Sbjct  4    MCDR-VREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQA  62

Query  61   EFLAGGSVQNSLRIAQWILGQPKVAVFFGCVGQDKYADILAEKARSAGLDVHYQVKKDVP  120
            EFLAGGSVQNSLRIAQWIL QP+VAVFFGCVG+D+YA+IL EKA++AGLDVHYQVKKDVP
Sbjct  63   EFLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVP  122

Query  121  TGTCAVLITGTHRSLCANLAAANNFTIDHLEEPGNKALVDNALYYYISGFFLTVNPPSIM  180
            TGTCAVLITGTHRSLCANLAAANNFTIDHLEEP NKALVDNA YYYISGFFLTVNPPSIM
Sbjct  123  TGTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIM  182

Query  181  KVAATAHANQRPFLMNLSAPFISQFYMAPLLAVLPYVDIIFGNEAEAQAFAEAQKWPSED  240
            +VAATAHA QRPFLMNLSAPFISQFYMAPLLA LPYVDIIFGNEAEAQAFAEAQ+WPS D
Sbjct  183  QVAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGD  242

Query  241  LREIGKRLVAMDKLNPSRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGD  300
            LREIGKRLVAM+K NP+RPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGD
Sbjct  243  LREIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGD  302

Query  301  AFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYNGKPEFVE  346
            AFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY+G+PEFVE
Sbjct  303  AFVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE  348


>Q9VU39_DROME unnamed protein product
Length=345

 Score = 627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/342 (91%), Positives = 330/342 (96%), Gaps = 0/342 (0%)

Query  5    NVREGILVGCGNPLLDISAIVPLEFLKKYAMKEDDAILAEERHMPIYQELVDGFQAEFLA  64
             ++EGILVGCGNPLLDISA+VPL FL+KY+M EDDAILAE+RHMPIY ELV+G+QAEFLA
Sbjct  4    TLQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAEFLA  63

Query  65   GGSVQNSLRIAQWILGQPKVAVFFGCVGQDKYADILAEKARSAGLDVHYQVKKDVPTGTC  124
            GGSVQNSLRIAQWIL QP+VAVFFGCVG+D+YA+IL EKA++AGLDVHYQVKKDVPTGTC
Sbjct  64   GGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPTGTC  123

Query  125  AVLITGTHRSLCANLAAANNFTIDHLEEPGNKALVDNALYYYISGFFLTVNPPSIMKVAA  184
            AVLITGTHRSLCANLAAANNFTIDHLEEP NKALVDNA YYYISGFFLTVNPPSIM+VAA
Sbjct  124  AVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQVAA  183

Query  185  TAHANQRPFLMNLSAPFISQFYMAPLLAVLPYVDIIFGNEAEAQAFAEAQKWPSEDLREI  244
            TAHA QRPFLMNLSAPFISQFYMAPLLA LPYVDIIFGNEAEAQAFAEAQ+WPS DLREI
Sbjct  184  TAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDLREI  243

Query  245  GKRLVAMDKLNPSRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVG  304
            GKRLVAM+K NP+RPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVG
Sbjct  244  GKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDAFVG  303

Query  305  GFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYNGKPEFVE  346
            GFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY+G+PEFVE
Sbjct  304  GFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE  345



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016357.1 uncharacterized protein LOC108070412 [Drosophila
kikkawai]

Length=200
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VJC6_DROME  unnamed protein product                                 30.0    1.4  
CARML_DICDI  unnamed protein product                                  29.6    1.8  
Q24140_DROME  unnamed protein product                                 29.3    2.6  


>Q9VJC6_DROME unnamed protein product
Length=4024

 Score = 30.0 bits (66),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 12/77 (16%)

Query  105   IFRKDTPLKKFD---------STSVQT--EQPRFHIRSRVDRHRLPPLAPCELTRQTIFI  153
             ++  D  LKK D         S S QT   Q +  I S++D+ R     P   +R  IF+
Sbjct  1975  VYVIDYMLKKMDLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFV  2034

Query  154   DAVSVPFP-NVISRPPL  169
             D VS+P   N  ++PP+
Sbjct  2035  DDVSMPLKENYGAQPPI  2051


>CARML_DICDI unnamed protein product
Length=1050

 Score = 29.6 bits (65),  Expect = 1.8, Method: Composition-based stats.
 Identities = 24/95 (25%), Positives = 48/95 (51%), Gaps = 8/95 (8%)

Query  20   LVQDAVNEPLKL---SRQKDTCQRLFDILGFQADDS----FENM-NGSEVLDTPSACTLQ  71
            L++++++  L++    + KD  Q + D++  + ++      E+M N  + +D P+   L 
Sbjct  724  LIKESIHASLEMELNQKLKDFVQVVNDVINAKKNEMTQQILESMQNTFQSMDGPTIKRLA  783

Query  72   SSPKQGSVDVNRRTWHSWLNKALEEECSEDEDEIF  106
            ++ + GS DV+ +  HS L K    E S    E F
Sbjct  784  TTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF  818


>Q24140_DROME unnamed protein product
Length=664

 Score = 29.3 bits (64),  Expect = 2.6, Method: Composition-based stats.
 Identities = 21/64 (33%), Positives = 31/64 (48%), Gaps = 7/64 (11%)

Query  88   SWLNKALEEECSEDEDEIFRKDTPLKKFDS-----TSVQTEQPRFHIRSRVDRHRL-PPL  141
            S+LNK LE  C +DE+E+      L   DS      S+ +  P   + +R  R  +  PL
Sbjct  591  SYLNKHLESACLKDEEELMMS-MSLSMHDSNSESGASMASSPPHEFLEARQTRRAVEEPL  649

Query  142  APCE  145
             PC+
Sbjct  650  MPCK  653



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016358.1 adenosine kinase isoform X2 [Drosophila kikkawai]

Length=345
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU39_DROME  unnamed protein product                                 638     0.0  
Q86NZ5_DROME  unnamed protein product                                 629     0.0  
Q9VU38_DROME  unnamed protein product                                 628     0.0  


>Q9VU39_DROME unnamed protein product
Length=345

 Score = 638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/345 (91%), Positives = 334/345 (97%), Gaps = 0/345 (0%)

Query  1    MTTTLQEGILVGCGNPLLDISAIVPLEFLKKYAMKEDDAILAEERHMPIYQELVDGFQAE  60
            MT+TLQEGILVGCGNPLLDISA+VPL FL+KY+M EDDAILAE+RHMPIY ELV+G+QAE
Sbjct  1    MTSTLQEGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAE  60

Query  61   FLAGGSVQNSLRIAQWILGQPKVAVFFGCVGQDKYADILAEKARSAGLDVHYQVKKDVPT  120
            FLAGGSVQNSLRIAQWIL QP+VAVFFGCVG+D+YA+IL EKA++AGLDVHYQVKKDVPT
Sbjct  61   FLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPT  120

Query  121  GTCAVLITGTHRSLCANLAAANNFTIDHLEEPGNKALVDNALYYYISGFFLTVNPPSIMK  180
            GTCAVLITGTHRSLCANLAAANNFTIDHLEEP NKALVDNA YYYISGFFLTVNPPSIM+
Sbjct  121  GTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQ  180

Query  181  VAATAHANQRPFLMNLSAPFISQFYMAPLLAVLPYVDIIFGNEAEAQAFAEAQKWPSEDL  240
            VAATAHA QRPFLMNLSAPFISQFYMAPLLA LPYVDIIFGNEAEAQAFAEAQ+WPS DL
Sbjct  181  VAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDL  240

Query  241  REIGKRLVAMDKLNPSRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA  300
            REIGKRLVAM+K NP+RPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA
Sbjct  241  REIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA  300

Query  301  FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYNGKPEFVE  345
            FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY+G+PEFVE
Sbjct  301  FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE  345


>Q86NZ5_DROME unnamed protein product
Length=348

 Score = 629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/345 (90%), Positives = 331/345 (96%), Gaps = 0/345 (0%)

Query  1    MTTTLQEGILVGCGNPLLDISAIVPLEFLKKYAMKEDDAILAEERHMPIYQELVDGFQAE  60
            M   ++EGILVGCGNPLLDISA+VPL FL+KY+M EDDAILAE+RHMPIY ELV+G+QAE
Sbjct  4    MCDRVREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAE  63

Query  61   FLAGGSVQNSLRIAQWILGQPKVAVFFGCVGQDKYADILAEKARSAGLDVHYQVKKDVPT  120
            FLAGGSVQNSLRIAQWIL QP+VAVFFGCVG+D+YA+IL EKA++AGLDVHYQVKKDVPT
Sbjct  64   FLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPT  123

Query  121  GTCAVLITGTHRSLCANLAAANNFTIDHLEEPGNKALVDNALYYYISGFFLTVNPPSIMK  180
            GTCAVLITGTHRSLCANLAAANNFTIDHLEEP NKALVDNA YYYISGFFLTVNPPSIM+
Sbjct  124  GTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQ  183

Query  181  VAATAHANQRPFLMNLSAPFISQFYMAPLLAVLPYVDIIFGNEAEAQAFAEAQKWPSEDL  240
            VAATAHA QRPFLMNLSAPFISQFYMAPLLA LPYVDIIFGNEAEAQAFAEAQ+WPS DL
Sbjct  184  VAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDL  243

Query  241  REIGKRLVAMDKLNPSRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA  300
            REIGKRLVAM+K NP+RPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA
Sbjct  244  REIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA  303

Query  301  FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYNGKPEFVE  345
            FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY+G+PEFVE
Sbjct  304  FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE  348


>Q9VU38_DROME unnamed protein product
Length=345

 Score = 628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/345 (90%), Positives = 331/345 (96%), Gaps = 0/345 (0%)

Query  1    MTTTLQEGILVGCGNPLLDISAIVPLEFLKKYAMKEDDAILAEERHMPIYQELVDGFQAE  60
            M   ++EGILVGCGNPLLDISA+VPL FL+KY+M EDDAILAE+RHMPIY ELV+G+QAE
Sbjct  1    MCDRVREGILVGCGNPLLDISAVVPLNFLQKYSMNEDDAILAEDRHMPIYGELVEGYQAE  60

Query  61   FLAGGSVQNSLRIAQWILGQPKVAVFFGCVGQDKYADILAEKARSAGLDVHYQVKKDVPT  120
            FLAGGSVQNSLRIAQWIL QP+VAVFFGCVG+D+YA+IL EKA++AGLDVHYQVKKDVPT
Sbjct  61   FLAGGSVQNSLRIAQWILRQPRVAVFFGCVGEDRYANILKEKAQAAGLDVHYQVKKDVPT  120

Query  121  GTCAVLITGTHRSLCANLAAANNFTIDHLEEPGNKALVDNALYYYISGFFLTVNPPSIMK  180
            GTCAVLITGTHRSLCANLAAANNFTIDHLEEP NKALVDNA YYYISGFFLTVNPPSIM+
Sbjct  121  GTCAVLITGTHRSLCANLAAANNFTIDHLEEPSNKALVDNAQYYYISGFFLTVNPPSIMQ  180

Query  181  VAATAHANQRPFLMNLSAPFISQFYMAPLLAVLPYVDIIFGNEAEAQAFAEAQKWPSEDL  240
            VAATAHA QRPFLMNLSAPFISQFYMAPLLA LPYVDIIFGNEAEAQAFAEAQ+WPS DL
Sbjct  181  VAATAHAKQRPFLMNLSAPFISQFYMAPLLAALPYVDIIFGNEAEAQAFAEAQQWPSGDL  240

Query  241  REIGKRLVAMDKLNPSRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA  300
            REIGKRLVAM+K NP+RPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA
Sbjct  241  REIGKRLVAMEKKNPTRPRIAILTQGCDPVLLIQQDSVQEFPVTKLAVHEIVDTNGAGDA  300

Query  301  FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYNGKPEFVE  345
            FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTY+G+PEFVE
Sbjct  301  FVGGFLSQFVQGKSLDVCIRCGNYAAGHIIKNPGCTYSGEPEFVE  345



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016359.1 cyclin-H [Drosophila kikkawai]

Length=325
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O76513_DROME  unnamed protein product                                 617     0.0  
O17144_DROME  unnamed protein product                                 614     0.0  
CCNC_DICDI  unnamed protein product                                   71.6    3e-14


>O76513_DROME unnamed protein product
Length=324

 Score = 617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/325 (90%), Positives = 313/325 (96%), Gaps = 1/325 (0%)

Query  1    MYPVSSQKKSWTFANEGQLMAFRVEQNNKYIEQHEAEAEAYDDLEDYFLTPAEERLLLKQ  60
            MYPVSSQK+SWTFANEGQLM FRVEQN+KYIE HE EA+   DL ++FLT AEERLLLKQ
Sbjct  1    MYPVSSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQG-RDLNEHFLTSAEERLLLKQ  59

Query  61   YEVHLFEFCRRFDPPMPKCVIGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFN  120
            YE++LF+FCRRF+P MPKCV+GTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFN
Sbjct  60   YEIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFN  119

Query  121  VSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPVEGFLIDIKTRSNMAN  180
            VSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRP+EGFLIDIKTRSNM N
Sbjct  120  VSINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQN  179

Query  181  PERLRPHIDSFIDSTFYTDACLLHTPSQIALAAVLHAASKEQENLDSYVTEFLFVSARDK  240
            P+RLRPHIDSFIDST+Y+DACLLHTPSQIALAAVLHAAS+EQENLDSYVT+ LFVSAR+K
Sbjct  180  PDRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREK  239

Query  241  LPGLIDAVRKIRILVKQHQQPERDKVKPIEKKLDKCRNQANNPDSELYKERLRRLYTDED  300
            LPGLIDAVRKIRI+VKQ+QQP+R+KVK IEKKLDKCRNQANNPDSELYKERLRRLYTDED
Sbjct  240  LPGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDED  299

Query  301  DMPAEDASFHIADVSSDTSAMNISQ  325
            DMPAEDASFHIADVSSDTSAMNISQ
Sbjct  300  DMPAEDASFHIADVSSDTSAMNISQ  324


>O17144_DROME unnamed protein product
Length=325

 Score = 614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/324 (90%), Positives = 312/324 (96%), Gaps = 1/324 (0%)

Query  2    YPVSSQKKSWTFANEGQLMAFRVEQNNKYIEQHEAEAEAYDDLEDYFLTPAEERLLLKQY  61
            YPVSSQK+SWTFANEGQLM FRVEQN+KYIE HE EA+   DL ++FLT AEERLLLKQY
Sbjct  3    YPVSSQKRSWTFANEGQLMEFRVEQNSKYIESHEEEAQG-RDLNEHFLTSAEERLLLKQY  61

Query  62   EVHLFEFCRRFDPPMPKCVIGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV  121
            E++LF+FCRRF+P MPKCV+GTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV
Sbjct  62   EIYLFDFCRRFEPTMPKCVVGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNV  121

Query  122  SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPVEGFLIDIKTRSNMANP  181
            SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRP+EGFLIDIKTRSNM NP
Sbjct  122  SINQFVNNIKGDRNKATDIVLSNELLLIGQLNYYLTIHNPFRPIEGFLIDIKTRSNMQNP  181

Query  182  ERLRPHIDSFIDSTFYTDACLLHTPSQIALAAVLHAASKEQENLDSYVTEFLFVSARDKL  241
            +RLRPHIDSFIDST+Y+DACLLHTPSQIALAAVLHAAS+EQENLDSYVT+ LFVSAR+KL
Sbjct  182  DRLRPHIDSFIDSTYYSDACLLHTPSQIALAAVLHAASREQENLDSYVTDLLFVSAREKL  241

Query  242  PGLIDAVRKIRILVKQHQQPERDKVKPIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD  301
            PGLIDAVRKIRI+VKQ+QQP+R+KVK IEKKLDKCRNQANNPDSELYKERLRRLYTDEDD
Sbjct  242  PGLIDAVRKIRIMVKQYQQPDREKVKAIEKKLDKCRNQANNPDSELYKERLRRLYTDEDD  301

Query  302  MPAEDASFHIADVSSDTSAMNISQ  325
            MPAEDASFHIADVSSDTSAMNISQ
Sbjct  302  MPAEDASFHIADVSSDTSAMNISQ  325


>CCNC_DICDI unnamed protein product
Length=255

 Score = 71.6 bits (174),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 82/155 (53%), Gaps = 9/155 (6%)

Query  81   IGTAFHYFKRFYLNNSPMDYHPKEILATCVFVACKVEEFNVSINQFVNNIK---GDRNKA  137
            I TA  YFKRFYL NS +D  P+ +  TC++++ KVEE      +    +K      N  
Sbjct  62   ISTAIVYFKRFYLKNSFVDCEPRLVAVTCLYLSSKVEECITQAKKCAAKMKEIDHSFNYL  121

Query  138  TDIVLSNELLLIGQLNYYLTIHNPFRPVEGFLIDIKTRSNMANPERLRPHIDSFIDSTFY  197
             + +L  E  ++ +L++ L I++P++ +  +L     +S+  +P  +   I   ++ ++ 
Sbjct  122  MNDILECEFFVLEELDFCLIIYHPYKSLPFYL-----QSSGLDPASIEI-IWGIVNDSYR  175

Query  198  TDACLLHTPSQIALAAVLHAASKEQENLDSYVTEF  232
            TD CLL+ P  + L  +L  +   ++++  +++E 
Sbjct  176  TDVCLLYPPFVVGLGCILLGSYLLKKDIKQWLSEL  210



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016360.1 protein-S-isoprenylcysteine O-methyltransferase
[Drosophila kikkawai]

Length=304
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ICMT_DICDI  unnamed protein product                                   173     5e-53
Q38DE5_TRYB2  unnamed protein product                                 119     5e-32
Q384A6_TRYB2  unnamed protein product                                 31.2    1.2  


>ICMT_DICDI unnamed protein product
Length=237

 Score = 173 bits (439),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 115/185 (62%), Gaps = 1/185 (1%)

Query  114  FGVYGCFMSVFHYSEFLVIAFANPRTLTLDSFMLNHSVHYGLAAAASWLEFALEVYFLPE  173
            FG+Y   +  FH  E++ +   +P  L+  SF+LNHS  + +A   S++EF +E YF P 
Sbjct  53   FGIYLAGLCTFHMWEYIWVTMYHPDKLSSKSFLLNHSPQFNMALLISFIEFWIEWYFFPS  112

Query  174  FKRFGYIWLAGVVLCSFGEVVRKAAIITAGRSFTHLVQNERHSDHKLITNGIYAYCRHPS  233
             K F  +W  G +   FG++VR  A+ TAG +FTHLVQ E+  DH L+TNGIY Y RHPS
Sbjct  113  LKTFS-LWWVGAICMVFGQIVRSVAMDTAGSNFTHLVQEEKRDDHVLVTNGIYQYMRHPS  171

Query  234  YVGWFWWSIGTQIVLLNPICICIYTLVSWLFFHDRIYVEEYSLLNFFQSDYVRYQKRVPT  293
            Y GWF WS+ TQ++L+NPI I  +   SW FF  RI  EE  L+ FF   Y  Y+K V +
Sbjct  172  YFGWFVWSVSTQVILMNPISIIGFGWASWSFFSQRIENEEDYLIQFFGKSYKDYKKSVWS  231

Query  294  GLPFI  298
            G+P I
Sbjct  232  GIPGI  236


>Q38DE5_TRYB2 unnamed protein product
Length=245

 Score = 119 bits (298),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/240 (34%), Positives = 128/240 (53%), Gaps = 21/240 (9%)

Query  81   NHDYQVAIRASFLG--FAMAVSVLV-ICFAPTEWQQFGVYGCFMS---VFHYSEFLVIAF  134
             H  +VA+ + +LG  F + VS+++   +      ++ V    +S   +FH SEFLV  +
Sbjct  6    RHALEVALISFYLGVCFTLGVSLMIHSVYYTGSVAEYAVGAYVISSIVLFHMSEFLVAVY  65

Query  135  ANPRTLTLDSFMLNHSVHYGLAAAASWLEFALEVYFLPE------FKRFGYIWL------  182
                     +FM+ HS  Y +A AA+WLEF  E++F  E        R+G+++       
Sbjct  66   FLRHDAHPGAFMIFHSREYTVAGAAAWLEFFTELFFCSEGWKVSATSRWGWLFRLNYTMV  125

Query  183  -AGVVLCSFGEVVRKAAIITAGRSFTHLVQNERHSDHKLITNGIYAYCRHPSYVGWFWWS  241
                VL  F  +VR   +   G +F+ L++  R S+H L+T+GIY+  RHP+Y G+FW +
Sbjct  126  NCAAVLTIFFYLVRVCGMAHCGCNFSLLIETRRRSNHVLVTDGIYSILRHPAYFGYFWTA  185

Query  242  IGTQIVLLNPICICIYTLVSWLFFHDRIYVEEYSL--LNFFQSDYVRYQKRVPTGLPFIR  299
            + +Q+VL NP C   Y +V   FF +RI  EE  L  + FF   Y++Y+     G+PFIR
Sbjct  186  LFSQLVLANPFCFMAYAIVLIRFFKERITYEETVLSSVEFFGESYMKYKAGTWVGIPFIR  245


>Q384A6_TRYB2 unnamed protein product
Length=977

 Score = 31.2 bits (69),  Expect = 1.2, Method: Composition-based stats.
 Identities = 18/69 (26%), Positives = 33/69 (48%), Gaps = 8/69 (12%)

Query  187  LCS-FGEVVRKAAIITAGRSFTHLVQNERHSDHKLITNGIYAYCRHPSYVGWFWWSIGTQ  245
            +CS FG ++    +   GR+ T  +  +RH   K +  G++ + +H     W+W+     
Sbjct  741  MCSKFGCIIATGLLDAGGRNCTFALHRQRHRLDKAVV-GMFVFLQH-----WYWFPYLLM  794

Query  246  IVL-LNPIC  253
            I L + P C
Sbjct  795  ITLAMRPTC  803



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016361.1 matrix-remodeling-associated protein 7 [Drosophila
kikkawai]

Length=170


***** No hits found *****



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016362.1 39S ribosomal protein L20, mitochondrial [Drosophila
kikkawai]

Length=150
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q383R2_TRYB2  unnamed protein product                                 32.0    0.11 
MTEF3_DROME  unnamed protein product                                  30.8    0.41 


>Q383R2_TRYB2 unnamed protein product
Length=213

 Score = 32.0 bits (71),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 14/52 (27%), Positives = 30/52 (58%), Gaps = 0/52 (0%)

Query  72   VEAGCQQYGMGLETFKDGLARSDILLNKKMLSDLAIWEPRSFEALVNISRER  123
            V++  +++G G +  ++ L R +++L  +    LA +EP +F A+V +   R
Sbjct  66   VDSAAREHGTGWQHLRNELGRQNVMLLPRSQQLLAQYEPLAFRAVVELCASR  117


>MTEF3_DROME unnamed protein product
Length=354

 Score = 30.8 bits (68),  Expect = 0.41, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query  19   WRKRRIFKLAAHYRSRTRNVY--SFAIRSVHRALAYATKGRKLKKLDMAQLWTTRVEAGC  76
            + K + F   A  R  T+N Y   F+ R V R L Y  K  KL   D+ +L  TR E   
Sbjct  166  YLKSKRFSDEARQRILTQNPYWLMFSTRRVDRRLGYFQKEFKLSGHDL-RLLATR-EPNA  223

Query  77   QQYGMGLETFKDGL--ARSDILLNKKMLSDLAIWEPR  111
              Y M  E  +  +   + ++  N K LSDL + +PR
Sbjct  224  ITYNM--EHLRKSVFTLKEEMGFNAKELSDLVVRKPR  258



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016363.1 40S ribosomal protein S12 [Drosophila kikkawai]

Length=139
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RS12_DICDI  unnamed protein product                                   121     2e-36
RS12_TRYBB  unnamed protein product                                   98.6    4e-27
Q38AC1_TRYB2  unnamed protein product                                 91.3    3e-24


>RS12_DICDI unnamed protein product
Length=136

 Score = 121 bits (304),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 87/133 (65%), Gaps = 1/133 (1%)

Query  5    DVDVPSAAPVIDGAMDINTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLAILAESFD  64
            D  V +A P ++   D   ALQ+V+K+SL   G+  G+H+  KALDKR A L +LA + D
Sbjct  4    DAPVIAANP-LEKNTDPMVALQKVIKESLAVQGVARGLHETVKALDKRTARLCVLASNCD  62

Query  65   EPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEE  124
            EPN+ +LV AL  EH IPLI V  +K LGEW+GLCK+DK+   RKV  CS +VIK FG+E
Sbjct  63   EPNFVRLVKALATEHNIPLIEVPDNKALGEWAGLCKLDKDLAARKVVACSTLVIKTFGKE  122

Query  125  TQALDVVKDHLRQ  137
            +     + +++ +
Sbjct  123  SDDYKFLMEYISK  135


>RS12_TRYBB unnamed protein product
Length=144

 Score = 98.6 bits (244),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 82/134 (61%), Gaps = 6/134 (4%)

Query  8    VPSAAPVIDGAMD-----INTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLAILAES  62
            VP  A VID   D     +  AL+ VL K+   +GL+ G+ +  +ALD+R A L +LA+ 
Sbjct  12   VPEPA-VIDAVADAMPDSLEDALRIVLMKARETNGLICGLSEVTRALDRRTAHLCVLADD  70

Query  63   FDEPNYKKLVTALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFG  122
             ++  YKKLVTAL  ++ I L+ +D  +KL +W+GL ++  +G  RK   CS + ++DFG
Sbjct  71   CEDEEYKKLVTALAKQNNIDLVSMDEREKLAQWAGLTRMAADGSVRKTLKCSCLAVRDFG  130

Query  123  EETQALDVVKDHLR  136
            E T+ALD +   L+
Sbjct  131  ERTKALDYLLSQLQ  144


>Q38AC1_TRYB2 unnamed protein product
Length=142

 Score = 91.3 bits (225),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 79/123 (64%), Gaps = 2/123 (2%)

Query  14   VIDGAMD-INTALQEVLKKSLIADGLVHGIHQACKALDKRQAVLAILAESFDEPNYKKLV  72
            VID   D +  A++ V++K+L  +GLV G+ +  +ALD+R A + ILA   D+  YKKL+
Sbjct  19   VIDVEPDTLQDAIRIVIRKALEVNGLVRGLSEVARALDRRTAHMCILATDCDDEEYKKLI  78

Query  73   TALCNEHQIPLIRVDSHKKLGEWSGLCKIDKEGKPRKVCGCSVVVIKDFGEETQALDVVK  132
             AL  +  I +I VDS ++L EW+GL +  K+ +  K   CS V I+DFGE T+ALD++ 
Sbjct  79   KALALQASIDIIEVDSREELAEWAGLQR-RKQDETVKTFKCSCVAIRDFGERTKALDMLL  137

Query  133  DHL  135
            + L
Sbjct  138  NKL  140



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016364.1 10 kDa heat shock protein, mitochondrial [Drosophila
kikkawai]

Length=103
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU35_DROME  unnamed protein product                                 193     9e-66
Q8I5Q3_PLAF7  unnamed protein product                                 81.6    1e-21
Q57WR6_TRYB2  unnamed protein product                                 78.2    4e-20


>Q9VU35_DROME unnamed protein product
Length=103

 Score = 193 bits (490),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 97/103 (94%), Positives = 101/103 (98%), Gaps = 0/103 (0%)

Query  1    MAAAIKRIIPMLDRILIQRADALTTTKGGIVLPEKSVGKVLEGTVLAVGPGTRNATTGTH  60
            MAAAIK+IIPMLDRILIQRA+ALT TKGGIVLPEK+VGKVLEGTVLAVGPGTRNA+TG H
Sbjct  1    MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNH  60

Query  61   IPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE  103
            IPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE
Sbjct  61   IPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE  103


>Q8I5Q3_PLAF7 unnamed protein product
Length=103

 Score = 81.6 bits (200),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 62/95 (65%), Gaps = 4/95 (4%)

Query  1   MAAAIKR-IIPMLDRILIQRADALTTTKGGIVLPEKSVGKVLEGTVLAVGPGTRNATTGT  59
           M++ I R  IP++DRILI +    TTTK G+ LPE +      G VLAVGPG R  + GT
Sbjct  1   MSSTITRKFIPLMDRILISKIVPKTTTKSGLFLPESATEPSYTGKVLAVGPG-RVTSNGT  59

Query  60  HIPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFR  94
            I   VKEGD V+LPE+GG+ + ++G+  E F++R
Sbjct  60  KISPSVKEGDVVVLPEYGGSSLKIDGE--EFFVYR  92


>Q57WR6_TRYB2 unnamed protein product
Length=100

 Score = 78.2 bits (191),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 61/96 (64%), Gaps = 8/96 (8%)

Query  4   AIKRIIPMLDRILIQRADALTTTKGGIVLPEKSVGKVLEGTVLAVGPGTRNATTGTHIPI  63
           A+K + P+  R+L++R  A   TK G+++PE+  GKV EGTV+AV   T++ T       
Sbjct  8   ALKTLQPLGSRVLVRRTLAAKQTKAGVLIPEQVAGKVNEGTVVAVAAATKDWTP------  61

Query  64  GVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDIL  99
            VK  D VLLPEFGG+ + LEG+  ELFL+ E  +L
Sbjct  62  SVKVNDTVLLPEFGGSSIKLEGE--ELFLYNEDSLL  95



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016365.1 uncharacterized protein LOC108070423 isoform X1
[Drosophila kikkawai]

Length=858
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8INC3_DROME  unnamed protein product                                 37.4    0.076
Q9VEZ0_DROME  unnamed protein product                                 36.6    0.11 
Q0KI67_DROME  unnamed protein product                                 36.6    0.11 


>Q8INC3_DROME unnamed protein product
Length=2194

 Score = 37.4 bits (85),  Expect = 0.076, Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 118/267 (44%), Gaps = 46/267 (17%)

Query  449   KRNANIFYSMIQSTHAHVRRLHAD----------KLQLEEDLKKARDSYRKQMGTMSTQF  498
             +R+   + ++++     + RL AD          + QLE D + AR    K   T   + 
Sbjct  1792  RRDLRKYKALLKDAQTQLERLKADTPGKTLIRQLRNQLE-DAESARSLAMKARQTAEAEL  1850

Query  499   TQIEKVFNAASHKKVWD--------HFTKAQRK------------NIDQWKKLATELRTV  538
             T+++ +F+  SH+   D        H  +A+ +             + ++     +L T 
Sbjct  1851  TEVQAMFDE-SHRARNDAEERANAAHRDRAELQAQIEENEEELGELMKKYSATVKQLNTE  1909

Query  539   QITDDEMEISDDERDYERRGPGAK--RMRYDSDSLKDEND--------SLRCQLEAIRHE  588
             QI   E E   +E + ER     +   +++  D++++  D         L  + + +   
Sbjct  1910  QINVSEAEFKLNEMEAERNNLKEQVAELQHRLDNVENLGDPSMAMMSKRLELRTKELESR  1969

Query  589   MTLERSDYVQREKQIKVLQETIRNMQTQLLQTKMREQKDTKIIEQLERNLKDAGVKQLLL  648
             + LE++   + E Q+   +E +  +Q ++ Q+KMRE +   +I++ +++L+D   +   +
Sbjct  1970  LELEQATRARLEVQVNRHKEALEKLQNEVTQSKMREMQAQDVIKKSQKSLRDMREEFHAV  2029

Query  649   KTKIKETADKLKNREAK----NSNGAA  671
              ++ +E+  + K+ E K     S GAA
Sbjct  2030  SSREQESLTRRKDLEKKVEQMESEGAA  2056


>Q9VEZ0_DROME unnamed protein product
Length=2148

 Score = 36.6 bits (83),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 118/267 (44%), Gaps = 46/267 (17%)

Query  449   KRNANIFYSMIQSTHAHVRRLHAD----------KLQLEEDLKKARDSYRKQMGTMSTQF  498
             +R+   + ++++     + RL AD          + QLE D + AR    K   T   + 
Sbjct  1792  RRDLRKYKALLKDAQTQLERLKADTPGKTLIRQLRNQLE-DAESARSLAMKARQTAEAEL  1850

Query  499   TQIEKVFNAASHKKVWD--------HFTKAQRK------------NIDQWKKLATELRTV  538
             T+++ +F+  SH+   D        H  +A+ +             + ++     +L T 
Sbjct  1851  TEVQAMFDE-SHRARNDAEERANAAHRDRAELQAQIEENEEELGELMKKYSATVKQLNTE  1909

Query  539   QITDDEMEISDDERDYERRGPGAK--RMRYDSDSLKDEND--------SLRCQLEAIRHE  588
             QI   E E   +E + ER     +   +++  D++++  D         L  + + +   
Sbjct  1910  QINVSEAEFKLNEMEAERNNLKEQVAELQHRLDNVENLGDPSMAMMSKRLELRTKELESR  1969

Query  589   MTLERSDYVQREKQIKVLQETIRNMQTQLLQTKMREQKDTKIIEQLERNLKDAGVKQLLL  648
             + LE++   + E Q+   +E +  +Q ++ Q+KMRE +   +I++ +++L+D   +   +
Sbjct  1970  LELEQATRARLEVQVNRHKEALEKLQNEVTQSKMREMQAQDVIKKSQKSLRDMREEFHAV  2029

Query  649   KTKIKETADKLKNREAK----NSNGAA  671
              ++ +E+  + K+ E K     S GAA
Sbjct  2030  SSREQESLTRRKDLEKKVEQMESEGAA  2056


>Q0KI67_DROME unnamed protein product
Length=2160

 Score = 36.6 bits (83),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 54/267 (20%), Positives = 118/267 (44%), Gaps = 46/267 (17%)

Query  449   KRNANIFYSMIQSTHAHVRRLHAD----------KLQLEEDLKKARDSYRKQMGTMSTQF  498
             +R+   + ++++     + RL AD          + QLE D + AR    K   T   + 
Sbjct  1792  RRDLRKYKALLKDAQTQLERLKADTPGKTLIRQLRNQLE-DAESARSLAMKARQTAEAEL  1850

Query  499   TQIEKVFNAASHKKVWD--------HFTKAQRK------------NIDQWKKLATELRTV  538
             T+++ +F+  SH+   D        H  +A+ +             + ++     +L T 
Sbjct  1851  TEVQAMFDE-SHRARNDAEERANAAHRDRAELQAQIEENEEELGELMKKYSATVKQLNTE  1909

Query  539   QITDDEMEISDDERDYERRGPGAK--RMRYDSDSLKDEND--------SLRCQLEAIRHE  588
             QI   E E   +E + ER     +   +++  D++++  D         L  + + +   
Sbjct  1910  QINVSEAEFKLNEMEAERNNLKEQVAELQHRLDNVENLGDPSMAMMSKRLELRTKELESR  1969

Query  589   MTLERSDYVQREKQIKVLQETIRNMQTQLLQTKMREQKDTKIIEQLERNLKDAGVKQLLL  648
             + LE++   + E Q+   +E +  +Q ++ Q+KMRE +   +I++ +++L+D   +   +
Sbjct  1970  LELEQATRARLEVQVNRHKEALEKLQNEVTQSKMREMQAQDVIKKSQKSLRDMREEFHAV  2029

Query  649   KTKIKETADKLKNREAK----NSNGAA  671
              ++ +E+  + K+ E K     S GAA
Sbjct  2030  SSREQESLTRRKDLEKKVEQMESEGAA  2056



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016366.1 uncharacterized protein LOC108070423 isoform X2
[Drosophila kikkawai]

Length=499
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VE52_DROME  unnamed protein product                                 45.1    9e-05
Q4QA88_LEIMA  unnamed protein product                                 42.7    6e-04
Q75K16_DICDI  unnamed protein product                                 40.8    0.002


>Q9VE52_DROME unnamed protein product
Length=419

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 8/67 (12%)

Query  294  RTVFVGGLPENITEEVIREIFESCGEITTLRM-------SKKNFCHIRYR-QETAIDRAI  345
            R+VFVG +P   TEE ++EIF   G + +L++         K F    Y+ QETA+    
Sbjct  16   RSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMR  75

Query  346  YLSGYRL  352
             L+GY +
Sbjct  76   NLNGYEI  82


>Q4QA88_LEIMA unnamed protein product
Length=544

 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 60/113 (53%), Gaps = 19/113 (17%)

Query  294  RTVFVGGLPENITEEVIREIFESCGEITTLRMSK------KNFCHIRYRQETAIDRAIY-  346
            R +++  LP++IT++ +REIFE  G+IT+  + K      K F  + +  +     A+  
Sbjct  289  RNLYIKHLPDDITDDRLREIFEPFGKITSCAIMKEPNGTLKGFAFVCFEDKQHASAALRS  348

Query  347  LSGYRLRISALNEPPNFGRLHVDYAQARDDQYDYECRQRQQQR-EQRHRERMS  398
            L+G+ L  SA  +P     L+V +A    +Q D   R  QQ+R   RH+ RM+
Sbjct  349  LNGHPLEHSA--KP-----LYVSHA----EQKDMRIRLLQQRRAAMRHQSRMA  390


>Q75K16_DICDI unnamed protein product
Length=299

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 38/79 (48%), Gaps = 10/79 (13%)

Query  296  VFVGGLPENITEEVIREIFESCGEITTLRMSKKN----FCHIRYRQETAIDRAIYLSGY-  350
            VFVG LP  +TE  ++E F  CG+I+ +++   N       I +  E   D AI  +G  
Sbjct  78   VFVGQLPSGVTEYDLKEYFSECGDISNIKILNSNPQRVAAFITFADEKGRDTAITYNGKD  137

Query  351  -----RLRISALNEPPNFG  364
                  LRI+  N  P+ G
Sbjct  138  FNGQGSLRINGANSKPSDG  156


 Score = 33.9 bits (76),  Expect = 0.23, Method: Compositional matrix adjust.
 Identities = 20/84 (24%), Positives = 36/84 (43%), Gaps = 17/84 (20%)

Query  276  PPNPNAPPPTIRDRPPGCRTVFVGGLPENITEEVIREIFESCGEITTLRM-------SKK  328
            P +    P TI      CR +        + E +++E F  CG I+ + +         K
Sbjct  153  PSDGEGEPTTIV-----CRNIAF-----TVDETLVKEFFSKCGSISRVSLPVYEDSGRLK  202

Query  329  NFCHIRYRQETAIDRAIYLSGYRL  352
             F  + +  E A+++AI L+G + 
Sbjct  203  GFAFVSFDSEDAVEKAIALTGTKF  226



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016367.1 uncharacterized protein LOC108070423 isoform X3
[Drosophila kikkawai]

Length=497
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VE52_DROME  unnamed protein product                                 45.1    9e-05
Q4QA88_LEIMA  unnamed protein product                                 42.4    7e-04
Q75K16_DICDI  unnamed protein product                                 40.8    0.002


>Q9VE52_DROME unnamed protein product
Length=419

 Score = 45.1 bits (105),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/67 (36%), Positives = 36/67 (54%), Gaps = 8/67 (12%)

Query  294  RTVFVGGLPENITEEVIREIFESCGEITTLRM-------SKKNFCHIRYR-QETAIDRAI  345
            R+VFVG +P   TEE ++EIF   G + +L++         K F    Y+ QETA+    
Sbjct  16   RSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMR  75

Query  346  YLSGYRL  352
             L+GY +
Sbjct  76   NLNGYEI  82


>Q4QA88_LEIMA unnamed protein product
Length=544

 Score = 42.4 bits (98),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 60/113 (53%), Gaps = 19/113 (17%)

Query  294  RTVFVGGLPENITEEVIREIFESCGEITTLRMSK------KNFCHIRYRQETAIDRAIY-  346
            R +++  LP++IT++ +REIFE  G+IT+  + K      K F  + +  +     A+  
Sbjct  289  RNLYIKHLPDDITDDRLREIFEPFGKITSCAIMKEPNGTLKGFAFVCFEDKQHASAALRS  348

Query  347  LSGYRLRISALNEPPNFGRLHVDYAQARDDQYDYECRQRQQQR-EQRHRERMS  398
            L+G+ L  SA  +P     L+V +A    +Q D   R  QQ+R   RH+ RM+
Sbjct  349  LNGHPLEHSA--KP-----LYVSHA----EQKDMRIRLLQQRRAAMRHQSRMA  390


>Q75K16_DICDI unnamed protein product
Length=299

 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 38/79 (48%), Gaps = 10/79 (13%)

Query  296  VFVGGLPENITEEVIREIFESCGEITTLRMSKKN----FCHIRYRQETAIDRAIYLSGY-  350
            VFVG LP  +TE  ++E F  CG+I+ +++   N       I +  E   D AI  +G  
Sbjct  78   VFVGQLPSGVTEYDLKEYFSECGDISNIKILNSNPQRVAAFITFADEKGRDTAITYNGKD  137

Query  351  -----RLRISALNEPPNFG  364
                  LRI+  N  P+ G
Sbjct  138  FNGQGSLRINGANSKPSDG  156


 Score = 34.3 bits (77),  Expect = 0.22, Method: Compositional matrix adjust.
 Identities = 20/84 (24%), Positives = 36/84 (43%), Gaps = 17/84 (20%)

Query  276  PPNPNAPPPTIRDRPPGCRTVFVGGLPENITEEVIREIFESCGEITTLRM-------SKK  328
            P +    P TI      CR +        + E +++E F  CG I+ + +         K
Sbjct  153  PSDGEGEPTTIV-----CRNIAF-----TVDETLVKEFFSKCGSISRVSLPVYEDSGRLK  202

Query  329  NFCHIRYRQETAIDRAIYLSGYRL  352
             F  + +  E A+++AI L+G + 
Sbjct  203  GFAFVSFDSEDAVEKAIALTGTKF  226



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016368.1 facilitated trehalose transporter Tret1-2 homolog
isoform X1 [Drosophila kikkawai]

Length=543
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU17_DROME  unnamed protein product                                 927     0.0   
Q8IQH6_DROME  unnamed protein product                                 813     0.0   
TRE12_DROME  unnamed protein product                                  336     1e-109


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/526 (88%), Positives = 490/526 (93%), Gaps = 0/526 (0%)

Query  11   GEEVAKKPGTNNEESSHLLESAENGAKYGSRQAVKIVKASDNGRTSSTPHDQENLLGNMV  70
            GEE  KK G+NNEESSHLLESAENGAKYGSRQ VKIVKASDNGRTSSTPHDQENLLGNMV
Sbjct  11   GEEANKKSGSNNEESSHLLESAENGAKYGSRQPVKIVKASDNGRTSSTPHDQENLLGNMV  70

Query  71   HTSTENNSKKLPQYVAALAAAGGAFACGTLLGWTSPAQTEIVDNHSGYDFLVSDTQFSWV  130
            HTST NNS+K PQYVAALAAAGGAFA GT+LGWTSPA+TEIVD   GYDF V   QFSWV
Sbjct  71   HTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFSWV  130

Query  131  GSAMTLGAACVCIPIGFLINLIGRKWTMLFLVLPFIVGWAMLIWAANVGMMYASRFILGI  190
            GSAMTLGAACVCIPIGFLIN+IGRKWTMLFLVLPFI+GW MLIWA NV M+YASRFILGI
Sbjct  131  GSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGI  190

Query  191  AGGAFCVTAPMYTGEIAQKDIRGTLGSFFQLMITIGILFVYAIGAGLDIFWVSVICGILP  250
            AGGAFCVTAPMYTGEIAQK+IRGTLGSFFQLMITIGILFVYA+GAG+ IFW+S+ICGILP
Sbjct  191  AGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILP  250

Query  251  LVFGVIFFFMPESPTYLVAKDRSEGAIKSIQWLRGKEYDYEPELAELRETDREIRENKVN  310
            L+FG IFFFMPESPTYLV+KDRSE AIKSIQWLRGKEYDYEPELAELRETDRE + NKVN
Sbjct  251  LIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANKVN  310

Query  311  VWSALNRPVTRKALAISLGLMFFQQVCGINAVIFYSSRIFKEANTGIGPRWATILIGIMQ  370
            VW+ALNRPVTRKALAIS+GLMFFQQVCGINAVIFY+SRIF EANTGI   WATILIGIMQ
Sbjct  311  VWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQ  370

Query  371  VVATFVSTVVVDKLGRRILLLASGIAMAVATTAIGVYFYLQGQDEAQVESLGWLPVAALC  430
            VVATFVST+VVDKLGRRILLLASGI+MA++TTAIGVYF+LQ QD AQV SLGWLPVA+LC
Sbjct  371  VVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLC  430

Query  431  IFIIMFSMGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFDDLNAGLGIGG  490
            +FIIMFS+GYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTF +LN GLGIGG
Sbjct  431  LFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGG  490

Query  491  TFWLFAGLTVLGVFFVFFAVPETKGKSLNEIQQELAGNRSIPAPTP  536
            TFWLFAGLTV+GV FV+FAVPETKGKSLNEIQQELAGNRS P   P
Sbjct  491  TFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIP  536


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/468 (87%), Positives = 436/468 (93%), Gaps = 0/468 (0%)

Query  69   MVHTSTENNSKKLPQYVAALAAAGGAFACGTLLGWTSPAQTEIVDNHSGYDFLVSDTQFS  128
            MVHTST NNS+K PQYVAALAAAGGAFA GT+LGWTSPA+TEIVD   GYDF V   QFS
Sbjct  1    MVHTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFS  60

Query  129  WVGSAMTLGAACVCIPIGFLINLIGRKWTMLFLVLPFIVGWAMLIWAANVGMMYASRFIL  188
            WVGSAMTLGAACVCIPIGFLIN+IGRKWTMLFLVLPFI+GW MLIWA NV M+YASRFIL
Sbjct  61   WVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFIL  120

Query  189  GIAGGAFCVTAPMYTGEIAQKDIRGTLGSFFQLMITIGILFVYAIGAGLDIFWVSVICGI  248
            GIAGGAFCVTAPMYTGEIAQK+IRGTLGSFFQLMITIGILFVYA+GAG+ IFW+S+ICGI
Sbjct  121  GIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGI  180

Query  249  LPLVFGVIFFFMPESPTYLVAKDRSEGAIKSIQWLRGKEYDYEPELAELRETDREIRENK  308
            LPL+FG IFFFMPESPTYLV+KDRSE AIKSIQWLRGKEYDYEPELAELRETDRE + NK
Sbjct  181  LPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANK  240

Query  309  VNVWSALNRPVTRKALAISLGLMFFQQVCGINAVIFYSSRIFKEANTGIGPRWATILIGI  368
            VNVW+ALNRPVTRKALAIS+GLMFFQQVCGINAVIFY+SRIF EANTGI   WATILIGI
Sbjct  241  VNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGI  300

Query  369  MQVVATFVSTVVVDKLGRRILLLASGIAMAVATTAIGVYFYLQGQDEAQVESLGWLPVAA  428
            MQVVATFVST+VVDKLGRRILLLASGI+MA++TTAIGVYF+LQ QD AQV SLGWLPVA+
Sbjct  301  MQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVAS  360

Query  429  LCIFIIMFSMGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFDDLNAGLGI  488
            LC+FIIMFS+GYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTF +LN GLGI
Sbjct  361  LCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGI  420

Query  489  GGTFWLFAGLTVLGVFFVFFAVPETKGKSLNEIQQELAGNRSIPAPTP  536
            GGTFWLFAGLTV+GV FV+FAVPETKGKSLNEIQQELAGNRS P   P
Sbjct  421  GGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIP  468


>TRE12_DROME unnamed protein product
Length=488

 Score = 336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 194/496 (39%), Positives = 285/496 (57%), Gaps = 17/496 (3%)

Query  44   VKIVKASDNGRTSSTPHDQENLLGNMVHTSTENNSKKLPQYVAALAAAGGAFACGTLLGW  103
            +KI+  +D   + S P D   L  N   +          Q +AAL+ +  +   G +  +
Sbjct  1    MKILMRADTHVSFSVPAD--GLKANFTFS----------QVLAALSVSLCSLVVGFVSAY  48

Query  104  TSPAQTEIVDNHSGYDFLVSDTQFSWVGSAMTLGAACVCIPIGFLINLIGRKWTMLFLVL  163
            TSPA   + D  +   F V+    SWVG  M L A    I  G LI  +GR+ T+L   +
Sbjct  49   TSPALVSMTD-RTITSFEVTKDAGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAV  107

Query  164  PFIVGWAMLIWAANVGMMYASRFILGIAGGAFCVTAPMYTGEIAQKDIRGTLGSFFQLMI  223
            PFIV   ++  A NV M+   RF+ G   G   ++ P+Y GE  Q ++RGTLG     + 
Sbjct  108  PFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALG  167

Query  224  TIGILFVYAIGAGLDIFWVSVICGILPLVFGVIFFFMPESPTYLVAKDRSEGAIKSIQWL  283
             IGIL  Y  G+ ++   ++ +   LP+ F ++   +PE+P + V + + E A K+++WL
Sbjct  168  NIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERARKALKWL  227

Query  284  RGKEYDYEPELAELRETDREI-RENKVNVWSALNRPVTRKALAISLGLMFFQQVCGINAV  342
            RGKE D EPEL EL ++  +  R+   N    L +    K L+ISLGLMFFQQ  GINAV
Sbjct  228  RGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLKPLSISLGLMFFQQFSGINAV  287

Query  343  IFYSSRIFKEANTGIGPRWATILIGIMQVVATFVSTVVVDKLGRRILLLASGIAMAVATT  402
            IFY+ +IFK+A + I    +TI++G++   ATF+  +++D+LGR+ILL  S IAM V  +
Sbjct  288  IFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLYVSDIAMIVTLS  347

Query  403  AIGVYFYLQGQDEAQVESLGWLPVAALCIFIIMFSMGYGPVPWLMMGELFATDIKGFAGS  462
             +G +FY +      V  LGWLP+    I+I+ FS+G+GP+PWLMMGE+    I+G A S
Sbjct  348  ILGGFFYCKAHGP-DVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAAS  406

Query  463  LAGTSNWLLAFVVTKTFDDLNAGLGIGGTFWLFAGLTVLGVFFVFFAVPETKGKSLNEIQ  522
            +    NW   FVVTKTF DL   +G  G FWLF  + ++G+FFV   VPET+GKSL EI+
Sbjct  407  VVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIE  466

Query  523  QELAGNRSIPAPTPVN  538
            +++ G   +P  + VN
Sbjct  467  RKMMGR--VPMSSVVN  480



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016369.1 uncharacterized protein LOC108070422 [Drosophila
kikkawai]

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q387J0_TRYB2  unnamed protein product                                 30.4    0.82 
Q38BA0_TRYB2  unnamed protein product                                 28.9    2.7  
MTR1_TRYB2  unnamed protein product                                   27.3    7.9  


>Q387J0_TRYB2 unnamed protein product
Length=356

 Score = 30.4 bits (67),  Expect = 0.82, Method: Compositional matrix adjust.
 Identities = 25/123 (20%), Positives = 52/123 (42%), Gaps = 15/123 (12%)

Query  7    KLLVLSWMAERCLSAQVVHLDRFTFTVDDHALFLSQSAVLEQEHNRSYLS----------  56
            KL V +WM    + + ++     +F   D+A+      ++ +E N   L           
Sbjct  4    KLFVTTWMYFFPIESTIILKGNMSF---DYAVLSPTEIIIYKERNAPILKKVTNLLLRGG  60

Query  57   --GHMMINRLVNDITLTSSMDIIRPRRPEMRLYNVKLNFCSVLNNGYKNKFIRLLYNNYA  114
              G++ + ++++  T   S D  + RR     +   +  C VL    ++K +R  Y++  
Sbjct  61   AFGYLNLEKMLHRSTEKDSDDSKKGRRINPVTFKSVMVQCGVLLTPEEHKSLRAAYSDEG  120

Query  115  GFL  117
            GF+
Sbjct  121  GFI  123


>Q38BA0_TRYB2 unnamed protein product
Length=746

 Score = 28.9 bits (63),  Expect = 2.7, Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 4/58 (7%)

Query  84   MRLYNVKLNFCSVL-NNGYKNKFIRLLYNNYAGFLNTKPKCPLKPNFNYSLTRAFVDE  140
            +R   +   F  VL  + YKNK I+LL +    +L   P    KPN  YS+T+   DE
Sbjct  266  IRRTTIANKFVPVLVGSAYKNKGIQLLLDAVCRYL---PSPMEKPNSGYSVTKVKDDE  320


>MTR1_TRYB2 unnamed protein product
Length=370

 Score = 27.3 bits (59),  Expect = 7.9, Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (47%), Gaps = 6/62 (10%)

Query  115  GFLNTKPKCPLKPNFNYSLTRAFVDEDLLPDLLPECTYR----FRASFEQKSKPLAHMQL  170
            GF+   PK  L+ +F       FVD D +P +LP   +     F A  E+ S  +A  Q+
Sbjct  292  GFIGA-PKQWLE-HFERCYQEGFVDNDNIPTVLPTSLFSGDKIFGADVERMSATIASNQV  349

Query  171  DG  172
             G
Sbjct  350  SG  351



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016370.1 facilitated trehalose transporter Tret1-2 homolog
isoform X2 [Drosophila kikkawai]

Length=475
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU17_DROME  unnamed protein product                                 812     0.0   
Q8IQH6_DROME  unnamed protein product                                 810     0.0   
TRE12_DROME  unnamed protein product                                  335     3e-110


>Q9VU17_DROME unnamed protein product
Length=539

 Score = 812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/468 (87%), Positives = 436/468 (93%), Gaps = 0/468 (0%)

Query  1    MVHTSTENNSKKLPQYVAALAAAGGAFACGTLLGWTSPAQTEIVDNHSGYDFLVSDTQFS  60
            MVHTST NNS+K PQYVAALAAAGGAFA GT+LGWTSPA+TEIVD   GYDF V   QFS
Sbjct  69   MVHTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFS  128

Query  61   WVGSAMTLGAACVCIPIGFLINLIGRKWTMLFLVLPFIVGWAMLIWAANVGMMYASRFIL  120
            WVGSAMTLGAACVCIPIGFLIN+IGRKWTMLFLVLPFI+GW MLIWA NV M+YASRFIL
Sbjct  129  WVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFIL  188

Query  121  GIAGGAFCVTAPMYTGEIAQKDIRGTLGSFFQLMITIGILFVYAIGAGLDIFWVSVICGI  180
            GIAGGAFCVTAPMYTGEIAQK+IRGTLGSFFQLMITIGILFVYA+GAG+ IFW+S+ICGI
Sbjct  189  GIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGI  248

Query  181  LPLVFGVIFFFMPESPTYLVAKDRSEGAIKSIQWLRGKEYDYEPELAELRETDREIRENK  240
            LPL+FG IFFFMPESPTYLV+KDRSE AIKSIQWLRGKEYDYEPELAELRETDRE + NK
Sbjct  249  LPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANK  308

Query  241  VNVWSALNRPVTRKALAISLGLMFFQQVCGINAVIFYSSRIFKEANTGIGPRWATILIGI  300
            VNVW+ALNRPVTRKALAIS+GLMFFQQVCGINAVIFY+SRIF EANTGI   WATILIGI
Sbjct  309  VNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGI  368

Query  301  MQVVATFVSTVVVDKLGRRILLLASGIAMAVATTAIGVYFYLQGQDEAQVESLGWLPVAA  360
            MQVVATFVST+VVDKLGRRILLLASGI+MA++TTAIGVYF+LQ QD AQV SLGWLPVA+
Sbjct  369  MQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVAS  428

Query  361  LCIFIIMFSMGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFDDLNAGLGI  420
            LC+FIIMFS+GYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTF +LN GLGI
Sbjct  429  LCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGI  488

Query  421  GGTFWLFAGLTVLGVFFVFFAVPETKGKSLNEIQQELAGNRSIPAPTP  468
            GGTFWLFAGLTV+GV FV+FAVPETKGKSLNEIQQELAGNRS P   P
Sbjct  489  GGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIP  536


>Q8IQH6_DROME unnamed protein product
Length=471

 Score = 810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/468 (87%), Positives = 436/468 (93%), Gaps = 0/468 (0%)

Query  1    MVHTSTENNSKKLPQYVAALAAAGGAFACGTLLGWTSPAQTEIVDNHSGYDFLVSDTQFS  60
            MVHTST NNS+K PQYVAALAAAGGAFA GT+LGWTSPA+TEIVD   GYDF V   QFS
Sbjct  1    MVHTSTSNNSQKWPQYVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFS  60

Query  61   WVGSAMTLGAACVCIPIGFLINLIGRKWTMLFLVLPFIVGWAMLIWAANVGMMYASRFIL  120
            WVGSAMTLGAACVCIPIGFLIN+IGRKWTMLFLVLPFI+GW MLIWA NV M+YASRFIL
Sbjct  61   WVGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFIL  120

Query  121  GIAGGAFCVTAPMYTGEIAQKDIRGTLGSFFQLMITIGILFVYAIGAGLDIFWVSVICGI  180
            GIAGGAFCVTAPMYTGEIAQK+IRGTLGSFFQLMITIGILFVYA+GAG+ IFW+S+ICGI
Sbjct  121  GIAGGAFCVTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGI  180

Query  181  LPLVFGVIFFFMPESPTYLVAKDRSEGAIKSIQWLRGKEYDYEPELAELRETDREIRENK  240
            LPL+FG IFFFMPESPTYLV+KDRSE AIKSIQWLRGKEYDYEPELAELRETDRE + NK
Sbjct  181  LPLIFGAIFFFMPESPTYLVSKDRSENAIKSIQWLRGKEYDYEPELAELRETDRETKANK  240

Query  241  VNVWSALNRPVTRKALAISLGLMFFQQVCGINAVIFYSSRIFKEANTGIGPRWATILIGI  300
            VNVW+ALNRPVTRKALAIS+GLMFFQQVCGINAVIFY+SRIF EANTGI   WATILIGI
Sbjct  241  VNVWAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGI  300

Query  301  MQVVATFVSTVVVDKLGRRILLLASGIAMAVATTAIGVYFYLQGQDEAQVESLGWLPVAA  360
            MQVVATFVST+VVDKLGRRILLLASGI+MA++TTAIGVYF+LQ QD AQV SLGWLPVA+
Sbjct  301  MQVVATFVSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVAS  360

Query  361  LCIFIIMFSMGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFDDLNAGLGI  420
            LC+FIIMFS+GYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTF +LN GLGI
Sbjct  361  LCLFIIMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGI  420

Query  421  GGTFWLFAGLTVLGVFFVFFAVPETKGKSLNEIQQELAGNRSIPAPTP  468
            GGTFWLFAGLTV+GV FV+FAVPETKGKSLNEIQQELAGNRS P   P
Sbjct  421  GGTFWLFAGLTVVGVIFVYFAVPETKGKSLNEIQQELAGNRSTPQAIP  468


>TRE12_DROME unnamed protein product
Length=488

 Score = 335 bits (858),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 186/457 (41%), Positives = 272/457 (60%), Gaps = 5/457 (1%)

Query  15   QYVAALAAAGGAFACGTLLGWTSPAQTEIVDNHSGYDFLVSDTQFSWVGSAMTLGAACVC  74
            Q +AAL+ +  +   G +  +TSPA   + D  +   F V+    SWVG  M L A    
Sbjct  28   QVLAALSVSLCSLVVGFVSAYTSPALVSMTD-RTITSFEVTKDAGSWVGGIMPLAALAGG  86

Query  75   IPIGFLINLIGRKWTMLFLVLPFIVGWAMLIWAANVGMMYASRFILGIAGGAFCVTAPMY  134
            I  G LI  +GR+ T+L   +PFIV   ++  A NV M+   RF+ G   G   ++ P+Y
Sbjct  87   ITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVY  146

Query  135  TGEIAQKDIRGTLGSFFQLMITIGILFVYAIGAGLDIFWVSVICGILPLVFGVIFFFMPE  194
             GE  Q ++RGTLG     +  IGIL  Y  G+ ++   ++ +   LP+ F ++   +PE
Sbjct  147  LGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPE  206

Query  195  SPTYLVAKDRSEGAIKSIQWLRGKEYDYEPELAELRETDREI-RENKVNVWSALNRPVTR  253
            +P + V + + E A K+++WLRGKE D EPEL EL ++  +  R+   N    L +    
Sbjct  207  TPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNL  266

Query  254  KALAISLGLMFFQQVCGINAVIFYSSRIFKEANTGIGPRWATILIGIMQVVATFVSTVVV  313
            K L+ISLGLMFFQQ  GINAVIFY+ +IFK+A + I    +TI++G++   ATF+  +++
Sbjct  267  KPLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILI  326

Query  314  DKLGRRILLLASGIAMAVATTAIGVYFYLQGQDEAQVESLGWLPVAALCIFIIMFSMGYG  373
            D+LGR+ILL  S IAM V  + +G +FY +      V  LGWLP+    I+I+ FS+G+G
Sbjct  327  DRLGRKILLYVSDIAMIVTLSILGGFFYCKAHGP-DVSHLGWLPLTCFVIYILGFSLGFG  385

Query  374  PVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFDDLNAGLGIGGTFWLFAGLTVL  433
            P+PWLMMGE+    I+G A S+    NW   FVVTKTF DL   +G  G FWLF  + ++
Sbjct  386  PIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIV  445

Query  434  GVFFVFFAVPETKGKSLNEIQQELAGNRSIPAPTPVN  470
            G+FFV   VPET+GKSL EI++++ G   +P  + VN
Sbjct  446  GLFFVIIFVPETRGKSLEEIERKMMGR--VPMSSVVN  480



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


Query= XP_017016371.1 WW domain-binding protein 2 isoform X1 [Drosophila
kikkawai]

Length=402
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU19_DROME  unnamed protein product                                 475     1e-167
Q18966_CAEEL  unnamed protein product                                 143     3e-40 


>Q9VU19_DROME unnamed protein product
Length=384

 Score = 475 bits (1222),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 330/403 (82%), Positives = 340/403 (84%), Gaps = 20/403 (5%)

Query  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNNKK  60
            MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQD+PIFKGSK GRIYLTSHRMIFN+KK
Sbjct  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKK  60

Query  61   SSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120
            SSD+MQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY
Sbjct  61   SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120

Query  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGAWNEAPPPAYQPPPGYYGWLPQHDAFSG  180
            GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAG+WNEAPPPAYQPPPGYYGWLPQHDAFSG
Sbjct  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSG  180

Query  181  PAPNTVFMSDNPPPYPGIAPPAPYQQPAQPQQPQAPPPSEPTWYGFSAPPPQQPQQPGYG  240
            PAPNTV+MSDNPPPYPGIAPPA    P QPQ P +   +EP WYGFSAPPPQQ       
Sbjct  181  PAPNTVYMSDNPPPYPGIAPPAHQPAPQQPQAPSS---NEPNWYGFSAPPPQQ-------  230

Query  241  QQQPGFGQQQPGYGQQQGWAGGYVQPPPYGACGPPANCPPGAPYVQPAQNYNGPPPYGGY  300
                   QQQ      QGWAGGYVQPPPY +C P  NCPP  PY  PAQ YNGP PYGGY
Sbjct  231  -------QQQQPGYGPQGWAGGYVQPPPYASCAP--NCPPQPPYAAPAQTYNGPQPYGGY  281

Query  301  GNVPGGFNTPGLQQ-PNGYPGGAPPPNQQPSQAAGAAGGTAASGVNFMGFSLPPGNSKEA  359
            GNVPGGFNTPG QQ      G    P     QAAGAAGG AASG +FMGFSLPPGNSKEA
Sbjct  282  GNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAGAAGGAAASGASFMGFSLPPGNSKEA  341

Query  360  EAAASAYNTPYNQGGPSGSGGGDMPPSYNNLPPSYDDASKKPH  402
            EAAASAYNTPYNQGGPSGSG  D+PPSYNNLPPSYDDASKK H
Sbjct  342  EAAASAYNTPYNQGGPSGSGNNDLPPSYNNLPPSYDDASKKNH  384


>Q18966_CAEEL unnamed protein product
Length=235

 Score = 143 bits (360),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 129/226 (57%), Gaps = 15/226 (7%)

Query  1    MSVNTAHANNG--VLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNN  58
            MS+NTA+  +G  VL++ GE I++ +  V M     ++   +G + G IYLTSHR+IF  
Sbjct  1    MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIFM-  59

Query  59   KKSSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAI  118
                D ++SF  PF ++ DV + QP+FGANY+ G   A   G   GEVK+++ F  GG I
Sbjct  60   PDPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCI  119

Query  119  EYGQALLRSAKTAMNNYHRGGLAGDDPPPYQ-PAGAWNEAPPPAYQPPP--GYYGWLPQH  175
            E+GQ+LL++ + A+          + PP Y  P G +  APP  YQP P  G  G+ P  
Sbjct  120  EFGQSLLQAVERAVRMRPE-----NAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTT  174

Query  176  DAF-SGPAPNTVFMSDNPPPYPGIAP---PAPYQQPAQPQQPQAPP  217
            D+F   P P+ VFMS  PPPYPGI P   P P ++     Q +APP
Sbjct  175  DSFPDQPNPSRVFMSSAPPPYPGIGPERGPHPTEELHVAGQFEAPP  220



Lambda      K        H
   0.318    0.136    0.392 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3518222594


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016372.1 WW domain-binding protein 2 isoform X2 [Drosophila
kikkawai]

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU19_DROME  unnamed protein product                                 464     5e-164
Q18966_CAEEL  unnamed protein product                                 141     1e-39 


>Q9VU19_DROME unnamed protein product
Length=384

 Score = 464 bits (1194),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 308/387 (80%), Positives = 318/387 (82%), Gaps = 17/387 (4%)

Query  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNNKK  60
            MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQD+PIFKGSK GRIYLTSHRMIFN+KK
Sbjct  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKK  60

Query  61   SSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120
            SSD+MQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY
Sbjct  61   SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120

Query  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGAWNEAPPPAYQPPPGYYGWLPQHDAFSG  180
            GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAG+WNEAPPPAYQPPPGYYGWLPQHDAFSG
Sbjct  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSG  180

Query  181  PAPNTVFMSDN-------------PPPYPGIAPPPQQPQQPGYGQQQPGFGQQQPGYGQQ  227
            PAPNTV+MSDN             P P    AP   +P   G+    P   QQQ      
Sbjct  181  PAPNTVYMSDNPPPYPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQ-QQQQQPGYGP  239

Query  228  QGWAGGYVQPPPYGACGPPANCPPGAPYVQPAQNYNGPPPYGGYGNVPGGFNTPGLQQ-P  286
            QGWAGGYVQPPPY +C P  NCPP  PY  PAQ YNGP PYGGYGNVPGGFNTPG QQ  
Sbjct  240  QGWAGGYVQPPPYASCAP--NCPPQPPYAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPN  297

Query  287  NGYPGGAPPPNQQPSQAAGAAGGTAASGVNFMGFSLPPGNSKEAEAAASAYNTPYNQGGP  346
                G    P     QAAGAAGG AASG +FMGFSLPPGNSKEAEAAASAYNTPYNQGGP
Sbjct  298  GNPNGYPGGPPPPGQQAAGAAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGGP  357

Query  347  SGSGGGDMPPSYNNLPPSYDDASKKPH  373
            SGSG  D+PPSYNNLPPSYDDASKK H
Sbjct  358  SGSGNNDLPPSYNNLPPSYDDASKKNH  384


>Q18966_CAEEL unnamed protein product
Length=235

 Score = 141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 120/206 (58%), Gaps = 12/206 (6%)

Query  1    MSVNTAHANNG--VLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNN  58
            MS+NTA+  +G  VL++ GE I++ +  V M     ++   +G + G IYLTSHR+IF  
Sbjct  1    MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIFM-  59

Query  59   KKSSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAI  118
                D ++SF  PF ++ DV + QP+FGANY+ G   A   G   GEVK+++ F  GG I
Sbjct  60   PDPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCI  119

Query  119  EYGQALLRSAKTAMNNYHRGGLAGDDPPPYQ-PAGAWNEAPPPAYQPPP--GYYGWLPQH  175
            E+GQ+LL++ + A+          + PP Y  P G +  APP  YQP P  G  G+ P  
Sbjct  120  EFGQSLLQAVERAVRMRPE-----NAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTT  174

Query  176  DAF-SGPAPNTVFMSDNPPPYPGIAP  200
            D+F   P P+ VFMS  PPPYPGI P
Sbjct  175  DSFPDQPNPSRVFMSSAPPPYPGIGP  200



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016373.1 WW domain-binding protein 2 isoform X3 [Drosophila
kikkawai]

Length=369
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU19_DROME  unnamed protein product                                 410     1e-142
Q18966_CAEEL  unnamed protein product                                 142     2e-40 


>Q9VU19_DROME unnamed protein product
Length=384

 Score = 410 bits (1053),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 286/356 (80%), Positives = 295/356 (83%), Gaps = 20/356 (6%)

Query  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNNKK  60
            MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQD+PIFKGSK GRIYLTSHRMIFN+KK
Sbjct  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKK  60

Query  61   SSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120
            SSD+MQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY
Sbjct  61   SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120

Query  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGAWNEAPPPAYQPPPGYYGWLPQHDAFSG  180
            GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAG+WNEAPPPAYQPPPGYYGWLPQHDAFSG
Sbjct  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSG  180

Query  181  PAPNTVFMSDNPPPYPGIAPPAPYQQPAQPQQPQAPPPSEPTWYGFSAPPPQQPQQPGYG  240
            PAPNTV+MSDNPPPYPGIAPPA    P QPQ P +   +EP WYGFSAPPPQQ       
Sbjct  181  PAPNTVYMSDNPPPYPGIAPPAHQPAPQQPQAPSS---NEPNWYGFSAPPPQQ-------  230

Query  241  QQQPGFGQQQPGYGQQQGWAGGYVQPPPYGACGPPANCPPGAPYVQPAQNYNGPPPYGGY  300
                   QQQ      QGWAGGYVQPPPY +C P  NCPP  PY  PAQ YNGP PYGGY
Sbjct  231  -------QQQQPGYGPQGWAGGYVQPPPYASCAP--NCPPQPPYAAPAQTYNGPQPYGGY  281

Query  301  GNVPGGFNTPGLQQ-PNGYPGGAPPPNQQPSQAAGAAGGTAASGVNFMGFSLPPGT  355
            GNVPGGFNTPG QQ      G    P     QAAGAAGG AASG +FMGFSLPPG 
Sbjct  282  GNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAGAAGGAAASGASFMGFSLPPGN  337


>Q18966_CAEEL unnamed protein product
Length=235

 Score = 142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 129/226 (57%), Gaps = 15/226 (7%)

Query  1    MSVNTAHANNG--VLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNN  58
            MS+NTA+  +G  VL++ GE I++ +  V M     ++   +G + G IYLTSHR+IF  
Sbjct  1    MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIFM-  59

Query  59   KKSSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAI  118
                D ++SF  PF ++ DV + QP+FGANY+ G   A   G   GEVK+++ F  GG I
Sbjct  60   PDPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCI  119

Query  119  EYGQALLRSAKTAMNNYHRGGLAGDDPPPYQ-PAGAWNEAPPPAYQPPP--GYYGWLPQH  175
            E+GQ+LL++ + A+          + PP Y  P G +  APP  YQP P  G  G+ P  
Sbjct  120  EFGQSLLQAVERAVRMRPE-----NAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTT  174

Query  176  DAF-SGPAPNTVFMSDNPPPYPGIAP---PAPYQQPAQPQQPQAPP  217
            D+F   P P+ VFMS  PPPYPGI P   P P ++     Q +APP
Sbjct  175  DSFPDQPNPSRVFMSSAPPPYPGIGPERGPHPTEELHVAGQFEAPP  220



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016374.1 WW domain-binding protein 2 isoform X4 [Drosophila
kikkawai]

Length=355
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU19_DROME  unnamed protein product                                 410     4e-143
Q18966_CAEEL  unnamed protein product                                 142     2e-40 


>Q9VU19_DROME unnamed protein product
Length=384

 Score = 410 bits (1054),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 286/355 (81%), Positives = 295/355 (83%), Gaps = 20/355 (6%)

Query  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNNKK  60
            MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQD+PIFKGSK GRIYLTSHRMIFN+KK
Sbjct  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKK  60

Query  61   SSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120
            SSD+MQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY
Sbjct  61   SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120

Query  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGAWNEAPPPAYQPPPGYYGWLPQHDAFSG  180
            GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAG+WNEAPPPAYQPPPGYYGWLPQHDAFSG
Sbjct  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSG  180

Query  181  PAPNTVFMSDNPPPYPGIAPPAPYQQPAQPQQPQAPPPSEPTWYGFSAPPPQQPQQPGYG  240
            PAPNTV+MSDNPPPYPGIAPPA    P QPQ P +   +EP WYGFSAPPPQQ       
Sbjct  181  PAPNTVYMSDNPPPYPGIAPPAHQPAPQQPQAPSS---NEPNWYGFSAPPPQQ-------  230

Query  241  QQQPGFGQQQPGYGQQQGWAGGYVQPPPYGACGPPANCPPGAPYVQPAQNYNGPPPYGGY  300
                   QQQ      QGWAGGYVQPPPY +C P  NCPP  PY  PAQ YNGP PYGGY
Sbjct  231  -------QQQQPGYGPQGWAGGYVQPPPYASCAP--NCPPQPPYAAPAQTYNGPQPYGGY  281

Query  301  GNVPGGFNTPGLQQ-PNGYPGGAPPPNQQPSQAAGAAGGTAASGVNFMGFSLPPG  354
            GNVPGGFNTPG QQ      G    P     QAAGAAGG AASG +FMGFSLPPG
Sbjct  282  GNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAAGAAGGAAASGASFMGFSLPPG  336


>Q18966_CAEEL unnamed protein product
Length=235

 Score = 142 bits (359),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 129/226 (57%), Gaps = 15/226 (7%)

Query  1    MSVNTAHANNG--VLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNN  58
            MS+NTA+  +G  VL++ GE I++ +  V M     ++   +G + G IYLTSHR+IF  
Sbjct  1    MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIFM-  59

Query  59   KKSSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAI  118
                D ++SF  PF ++ DV + QP+FGANY+ G   A   G   GEVK+++ F  GG I
Sbjct  60   PDPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCI  119

Query  119  EYGQALLRSAKTAMNNYHRGGLAGDDPPPYQ-PAGAWNEAPPPAYQPPP--GYYGWLPQH  175
            E+GQ+LL++ + A+          + PP Y  P G +  APP  YQP P  G  G+ P  
Sbjct  120  EFGQSLLQAVERAVRMRPE-----NAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTT  174

Query  176  DAF-SGPAPNTVFMSDNPPPYPGIAP---PAPYQQPAQPQQPQAPP  217
            D+F   P P+ VFMS  PPPYPGI P   P P ++     Q +APP
Sbjct  175  DSFPDQPNPSRVFMSSAPPPYPGIGPERGPHPTEELHVAGQFEAPP  220



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016375.1 WW domain-binding protein 2 isoform X5 [Drosophila
kikkawai]

Length=246
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU19_DROME  unnamed protein product                                 348     2e-120
Q18966_CAEEL  unnamed protein product                                 141     3e-41 
ALIX_DICDI  unnamed protein product                                   28.5    6.3   


>Q9VU19_DROME unnamed protein product
Length=384

 Score = 348 bits (893),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 185/191 (97%), Positives = 190/191 (99%), Gaps = 0/191 (0%)

Query  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNNKK  60
            MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQD+PIFKGSK GRIYLTSHRMIFN+KK
Sbjct  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKK  60

Query  61   SSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120
            SSD+MQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY
Sbjct  61   SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120

Query  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGAWNEAPPPAYQPPPGYYGWLPQHDAFSG  180
            GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAG+WNEAPPPAYQPPPGYYGWLPQHDAFSG
Sbjct  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSG  180

Query  181  PAPNTVFMSDN  191
            PAPNTV+MSDN
Sbjct  181  PAPNTVYMSDN  191


 Score = 69.3 bits (168),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)

Query  210  YNTPYNQGGPSGSGGGDMPPSYNNLPPSYDDASKKPH  246
            YNTPYNQGGPSGSG  D+PPSYNNLPPSYDDASKK H
Sbjct  348  YNTPYNQGGPSGSGNNDLPPSYNNLPPSYDDASKKNH  384


>Q18966_CAEEL unnamed protein product
Length=235

 Score = 141 bits (356),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 119/204 (58%), Gaps = 12/204 (6%)

Query  1    MSVNTAHANNG--VLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNN  58
            MS+NTA+  +G  VL++ GE I++ +  V M     ++   +G + G IYLTSHR+IF  
Sbjct  1    MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIFM-  59

Query  59   KKSSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAI  118
                D ++SF  PF ++ DV + QP+FGANY+ G   A   G   GEVK+++ F  GG I
Sbjct  60   PDPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCI  119

Query  119  EYGQALLRSAKTAMNNYHRGGLAGDDPPPYQ-PAGAWNEAPPPAYQPPP--GYYGWLPQH  175
            E+GQ+LL++ + A+          + PP Y  P G +  APP  YQP P  G  G+ P  
Sbjct  120  EFGQSLLQAVERAVRMRPE-----NAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTT  174

Query  176  DAF-SGPAPNTVFMSDNPPPYPGI  198
            D+F   P P+ VFMS  PPPYPGI
Sbjct  175  DSFPDQPNPSRVFMSSAPPPYPGI  198


>ALIX_DICDI unnamed protein product
Length=794

 Score = 28.5 bits (62),  Expect = 6.3, Method: Composition-based stats.
 Identities = 17/49 (35%), Positives = 21/49 (43%), Gaps = 15/49 (31%)

Query  160  PAYQPPP-------------GYYGWLPQHDAFSGPAPNTVFMSDNPPPY  195
            P+ QPPP              + G LP   +FS P P   F +  PPPY
Sbjct  741  PSSQPPPQYSYNPQPYQPPQQFGGPLPPPQSFSAPPPPQSFTA--PPPY  787



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016376.1 WW domain-binding protein 2 isoform X6 [Drosophila
kikkawai]

Length=228
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU19_DROME  unnamed protein product                                 398     3e-140
Q18966_CAEEL  unnamed protein product                                 140     5e-41 
ALIX_DICDI  unnamed protein product                                   29.6    2.7   


>Q9VU19_DROME unnamed protein product
Length=384

 Score = 398 bits (1022),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/199 (96%), Positives = 197/199 (99%), Gaps = 0/199 (0%)

Query  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNNKK  60
            MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQD+PIFKGSK GRIYLTSHRMIFN+KK
Sbjct  1    MSVNTAHANNGVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKK  60

Query  61   SSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120
            SSD+MQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY
Sbjct  61   SSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEY  120

Query  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGAWNEAPPPAYQPPPGYYGWLPQHDAFSG  180
            GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAG+WNEAPPPAYQPPPGYYGWLPQHDAFSG
Sbjct  121  GQALLRSAKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSG  180

Query  181  PAPNTVFMSDNPPPYPGIV  199
            PAPNTV+MSDNPPPYPGI 
Sbjct  181  PAPNTVYMSDNPPPYPGIA  199


>Q18966_CAEEL unnamed protein product
Length=235

 Score = 140 bits (352),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 119/204 (58%), Gaps = 12/204 (6%)

Query  1    MSVNTAHANNG--VLIHAGEYILLHSDSVSMEFSGQDSPIFKGSKAGRIYLTSHRMIFNN  58
            MS+NTA+  +G  VL++ GE I++ +  V M     ++   +G + G IYLTSHR+IF  
Sbjct  1    MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIFM-  59

Query  59   KKSSDAMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAI  118
                D ++SF  PF ++ DV + QP+FGANY+ G   A   G   GEVK+++ F  GG I
Sbjct  60   PDPGDWLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCI  119

Query  119  EYGQALLRSAKTAMNNYHRGGLAGDDPPPYQ-PAGAWNEAPPPAYQPPP--GYYGWLPQH  175
            E+GQ+LL++ + A+          + PP Y  P G +  APP  YQP P  G  G+ P  
Sbjct  120  EFGQSLLQAVERAVRMRPE-----NAPPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTT  174

Query  176  DAF-SGPAPNTVFMSDNPPPYPGI  198
            D+F   P P+ VFMS  PPPYPGI
Sbjct  175  DSFPDQPNPSRVFMSSAPPPYPGI  198


>ALIX_DICDI unnamed protein product
Length=794

 Score = 29.6 bits (65),  Expect = 2.7, Method: Composition-based stats.
 Identities = 17/49 (35%), Positives = 21/49 (43%), Gaps = 15/49 (31%)

Query  160  PAYQPPP-------------GYYGWLPQHDAFSGPAPNTVFMSDNPPPY  195
            P+ QPPP              + G LP   +FS P P   F +  PPPY
Sbjct  741  PSSQPPPQYSYNPQPYQPPQQFGGPLPPPQSFSAPPPPQSFTA--PPPY  787



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016377.1 uncharacterized protein LOC108070425 isoform X7
[Drosophila kikkawai]

Length=207
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q386J2_TRYB2  unnamed protein product                                 28.1    6.8  


>Q386J2_TRYB2 unnamed protein product
Length=1650

 Score = 28.1 bits (61),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (54%), Gaps = 6/63 (10%)

Query  49    VVRPRIARQELRMCSRPRTTM---DLRRMVVM--VMCPVDSTRRDFSSRMVIRVEHHHQI  103
             +VR  + RQ+   C+ P TT+   DLR+  V   +  PVD TR  F+ R+V ++     +
Sbjct  1152  IVRSYL-RQQHEKCTNPITTLPQFDLRKGHVYYPLDAPVDQTRNAFNRRLVQKMGLDFSL  1210

Query  104   SSR  106
              +R
Sbjct  1211  RTR  1213



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016378.1 vacuolar protein sorting-associated protein 13D
isoform X1 [Drosophila kikkawai]

Length=3939
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VP13D_DROME  unnamed protein product                                  7143    0.0  
VP13C_DICDI  unnamed protein product                                  140     3e-32
VPS13_DROME  unnamed protein product                                  135     8e-31


>VP13D_DROME unnamed protein product
Length=3919

 Score = 7143 bits (18534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 3491/3948 (88%), Positives = 3706/3948 (94%), Gaps = 38/3948 (1%)

Query  1     MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGS  60
             MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGS
Sbjct  1     MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGS  60

Query  61    IRKIKLQIPVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEKQQDLEYKLAVLDTAEAG  120
             IRKIKLQIPVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEK QDLEYKLAVLDTAEAG
Sbjct  61    IRKIKLQIPVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEKLQDLEYKLAVLDTAEAG  120

Query  121   WRSEKGKQMESYYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVETGKSKICTG  180
             WRSEKGKQMESYYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIV+TGKSKICTG
Sbjct  121   WRSEKGKQMESYYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVDTGKSKICTG  180

Query  181   IRIGSLTAQSCDCDWTNGSYKMNNSEMNYKLVELKELSVYWDLLHDDIKCQSYSNQEILE  240
             I+IGSLTAQSCDCDWTNGSYKMNN+EMNYKLVELKELSVYWDLLH+DIKCQSYSNQEILE
Sbjct  181   IKIGSLTAQSCDCDWTNGSYKMNNNEMNYKLVELKELSVYWDLLHEDIKCQSYSNQEILE  240

Query  241   KMHSTCELRPHNFIIKPICATARWKRDKCQQVIRTKDKPRVSCELLVPEVVIDISKVQRV  300
             KMHSTCELR HNFIIKPICATARWKRDKCQQVIRTKDKPRVSCELLVPEVVIDISKVQR+
Sbjct  241   KMHSTCELRSHNFIIKPICATARWKRDKCQQVIRTKDKPRVSCELLVPEVVIDISKVQRL  300

Query  301   QMLDKLSEVRHVREVRQYRLRRPNCSVALNPSQWWRYAVACHGFDFKSNEEKWATLKENL  360
             QMLDKLSE+R V+EVRQYRL+RP C+V  NP  WW+YA  CHGFDFK NEEKW  LKENL
Sbjct  301   QMLDKLSEIRQVKEVRQYRLKRPTCTVESNPIAWWKYATICHGFDFKKNEEKWLMLKENL  360

Query  361   RYMLLYKTIILNPNENLSSDDKEFKAYIEGDRNITDLTVMRRISFEKVFTKGFSFESQDV  420
             RYMLLYK+IILNPNENLS+ DKEFKAYIE DR I+DLT+MRRI FEKVFTKGF+FESQ+ 
Sbjct  361   RYMLLYKSIILNPNENLSAADKEFKAYIESDRKISDLTIMRRICFEKVFTKGFAFESQNE  420

Query  421   KGKNMLFHWFPNWMGWYANSPSTPNGEQDESLKHLEDDILVALENSLQNSSDLKSDAVFG  480
             +GKNMLFHWFPNWMGWYANSPSTPN EQDESLKHLEDDILVALENSLQNSSDLKSDAVFG
Sbjct  421   QGKNMLFHWFPNWMGWYANSPSTPNNEQDESLKHLEDDILVALENSLQNSSDLKSDAVFG  480

Query  481   HFSIKLLKGLIILQTDERLCDERSKSMEMQFNNFSAYLQLSPQLTSYTVGVSLQEIYLID  540
             HFSIKLLKGL+ILQT+++L D R+KSMEMQFNNFSAYLQLSPQLTSYTVG+SLQE+YLID
Sbjct  481   HFSIKLLKGLVILQTEDKLNDGRNKSMEMQFNNFSAYLQLSPQLTSYTVGISLQEVYLID  540

Query  541   KTSLDTMHSYLIKPQTGS------VTKSVPLEEDILFQLQYENCNHLRFQLNIKSKGLDL  594
             KTS DTMH+YLIKPQTG+      + K+  L+EDILFQLQYENCNHLRFQLNIKSKGLDL
Sbjct  541   KTSSDTMHNYLIKPQTGNTATPNQLVKNAALQEDILFQLQYENCNHLRFQLNIKSKGLDL  600

Query  595   TYNEDAIQWLFDFLADSSPEKYTPRDRVEEKTDFMKNWNQMFSGNEVNRKTWMFEIEIFA  654
              YNEDAIQWL DFLADS+  KY+PR+RV +KTDFMKNWN+MFSGNEVNRK WMFEIEIFA
Sbjct  601   IYNEDAIQWLLDFLADSNSFKYSPRNRVAKKTDFMKNWNEMFSGNEVNRKIWMFEIEIFA  660

Query  655   PRIIFLENYKVTNSLMVLLDFGKLEMRKMEVKRTIPVIESAVTDSNQSDDDETYLTPCST  714
             PRIIFLENYKV+NSLMVLLDFGKLEMRKMEVKR IPVIESAVT+ N SDDDETYLTPCST
Sbjct  661   PRIIFLENYKVSNSLMVLLDFGKLEMRKMEVKRVIPVIESAVTE-NTSDDDETYLTPCST  719

Query  715   PPASEKSGSESPTLLENPTLEEGFLNKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEER  774
             PPASEKSGSESPTLLENP   E FLNKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEER
Sbjct  720   PPASEKSGSESPTLLENPK-TESFLNKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEER  778

Query  775   WQACLKTSSNFHLIDKFNINLTLEQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCC  834
             WQACLKTSSNFHLIDKFNINLTLEQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCC
Sbjct  779   WQACLKTSSNFHLIDKFNINLTLEQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCC  838

Query  835   NIMRPIIKASREMENIYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSI  894
             NIM+PIIKAS+EMENIYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSI
Sbjct  839   NIMKPIIKASKEMENIYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSI  898

Query  895   AELQIIGARAGLTKESNETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSL  954
             AELQIIGARAGLTKE +ETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSL
Sbjct  899   AELQIIGARAGLTKEPHETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSL  958

Query  955   KHSAVVSPTSPGSPNFFDRATSPHMITKAVQNIKMGDKSTEFCEDEDSQALISIDIKIVP  1014
             KHSA+VSPTSPGSPNFFDRATSPHMITKAVQNIKMGD+STEFC+DEDS ALIS+DIKIVP
Sbjct  959   KHSAIVSPTSPGSPNFFDRATSPHMITKAVQNIKMGDRSTEFCDDEDSTALISVDIKIVP  1018

Query  1015  PNQNNSAQLHTTSITFNSLDIIANQDTILEILNFAKRTLLTQNIFSSETEELRKESMLEE  1074
             PN++NS QLHTTSITFNSLDIIANQDTI+EILNFAKRTLL QNIF SE+ E  KE+   E
Sbjct  1019  PNESNSMQLHTTSITFNSLDIIANQDTIIEILNFAKRTLLAQNIFPSESPESPKEAT--E  1076

Query  1075  RPKEELDEDQVDQKTHNEIFFDFFRLNILLLYTIKRDKFNIGRKVGTVTLTEAKINASFQ  1134
              P + +  DQVD K+HNEIFFDFFRLNILLLYTIKRDKFN+GRKVGTVTLTEAKINASFQ
Sbjct  1077  APVDVV--DQVDHKSHNEIFFDFFRLNILLLYTIKRDKFNVGRKVGTVTLTEAKINASFQ  1134

Query  1135  SDLSIFGSLGGIQVIDITPEAFCHPRILSVGRDTILRTSDTNKQTVLSQLSNEIYSNNYN  1194
             SDLSI GSLGGIQVIDIT EAFCHPRILSVGRD ILR SDTNKQTVLSQLSNEIYSNNYN
Sbjct  1135  SDLSIIGSLGGIQVIDITSEAFCHPRILSVGRDQILRASDTNKQTVLSQLSNEIYSNNYN  1194

Query  1195  EEKNDDDDSDAISFQSHWSDKTTCTFHMRMASASYTHCPRFLRDVNACITYFKRSLREFA  1254
             EE    D+SDAISFQSHWSDKTTCTF MRMASASYTHCPRFLRDVNACITYFKRSLREFA
Sbjct  1195  EE-TKSDESDAISFQSHWSDKTTCTFQMRMASASYTHCPRFLRDVNACITYFKRSLREFA  1253

Query  1255  TSIGNKATDMAKEFVQQVRAVEQTGPVHPQRNRQDNWLDIIISSPIIILPISNTSTNVLI  1314
             TSIGNKATDMAKEFVQQVRAVEQ GPV+PQRNRQDNWLDIIISSPIIILPISNTSTNVLI
Sbjct  1254  TSIGNKATDMAKEFVQQVRAVEQIGPVYPQRNRQDNWLDIIISSPIIILPISNTSTNVLI  1313

Query  1315  ANLGKISCTNSVSKPSDSDDYNESYTIEIKNTYVYSLNIDESEYSFNVHPAKNKDAIPIL  1374
             ANLGKISC+N+V    DSD++NESYTIEIKNTYVYSLNIDE EYSFNVHPAKNKDAIPIL
Sbjct  1314  ANLGKISCSNAVK--CDSDEFNESYTIEIKNTYVYSLNIDEGEYSFNVHPAKNKDAIPIL  1371

Query  1375  HDTAITLPIYAGYSEDNGQEKQLNSLTIKGTMVEALKVSLNRKQYELLLECIQYATNFSN  1434
             HDTAITL +YAGYS+DN ++KQLN  +IKG+MVEALKVSLNRKQYELLLE I+YATNFSN
Sbjct  1372  HDTAITLQLYAGYSDDNDEDKQLNRFSIKGSMVEALKVSLNRKQYELLLESIRYATNFSN  1431

Query  1435  GLTSDPEDLDQNGDSEPTSSIDDEHVISTTIQFSMPVFQINLQNEFHNDLINLTFKDFNV  1494
              + ++ ++LDQNGD EPT++ID E +ISTTIQFS+PVFQINLQNE+HNDLINLTFK+FNV
Sbjct  1432  EVLNESDELDQNGDIEPTANIDAESIISTTIQFSVPVFQINLQNEYHNDLINLTFKNFNV  1491

Query  1495  KHIAKGHDKDVEVMLKSVLMEDLKSDFTSPFRNMVTSIDLEKSSKKNELTSSSCPDLPGY  1554
             KHI+KG DKDVEV+LKSVLMEDLKSD TSPFRNMVTS+DLE+  KKNE+TSSSCPDLP Y
Sbjct  1492  KHISKGFDKDVEVVLKSVLMEDLKSDLTSPFRNMVTSVDLEQKIKKNEMTSSSCPDLPSY  1551

Query  1555  CNSLKSRSSSVPSCFYDYMQLKSFSGEKKPSTFCRNSKRELGKQPRESQTLVTYKSHTGR  1614
             CNSLK+RSSSVPSCFY++MQ+K F G++K   +  ++K ELGK+ +ESQTLV YKSHTGR
Sbjct  1552  CNSLKNRSSSVPSCFYNHMQVKVFGGDQK---YTSSNKNELGKK-KESQTLVIYKSHTGR  1607

Query  1615  SAQDSKLEKSSSIQFNCLNLAICVERWYTIFDFFGLVSADNLNQNYTEEKKLVETHIDEL  1674
             SAQ+ KLE++SSIQFNCLNLAICVERWYTIFDFFGLVS DN+N+ Y EE KLVE HID++
Sbjct  1608  SAQNGKLEQTSSIQFNCLNLAICVERWYTIFDFFGLVSVDNVNEKYPEEMKLVEKHIDKV  1667

Query  1675  FSRLKVSIRSFNFTLIRNESLLSRVNVSNAVFVILQDHRSKIVEGCLGSVSVYDLTKYGN  1734
              S+LKVSIRSFNFTLIRNESLLSRVNVSNAVF+ILQD  SKIVEGCLGSVSV DLTKYGN
Sbjct  1668  CSKLKVSIRSFNFTLIRNESLLSRVNVSNAVFMILQDPYSKIVEGCLGSVSVNDLTKYGN  1727

Query  1735  IYKQKFLTSGTEALNFVYKKKLVDLEALKTLDTDSTLRINMAAVHYIHTKRFSTELHVFV  1794
             IYKQKFLTSGTEALNFVYKKKLVDLEAL TLDTDSTLRINM+AVHYIHTKRFSTELHVFV
Sbjct  1728  IYKQKFLTSGTEALNFVYKKKLVDLEALNTLDTDSTLRINMSAVHYIHTKRFSTELHVFV  1787

Query  1795  KDLLQLQTPVIRKLKKQSQSGSEQNMRPSKMKLVIQADSPVIVLPACYNRNEVIIAYLGQ  1854
             KDLLQLQTPVIRKLKK    GSEQNMRPSKMKLVIQADSPVIVLP+ YNRNEVIIAYLGQ
Sbjct  1788  KDLLQLQTPVIRKLKKH---GSEQNMRPSKMKLVIQADSPVIVLPSSYNRNEVIIAYLGQ  1844

Query  1855  FTLKNSFHLASDENIISKMTATPNPNEILDVMRIDLVNINLFSGERSSMKAKGEQEKNRI  1914
             F+LKNSFH ASD NIISKM+ATP+ +EILDVMRIDLVNINLFSGERSSMKAK +QEK+RI
Sbjct  1845  FSLKNSFHFASDNNIISKMSATPSKDEILDVMRIDLVNINLFSGERSSMKAKADQEKDRI  1904

Query  1915  VIADMNFLRLGQPFFNESCFLHLQLERNLSAEGDRVCPDISVQGTFSKLNGMVNIQQYKL  1974
             +IADMNFLRLGQPFFNESCFLHLQLERNLSA+  RVCPDISVQGTFSKL+G++NIQQYKL
Sbjct  1905  IIADMNFLRLGQPFFNESCFLHLQLERNLSADAHRVCPDISVQGTFSKLSGIINIQQYKL  1964

Query  1975  IRSFLNNNIGEQTDDIYMNYHNNSCTSIERLSTISLVQKKSEVLPRTISILISIRILLED  2034
             IRSFLNNNIGEQTDDIYMNYHNNSCTSIERLSTI+L+ K    + + +SILISIRILLED
Sbjct  1965  IRSFLNNNIGEQTDDIYMNYHNNSCTSIERLSTINLMPKNE--VSKIVSILISIRILLED  2022

Query  2035  VSLLLALNTSQSAVIEPLACIHFLKSALEIDLFSDGSQDIDLISSNILIVDERKVEAGAG  2094
             VSLLLALNTSQSA IEPLACIHFLKS LEIDLFSDGSQDIDLISSNILIVDER  E+   
Sbjct  2023  VSLLLALNTSQSAAIEPLACIHFLKSTLEIDLFSDGSQDIDLISSNILIVDERN-ESDKS  2081

Query  2095  NENMFKNILEPSKKEARIENSVQVEIHCRKKANFSKYTIMLNNMRVFALISFLDQLKSYL  2154
             NEN+FKNILEPSKKE RIENSVQVE+HCRKKA FSKYTIMLNNMRVFAL+SFLDQLKSYL
Sbjct  2082  NENVFKNILEPSKKEVRIENSVQVEVHCRKKATFSKYTIMLNNMRVFALLSFLDQLKSYL  2141

Query  2155  QEDSPAAPTVVNS--QVSQKQQVDNTVSTEFVVNITDSEIILAEECSRLDSNAIILKSTT  2212
             QEDSP AP V N+  Q++QK Q+D ++STE+VVNITDSEII AEECSRLDSNAIILKSTT
Sbjct  2142  QEDSP-APVVNNAANQIAQKPQIDTSISTEYVVNITDSEIIFAEECSRLDSNAIILKSTT  2200

Query  2213  VICYKPNSNSVPLSLDINHLEIFSCTLDAEEESALSIIDPFTLNIELRSNCLNILIQKPL  2272
             VICYKPNSN VPLSLDINHLEIFSCTLDAEEESALSIIDPFTL IELRSNCLNILIQK L
Sbjct  2201  VICYKPNSNIVPLSLDINHLEIFSCTLDAEEESALSIIDPFTLIIELRSNCLNILIQKHL  2260

Query  2273  NIRLSYVDVKLFSRMVRLLPTQTSRSKNVISKANSDLEKVAPLVAMGFELSDCLYAMQVN  2332
             NIRLSYVDVKLFSRM RLLPTQTSR KNVISKA+SDLEK APLVAMGFE+SDCLYAMQ+N
Sbjct  2261  NIRLSYVDVKLFSRMARLLPTQTSRPKNVISKADSDLEKAAPLVAMGFEISDCLYAMQIN  2320

Query  2333  NWRINDAALWLSQQKQSTYKNPALEMKTAVVDASLISVFIIDDCMDADVPLLEVSLSKFL  2392
             NWRINDAA+WLSQQKQ+TY+NPALEMKTAVVDASLISVFIIDDCMDADVPLLEVSLSKFL
Sbjct  2321  NWRINDAAIWLSQQKQNTYRNPALEMKTAVVDASLISVFIIDDCMDADVPLLEVSLSKFL  2380

Query  2393  LNYTFKTKDPNPKESNIQHFSLGNIDTEAAVNYYNRRLSGWEPVAETWESNLKWKYTKGH  2452
             LN+TF+T+DPNPKE+NI+H+SLGNIDTE +VNYYNRRLSGWEPVAETWESNL WKYTKGH
Sbjct  2381  LNFTFQTQDPNPKETNIRHYSLGNIDTEVSVNYYNRRLSGWEPVAETWESNLNWKYTKGH  2440

Query  2453  LNENKKRFEIGVSSKQMLKLNVTSTFIELFHMVLKNWTNDFNDNGAKNFRQRSPFIPFAL  2512
             L +NKKRFEIG+SSKQMLKLNVTSTFIELFHMVLKNWTNDFNDNGAKNFRQRSPFIPFAL
Sbjct  2441  L-DNKKRFEIGISSKQMLKLNVTSTFIELFHMVLKNWTNDFNDNGAKNFRQRSPFIPFAL  2499

Query  2513  QNLTGTPLLFKPIYAPLGDLSCSDLQQFELIKNWSSVQPNETKTFDFSQKSKLRHVHSHQ  2572
             QNL+GTPLLFKPIYAPLGDL+ SDLQQ ELIKNW SVQPNETKTFDFSQKSKLRHVHSHQ
Sbjct  2500  QNLSGTPLLFKPIYAPLGDLTRSDLQQVELIKNWYSVQPNETKTFDFSQKSKLRHVHSHQ  2559

Query  2573  LNLHQIFVQIHGWTLIGPISIDKVGMFFRTTNLDSQYSTKSRIVFDISLIGSAQKLIKVK  2632
             LNLHQIFVQIHGWTLIGPIS+DKVGMFFRTT LDSQ+ TKSRIVFDISLIGSAQKLIKVK
Sbjct  2560  LNLHQIFVQIHGWTLIGPISVDKVGMFFRTTKLDSQFLTKSRIVFDISLIGSAQKLIKVK  2619

Query  2633  SSLFIVNKLDRNVFLKMSLKSTQSDGLTAISVVKPNDELPLPLKFIDASLHVAHSTHSES  2692
             SSL ++NKLDRNVFLKM+LK T SDGL++ISV+KPNDEL +PLKFIDASL+VAH+T SES
Sbjct  2620  SSLGVINKLDRNVFLKMTLKGTHSDGLSSISVIKPNDELSVPLKFIDASLYVAHNT-SES  2678

Query  2693  EAYEETGFSNEEILWKLCGKDNTRQLLVSYDQNKSILYTLVNISRIIYHVKEQTLPGHLI  2752
             +AYE+TGFSNEEILWK CGKD+TRQLL  YD NKSILYT VNISR IYH KEQ LPGH I
Sbjct  2679  DAYEDTGFSNEEILWKACGKDDTRQLLAGYDTNKSILYTFVNISREIYHCKEQNLPGHKI  2738

Query  2753  TLLPPLKINNMLCCDLMFKIHEHATGRINSSESANIYNVNIYQPLNLSITLDNFQLSGQL  2812
             TLLPPLKINNMLCCDLMFKIHEHATGRINSSES NIYNVNI QPLNLSITLDNFQLSGQL
Sbjct  2739  TLLPPLKINNMLCCDLMFKIHEHATGRINSSESVNIYNVNICQPLNLSITLDNFQLSGQL  2798

Query  2813  KVPTSHTGVVETKLKLFDIKKRELHLRISIQFVKGKGMEIYISAPVWIINKTGLPLIYKQ  2872
             K+P SH GV+E KLKL DI+KRELH+R+SIQ V GKGME+YISAPVWIINKTGLPLIYKQ
Sbjct  2799  KIPVSHRGVIEPKLKLIDIQKRELHVRVSIQSVPGKGMELYISAPVWIINKTGLPLIYKQ  2858

Query  2873  EGTNNTAAGQFEEHETARQVAPLMFSFSDQEGSPALELRLGRAFGLNNTWCKSFSTHKDL  2932
             EGT++TAAGQFEEHETARQVAPLMFSFSDQEGSPAL LRLG+A+G NN WCKSFSTHKDL
Sbjct  2859  EGTSHTAAGQFEEHETARQVAPLMFSFSDQEGSPALVLRLGKAYGSNNMWCKSFSTHKDL  2918

Query  2933  THRELRAENTKGSYAIGISVRRGRGLYASTTFVTLSPRFHLHNRSGYRLEFMQLCDIVNY  2992
               R+LRAENTKGSYAIGISVRRGRGLYA TTFVTLSPRFHLHNRSGY+LEFMQLCDIVNY
Sbjct  2919  ADRDLRAENTKGSYAIGISVRRGRGLYACTTFVTLSPRFHLHNRSGYKLEFMQLCDIVNY  2978

Query  2993  DRPDPRKIISAPIDCNFAFHWPNWDQEQFICVRIPDVECCCWSKGIPINDDVQSLYINVR  3052
             DRPDPRKIISAP+DCNFAFHWPNWDQEQ ICVRIP++ECCCWSKGIPI  DVQSLYINVR
Sbjct  2979  DRPDPRKIISAPVDCNFAFHWPNWDQEQIICVRIPEIECCCWSKGIPIK-DVQSLYINVR  3037

Query  3053  NEWGDMFFLRLEIISKDATFILLFTDARTLPPPIRIDNCSEVVINFSQLRSKPVWITPVR  3112
             NEWG+MFFLRLEIISKDATFILLFTDARTLPPPIRIDNCSEVVINFSQLRSKPVWITPVR
Sbjct  3038  NEWGEMFFLRLEIISKDATFILLFTDARTLPPPIRIDNCSEVVINFSQLRSKPVWITPVR  3097

Query  3113  PQSSLSYVLDDPLGLQALLMEAPGGNMIEFPINNVNNIKKTLTYTNFIYIAFHGTFERST  3172
             PQSSLSYV+DDPLG Q LLMEAPGGNMIEFPINN NNIKKTLTYTNFIYIAF GTFER  
Sbjct  3098  PQSSLSYVMDDPLGQQILLMEAPGGNMIEFPINNKNNIKKTLTYTNFIYIAFQGTFER--  3155

Query  3173  SDEESSPHRHLVLGVRGRKVVIMEKNSGDRSQLWLMNSNGQLEHEGSTPPIQSNDANAVR  3232
             S+EE + HR LVLGVRG+KVVI+EKNSGDRSQLWLMNSNGQLEHEGSTPPIQ+NDANAVR
Sbjct  3156  SNEEENTHRQLVLGVRGKKVVIVEKNSGDRSQLWLMNSNGQLEHEGSTPPIQTNDANAVR  3215

Query  3233  LVLDLEKPPNPMEFTTLVVRTPNKQRVTTQTWRFENGRLMCHANMCVQSRY-EVGLRPNC  3291
             LVLDLEK PNPMEFT LVVRTPNKQRVTTQTWRFENGRLMCHANMCVQSR+ E GL+PN 
Sbjct  3216  LVLDLEKAPNPMEFTNLVVRTPNKQRVTTQTWRFENGRLMCHANMCVQSRFGESGLKPNY  3275

Query  3292  EAYVGRTENNSSNHQSIPIGQHIVAQKLRPGSGQLELSTRMDGPISTIEICDIKIKQNSV  3351
             EA VGRTEN +S+ + IPIGQHIVAQKLRPGSGQLELST+MDGPISTIEICDIKIKQNSV
Sbjct  3276  EAVVGRTENRASSSKQIPIGQHIVAQKLRPGSGQLELSTKMDGPISTIEICDIKIKQNSV  3335

Query  3352  FLTPDLLWMHASLNNRQITDKGKISITHEYLINVELVKGIGISIITRKPCEEIMFISLDH  3411
             FLTPDLLWMHASLNNRQITDKGK+S  HEYLINVELVKGIGISII RKPCEEIMFISLDH
Sbjct  3336  FLTPDLLWMHASLNNRQITDKGKVSFVHEYLINVELVKGIGISIIARKPCEEIMFISLDH  3395

Query  3412  IHCDISQGALENSLDLNISYIQIDNQLLDAVSQIALHTQTSSSDHDQHKNAVVLKLKMLP  3471
             I+CDI Q ALENSLDLNI+YIQIDNQLLDAVS IALHTQT S+D ++ +NAVVLKLKMLP
Sbjct  3396  INCDIVQSALENSLDLNIAYIQIDNQLLDAVSPIALHTQT-SNDLEETQNAVVLKLKMLP  3454

Query  3472  CPNKNAIIFKYLTLDLKPCTANLDEKLILKVASFLGYGKINRQNLSVQYQFENFEDKQPI  3531
              PNKNAIIFKYLTLDLKP TA+L+EKLILKVASFLGYGKINRQNLSVQYQFEN +DK P 
Sbjct  3455  SPNKNAIIFKYLTLDLKPSTASLEEKLILKVASFLGYGKINRQNLSVQYQFENTDDK-PF  3513

Query  3532  LQDMKRYYFENLSIGATQVRLSAFTSSKLPVELHETKKTLGLTLIKFEDALIELDRYSDR  3591
             LQDMKRYYFENLSIGATQVRLSAFTSSKLPVELHETKK LGLTLIKFEDALIELDRYSD+
Sbjct  3514  LQDMKRYYFENLSIGATQVRLSAFTSSKLPVELHETKKALGLTLIKFEDALIELDRYSDK  3573

Query  3592  LHFETLDVYLKEMKKHYVNQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKS  3651
             LHFET+DVY KE+KKHY+NQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKS
Sbjct  3574  LHFETMDVYRKELKKHYINQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKS  3633

Query  3652  LVKNVTHGISNSTAKLTETLSDSLGKVVLNDHDNETRQRILELQSNTSGGHLAAGLKGLG  3711
             LVKNVTHGISNSTAKLTETLSDSLGKVVL+DHDNETRQRILELQSNTSGGHLAAGLKGLG
Sbjct  3634  LVKNVTHGISNSTAKLTETLSDSLGKVVLDDHDNETRQRILELQSNTSGGHLAAGLKGLG  3693

Query  3712  FGLLGGVTSIVRHTYDGAYDGGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETS  3771
             FGLLGGVTSIVRHTYDGA   GVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETS
Sbjct  3694  FGLLGGVTSIVRHTYDGATSDGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETS  3753

Query  3772  RDTQKNTPDRKRLPRCVTGAPGGLLPLFSNRQSKGQQYLYLINHKNFSEKIISYEANLWS  3831
             RD+ +N P+RKRLPRCVTGAPGGLLPL+SNRQSKGQQYLYLIN KNFSEKIISYE NLWS
Sbjct  3754  RDSHRNAPERKRLPRCVTGAPGGLLPLYSNRQSKGQQYLYLINQKNFSEKIISYEPNLWS  3813

Query  3832  DKEARLRLLVSTEFVRIFSLVDGNPTIMLECHLCEILSCHPLITNVGTTPSTSSRTASAA  3891
             DKEARLRLLVSTE+VRIFSL D NPTIM ECH+ EILSCHP++TN GTTP+TSSR  ++A
Sbjct  3814  DKEARLRLLVSTEYVRIFSLSDANPTIMFECHVSEILSCHPVVTNAGTTPTTSSR--ASA  3871

Query  3892  CHYIEISTNLPKITRPRIRCRSEECAEAASRCINYAKSVFDEREHAVL  3939
              HYIEISTNLPKITRPRIRCRSEECAEAASRCINYAKSVFDEREHAVL
Sbjct  3872  SHYIEISTNLPKITRPRIRCRSEECAEAASRCINYAKSVFDEREHAVL  3919


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 140 bits (352),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 135/509 (27%), Positives = 221/509 (43%), Gaps = 80/509 (16%)

Query  3374  KISITHEYLINVELVKGIGISIITRKPC-EEIMFISLDHIHCDISQGALENSLDLNISYI  3432
             K+++ +E+ I++     IGISII + P  EEI+++S+D +  ++ Q  L+  +   +  +
Sbjct  3229  KLNVKYEFSIDLS---NIGISIINKIPTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDL  3285

Query  3433  QIDNQLLDAVSQIAL-------HT------QTSSSDH-------------------DQHK  3460
             QID+Q       + L       H+      Q SSS                      Q K
Sbjct  3286  QIDDQRYSTNFPVFLCQSKKINHSINQQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQK  3345

Query  3461  NAVVLKLKML-PCPNKNAIIFKYLTLDLKPCTANLDEKLILKVASFLGYGKINRQNLSVQ  3519
                 L+          N + F+Y ++ ++    NLDE  IL   SF+    IN  +L+  
Sbjct  3346  LKPFLQFSATRTLKYSNIMFFRYFSILIQEFDINLDEASILNALSFIN---INLNSLNEH  3402

Query  3520  YQFENFEDKQPILQ-------DMKRYYFENLSIGATQVRLSAFTSSKLPVELHET--KKT  3570
             +       ++ IL+       +    YFE L I   ++ LS F S K P E       ++
Sbjct  3403  FTLHPTITQEEILETKNASNIENHMVYFEMLHINPVKMNLS-FISCKSPKETQAILGARS  3461

Query  3571  LGLTLIKF---------EDALIELDRYSDRLHFETLDVYLKEMKKHYVNQVKWHAAAILG  3621
             L   LI F         E A I+ + +     F +    + E+  H+  Q+   A  I G
Sbjct  3462  LAELLIGFKSNSPFLNIERAPIKFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFG  3521

Query  3622  SVDFLGNPLGFANDLSEGVSGLIFE---GSVKS--------------LVKNVTHGISNST  3664
             S DF+GNP+  A  L  G      E   G VKS              L+ N   G ++ST
Sbjct  3522  SFDFIGNPIRLAESLGSGFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADST  3581

Query  3665  AKLTETLSDSLGKVVLNDHDNETRQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRH  3724
             +K+T T+S  L ++ L+D   + RQ   + +       L  G +  G G++ G+T I+  
Sbjct  3582  SKITGTISKGLVQLSLDDSYIKERQESNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDE  3641

Query  3725  TYDGA-YDGGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDTQK-NTPDRK  3782
              Y GA  +    GF  G+GKG++G   KP +GV DL S+T+  ++ ++   +  +   R+
Sbjct  3642  PYKGATQEKSWEGFFKGIGKGVLGVAVKPTVGVFDLVSKTSEGIKNSTTVAKSLSQIKRR  3701

Query  3783  RLPRCVTGAPGGLLPLFSNRQSKGQQYLY  3811
             R+PR       G L  ++  +S G   LY
Sbjct  3702  RIPRYFPRE--GTLSTYNQFKSIGSFILY  3728


 Score = 130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 104/408 (25%), Positives = 188/408 (46%), Gaps = 44/408 (11%)

Query  1    MLRDLITWVLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGS  60
            M+  +   VL  YLG Y+++LN   + ++ LSGE  L+++ I+K  L+SF   V V    
Sbjct  1    MVSHIAASVLTKYLGDYVDDLNKDNIKLSFLSGEAVLQDLKIKKTVLQSFLPNVIVKQAI  60

Query  61   IRKIKLQIPVRQFRTSPWCISIEGLFCII-CPKNLDNWDYEKEKQQDLEYKLAVLDTAEA  119
            I+K+ L +P +  +  P  I IEG++ +       D   Y+K+ Q + + KL + +    
Sbjct  61   IKKLSLHVPWKDLKGKPAIIKIEGIYVLAETSVEFDEQYYKKKFQDEKQAKLHIQEVLRL  120

Query  120  GWRSEKG-KQMESYYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVETGKSKIC  178
              +  K   Q  +   ++ +    +G+ +   ++DN++L I  VH RFED V   +    
Sbjct  121  NKQQLKNPHQSTTTTTTTSDESNTFGSKLLQTVVDNLQLYIDSVHIRFEDSV--NRRSFS  178

Query  179  TGIRIGSLTAQSCDCDWTNGSYKMNNSEMNYKLVELKELSVYWD-----LLHDDIKCQSY  233
             G+ + SL A+S D  W N ++  N S + +KL+ L +LS+YW+     L + +I   S 
Sbjct  179  FGVTLNSLVAESTDQTW-NPTFIKNESTIIHKLINLNQLSIYWNSNSPKLKYTNIDDLSQ  237

Query  234  SNQEILEKMHS-------------------------TCELRPHNFIIKPICATARWKRDK  268
              + +++K  S                         + E R   +II PI A  +   +K
Sbjct  238  KLKSMIKKEDSGKQQQQQQQQQGEEQDDEIEEDYFLSTESRKQQYIIDPISAKLKVVINK  297

Query  269  CQQVIRTKDKPRVSCELLVPEVVIDISKVQRVQMLDKLSEVRHVREVRQYRLRRP-NCSV  327
               +I ++  P+ +      +  I +S  Q   +   L   +   +  ++R  RP N ++
Sbjct  298  S--IIPSEVIPKYNLNFEFDKTDISLSDYQYKDITGILESFKLFEKSIEFRSARPINTTI  355

Query  328  ALNPSQWWRYAVAC--HGFDFKSNEEKWATLKENLR----YMLLYKTI  369
              +P +WW YA+ C       K   + W+ +KE L     Y+ L+K +
Sbjct  356  KQSPRKWWNYAIQCVLQKVHQKRYTQSWSYIKEFLSDKRDYIELFKKL  403


 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 85/178 (48%), Gaps = 26/178 (15%)

Query  1771  LRINMAAVHYIHTKRFSTELHVFVKDLLQLQTPVIRKLKKQSQSGSEQNMRPSKMKLV--  1828
             L+IN++++ +I  KRF+ EL +F+ ++      ++R+  K S   +   +  ++  L   
Sbjct  1401  LKINLSSIRFIFLKRFTEELRLFLNNV-----NMMREYLKSSIYSAATVISQNRSTLFYE  1455

Query  1829  IQADSPVIVLPACYNRNEVIIAYLGQFTLKNSFH--LASDENIISKMTATPNPNEILDVM  1886
             I+  +P IV+P     N++ I  LG+  +KN F   + +    I  +   P    I++ +
Sbjct  1456  IEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEKIIPTSTGEIDMILMEP---VIIENI  1512

Query  1887  RIDLVNINLFSGERSSMKAKGE------------QEKNRIVIADMNF-LRLGQPFFNE  1931
              I+  NI L SG  S +K K E            Q     +++D+N  + L  P F+E
Sbjct  1513  IIEAQNIKLLSGLNSEIK-KSENNNNNNNNSNTNQRSYGTMVSDVNVSINLKTPLFSE  1569


 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 71/347 (20%), Positives = 127/347 (37%), Gaps = 85/347 (24%)

Query  2752  ITLLPPLKINNMLCCDLMFKIHEHA----------TGRINSSESANIYNVNIYQPLNLSI  2801
             I++   + I N+L CDL ++++             +G I   +   +   +  Q + +  
Sbjct  2591  ISINTAIMIENVLACDLQYRLYHGKNKKIIGSAFFSGVIPMGKKLPVLVYDSLQDIYMEF  2650

Query  2802  TLDNFQLSGQLKVPTSHTGVVETKLKLFDIKKRELHLRISIQF---VKGKGME-IYISAP  2857
              + +FQ S    + +     V  K+K+ D     LH  + I F   ++  G   + +   
Sbjct  2651  QIYDFQWSPLCLIDSMVGLAVTDKVKIED----RLHQPLLISFDNRIQPNGSRFVTLYCE  2706

Query  2858  VWIINKTGLPLIYKQ-------EGTNNTAAGQFEE-HETARQ----------------VA  2893
              W+IN+TGLPL ++        +    T   Q E  HE+                     
Sbjct  2707  YWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHESTSMKPTDSRNWYTKEWNHPSQ  2766

Query  2894  PLMFSFSDQEGSPALELRLGRAFGL---NNTWCKSF-------------STHKDLTHREL  2937
             P MF++SD          +G  F L   ++ W   F                +D T  E 
Sbjct  2767  PFMFAYSDNS-------IVGGKFSLKIYDSNWSSPFSLISSQSSSNSNIEISEDRTDEEK  2819

Query  2938  RAENTKGS----------YAIGISVRRGRGLYASTTFVTLSPRFHLHNRSGYRLEFMQL-  2986
               +N  G+          Y + +S+      +  T  VT SP + + N + +R+ + Q  
Sbjct  2820  EIKNVIGTITKRQPLKTNYNLSVSILPSNSKFWRTKVVTFSPMYLMVNSTRFRILYQQFD  2879

Query  2987  CDIVNYDRPDPRKIISAPIDCNFAFHWPNWDQEQFICVRIPDVECCC  3033
             CD       + + II    D +  F +P+   E+ I + I D     
Sbjct  2880  CD------SNTQSIIQ---DQSLPFQFPSSRHEKLIRIGILDTSAIS  2917


 Score = 37.0 bits (84),  Expect = 0.47, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 21/125 (17%)

Query  2384  LEVSLSK--FLLNYTFKTKDP--------NPKESNIQHFSLGN-----IDTEAAVNYYNR  2428
             L +SL K  F+LN   K   P        +  +SNI  F   N     +D      Y+N+
Sbjct  2058  LSISLEKGEFILNDDHKISSPIKLLSIGVDGLKSNIFSFPQKNQIALSLDANMKAGYFNK  2117

Query  2429  RLSGWEPVAETWESNLKWKYTKGHLNENKKRFEIGVSSKQMLKLNVTSTFIELFHMVLKN  2488
              +  WEP+ E W     + +T    N  +  + +  +SK  L +N+T  FI+      + 
Sbjct  2118  NIGIWEPLIENW----GFSFTSN--NSIEGGWMVNFNSKIPLYINITKIFIDTSISTYQI  2171

Query  2489  WTNDF  2493
             W +D+
Sbjct  2172  WADDY  2176


 Score = 35.8 bits (81),  Expect = 0.98, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 39/94 (41%), Gaps = 26/94 (28%)

Query  1235  FLRDVNACITYFKRSLREFATSIGNKATDMAKEFVQQVRAVEQTGPVHPQRNRQDNWLDI  1294
             FL +VN    Y K S+   AT I                           +NR   + +I
Sbjct  1423  FLNNVNMMREYLKSSIYSAATVIS--------------------------QNRSTLFYEI  1456

Query  1295  IISSPIIILPISNTSTNVLIANLGKISCTNSVSK  1328
              I +P I++P+S+ S  + I +LGKI+  N   K
Sbjct  1457  EIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEK  1490


 Score = 34.3 bits (77),  Expect = 3.2, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (4%)

Query  3084  PPIRIDNCSEVVINFSQLRSKPVWITPVRPQSSLSYVLDDPLGLQALLMEAPGG  3137
             PP RI+N +   +   Q +++ +W   V+P++S+ Y  D P+  + L++E P G
Sbjct  3086  PPYRINNKTRFPLWIRQKKTE-IW-DKVQPKTSIPYAWDHPILPKKLIIEFPTG  3137


>VPS13_DROME unnamed protein product
Length=3321

 Score = 135 bits (339),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 96/344 (28%), Positives = 176/344 (51%), Gaps = 32/344 (9%)

Query  9    VLNTYLGKYLENLNSAQLSVALLSGEVELENIPIRKDALRSFNLPVEVTAGSIRKIKLQI  68
            VLN  LG Y+ENL+  QL + +  G+V L+N+ IR++AL   +LPV++  G + K+ L+I
Sbjct  10   VLNKVLGDYIENLDRNQLKIGIWGGDVVLQNLKIRENALDELDLPVQLIYGYLGKLVLKI  69

Query  69   PVRQFRTSPWCISIEGLFCIICPKNLDNWDYEKEKQQDLEYKLAVLDTAEAGWRSEKGKQ  128
            P +   + P  ++IE L+ ++ P N   ++ EKE + +++ K A LD  EA  + E   +
Sbjct  70   PWKNLYSQPVIVNIEDLYVLVSPNNNVQYNAEKEAKYEMDLKKAALDALEAARKKE--LE  127

Query  129  MESYYFSSYNNWLKYGTNMATNIIDNIELKISDVHFRFEDIVETGKSKICTGIRIGSLTA  188
            M+     +      +   +   I++N++++I++VH R+ED   TG S    GI +  L  
Sbjct  128  MDQPKADA-----GFAEKLTAQIVNNLQVQITNVHLRYEDTTTTG-SPFSFGISLHELEL  181

Query  189  QSCDCDWTNGSYKMNNSEMNYKLVELKELSVYWDLLHDDIKC--QSYSN------QEILE  240
             + DCDW    Y    +   +K+  L  LS Y       + C  Q Y+N      Q+   
Sbjct  182  YTTDCDWEK-CYMAQQASQVFKIANLSCLSAY-------LNCGGQLYANNKSDLSQQF--  231

Query  241  KMHSTC-ELRP-HNFIIKPICATARWKRDKCQQVIRTK-DKPRVSCELLVPEVVIDISKV  297
            K +  C E +P +N+++ PI   A+ K +   ++     +KP++   L + ++ + ++  
Sbjct  232  KTNIACKETKPNYNYVLGPISCNAKLKLNMNPELDDPPFEKPKIDLTLEMEKLNVGLTNT  291

Query  298  QRVQMLDKLSEVRHVREVR-QYRLRRP-NCSVALNPSQWWRYAV  339
            Q   ++ KL +  + +++   YR  RP N     +   WW +A+
Sbjct  292  QFDNLM-KLGDAMNRQQLGIPYRKYRPYNIPYKGHARDWWHFAI  334


 Score = 130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 111/415 (27%), Positives = 178/415 (43%), Gaps = 45/415 (11%)

Query  3421  LENSLDLNISYIQIDNQLLDAVSQIALHT---QTSSSDHDQHKNAVVLKLKMLPCPNKNA  3477
              ++ L + I+ IQ+DNQ LD +  + L       S +     K  +   +     PN   
Sbjct  2779  FQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNSTV  2838

Query  3478  IIFKYLTLDLKPCTANLDEKLILKVASFLG-------YGKINRQNL-SVQYQFENFEDKQ  3529
               FKY  + ++     +D   +  +A             K  RQ++ S++     F ++ 
Sbjct  2839  RQFKYARILIQEFLFKVDLNFLTAIAEMFAKEVSDEAAAKQFRQDVESIELPLSAFFEEH  2898

Query  3530  PILQDMKRYYFENLSIGATQVRLS---AFTSSK-LPVELHETKKTLGLTLIKFEDALIEL  3585
               L++ K +Y +NL +G  ++ +S   A + +K LP  L    + +G+TL    D +  L
Sbjct  2899  S-LEEQKSFY-DNLHLGPLKIHVSFSMAGSDTKALPGFLGSLVQGVGVTLTDVNDVVFRL  2956

Query  3586  DRYSDRLHFETLDVYLKEMKKHYVNQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIF  3645
               +     F +    + E+  HY  Q       ++  +D LGNP G    L +GV  L +
Sbjct  2957  AFFEREYQFFSQKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVEDLFY  3016

Query  3646  EG-----------------SVKSLVKNVTHGISNSTAKLTETLSDSLGKVVLN-DHDNET  3687
             E                   VKSL  +   G + + +K+T  +   L  +  + D+  + 
Sbjct  3017  EPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKR  3076

Query  3688  RQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRHTYDGAYDGGVPGFLSGLGKGLVG  3747
             RQ I     N   G LA   KGL  G + GVT +V     GA D GV GF  GLGKG +G
Sbjct  3077  RQGIQNKPKNFHEG-LARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIG  3135

Query  3748  TVTKPIIGVLDLASETASAVR---ETSRDTQKNTPDRKR------LPRCVTGAPG  3793
              V +P  GV+D AS +  AV+   + S D ++  P R +       P C+  A G
Sbjct  3136  LVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATG  3190


 Score = 39.3 bits (90),  Expect = 0.11, Method: Compositional matrix adjust.
 Identities = 70/332 (21%), Positives = 131/332 (39%), Gaps = 31/332 (9%)

Query  1664  KKLVETHIDELFS-RLKVSIRSFNFTLIRNESLLSRVNVSNAVFVILQDHRSKIVEGCLG  1722
             KK   TH+ E    R+  ++      L   +  ++ +NV   V  ++       V   L 
Sbjct  1085  KKTRRTHVVETVKVRVIANLDQVGLVLTGRKRPIAEMNVKKFVSSLIIKSSYTEVNIGLK  1144

Query  1723  SVSVYDLTKYGNIYKQKFLTSGTEALN---FVYKKKLVDLEALKTLDTDSTLRINMAAVH  1779
              + V DL  Y  I+K      G +A N    +Y K+    E       D  + +++  + 
Sbjct  1145  DIQVLDLNPY-TIHKNILSIVGKDAFNCQIVIYNKE----ETQDYNSDDMKITVDIGCMK  1199

Query  1780  YIHTKRFSTELHVFVKDLLQLQTPVIRKLKKQSQSGSEQNM----RPSKMKLVIQADSPV  1835
              I    F   +  F+ +    Q  + +     ++S  ++ M      ++MKL I+  +P+
Sbjct  1200  IIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYETATRMKLNIRIKAPI  1259

Query  1836  IVLP-ACYNRNEVIIAYLGQFTLKNSFHLASDENIISKMTATPNPNEI-LDVMRIDLVNI  1893
             I++P    +RN +++         N+  +A  E    ++      +EI L +  + +  I
Sbjct  1260  IIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEE--ERLAVI---DEIKLQICDVKISKI  1314

Query  1894  NLFSGERSSMKAKGEQEKNRIVIADMNFLRLGQPFFNESCFLHLQLERNLSAEGDRVCPD  1953
              L  G  S++           V A++ FL         SC   L + RNLS    R  P+
Sbjct  1315  VLLDGNESTVDE---------VDAEVGFLSKFNMMNPMSC--TLSITRNLSYTWYRDVPE  1363

Query  1954  ISVQGTFSKLNGMVNIQQYKLIRSFLNNNIGE  1985
             +++ G    +   +    Y L+   LN N+ E
Sbjct  1364  LNLSGRLKSIELTLFADDYALVMLVLNRNLNE  1395


 Score = 36.2 bits (82),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 113/537 (21%), Positives = 204/537 (38%), Gaps = 127/537 (24%)

Query  740   NKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEERWQACL--KTSSNFHLIDKFNINLTL  797
             +K+  L+ V+ N  YD++ +   ++Q+LV +  E WQ  L    S+  H++   ++ +T 
Sbjct  706   DKDEILKTVMENA-YDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVT-  763

Query  798   EQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIMRPII------KASREMENIY  851
                 +   DP  P+  +    P IL++ +E+ I     +   I        ASR  +   
Sbjct  764   AALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEPASRLTQTNS  823

Query  852   RGGNTI--YASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTER--SIAELQIIGARAGLT  907
             R   +I  + ++ +K +          +  +   +I+  S +   S+ E+  +     L 
Sbjct  824   RSSMSISNFINKEVKKIGPSASGSSASKDPLLDEIIQYTSLDVNFSLGEINFV-----LF  878

Query  908   KESNETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHS-AVVSPTSPG  966
             + S +   S  V       +I+   PD ++L +         L+ +++     + PT P 
Sbjct  879   QSSRKCETSPDV-------SIEFLTPDGDVLPS--------QLTENIQEPIEELPPTPPQ  923

Query  967   SPNFFD-RATSPHMITK---AVQNIKMGDKSTEF--CEDEDSQALISIDIKIVPPNQNNS  1020
                  D R    H ++K   +V  +K+GD +     C+D D   L   D+   P  +N+S
Sbjct  924   QILSIDIRRLEAHFVSKTYESVATVKLGDINLRQYDCQDSDMDVL---DVIYTPKQENSS  980

Query  1021  AQLHTTSIT-----------------------FNSLDIIANQDT---ILEILNFAKRTL-  1053
               L T S T                       F  L I+ +Q+    I+E++N  +R L 
Sbjct  981   NYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLD  1040

Query  1054  ----------------------LTQNIFSSETEELRKESMLEERPKEELDEDQVDQKTHN  1091
                                    T N+   +TEE+     ++ R K       V +    
Sbjct  1041  LVLSSTRPRDRMGSIGGGDGIKRTLNVILEDTEEIMTTDQMKRRKKTR--RTHVVETVKV  1098

Query  1092  EIFFDFFRLNILLLYTIKRDKFNIGRKVGTVTLTEAKINASF---QSDLSIFGSLGGIQV  1148
              +  +  ++ ++L           GRK     +   K  +S     S   +   L  IQV
Sbjct  1099  RVIANLDQVGLVL----------TGRKRPIAEMNVKKFVSSLIIKSSYTEVNIGLKDIQV  1148

Query  1149  IDITPEAFCHPRILS-VGRDTILRTSDTNKQTVLSQLSNEIYSNNYNEEKNDDDDSD  1204
             +D+ P    H  ILS VG+D        N Q V+           YN+E+  D +SD
Sbjct  1149  LDLNPYTI-HKNILSIVGKDAF------NCQIVI-----------YNKEETQDYNSD  1187


 Score = 35.8 bits (81),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  2856  APVWIINKTGLPLIYKQEGTNNTAAGQFEEHETARQVAPLMFSFSDQ  2902
             +P W+INKTG+ L YK E T+        E+       P++F+F D+
Sbjct  2355  SPFWMINKTGMMLTYKSETTSVEVLYHPPEYS-----GPILFTFRDK  2396



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016379.1 vacuolar protein sorting-associated protein 13D
isoform X2 [Drosophila kikkawai]

Length=3270
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

VP13D_DROME  unnamed protein product                                  5868    0.0  
VP13C_DICDI  unnamed protein product                                  140     3e-32
VPS13_DROME  unnamed protein product                                  129     4e-29


>VP13D_DROME unnamed protein product
Length=3919

 Score = 5868 bits (15223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 2888/3273 (88%), Positives = 3068/3273 (94%), Gaps = 32/3273 (1%)

Query  1     MVLLDFGKLEMRKMEVKRTIPVIESAVTDSNQSDDDETYLTPCSTPPASEKSGSESPTLL  60
             MVLLDFGKLEMRKMEVKR IPVIESAVT+ N SDDDETYLTPCSTPPASEKSGSESPTLL
Sbjct  676   MVLLDFGKLEMRKMEVKRVIPVIESAVTE-NTSDDDETYLTPCSTPPASEKSGSESPTLL  734

Query  61    ENPTLEEGFLNKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEERWQACLKTSSNFHLID  120
             ENP   E FLNKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEERWQACLKTSSNFHLID
Sbjct  735   ENPK-TESFLNKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEERWQACLKTSSNFHLID  793

Query  121   KFNINLTLEQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIMRPIIKASREMEN  180
             KFNINLTLEQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIM+PIIKAS+EMEN
Sbjct  794   KFNINLTLEQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIMKPIIKASKEMEN  853

Query  181   IYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSIAELQIIGARAGLTKE  240
             IYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSIAELQIIGARAGLTKE
Sbjct  854   IYRGGNTIYASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTERSIAELQIIGARAGLTKE  913

Query  241   SNETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHSAVVSPTSPGSPN  300
              +ETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHSA+VSPTSPGSPN
Sbjct  914   PHETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHSAIVSPTSPGSPN  973

Query  301   FFDRATSPHMITKAVQNIKMGDKSTEFCEDEDSQALISIDIKIVPPNQNNSAQLHTTSIT  360
             FFDRATSPHMITKAVQNIKMGD+STEFC+DEDS ALIS+DIKIVPPN++NS QLHTTSIT
Sbjct  974   FFDRATSPHMITKAVQNIKMGDRSTEFCDDEDSTALISVDIKIVPPNESNSMQLHTTSIT  1033

Query  361   FNSLDIIANQDTILEILNFAKRTLLTQNIFSSETEELRKESMLEERPKEELDEDQVDQKT  420
             FNSLDIIANQDTI+EILNFAKRTLL QNIF SE+ E  KE+   E P + +D  QVD K+
Sbjct  1034  FNSLDIIANQDTIIEILNFAKRTLLAQNIFPSESPESPKEAT--EAPVDVVD--QVDHKS  1089

Query  421   HNEIFFDFFRLNILLLYTIKRDKFNIGRKVGTVTLTEAKINASFQSDLSIFGSLGGIQVI  480
             HNEIFFDFFRLNILLLYTIKRDKFN+GRKVGTVTLTEAKINASFQSDLSI GSLGGIQVI
Sbjct  1090  HNEIFFDFFRLNILLLYTIKRDKFNVGRKVGTVTLTEAKINASFQSDLSIIGSLGGIQVI  1149

Query  481   DITPEAFCHPRILSVGRDTILRTSDTNKQTVLSQLSNEIYSNNYNEEKNDDDDSDAISFQ  540
             DIT EAFCHPRILSVGRD ILR SDTNKQTVLSQLSNEIYSNNYNEE    D+SDAISFQ
Sbjct  1150  DITSEAFCHPRILSVGRDQILRASDTNKQTVLSQLSNEIYSNNYNEE-TKSDESDAISFQ  1208

Query  541   SHWSDKTTCTFHMRMASASYTHCPRFLRDVNACITYFKRSLREFATSIGNKATDMAKEFV  600
             SHWSDKTTCTF MRMASASYTHCPRFLRDVNACITYFKRSLREFATSIGNKATDMAKEFV
Sbjct  1209  SHWSDKTTCTFQMRMASASYTHCPRFLRDVNACITYFKRSLREFATSIGNKATDMAKEFV  1268

Query  601   QQVRAVEQTGPVHPQRNRQDNWLDIIISSPIIILPISNTSTNVLIANLGKISCTNSVSKP  660
             QQVRAVEQ GPV+PQRNRQDNWLDIIISSPIIILPISNTSTNVLIANLGKISC+N+V   
Sbjct  1269  QQVRAVEQIGPVYPQRNRQDNWLDIIISSPIIILPISNTSTNVLIANLGKISCSNAVK--  1326

Query  661   SDSDDYNESYTIEIKNTYVYSLNIDESEYSFNVHPAKNKDAIPILHDTAITLPIYAGYSE  720
              DSD++NESYTIEIKNTYVYSLNIDE EYSFNVHPAKNKDAIPILHDTAITL +YAGYS+
Sbjct  1327  CDSDEFNESYTIEIKNTYVYSLNIDEGEYSFNVHPAKNKDAIPILHDTAITLQLYAGYSD  1386

Query  721   DNGQEKQLNSLTIKGTMVEALKVSLNRKQYELLLECIQYATNFSNGLTSDPEDLDQNGDS  780
             DN ++KQLN  +IKG+MVEALKVSLNRKQYELLLE I+YATNFSN + ++ ++LDQNGD 
Sbjct  1387  DNDEDKQLNRFSIKGSMVEALKVSLNRKQYELLLESIRYATNFSNEVLNESDELDQNGDI  1446

Query  781   EPTSSIDDEHVISTTIQFSMPVFQINLQNEFHNDLINLTFKDFNVKHIAKGHDKDVEVML  840
             EPT++ID E +ISTTIQFS+PVFQINLQNE+HNDLINLTFK+FNVKHI+KG DKDVEV+L
Sbjct  1447  EPTANIDAESIISTTIQFSVPVFQINLQNEYHNDLINLTFKNFNVKHISKGFDKDVEVVL  1506

Query  841   KSVLMEDLKSDFTSPFRNMVTSIDLEKSSKKNELTSSSCPDLPGYCNSLKSRSSSVPSCF  900
             KSVLMEDLKSD TSPFRNMVTS+DLE+  KKNE+TSSSCPDLP YCNSLK+RSSSVPSCF
Sbjct  1507  KSVLMEDLKSDLTSPFRNMVTSVDLEQKIKKNEMTSSSCPDLPSYCNSLKNRSSSVPSCF  1566

Query  901   YDYMQLKSFSGEKKPSTFCRNSKRELGKQPRESQTLVTYKSHTGRSAQDSKLEKSSSIQF  960
             Y++MQ+K F G++K   +  ++K ELGK+ +ESQTLV YKSHTGRSAQ+ KLE++SSIQF
Sbjct  1567  YNHMQVKVFGGDQK---YTSSNKNELGKK-KESQTLVIYKSHTGRSAQNGKLEQTSSIQF  1622

Query  961   NCLNLAICVERWYTIFDFFGLVSADNLNQNYTEEKKLVETHIDELFSRLKVSIRSFNFTL  1020
             NCLNLAICVERWYTIFDFFGLVS DN+N+ Y EE KLVE HID++ S+LKVSIRSFNFTL
Sbjct  1623  NCLNLAICVERWYTIFDFFGLVSVDNVNEKYPEEMKLVEKHIDKVCSKLKVSIRSFNFTL  1682

Query  1021  IRNESLLSRVNVSNAVFVILQDHRSKIVEGCLGSVSVYDLTKYGNIYKQKFLTSGTEALN  1080
             IRNESLLSRVNVSNAVF+ILQD  SKIVEGCLGSVSV DLTKYGNIYKQKFLTSGTEALN
Sbjct  1683  IRNESLLSRVNVSNAVFMILQDPYSKIVEGCLGSVSVNDLTKYGNIYKQKFLTSGTEALN  1742

Query  1081  FVYKKKLVDLEALKTLDTDSTLRINMAAVHYIHTKRFSTELHVFVKDLLQLQTPVIRKLK  1140
             FVYKKKLVDLEAL TLDTDSTLRINM+AVHYIHTKRFSTELHVFVKDLLQLQTPVIRKLK
Sbjct  1743  FVYKKKLVDLEALNTLDTDSTLRINMSAVHYIHTKRFSTELHVFVKDLLQLQTPVIRKLK  1802

Query  1141  KQSQSGSEQNMRPSKMKLVIQADSPVIVLPACYNRNEVIIAYLGQFTLKNSFHLASDENI  1200
             K    GSEQNMRPSKMKLVIQADSPVIVLP+ YNRNEVIIAYLGQF+LKNSFH ASD NI
Sbjct  1803  KH---GSEQNMRPSKMKLVIQADSPVIVLPSSYNRNEVIIAYLGQFSLKNSFHFASDNNI  1859

Query  1201  ISKMTATPNPNEILDVMRIDLVNINLFSGERSSMKAKGEQEKNRIVIADMNFLRLGQPFF  1260
             ISKM+ATP+ +EILDVMRIDLVNINLFSGERSSMKAK +QEK+RI+IADMNFLRLGQPFF
Sbjct  1860  ISKMSATPSKDEILDVMRIDLVNINLFSGERSSMKAKADQEKDRIIIADMNFLRLGQPFF  1919

Query  1261  NESCFLHLQLERNLSAEGDRVCPDISVQGTFSKLNGMVNIQQYKLIRSFLNNNIGEQTDD  1320
             NESCFLHLQLERNLSA+  RVCPDISVQGTFSKL+G++NIQQYKLIRSFLNNNIGEQTDD
Sbjct  1920  NESCFLHLQLERNLSADAHRVCPDISVQGTFSKLSGIINIQQYKLIRSFLNNNIGEQTDD  1979

Query  1321  IYMNYHNNSCTSIERLSTISLVQKKSEVLPRTISILISIRILLEDVSLLLALNTSQSAVI  1380
             IYMNYHNNSCTSIERLSTI+L+ K    + + +SILISIRILLEDVSLLLALNTSQSA I
Sbjct  1980  IYMNYHNNSCTSIERLSTINLMPKNE--VSKIVSILISIRILLEDVSLLLALNTSQSAAI  2037

Query  1381  EPLACIHFLKSALEIDLFSDGSQDIDLISSNILIVDERKVEAGAGNENMFKNILEPSKKE  1440
             EPLACIHFLKS LEIDLFSDGSQDIDLISSNILIVDER  E+   NEN+FKNILEPSKKE
Sbjct  2038  EPLACIHFLKSTLEIDLFSDGSQDIDLISSNILIVDERN-ESDKSNENVFKNILEPSKKE  2096

Query  1441  ARIENSVQVEIHCRKKANFSKYTIMLNNMRVFALISFLDQLKSYLQEDSPAAPTVVNS--  1498
              RIENSVQVE+HCRKKA FSKYTIMLNNMRVFAL+SFLDQLKSYLQEDSPA P V N+  
Sbjct  2097  VRIENSVQVEVHCRKKATFSKYTIMLNNMRVFALLSFLDQLKSYLQEDSPA-PVVNNAAN  2155

Query  1499  QVSQKQQVDNTVSTEFVVNITDSEIILAEECSRLDSNAIILKSTTVICYKPNSNSVPLSL  1558
             Q++QK Q+D ++STE+VVNITDSEII AEECSRLDSNAIILKSTTVICYKPNSN VPLSL
Sbjct  2156  QIAQKPQIDTSISTEYVVNITDSEIIFAEECSRLDSNAIILKSTTVICYKPNSNIVPLSL  2215

Query  1559  DINHLEIFSCTLDAEEESALSIIDPFTLNIELRSNCLNILIQKPLNIRLSYVDVKLFSRM  1618
             DINHLEIFSCTLDAEEESALSIIDPFTL IELRSNCLNILIQK LNIRLSYVDVKLFSRM
Sbjct  2216  DINHLEIFSCTLDAEEESALSIIDPFTLIIELRSNCLNILIQKHLNIRLSYVDVKLFSRM  2275

Query  1619  VRLLPTQTSRSKNVISKANSDLEKVAPLVAMGFELSDCLYAMQVNNWRINDAALWLSQQK  1678
              RLLPTQTSR KNVISKA+SDLEK APLVAMGFE+SDCLYAMQ+NNWRINDAA+WLSQQK
Sbjct  2276  ARLLPTQTSRPKNVISKADSDLEKAAPLVAMGFEISDCLYAMQINNWRINDAAIWLSQQK  2335

Query  1679  QSTYKNPALEMKTAVVDASLISVFIIDDCMDADVPLLEVSLSKFLLNYTFKTKDPNPKES  1738
             Q+TY+NPALEMKTAVVDASLISVFIIDDCMDADVPLLEVSLSKFLLN+TF+T+DPNPKE+
Sbjct  2336  QNTYRNPALEMKTAVVDASLISVFIIDDCMDADVPLLEVSLSKFLLNFTFQTQDPNPKET  2395

Query  1739  NIQHFSLGNIDTEAAVNYYNRRLSGWEPVAETWESNLKWKYTKGHLNENKKRFEIGVSSK  1798
             NI+H+SLGNIDTE +VNYYNRRLSGWEPVAETWESNL WKYTKGHL +NKKRFEIG+SSK
Sbjct  2396  NIRHYSLGNIDTEVSVNYYNRRLSGWEPVAETWESNLNWKYTKGHL-DNKKRFEIGISSK  2454

Query  1799  QMLKLNVTSTFIELFHMVLKNWTNDFNDNGAKNFRQRSPFIPFALQNLTGTPLLFKPIYA  1858
             QMLKLNVTSTFIELFHMVLKNWTNDFNDNGAKNFRQRSPFIPFALQNL+GTPLLFKPIYA
Sbjct  2455  QMLKLNVTSTFIELFHMVLKNWTNDFNDNGAKNFRQRSPFIPFALQNLSGTPLLFKPIYA  2514

Query  1859  PLGDLSCSDLQQFELIKNWSSVQPNETKTFDFSQKSKLRHVHSHQLNLHQIFVQIHGWTL  1918
             PLGDL+ SDLQQ ELIKNW SVQPNETKTFDFSQKSKLRHVHSHQLNLHQIFVQIHGWTL
Sbjct  2515  PLGDLTRSDLQQVELIKNWYSVQPNETKTFDFSQKSKLRHVHSHQLNLHQIFVQIHGWTL  2574

Query  1919  IGPISIDKVGMFFRTTNLDSQYSTKSRIVFDISLIGSAQKLIKVKSSLFIVNKLDRNVFL  1978
             IGPIS+DKVGMFFRTT LDSQ+ TKSRIVFDISLIGSAQKLIKVKSSL ++NKLDRNVFL
Sbjct  2575  IGPISVDKVGMFFRTTKLDSQFLTKSRIVFDISLIGSAQKLIKVKSSLGVINKLDRNVFL  2634

Query  1979  KMSLKSTQSDGLTAISVVKPNDELPLPLKFIDASLHVAHSTHSESEAYEETGFSNEEILW  2038
             KM+LK T SDGL++ISV+KPNDEL +PLKFIDASL+VAH+T SES+AYE+TGFSNEEILW
Sbjct  2635  KMTLKGTHSDGLSSISVIKPNDELSVPLKFIDASLYVAHNT-SESDAYEDTGFSNEEILW  2693

Query  2039  KLCGKDNTRQLLVSYDQNKSILYTLVNISRIIYHVKEQTLPGHLITLLPPLKINNMLCCD  2098
             K CGKD+TRQLL  YD NKSILYT VNISR IYH KEQ LPGH ITLLPPLKINNMLCCD
Sbjct  2694  KACGKDDTRQLLAGYDTNKSILYTFVNISREIYHCKEQNLPGHKITLLPPLKINNMLCCD  2753

Query  2099  LMFKIHEHATGRINSSESANIYNVNIYQPLNLSITLDNFQLSGQLKVPTSHTGVVETKLK  2158
             LMFKIHEHATGRINSSES NIYNVNI QPLNLSITLDNFQLSGQLK+P SH GV+E KLK
Sbjct  2754  LMFKIHEHATGRINSSESVNIYNVNICQPLNLSITLDNFQLSGQLKIPVSHRGVIEPKLK  2813

Query  2159  LFDIKKRELHLRISIQFVKGKGMEIYISAPVWIINKTGLPLIYKQEGTNNTAAGQFEEHE  2218
             L DI+KRELH+R+SIQ V GKGME+YISAPVWIINKTGLPLIYKQEGT++TAAGQFEEHE
Sbjct  2814  LIDIQKRELHVRVSIQSVPGKGMELYISAPVWIINKTGLPLIYKQEGTSHTAAGQFEEHE  2873

Query  2219  TARQVAPLMFSFSDQEGSPALELRLGRAFGLNNTWCKSFSTHKDLTHRELRAENTKGSYA  2278
             TARQVAPLMFSFSDQEGSPAL LRLG+A+G NN WCKSFSTHKDL  R+LRAENTKGSYA
Sbjct  2874  TARQVAPLMFSFSDQEGSPALVLRLGKAYGSNNMWCKSFSTHKDLADRDLRAENTKGSYA  2933

Query  2279  IGISVRRGRGLYASTTFVTLSPRFHLHNRSGYRLEFMQLCDIVNYDRPDPRKIISAPIDC  2338
             IGISVRRGRGLYA TTFVTLSPRFHLHNRSGY+LEFMQLCDIVNYDRPDPRKIISAP+DC
Sbjct  2934  IGISVRRGRGLYACTTFVTLSPRFHLHNRSGYKLEFMQLCDIVNYDRPDPRKIISAPVDC  2993

Query  2339  NFAFHWPNWDQEQFICVRIPDVECCCWSKGIPINDDVQSLYINVRNEWGDMFFLRLEIIS  2398
             NFAFHWPNWDQEQ ICVRIP++ECCCWSKGIPI D VQSLYINVRNEWG+MFFLRLEIIS
Sbjct  2994  NFAFHWPNWDQEQIICVRIPEIECCCWSKGIPIKD-VQSLYINVRNEWGEMFFLRLEIIS  3052

Query  2399  KDATFILLFTDARTLPPPIRIDNCSEVVINFSQLRSKPVWITPVRPQSSLSYVLDDPLGL  2458
             KDATFILLFTDARTLPPPIRIDNCSEVVINFSQLRSKPVWITPVRPQSSLSYV+DDPLG 
Sbjct  3053  KDATFILLFTDARTLPPPIRIDNCSEVVINFSQLRSKPVWITPVRPQSSLSYVMDDPLGQ  3112

Query  2459  QALLMEAPGGNMIEFPINNVNNIKKTLTYTNFIYIAFHGTFERSTSDEESSPHRHLVLGV  2518
             Q LLMEAPGGNMIEFPINN NNIKKTLTYTNFIYIAF GTFERS  +EE + HR LVLGV
Sbjct  3113  QILLMEAPGGNMIEFPINNKNNIKKTLTYTNFIYIAFQGTFERS--NEEENTHRQLVLGV  3170

Query  2519  RGRKVVIMEKNSGDRSQLWLMNSNGQLEHEGSTPPIQSNDANAVRLVLDLEKPPNPMEFT  2578
             RG+KVVI+EKNSGDRSQLWLMNSNGQLEHEGSTPPIQ+NDANAVRLVLDLEK PNPMEFT
Sbjct  3171  RGKKVVIVEKNSGDRSQLWLMNSNGQLEHEGSTPPIQTNDANAVRLVLDLEKAPNPMEFT  3230

Query  2579  TLVVRTPNKQRVTTQTWRFENGRLMCHANMCVQSRY-EVGLRPNCEAYVGRTENNSSNHQ  2637
              LVVRTPNKQRVTTQTWRFENGRLMCHANMCVQSR+ E GL+PN EA VGRTEN +S+ +
Sbjct  3231  NLVVRTPNKQRVTTQTWRFENGRLMCHANMCVQSRFGESGLKPNYEAVVGRTENRASSSK  3290

Query  2638  SIPIGQHIVAQKLRPGSGQLELSTRMDGPISTIEICDIKIKQNSVFLTPDLLWMHASLNN  2697
              IPIGQHIVAQKLRPGSGQLELST+MDGPISTIEICDIKIKQNSVFLTPDLLWMHASLNN
Sbjct  3291  QIPIGQHIVAQKLRPGSGQLELSTKMDGPISTIEICDIKIKQNSVFLTPDLLWMHASLNN  3350

Query  2698  RQITDKGKISITHEYLINVELVKGIGISIITRKPCEEIMFISLDHIHCDISQGALENSLD  2757
             RQITDKGK+S  HEYLINVELVKGIGISII RKPCEEIMFISLDHI+CDI Q ALENSLD
Sbjct  3351  RQITDKGKVSFVHEYLINVELVKGIGISIIARKPCEEIMFISLDHINCDIVQSALENSLD  3410

Query  2758  LNISYIQIDNQLLDAVSQIALHTQTSSSDHDQHKNAVVLKLKMLPCPNKNAIIFKYLTLD  2817
             LNI+YIQIDNQLLDAVS IALHTQTS+ D ++ +NAVVLKLKMLP PNKNAIIFKYLTLD
Sbjct  3411  LNIAYIQIDNQLLDAVSPIALHTQTSN-DLEETQNAVVLKLKMLPSPNKNAIIFKYLTLD  3469

Query  2818  LKPCTANLDEKLILKVASFLGYGKINRQNLSVQYQFENFEDKQPILQDMKRYYFENLSIG  2877
             LKP TA+L+EKLILKVASFLGYGKINRQNLSVQYQFEN +DK P LQDMKRYYFENLSIG
Sbjct  3470  LKPSTASLEEKLILKVASFLGYGKINRQNLSVQYQFENTDDK-PFLQDMKRYYFENLSIG  3528

Query  2878  ATQVRLSAFTSSKLPVELHETKKTLGLTLIKFEDALIELDRYSDRLHFETLDVYLKEMKK  2937
             ATQVRLSAFTSSKLPVELHETKK LGLTLIKFEDALIELDRYSD+LHFET+DVY KE+KK
Sbjct  3529  ATQVRLSAFTSSKLPVELHETKKALGLTLIKFEDALIELDRYSDKLHFETMDVYRKELKK  3588

Query  2938  HYVNQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKSLVKNVTHGISNSTAK  2997
             HY+NQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKSLVKNVTHGISNSTAK
Sbjct  3589  HYINQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIFEGSVKSLVKNVTHGISNSTAK  3648

Query  2998  LTETLSDSLGKVVLNDHDNETRQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRHTY  3057
             LTETLSDSLGKVVL+DHDNETRQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRHTY
Sbjct  3649  LTETLSDSLGKVVLDDHDNETRQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRHTY  3708

Query  3058  DGAYDGGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDTQKNTPDRKRLPR  3117
             DGA   GVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRD+ +N P+RKRLPR
Sbjct  3709  DGATSDGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDSHRNAPERKRLPR  3768

Query  3118  CVTGAPGGLLPLFSNRQSKGQQYLYLINHKNFSEKIISYEANLWSDKEARLRLLVSTEFV  3177
             CVTGAPGGLLPL+SNRQSKGQQYLYLIN KNFSEKIISYE NLWSDKEARLRLLVSTE+V
Sbjct  3769  CVTGAPGGLLPLYSNRQSKGQQYLYLINQKNFSEKIISYEPNLWSDKEARLRLLVSTEYV  3828

Query  3178  RIFSLVDGNPTIMLECHLCEILSCHPLITNVGTTPSTSSRTASAACHYIEISTNLPKITR  3237
             RIFSL D NPTIM ECH+ EILSCHP++TN GTTP+TSSR  ++A HYIEISTNLPKITR
Sbjct  3829  RIFSLSDANPTIMFECHVSEILSCHPVVTNAGTTPTTSSR--ASASHYIEISTNLPKITR  3886

Query  3238  PRIRCRSEECAEAASRCINYAKSVFDEREHAVL  3270
             PRIRCRSEECAEAASRCINYAKSVFDEREHAVL
Sbjct  3887  PRIRCRSEECAEAASRCINYAKSVFDEREHAVL  3919


>VP13C_DICDI unnamed protein product
Length=3848

 Score = 140 bits (352),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 135/509 (27%), Positives = 221/509 (43%), Gaps = 80/509 (16%)

Query  2705  KISITHEYLINVELVKGIGISIITRKPC-EEIMFISLDHIHCDISQGALENSLDLNISYI  2763
             K+++ +E+ I++     IGISII + P  EEI+++S+D +  ++ Q  L+  +   +  +
Sbjct  3229  KLNVKYEFSIDLS---NIGISIINKIPTREEIVYLSIDGLKLEVKQSKLDQYIQFKVDDL  3285

Query  2764  QIDNQLLDAVSQIAL-------HT------QTSSSDH-------------------DQHK  2791
             QID+Q       + L       H+      Q SSS                      Q K
Sbjct  3286  QIDDQRYSTNFPVFLCQSKKINHSINQQPNQQSSSPQSTNTTTTTTTNTTTTNNTTQQQK  3345

Query  2792  NAVVLKLKML-PCPNKNAIIFKYLTLDLKPCTANLDEKLILKVASFLGYGKINRQNLSVQ  2850
                 L+          N + F+Y ++ ++    NLDE  IL   SF+    IN  +L+  
Sbjct  3346  LKPFLQFSATRTLKYSNIMFFRYFSILIQEFDINLDEASILNALSFIN---INLNSLNEH  3402

Query  2851  YQFENFEDKQPILQ-------DMKRYYFENLSIGATQVRLSAFTSSKLPVELHET--KKT  2901
             +       ++ IL+       +    YFE L I   ++ LS F S K P E       ++
Sbjct  3403  FTLHPTITQEEILETKNASNIENHMVYFEMLHINPVKMNLS-FISCKSPKETQAILGARS  3461

Query  2902  LGLTLIKF---------EDALIELDRYSDRLHFETLDVYLKEMKKHYVNQVKWHAAAILG  2952
             L   LI F         E A I+ + +     F +    + E+  H+  Q+   A  I G
Sbjct  3462  LAELLIGFKSNSPFLNIERAPIKFNGFIWEHPFLSTRQVIDEISLHFSYQMMSQAHKIFG  3521

Query  2953  SVDFLGNPLGFANDLSEGVSGLIFE---GSVKS--------------LVKNVTHGISNST  2995
             S DF+GNP+  A  L  G      E   G VKS              L+ N   G ++ST
Sbjct  3522  SFDFIGNPIRLAESLGSGFKDFFHEPALGLVKSPQDFAAGLSKGTSSLINNSVFGFADST  3581

Query  2996  AKLTETLSDSLGKVVLNDHDNETRQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRH  3055
             +K+T T+S  L ++ L+D   + RQ   + +       L  G +  G G++ G+T I+  
Sbjct  3582  SKITGTISKGLVQLSLDDSYIKERQESNKQKPKGVKEGLEFGFRDFGEGVIKGITGIIDE  3641

Query  3056  TYDGA-YDGGVPGFLSGLGKGLVGTVTKPIIGVLDLASETASAVRETSRDTQK-NTPDRK  3113
              Y GA  +    GF  G+GKG++G   KP +GV DL S+T+  ++ ++   +  +   R+
Sbjct  3642  PYKGATQEKSWEGFFKGIGKGVLGVAVKPTVGVFDLVSKTSEGIKNSTTVAKSLSQIKRR  3701

Query  3114  RLPRCVTGAPGGLLPLFSNRQSKGQQYLY  3142
             R+PR       G L  ++  +S G   LY
Sbjct  3702  RIPRYFPRE--GTLSTYNQFKSIGSFILY  3728


 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/178 (26%), Positives = 85/178 (48%), Gaps = 26/178 (15%)

Query  1102  LRINMAAVHYIHTKRFSTELHVFVKDLLQLQTPVIRKLKKQSQSGSEQNMRPSKMKLV--  1159
             L+IN++++ +I  KRF+ EL +F+ ++      ++R+  K S   +   +  ++  L   
Sbjct  1401  LKINLSSIRFIFLKRFTEELRLFLNNV-----NMMREYLKSSIYSAATVISQNRSTLFYE  1455

Query  1160  IQADSPVIVLPACYNRNEVIIAYLGQFTLKNSFH--LASDENIISKMTATPNPNEILDVM  1217
             I+  +P IV+P     N++ I  LG+  +KN F   + +    I  +   P    I++ +
Sbjct  1456  IEIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEKIIPTSTGEIDMILMEP---VIIENI  1512

Query  1218  RIDLVNINLFSGERSSMKAKGE------------QEKNRIVIADMNF-LRLGQPFFNE  1262
              I+  NI L SG  S +K K E            Q     +++D+N  + L  P F+E
Sbjct  1513  IIEAQNIKLLSGLNSEIK-KSENNNNNNNNSNTNQRSYGTMVSDVNVSINLKTPLFSE  1569


 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 71/347 (20%), Positives = 127/347 (37%), Gaps = 85/347 (24%)

Query  2083  ITLLPPLKINNMLCCDLMFKIHEHA----------TGRINSSESANIYNVNIYQPLNLSI  2132
             I++   + I N+L CDL ++++             +G I   +   +   +  Q + +  
Sbjct  2591  ISINTAIMIENVLACDLQYRLYHGKNKKIIGSAFFSGVIPMGKKLPVLVYDSLQDIYMEF  2650

Query  2133  TLDNFQLSGQLKVPTSHTGVVETKLKLFDIKKRELHLRISIQF---VKGKGME-IYISAP  2188
              + +FQ S    + +     V  K+K+ D     LH  + I F   ++  G   + +   
Sbjct  2651  QIYDFQWSPLCLIDSMVGLAVTDKVKIED----RLHQPLLISFDNRIQPNGSRFVTLYCE  2706

Query  2189  VWIINKTGLPLIYKQ-------EGTNNTAAGQFEE-HETARQ----------------VA  2224
              W+IN+TGLPL ++        +    T   Q E  HE+                     
Sbjct  2707  YWLINQTGLPLYFRHHIGAQTIDPAGQTPTKQIETIHESTSMKPTDSRNWYTKEWNHPSQ  2766

Query  2225  PLMFSFSDQEGSPALELRLGRAFGL---NNTWCKSF-------------STHKDLTHREL  2268
             P MF++SD          +G  F L   ++ W   F                +D T  E 
Sbjct  2767  PFMFAYSDNS-------IVGGKFSLKIYDSNWSSPFSLISSQSSSNSNIEISEDRTDEEK  2819

Query  2269  RAENTKGS----------YAIGISVRRGRGLYASTTFVTLSPRFHLHNRSGYRLEFMQL-  2317
               +N  G+          Y + +S+      +  T  VT SP + + N + +R+ + Q  
Sbjct  2820  EIKNVIGTITKRQPLKTNYNLSVSILPSNSKFWRTKVVTFSPMYLMVNSTRFRILYQQFD  2879

Query  2318  CDIVNYDRPDPRKIISAPIDCNFAFHWPNWDQEQFICVRIPDVECCC  2364
             CD       + + II    D +  F +P+   E+ I + I D     
Sbjct  2880  CD------SNTQSIIQ---DQSLPFQFPSSRHEKLIRIGILDTSAIS  2917


 Score = 37.0 bits (84),  Expect = 0.38, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 21/125 (17%)

Query  1715  LEVSLSK--FLLNYTFKTKDP--------NPKESNIQHFSLGN-----IDTEAAVNYYNR  1759
             L +SL K  F+LN   K   P        +  +SNI  F   N     +D      Y+N+
Sbjct  2058  LSISLEKGEFILNDDHKISSPIKLLSIGVDGLKSNIFSFPQKNQIALSLDANMKAGYFNK  2117

Query  1760  RLSGWEPVAETWESNLKWKYTKGHLNENKKRFEIGVSSKQMLKLNVTSTFIELFHMVLKN  1819
              +  WEP+ E W     + +T    N  +  + +  +SK  L +N+T  FI+      + 
Sbjct  2118  NIGIWEPLIENW----GFSFTSN--NSIEGGWMVNFNSKIPLYINITKIFIDTSISTYQI  2171

Query  1820  WTNDF  1824
             W +D+
Sbjct  2172  WADDY  2176


 Score = 35.8 bits (81),  Expect = 0.84, Method: Compositional matrix adjust.
 Identities = 26/94 (28%), Positives = 39/94 (41%), Gaps = 26/94 (28%)

Query  566   FLRDVNACITYFKRSLREFATSIGNKATDMAKEFVQQVRAVEQTGPVHPQRNRQDNWLDI  625
             FL +VN    Y K S+   AT I                           +NR   + +I
Sbjct  1423  FLNNVNMMREYLKSSIYSAATVIS--------------------------QNRSTLFYEI  1456

Query  626   IISSPIIILPISNTSTNVLIANLGKISCTNSVSK  659
              I +P I++P+S+ S  + I +LGKI+  N   K
Sbjct  1457  EIQNPYIVIPLSSLSNKIFIVDLGKINIKNQFEK  1490


 Score = 34.7 bits (78),  Expect = 1.8, Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 2/54 (4%)

Query  2415  PPIRIDNCSEVVINFSQLRSKPVWITPVRPQSSLSYVLDDPLGLQALLMEAPGG  2468
             PP RI+N +   +   Q +++ +W   V+P++S+ Y  D P+  + L++E P G
Sbjct  3086  PPYRINNKTRFPLWIRQKKTE-IW-DKVQPKTSIPYAWDHPILPKKLIIEFPTG  3137


>VPS13_DROME unnamed protein product
Length=3321

 Score = 129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 111/415 (27%), Positives = 178/415 (43%), Gaps = 45/415 (11%)

Query  2752  LENSLDLNISYIQIDNQLLDAVSQIALHT---QTSSSDHDQHKNAVVLKLKMLPCPNKNA  2808
              ++ L + I+ IQ+DNQ LD +  + L       S +     K  +   +     PN   
Sbjct  2779  FQSQLHVKINRIQVDNQFLDPIFPVVLAPIPPPKSVASTTSLKPFIECSMVQRIMPNSTV  2838

Query  2809  IIFKYLTLDLKPCTANLDEKLILKVASFLG-------YGKINRQNL-SVQYQFENFEDKQ  2860
               FKY  + ++     +D   +  +A             K  RQ++ S++     F ++ 
Sbjct  2839  RQFKYARILIQEFLFKVDLNFLTAIAEMFAKEVSDEAAAKQFRQDVESIELPLSAFFEEH  2898

Query  2861  PILQDMKRYYFENLSIGATQVRLS---AFTSSK-LPVELHETKKTLGLTLIKFEDALIEL  2916
               L++ K +Y +NL +G  ++ +S   A + +K LP  L    + +G+TL    D +  L
Sbjct  2899  S-LEEQKSFY-DNLHLGPLKIHVSFSMAGSDTKALPGFLGSLVQGVGVTLTDVNDVVFRL  2956

Query  2917  DRYSDRLHFETLDVYLKEMKKHYVNQVKWHAAAILGSVDFLGNPLGFANDLSEGVSGLIF  2976
               +     F +    + E+  HY  Q       ++  +D LGNP G    L +GV  L +
Sbjct  2957  AFFEREYQFFSQKQLINEITSHYTGQALKQLYVLVLGLDVLGNPYGLVVGLKKGVEDLFY  3016

Query  2977  EG-----------------SVKSLVKNVTHGISNSTAKLTETLSDSLGKVVLN-DHDNET  3018
             E                   VKSL  +   G + + +K+T  +   L  +  + D+  + 
Sbjct  3017  EPFQGAIQGPGEFAEGLVLGVKSLFGHTVGGAAGAVSKITGAMGKGLAALTFDEDYQKKR  3076

Query  3019  RQRILELQSNTSGGHLAAGLKGLGFGLLGGVTSIVRHTYDGAYDGGVPGFLSGLGKGLVG  3078
             RQ I     N   G LA   KGL  G + GVT +V     GA D GV GF  GLGKG +G
Sbjct  3077  RQGIQNKPKNFHEG-LARSSKGLVMGFVDGVTGVVTKPVTGARDNGVEGFFKGLGKGAIG  3135

Query  3079  TVTKPIIGVLDLASETASAVR---ETSRDTQKNTPDRKR------LPRCVTGAPG  3124
              V +P  GV+D AS +  AV+   + S D ++  P R +       P C+  A G
Sbjct  3136  LVARPTAGVVDFASGSFEAVKRAADASEDVKRMRPPRFQHYDFVLRPYCLMEATG  3190


 Score = 38.9 bits (89),  Expect = 0.091, Method: Compositional matrix adjust.
 Identities = 70/332 (21%), Positives = 131/332 (39%), Gaps = 31/332 (9%)

Query  995   KKLVETHIDELFS-RLKVSIRSFNFTLIRNESLLSRVNVSNAVFVILQDHRSKIVEGCLG  1053
             KK   TH+ E    R+  ++      L   +  ++ +NV   V  ++       V   L 
Sbjct  1085  KKTRRTHVVETVKVRVIANLDQVGLVLTGRKRPIAEMNVKKFVSSLIIKSSYTEVNIGLK  1144

Query  1054  SVSVYDLTKYGNIYKQKFLTSGTEALN---FVYKKKLVDLEALKTLDTDSTLRINMAAVH  1110
              + V DL  Y  I+K      G +A N    +Y K+    E       D  + +++  + 
Sbjct  1145  DIQVLDLNPY-TIHKNILSIVGKDAFNCQIVIYNKE----ETQDYNSDDMKITVDIGCMK  1199

Query  1111  YIHTKRFSTELHVFVKDLLQLQTPVIRKLKKQSQSGSEQNM----RPSKMKLVIQADSPV  1166
              I    F   +  F+ +    Q  + +     ++S  ++ M      ++MKL I+  +P+
Sbjct  1200  IIFLNWFVAGVMNFLNNFTAAQATISQAGAAAAESARQKAMDAYETATRMKLNIRIKAPI  1259

Query  1167  IVLP-ACYNRNEVIIAYLGQFTLKNSFHLASDENIISKMTATPNPNEI-LDVMRIDLVNI  1224
             I++P    +RN +++         N+  +A  E    ++      +EI L +  + +  I
Sbjct  1260  IIVPIGSQDRNALLLDLGLLELTNNTVEVAVAEE--ERLAVI---DEIKLQICDVKISKI  1314

Query  1225  NLFSGERSSMKAKGEQEKNRIVIADMNFLRLGQPFFNESCFLHLQLERNLSAEGDRVCPD  1284
              L  G  S++           V A++ FL         SC   L + RNLS    R  P+
Sbjct  1315  VLLDGNESTVDE---------VDAEVGFLSKFNMMNPMSC--TLSITRNLSYTWYRDVPE  1363

Query  1285  ISVQGTFSKLNGMVNIQQYKLIRSFLNNNIGE  1316
             +++ G    +   +    Y L+   LN N+ E
Sbjct  1364  LNLSGRLKSIELTLFADDYALVMLVLNRNLNE  1395


 Score = 35.8 bits (81),  Expect = 0.88, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 5/47 (11%)

Query  2187  APVWIINKTGLPLIYKQEGTNNTAAGQFEEHETARQVAPLMFSFSDQ  2233
             +P W+INKTG+ L YK E T+        E+       P++F+F D+
Sbjct  2355  SPFWMINKTGMMLTYKSETTSVEVLYHPPEYS-----GPILFTFRDK  2396


 Score = 35.8 bits (81),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 113/537 (21%), Positives = 204/537 (38%), Gaps = 127/537 (24%)

Query  71    NKNVQLEYVLHNKIYDKYLINFTNLQVLVCKYEERWQACL--KTSSNFHLIDKFNINLTL  128
             +K+  L+ V+ N  YD++ +   ++Q+LV +  E WQ  L    S+  H++   ++ +T 
Sbjct  706   DKDEILKTVMENA-YDRFTVAVDDVQMLVVRAGEPWQNALAEANSTEMHVLRPVSLKVT-  763

Query  129   EQRNIFTVDPEYPSFMLFGTCPTILIHGNEELINNCCNIMRPII------KASREMENIY  182
                 +   DP  P+  +    P IL++ +E+ I     +   I        ASR  +   
Sbjct  764   AALCVVDNDPRLPNIKVDIDLPAILVNVSEDRIFLAIKVATSIPLPEQKEPASRLTQTNS  823

Query  183   RGGNTI--YASERIKNLAEDDRSRVVIEFVMDQLVIEMQSTER--SIAELQIIGARAGLT  238
             R   +I  + ++ +K +          +  +   +I+  S +   S+ E+  +     L 
Sbjct  824   RSSMSISNFINKEVKKIGPSASGSSASKDPLLDEIIQYTSLDVNFSLGEINFV-----LF  878

Query  239   KESNETNISMSVHGLLLVDAIQSFGPDFELLVASHRHVGMDSLSGSLKHS-AVVSPTSPG  297
             + S +   S  V       +I+   PD ++L +         L+ +++     + PT P 
Sbjct  879   QSSRKCETSPDV-------SIEFLTPDGDVLPS--------QLTENIQEPIEELPPTPPQ  923

Query  298   SPNFFD-RATSPHMITK---AVQNIKMGDKSTEF--CEDEDSQALISIDIKIVPPNQNNS  351
                  D R    H ++K   +V  +K+GD +     C+D D   L   D+   P  +N+S
Sbjct  924   QILSIDIRRLEAHFVSKTYESVATVKLGDINLRQYDCQDSDMDVL---DVIYTPKQENSS  980

Query  352   AQLHTTSIT-----------------------FNSLDIIANQDT---ILEILNFAKRTL-  384
               L T S T                       F  L I+ +Q+    I+E++N  +R L 
Sbjct  981   NYLFTVSCTIADKSSPEFSTKYNSTEQLVVANFEVLQIVLHQECLQRIMEVVNNFQRNLD  1040

Query  385   ----------------------LTQNIFSSETEELRKESMLEERPKEELDEDQVDQKTHN  422
                                    T N+   +TEE+     ++ R K       V +    
Sbjct  1041  LVLSSTRPRDRMGSIGGGDGIKRTLNVILEDTEEIMTTDQMKRRKKTR--RTHVVETVKV  1098

Query  423   EIFFDFFRLNILLLYTIKRDKFNIGRKVGTVTLTEAKINASF---QSDLSIFGSLGGIQV  479
              +  +  ++ ++L           GRK     +   K  +S     S   +   L  IQV
Sbjct  1099  RVIANLDQVGLVL----------TGRKRPIAEMNVKKFVSSLIIKSSYTEVNIGLKDIQV  1148

Query  480   IDITPEAFCHPRILS-VGRDTILRTSDTNKQTVLSQLSNEIYSNNYNEEKNDDDDSD  535
             +D+ P    H  ILS VG+D        N Q V+           YN+E+  D +SD
Sbjct  1149  LDLNPYTI-HKNILSIVGKDAF------NCQIVI-----------YNKEETQDYNSD  1187



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


Query= XP_017016380.1 huntingtin-interacting protein 1 [Drosophila
kikkawai]

Length=1122
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLAP2_CAEEL  unnamed protein product                                  253     4e-70
Q1ZXE9_DICDI  unnamed protein product                                 109     7e-24
TALB_DICDI  unnamed protein product                                   101     3e-21


>SLAP2_CAEEL unnamed protein product
Length=927

 Score = 253 bits (646),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 160/522 (31%), Positives = 264/522 (51%), Gaps = 68/522 (13%)

Query  15   SVNKALNGLEAPLKTKHARSIIIMIHKTKEAKSFWMMISRQPLMQNRFTAWKFSHLLHKV  74
            +V KA+   E PLK KHAR+II+  HK K +  FW  + R  L ++    WKF HL+HK+
Sbjct  18   AVQKAITKNEVPLKPKHARTIIVGTHKEKSSGIFWHTVGRIQLEKHPVLTWKFCHLVHKL  77

Query  75   LREAHESAIRHSQSHKKMILEVGKMWGLLQ-DDIGCCIQAYSKLLATKLNFHDKNRMFPG  133
            LR+ H      +  +     ++ + W  L     G CI++Y KLL  ++ FH+K  + PG
Sbjct  78   LRDGHRKVPEETYRYVNRFTQLSQFWKHLNTSGYGPCIESYCKLLHDRVTFHNKYPVVPG  137

Query  134  SLNISFTELFVAVDRDLNYCFQLCVEIFDYLEDIIALQQTIFSSMEKYRMSSMTPQGQCR  193
             L+++ ++L   ++ DL+  F++ +++ D ++ ++ LQ  ++  M   R +S+ PQGQC 
Sbjct  138  KLDLNDSQL-KTLEGDLDNMFEMTIDMLDQMDALLVLQDRVYEMMNSLRWNSLIPQGQCM  196

Query  194  LAPIVCLIQDSNALYDMSVRLMFKLHDGIPYDVVSGHRDRFYGLFLKLKSFYNNVRPLQY  253
            L+P++  I D++  YD  V+++FKLH  +P D + GHR RF  +F + K FY     LQY
Sbjct  197  LSPLIIAILDTSKFYDYLVKMIFKLHSQVPPDALEGHRSRFRTIFERTKKFYEESSNLQY  256

Query  254  FKDLITVPELPDTSPNFKSQNDFSSYVPPVVHVPQEPDPVVEDLVDTNNHEAEAFSQA--  311
            FK L+++P LP  +PNF  Q+D  SY  P  ++  E     ED    N H+ E  + A  
Sbjct  257  FKYLVSIPTLPSHAPNFLQQSDLESYRTPHAYLHSEGS---EDGTSLNGHDGELLNLAEA  313

Query  312  --------------QQQLTML-----------EGIISEKEAGIEELSYKLVALQKNYDDL  346
                          ++Q+ ML           E +I E  + IE+   +L+ +Q  +D  
Sbjct  314  EPQQASPSSQPDPREEQIVMLSRAVEDEKFAKERLIQEARSRIEQYENRLLQMQGEFDHA  373

Query  347  QQSYRQDVQELQQNNTILSNDLVLAREMCATFRMQNDDLELQLNQNPILMQKAMEEEEKH  406
            ++   ++ +E Q+    L N+L L R+     R Q DD  ++            E E K 
Sbjct  374  KREADENREEAQR----LKNELAL-RDAS---RTQTDDARVK------------EAELKA  413

Query  407  KLSSEKFNKLKTLYTKIRDEHIQLLR---------EQSESNKSLNKEKQV---NSQLLLE  454
              + E+FNK+K +Y K R EH+  L          E SE +K  +K++++   N ++   
Sbjct  414  TAAEERFNKMKGVYEKFRSEHVLALTKLGDIQKQLEASEKSK-FDKDEEITALNRKVEEA  472

Query  455  TKELTNEISKIKGNVEEKDKANLALQK---QVEEHKEKITQL  493
             +E    ++K +G+    D+    L K   +VEE K  I  L
Sbjct  473  QREAGRALTKAEGDAGAVDEMRTQLVKADIEVEELKRTIDHL  514


 Score = 184 bits (467),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 148/232 (64%), Gaps = 1/232 (0%)

Query  890   LEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVDSCTTLMECVKVLIQKSR  949
             LE E+R MD AI  A  +I  +  +ARE  +   LEVN  I+ +C  LM  +  L+  SR
Sbjct  685   LEQEMRRMDDAIRRAVQEIEAIQRRARESSDGIRLEVNESILANCQALMSVIMQLVIASR  744

Query  950   LLQHEIVASQKGNASANEFYRRNSQWSDGLISASKSVAKAANYLVEAANKAIESESGKNF  1009
              LQ EIVA+ K   S  EFY+RN QW++GL+SA+K+V  AA  LVE+A+  +  + GK  
Sbjct  745   ELQTEIVAAGKAGGSPAEFYKRNHQWTEGLLSAAKAVGVAARVLVESADGVVTGK-GKFE  803

Query  1010  ELIVAAQEIAACTTQMVIASKVKAERNSQKLSDLTKASRSVTQATGTLVATVKDCNAQLE  1069
              LIVAAQEIAA T Q+ ++S+VKA+++S KL  L+ A+++V Q T  +VA VK+    L 
Sbjct  804   HLIVAAQEIAASTAQLFVSSRVKADKDSSKLDALSVAAKAVNQNTAQVVAAVKNGQTTLN  863

Query  1070  QQSELELAKLTPSQIKTMEMEIHVKVLEIEQALQTQRQKLASFRREHYKNAE  1121
              +  L+ + L+    K  EME  VK+LE+EQ+L  +R KLA+ R++HY  A+
Sbjct  864   DEGSLDFSYLSLHAAKKEEMESQVKMLELEQSLNQERAKLAALRKQHYHMAQ  915


>Q1ZXE9_DICDI unnamed protein product
Length=960

 Score = 109 bits (272),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 81/249 (33%), Positives = 129/249 (52%), Gaps = 6/249 (2%)

Query  873   IEKIKATFEQKIDLDKLLEIELREMDAAIDDAASKITDLLAKAREKDNQTNLEVNGKIVD  932
             IE  K   E   DLD + E EL      I+DAA+ +    +K   K    + +V   I++
Sbjct  710   IEAEKKYLENGFDLDDVAERELLAAAKTIEDAANSLLAAKSKRAPKKEGDSPDVAEAILE  769

Query  933   SCTTLMECVKVLIQKSRLLQHEIVASQKGNAS-ANEFYRRNSQWSDGLISASKSVAKAAN  991
             +   +      L+  + L Q E V  +KG  S     YR++  W++GLISA+KSVA+A  
Sbjct  770   AAMAITGATSTLVGAATLAQRERV--EKGRTSDGGPLYRKDPTWAEGLISAAKSVAQATK  827

Query  992   YLVEAANKAIESE---SGKNFELIVAAQEIAACTTQMVIASKVKAERNSQKLSDLTKASR  1048
              LV+ ANK    +    G    LI  +  + A T+Q+V A K K++ NS     L+ A++
Sbjct  828   ALVDNANKTASGQEIPGGTEEALIATSMAVTAATSQLVSACKSKSDINSPSQHKLSNAAK  887

Query  1049  SVTQATGTLVATVKDCNAQLEQQSELELAKLTPSQIKTMEMEIHVKVLEIEQALQTQRQK  1108
             SV+ AT  LVA  K   A++  + +++  KLT +  K  EME  + +L +E+ L+  R+ 
Sbjct  888   SVSNATNLLVAAAKAVAAKVASEEDIDFDKLTVTGYKVKEMEQQMAILRLEKELEVARKG  947

Query  1109  LASFRREHY  1117
             L+  R++ Y
Sbjct  948   LSVIRKKQY  956


 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/259 (25%), Positives = 120/259 (46%), Gaps = 14/259 (5%)

Query  16   VNKALNG-LEAPLKTKHARSIIIMIHKTKEAKSFWMMISRQPLMQNRFTAWKFSHLLHKV  74
            V+KA N  + AP K KH RSI++  +    A++F+M + R+PL  +    WK    +HKV
Sbjct  8    VHKATNSKITAP-KRKHVRSIVLECYNENSARTFYMELYRRPLDTSDVVCWKSLITIHKV  66

Query  75   LREAHESAIRHSQSHKKMILEVGKMWGLLQD-DIGCCIQAYSKLLATKLNFHDKNRMFPG  133
            ++E  ++ +  + S       +   W    +   G  +  Y  L+  K+ FH  +  F G
Sbjct  67   VQEGPKNVLSDTISRVGWFENLRDHWARFDNRGFGRLVADYCTLIIDKIRFHQAHPEFDG  126

Query  134  SLNI-SFTELFVAVDRDLNYCFQLCVEIFDYLEDIIALQQTIFSSMEKYRMSSMTPQGQC  192
             L++ ++++       +++   Q    + D  + +  +  +I S+         TP   C
Sbjct  127  GLSLENYSKNHRPESIEVDKGLQTVNRLMDLTDAVFRMHNSIVSA---------TPYNDC  177

Query  193  RLAPIVCLIQDSNALYDMSVRLMFKLHDGIP-YDVVSGHRDRFYGLFLKLKSFYNNVRPL  251
            + +  + L+ +S A+Y + V  +  L D +   +V+     RFYG +  L++F+ N   +
Sbjct  178  KTSAFIPLVLESYAIYILVVHFLTNLIDKVDNKEVMDFSIKRFYGQYQTLRNFFLNASAI  237

Query  252  QYFKDLITVPELPDTSPNF  270
                 +I VP LP   P F
Sbjct  238  TSVSSVIAVPNLPPDPPKF  256


>TALB_DICDI unnamed protein product
Length=2614

 Score = 101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 112/193 (58%), Gaps = 10/193 (5%)

Query  930   IVDSCTTLMECVKVLIQKSRLLQHEIV-ASQKGNASANEFYRRNSQWSDGLISASKSVAK  988
             I+++   +     VL+Q +  +QHE+V A + GN      YRR+  W+ GLISA+++VA 
Sbjct  2274  ILEAARAITSATGVLVQCATNVQHELVLAGKVGNK--GNMYRRDPTWARGLISAAQAVAG  2331

Query  989   AANYLVEAANKAIESESGKNFE--LIVAAQEIAACTTQMVIASKVKAERNSQKLSDLTKA  1046
             +   LV +AN    S  GK  E  L+ +A+ +AA T ++V AS+ KA+ NS   S L +A
Sbjct  2332  SVQGLVHSAN---SSSQGKVDEEQLVASAKGVAAATARLVTASRAKADLNSASNSQLAQA  2388

Query  1047  SRSVTQATGTLVATVKDCNAQLEQQSELELAKLTPSQIKTMEMEIHVKVLEIEQALQTQR  1106
             ++ V+ AT  LV   K  N   E + E +   L+ +QI + EM+  +++L++++ L+   
Sbjct  2389  AKQVSNATAALVEAAKQVNE--EPEVEFDTTNLSNAQIISKEMDQQIQILKLKKELEQAE  2446

Query  1107  QKLASFRREHYKN  1119
             +KL S R++ Y +
Sbjct  2447  KKLFSIRKKEYSD  2459



Lambda      K        H
   0.311    0.135    0.431 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 3920191338


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016381.1 serine/threonine-protein kinase unc-51 isoform X1
[Drosophila kikkawai]

Length=866
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MQJ7_DROME  unnamed protein product                                 1679    0.0   
Q9VU14_DROME  unnamed protein product                                 1648    0.0   
UNC51_CAEEL  unnamed protein product                                  360     5e-111


>Q8MQJ7_DROME unnamed protein product
Length=855

 Score = 1679 bits (4347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 831/867 (96%), Positives = 841/867 (97%), Gaps = 13/867 (1%)

Query  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60
            MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK
Sbjct  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60

Query  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120
            ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA
Sbjct  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120

Query  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180
            MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS
Sbjct  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180

Query  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKFYYEQNANLAPKIP  240
            PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELK YYEQNANLAPKIP
Sbjct  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKSYYEQNANLAPKIP  240

Query  241  HGVSPDLRDLLLCLLRRNAKDRISYESFFVHRFLQGKKAAASSPGEHS-SSNLRRRVSKT  299
             GVSPDLRDLLLCLLRRN+KDRISYESFFVHRFLQGKKAA  SPGE S ++NLRRRVSK+
Sbjct  241  SGVSPDLRDLLLCLLRRNSKDRISYESFFVHRFLQGKKAAV-SPGEPSQAANLRRRVSKS  299

Query  300  GVLAVDMPPLGGTPPAKAKSPLQQQLEQELQLVKLAEQQQKREREEQEAALEEEENTVSV  359
            GVL VDMPPLGGTPPAKAKSPLQQQLEQEL+LVKLAEQQQK EREEQEA  +E+ENTVSV
Sbjct  300  GVLPVDMPPLGGTPPAKAKSPLQQQLEQELKLVKLAEQQQK-EREEQEA--QEDENTVSV  356

Query  360  VANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQAQAQPASG  419
            VANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQ QAQPASG
Sbjct  357  VANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQVQAQPASG  416

Query  420  GQRPVPQQNQSSPPRPSSLPISEPKPVPAPARRQVANGSPARQGSVPLTVATLGGQQIPR  479
            GQRP  QQNQSSPPRPSSLPISEPKPVPAPARRQV     AR G  PLTVATLGGQQIPR
Sbjct  417  GQRPQQQQNQSSPPRPSSLPISEPKPVPAPARRQV-----ARPG--PLTVATLGGQQIPR  469

Query  480  SQPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPST  539
            SQPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPST
Sbjct  470  SQPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPST  529

Query  540  WQVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQ  599
            WQVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQ
Sbjct  530  WQVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQ  589

Query  600  HHMLGPRAFTLPELGATGGLHSLLDTGAGSGGGEPHAFQAPELSEETLMDREHNETLSKL  659
            HHMLGPRAFTLPELGATGGLHSLLDTGAG GGGEPHAFQAPELSEETLMDREHNETLSKL
Sbjct  590  HHMLGPRAFTLPELGATGGLHSLLDTGAG-GGGEPHAFQAPELSEETLMDREHNETLSKL  648

Query  660  NFVLALTDCIQEVADSRCAPLSTLMVAGSQSAAAAAAADAQQIPPHAPEHCKRAERLVLL  719
            NFVLALTDCIQEVADSRCAPLST MVAGSQSAA AA+ADAQQIPPHAPEHCKRAERLVLL
Sbjct  649  NFVLALTDCIQEVADSRCAPLSTFMVAGSQSAAQAASADAQQIPPHAPEHCKRAERLVLL  708

Query  720  VRGLQLLSSGMNLASQQLRNGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKAN  779
            VRGLQLLSSGMNLASQQL NGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKAN
Sbjct  709  VRGLQLLSSGMNLASQQLSNGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKAN  768

Query  780  AFNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKCTHPQDKMLL  839
            AFNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKC HPQDKM+L
Sbjct  769  AFNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKCNHPQDKMML  828

Query  840  NKYRDAVEKRLSILQQHGYIYVTDENA  866
            NKYRDAVEKRLSILQQHGYIY+TDENA
Sbjct  829  NKYRDAVEKRLSILQQHGYIYMTDENA  855


>Q9VU14_DROME unnamed protein product
Length=835

 Score = 1648 bits (4267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 816/866 (94%), Positives = 823/866 (95%), Gaps = 31/866 (4%)

Query  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60
            MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK
Sbjct  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60

Query  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120
            ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA
Sbjct  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120

Query  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180
            MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS
Sbjct  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180

Query  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKFYYEQNANLAPKIP  240
            PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELK YYEQNANLAPKIP
Sbjct  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKSYYEQNANLAPKIP  240

Query  241  HGVSPDLRDLLLCLLRRNAKDRISYESFFVHRFLQGKKAAASSPGEHSSSNLRRRVSKTG  300
             GVSPDLRDLLLCLLRRN+KDRISYESFFVHRFLQGKKAA S                  
Sbjct  241  SGVSPDLRDLLLCLLRRNSKDRISYESFFVHRFLQGKKAAVS------------------  282

Query  301  VLAVDMPPLGGTPPAKAKSPLQQQLEQELQLVKLAEQQQKREREEQEAALEEEENTVSVV  360
               VDMPPLGGTPPAKAKSPLQQQLEQEL+LVKLAEQQQK EREEQEA  +E+ENTVSVV
Sbjct  283  --PVDMPPLGGTPPAKAKSPLQQQLEQELKLVKLAEQQQK-EREEQEA--QEDENTVSVV  337

Query  361  ANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQAQAQPASGG  420
            ANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQ QAQPASGG
Sbjct  338  ANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQVQAQPASGG  397

Query  421  QRPVPQQNQSSPPRPSSLPISEPKPVPAPARRQVANGSPARQGSVPLTVATLGGQQIPRS  480
            QRP  QQNQSSPPRPSSLPISEPKPVPAPARRQV     AR G  PLTVATLGGQQIPRS
Sbjct  398  QRPQQQQNQSSPPRPSSLPISEPKPVPAPARRQV-----ARPG--PLTVATLGGQQIPRS  450

Query  481  QPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTW  540
            QPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTW
Sbjct  451  QPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTW  510

Query  541  QVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQH  600
            QVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQH
Sbjct  511  QVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQH  570

Query  601  HMLGPRAFTLPELGATGGLHSLLDTGAGSGGGEPHAFQAPELSEETLMDREHNETLSKLN  660
            HMLGPRAFTLPELGATGGLHSLLDTGAG GGGEPHAFQAPELSEETLMDREHNETLSKLN
Sbjct  571  HMLGPRAFTLPELGATGGLHSLLDTGAG-GGGEPHAFQAPELSEETLMDREHNETLSKLN  629

Query  661  FVLALTDCIQEVADSRCAPLSTLMVAGSQSAAAAAAADAQQIPPHAPEHCKRAERLVLLV  720
            FVLALTDCIQEVADSRCAPLST MVAGSQSAA AA+ADAQQIPPHAPEHCKRAERLVLLV
Sbjct  630  FVLALTDCIQEVADSRCAPLSTFMVAGSQSAAQAASADAQQIPPHAPEHCKRAERLVLLV  689

Query  721  RGLQLLSSGMNLASQQLRNGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANA  780
            RGLQLLSSGMNLASQQL NGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANA
Sbjct  690  RGLQLLSSGMNLASQQLSNGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANA  749

Query  781  FNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKCTHPQDKMLLN  840
            FNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKC HPQDKM+LN
Sbjct  750  FNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKCNHPQDKMMLN  809

Query  841  KYRDAVEKRLSILQQHGYIYVTDENA  866
            KYRDAVEKRLSILQQHGYIY+TDENA
Sbjct  810  KYRDAVEKRLSILQQHGYIYMTDENA  835


>UNC51_CAEEL unnamed protein product
Length=856

 Score = 360 bits (924),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 179/269 (67%), Positives = 216/269 (80%), Gaps = 1/269 (0%)

Query  7    YEYSSKDMLGHGAFAVVYKGRH-RKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTEL  65
            +EYS +D+LGHGAFA+VY+GR+  +  +PVAIK I KK   K++NLL KEIKILKEL+ L
Sbjct  7    FEYSKRDLLGHGAFAIVYRGRYVDRTDVPVAIKAIAKKNISKSKNLLTKEIKILKELSSL  66

Query  66   HHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALY  125
             HEN+V LL C E+   V LVME+CNGGDLADYL  K TL+EDT++ F+VQ+A A++A+ 
Sbjct  67   KHENLVGLLKCTETPTHVYLVMEFCNGGDLADYLQQKTTLNEDTIQHFVVQIAHALEAIN  126

Query  126  TKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGSPMYMA  185
             KGIVHRDLKPQNILL +N     P  + I +K+ADFGFARFLN+G MAATLCGSPMYMA
Sbjct  127  KKGIVHRDLKPQNILLCNNSRTQNPHFTDIVIKLADFGFARFLNDGVMAATLCGSPMYMA  186

Query  186  PEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKFYYEQNANLAPKIPHGVSP  245
            PEVIMS+QYD+KADLWS+GTI++QCLTGKAPF AQTP +LK YYE+   L P IP   SP
Sbjct  187  PEVIMSMQYDAKADLWSIGTILFQCLTGKAPFVAQTPPQLKAYYEKTRELRPNIPEWCSP  246

Query  246  DLRDLLLCLLRRNAKDRISYESFFVHRFL  274
            +LRDLLL LL+RNAKDRIS+E FF H FL
Sbjct  247  NLRDLLLRLLKRNAKDRISFEDFFNHPFL  275


 Score = 151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 130/226 (58%), Gaps = 7/226 (3%)

Query  635  HAFQAPELSEETLMDREHNETLSKLNFVLALTDCIQEVADSRCAPLSTLMVAGSQSAAAA  694
            H    P L +E ++  EH + L+KL FV  L D +  VA+ +  PL++ M +  Q     
Sbjct  632  HGALPPALDQEIVLGEEHKQILAKLRFVAELVDTLIHVAEQKDNPLASAMASRRQLLTTG  691

Query  695  AAADAQQIPPHAPEHCKRAERLVLLVRGLQLLSSGMNLASQQLRNGQLKPSSNVKNALLT  754
             +      P       +RAE+LV+ VR L +LSS + LA   + N  L PS  V+  L  
Sbjct  692  TSTTNTSSP------YRRAEQLVVYVRALHMLSSALLLAQTNVANRVLHPSVAVQQVLNQ  745

Query  755  MNAKYRSMLFESKRLNGSGLLQKANAFN-ITADKILYDYALDMCQAAALDELLKNTKNCF  813
            +N KY   L  S+ L   GL  +  A   I+A++I+Y +A+++CQAAALDEL  N + C 
Sbjct  746  LNDKYHQCLVRSQELASLGLPGQDPAMAVISAERIMYRHAIELCQAAALDELFGNPQLCS  805

Query  814  ERYNTAHILLHSLVQKCTHPQDKMLLNKYRDAVEKRLSILQQHGYI  859
            +RY TA+++LH+L ++    QDK +L +Y+ AVEKRL IL++ G++
Sbjct  806  QRYQTAYMMLHTLAEQVNCDQDKTVLTRYKVAVEKRLRILERQGFV  851



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016382.1 serine/threonine-protein kinase unc-51 isoform X2
[Drosophila kikkawai]

Length=847
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU14_DROME  unnamed protein product                                 1654    0.0   
Q8MQJ7_DROME  unnamed protein product                                 1476    0.0   
UNC51_CAEEL  unnamed protein product                                  360     4e-111


>Q9VU14_DROME unnamed protein product
Length=835

 Score = 1654 bits (4284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 817/847 (96%), Positives = 824/847 (97%), Gaps = 12/847 (1%)

Query  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60
            MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK
Sbjct  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60

Query  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120
            ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA
Sbjct  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120

Query  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180
            MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS
Sbjct  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180

Query  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKFYYEQNANLAPKIP  240
            PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELK YYEQNANLAPKIP
Sbjct  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKSYYEQNANLAPKIP  240

Query  241  HGVSPDLRDLLLCLLRRNAKDRISYESFFVHRFLQGKKAAASSPVDMPPLGGTPPAKAKS  300
             GVSPDLRDLLLCLLRRN+KDRISYESFFVHRFLQGKKAA  SPVDMPPLGGTPPAKAKS
Sbjct  241  SGVSPDLRDLLLCLLRRNSKDRISYESFFVHRFLQGKKAAV-SPVDMPPLGGTPPAKAKS  299

Query  301  PLQQQLEQELQLVKLAEQQQKREREEQEAALEEEENTVSVVANPAICATITNVGVLCDSE  360
            PLQQQLEQEL+LVKLAEQQQK EREEQEA  +E+ENTVSVVANPAICATITNVGVLCDSE
Sbjct  300  PLQQQLEQELKLVKLAEQQQK-EREEQEA--QEDENTVSVVANPAICATITNVGVLCDSE  356

Query  361  NNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQAQAQPASGGQRPVPQQNQSSPPRPSSLP  420
            NNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQ QAQPASGGQRP  QQNQSSPPRPSSLP
Sbjct  357  NNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQVQAQPASGGQRPQQQQNQSSPPRPSSLP  416

Query  421  ISEPKPVPAPARRQVANGSPARQGSVPLTVATLGGQQIPRSQPISVKQPRPDQRKSSVSS  480
            ISEPKPVPAPARRQV     AR G  PLTVATLGGQQIPRSQPISVKQPRPDQRKSSVSS
Sbjct  417  ISEPKPVPAPARRQV-----ARPG--PLTVATLGGQQIPRSQPISVKQPRPDQRKSSVSS  469

Query  481  DINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTWQVSPGHSQSPLRRSGNSSP  540
            DINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTWQVSPGHSQSPLRRSGNSSP
Sbjct  470  DINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTWQVSPGHSQSPLRRSGNSSP  529

Query  541  VLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQHHMLGPRAFTLPELGATGGL  600
            VLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQHHMLGPRAFTLPELGATGGL
Sbjct  530  VLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQHHMLGPRAFTLPELGATGGL  589

Query  601  HSLLDTGAGSGGGEPHAFQAPELSEETLMDREHNETLSKLNFVLALTDCIQEVADSRCAP  660
            HSLLDTGAG GGGEPHAFQAPELSEETLMDREHNETLSKLNFVLALTDCIQEVADSRCAP
Sbjct  590  HSLLDTGAG-GGGEPHAFQAPELSEETLMDREHNETLSKLNFVLALTDCIQEVADSRCAP  648

Query  661  LSTLMVAGSQSAAAAAAADAQQIPPHAPEHCKRAERLVLLVRGLQLLSSGMNLASQQLRN  720
            LST MVAGSQSAA AA+ADAQQIPPHAPEHCKRAERLVLLVRGLQLLSSGMNLASQQL N
Sbjct  649  LSTFMVAGSQSAAQAASADAQQIPPHAPEHCKRAERLVLLVRGLQLLSSGMNLASQQLSN  708

Query  721  GQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANAFNITADKILYDYALDMCQA  780
            GQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANAFNITADKILYDYALDMCQA
Sbjct  709  GQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANAFNITADKILYDYALDMCQA  768

Query  781  AALDELLKNTKNCFERYNTAHILLHSLVQKCTHPQDKMLLNKYRDAVEKRLSILQQHGYI  840
            AALDELLKNTKNCFERYNTAHILLHSLVQKC HPQDKM+LNKYRDAVEKRLSILQQHGYI
Sbjct  769  AALDELLKNTKNCFERYNTAHILLHSLVQKCNHPQDKMMLNKYRDAVEKRLSILQQHGYI  828

Query  841  YVTDENA  847
            Y+TDENA
Sbjct  829  YMTDENA  835


>Q8MQJ7_DROME unnamed protein product
Length=855

 Score = 1476 bits (3822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 810/866 (94%), Positives = 818/866 (94%), Gaps = 30/866 (3%)

Query  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60
            MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK
Sbjct  1    MNIVGEYEYSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILK  60

Query  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120
            ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA
Sbjct  61   ELTELHHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGA  120

Query  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180
            MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS
Sbjct  121  MKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGS  180

Query  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKFYYEQNANLAPKIP  240
            PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELK YYEQNANLAPKIP
Sbjct  181  PMYMAPEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKSYYEQNANLAPKIP  240

Query  241  HGVSPDLRDLLLCLLRRNAKDRISYESFFVHRFLQGKKAAASS-----------------  283
             GVSPDLRDLLLCLLRRN+KDRISYESFFVHRFLQGKKAA S                  
Sbjct  241  SGVSPDLRDLLLCLLRRNSKDRISYESFFVHRFLQGKKAAVSPGEPSQAANLRRRVSKSG  300

Query  284  --PVDMPPLGGTPPAKAKSPLQQQLEQELQLVKLAEQQQKREREEQEAALEEEENTVSVV  341
              PVDMPPLGGTPPAKAKSPLQQQLEQEL+LVKLAEQQQK   E++      +ENTVSVV
Sbjct  301  VLPVDMPPLGGTPPAKAKSPLQQQLEQELKLVKLAEQQQKEREEQEAQE---DENTVSVV  357

Query  342  ANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQAQAQPASGG  401
            ANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQ QAQPASGG
Sbjct  358  ANPAICATITNVGVLCDSENNSGSCSSHEDSDDFVLVPKNLPEDQRQGLAQVQAQPASGG  417

Query  402  QRPVPQQNQSSPPRPSSLPISEPKPVPAPARRQVANGSPARQGSVPLTVATLGGQQIPRS  461
            QRP  QQNQSSPPRPSSLPISEPKPVPAPARRQV     AR G  PLTVATLGGQQIPRS
Sbjct  418  QRPQQQQNQSSPPRPSSLPISEPKPVPAPARRQV-----ARPG--PLTVATLGGQQIPRS  470

Query  462  QPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTW  521
            QPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTW
Sbjct  471  QPISVKQPRPDQRKSSVSSDINSISPPAVQFAIGTPPTRMRSASGGSLSETPPPHAPSTW  530

Query  522  QVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQH  581
            QVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQH
Sbjct  531  QVSPGHSQSPLRRSGNSSPVLPSAALTKLPTLGSPTMLVAPGSLGSIGSAGSGSENNNQH  590

Query  582  HMLGPRAFTLPELGATGGLHSLLDTGAGSGGGEPHAFQAPELSEETLMDREHNETLSKLN  641
            HMLGPRAFTLPELGATGGLHSLLDTGAG GGGEPHAFQAPELSEETLMDREHNETLSKLN
Sbjct  591  HMLGPRAFTLPELGATGGLHSLLDTGAG-GGGEPHAFQAPELSEETLMDREHNETLSKLN  649

Query  642  FVLALTDCIQEVADSRCAPLSTLMVAGSQSAAAAAAADAQQIPPHAPEHCKRAERLVLLV  701
            FVLALTDCIQEVADSRCAPLST MVAGSQSAA AA+ADAQQIPPHAPEHCKRAERLVLLV
Sbjct  650  FVLALTDCIQEVADSRCAPLSTFMVAGSQSAAQAASADAQQIPPHAPEHCKRAERLVLLV  709

Query  702  RGLQLLSSGMNLASQQLRNGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANA  761
            RGLQLLSSGMNLASQQL NGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANA
Sbjct  710  RGLQLLSSGMNLASQQLSNGQLKPSSNVKNALLTMNAKYRSMLFESKRLNGSGLLQKANA  769

Query  762  FNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKCTHPQDKMLLN  821
            FNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKC HPQDKM+LN
Sbjct  770  FNITADKILYDYALDMCQAAALDELLKNTKNCFERYNTAHILLHSLVQKCNHPQDKMMLN  829

Query  822  KYRDAVEKRLSILQQHGYIYVTDENA  847
            KYRDAVEKRLSILQQHGYIY+TDENA
Sbjct  830  KYRDAVEKRLSILQQHGYIYMTDENA  855


>UNC51_CAEEL unnamed protein product
Length=856

 Score = 360 bits (924),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/269 (67%), Positives = 216/269 (80%), Gaps = 1/269 (0%)

Query  7    YEYSSKDMLGHGAFAVVYKGRH-RKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTEL  65
            +EYS +D+LGHGAFA+VY+GR+  +  +PVAIK I KK   K++NLL KEIKILKEL+ L
Sbjct  7    FEYSKRDLLGHGAFAIVYRGRYVDRTDVPVAIKAIAKKNISKSKNLLTKEIKILKELSSL  66

Query  66   HHENVVALLDCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALY  125
             HEN+V LL C E+   V LVME+CNGGDLADYL  K TL+EDT++ F+VQ+A A++A+ 
Sbjct  67   KHENLVGLLKCTETPTHVYLVMEFCNGGDLADYLQQKTTLNEDTIQHFVVQIAHALEAIN  126

Query  126  TKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGSPMYMA  185
             KGIVHRDLKPQNILL +N     P  + I +K+ADFGFARFLN+G MAATLCGSPMYMA
Sbjct  127  KKGIVHRDLKPQNILLCNNSRTQNPHFTDIVIKLADFGFARFLNDGVMAATLCGSPMYMA  186

Query  186  PEVIMSLQYDSKADLWSLGTIVYQCLTGKAPFYAQTPNELKFYYEQNANLAPKIPHGVSP  245
            PEVIMS+QYD+KADLWS+GTI++QCLTGKAPF AQTP +LK YYE+   L P IP   SP
Sbjct  187  PEVIMSMQYDAKADLWSIGTILFQCLTGKAPFVAQTPPQLKAYYEKTRELRPNIPEWCSP  246

Query  246  DLRDLLLCLLRRNAKDRISYESFFVHRFL  274
            +LRDLLL LL+RNAKDRIS+E FF H FL
Sbjct  247  NLRDLLLRLLKRNAKDRISFEDFFNHPFL  275


 Score = 151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 130/226 (58%), Gaps = 7/226 (3%)

Query  616  HAFQAPELSEETLMDREHNETLSKLNFVLALTDCIQEVADSRCAPLSTLMVAGSQSAAAA  675
            H    P L +E ++  EH + L+KL FV  L D +  VA+ +  PL++ M +  Q     
Sbjct  632  HGALPPALDQEIVLGEEHKQILAKLRFVAELVDTLIHVAEQKDNPLASAMASRRQLLTTG  691

Query  676  AAADAQQIPPHAPEHCKRAERLVLLVRGLQLLSSGMNLASQQLRNGQLKPSSNVKNALLT  735
             +      P       +RAE+LV+ VR L +LSS + LA   + N  L PS  V+  L  
Sbjct  692  TSTTNTSSP------YRRAEQLVVYVRALHMLSSALLLAQTNVANRVLHPSVAVQQVLNQ  745

Query  736  MNAKYRSMLFESKRLNGSGLLQKANAFN-ITADKILYDYALDMCQAAALDELLKNTKNCF  794
            +N KY   L  S+ L   GL  +  A   I+A++I+Y +A+++CQAAALDEL  N + C 
Sbjct  746  LNDKYHQCLVRSQELASLGLPGQDPAMAVISAERIMYRHAIELCQAAALDELFGNPQLCS  805

Query  795  ERYNTAHILLHSLVQKCTHPQDKMLLNKYRDAVEKRLSILQQHGYI  840
            +RY TA+++LH+L ++    QDK +L +Y+ AVEKRL IL++ G++
Sbjct  806  QRYQTAYMMLHTLAEQVNCDQDKTVLTRYKVAVEKRLRILERQGFV  851



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016383.1 uncharacterized protein LOC108070427 [Drosophila
kikkawai]

Length=106
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q38AE6_TRYB2  unnamed protein product                                 28.9    0.70 
MYO4_CAEEL  unnamed protein product                                   28.9    0.91 
Q57XU5_TRYB2  unnamed protein product                                 26.2    7.5  


>Q38AE6_TRYB2 unnamed protein product
Length=1203

 Score = 28.9 bits (63),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 18/59 (31%), Positives = 27/59 (46%), Gaps = 2/59 (3%)

Query  50   RRDATGFTANQEV--KLKAGDMRIAQMQICISQLRTEMEESSKQLQDLCKAMLVDAESG  106
            RR ++ F   Q    ++KA        Q  +S +   +E+ S  LQD C   L DA +G
Sbjct  547  RRQSSVFATQQPTSSRMKANTRTRVTSQTQVSVVSNSLEKDSSVLQDSCTLSLTDAATG  605


>MYO4_CAEEL unnamed protein product
Length=1963

 Score = 28.9 bits (63),  Expect = 0.91, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (53%), Gaps = 4/85 (5%)

Query  15    GLHQEENAAVIEAANRLVIRPPTHRRPQRQRQPQGRRDATGFTA--NQEVKLKAGDMRIA  72
             GL ++   AV E  ++L        + ++ +  Q  RDA    A  +QE   K  + ++A
Sbjct  1200  GLRKKHTDAVAELTDQLDQLNKAKAKVEKDK-AQAVRDAEDLAAQLDQETSGKLNNEKLA  1258

Query  73    -QMQICISQLRTEMEESSKQLQDLC  96
              Q ++ +++L+++ +E S+QLQD  
Sbjct  1259  KQFELQLTELQSKADEQSRQLQDFT  1283


>Q57XU5_TRYB2 unnamed protein product
Length=1317

 Score = 26.2 bits (56),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 22/41 (54%), Gaps = 3/41 (7%)

Query  16   LHQEENAAVIEAANRLVIRPPTHRRPQRQRQPQGRRDATGF  56
            LH  E+AAV+  A+  V+ P +     ++RQ    R  +GF
Sbjct  685  LHHSESAAVVSNADTSVLSPHSQAPATKRRQ---HRTGSGF  722



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016384.1 leucine-rich repeat and transmembrane
domain-containing protein 2 [Drosophila kikkawai]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIT_DROME  unnamed protein product                                   79.7    2e-15
PXDN_DROME  unnamed protein product                                   77.8    7e-15
Q7KTA0_DROME  unnamed protein product                                 72.0    4e-13


>SLIT_DROME unnamed protein product
Length=1504

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 89/189 (47%), Gaps = 3/189 (2%)

Query  92   VLEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSR  151
            + E  CPR C C      V C++  LT VP  +      ++L  N +  +   DF  L++
Sbjct  68   ITEARCPRVCSCTG--LNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTK  125

Query  152  AVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
               + L  N I  I++  FQ    L+RLRL NNRL  I  +  +++  L++LD+SNN IT
Sbjct  126  LRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVIT  185

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLK  271
                  F    +L      N   T L E  F+ +  L++L LNNN+    +    F  L 
Sbjct  186  TVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLT-SLPHNIFGGLG  244

Query  272  NLIKLKLPE  280
             L  L+L +
Sbjct  245  RLRALRLSD  253


 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 77/172 (45%), Gaps = 2/172 (1%)

Query  94   EPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAV  153
            E SCP  C C +    V C    LT VP+ LP     + L  N I EL P+ F++  R  
Sbjct  316  ENSCPHPCRCADGI--VDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLR  373

Query  154  EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQR  213
             I L++N IS I  +   G ++L  L L  N++  +    F     L  L L+ N I+  
Sbjct  374  RIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCI  433

Query  214  LDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTR  265
               +F +  +L   S  + +   L   TF+ M +++ + L  N F    N R
Sbjct  434  RKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLR  485


 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (50%), Gaps = 25/117 (21%)

Query  143  PEDFANLSRAV-EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELI  201
            PE+F   S ++  + +++N+I+ + + VF+G++ L+ L+L NN++T +D   F    EL 
Sbjct  164  PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELE  223

Query  202  QLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
             L L+NN +                        T LP   F  +  L+ LRL++N F
Sbjct  224  ILTLNNNNL------------------------TSLPHNIFGGLGRLRALRLSDNPF  256


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 68/167 (41%), Gaps = 27/167 (16%)

Query  93   LEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRA  152
            ++  CP  C C  +   V CT   L  +P D+P                           
Sbjct  539  MDSDCPAMCHC--EGTTVDCTGRGLKEIPRDIPL------------------------HT  572

Query  153  VEITLNHNLISNIDKE-VFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
             E+ LN N +  I  + +F     L +L L  N+LT I+P+ F  A  + +L L  N I 
Sbjct  573  TELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK  632

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
            +  +  FL    L   +  +   + +   +FE++++L  L L +N F
Sbjct  633  EISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPF  679


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 2/122 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP +C C      V+C+   L  +P  +P   + + L  N I ++  E   +L     + 
Sbjct  739  CPPSCTCTGTV--VRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLD  796

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            L++N I+ +    F    +L  L ++ N+L  +     S    L  L L  N I+   +G
Sbjct  797  LSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEG  856

Query  217  SF  218
            SF
Sbjct  857  SF  858


 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 3/111 (3%)

Query  114  NAHLTHVPLDLPKTAAII---DLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVF  170
            N  L  +P +   ++A +   D+S+NVI  +    F        + L++N I+ +D+  F
Sbjct  157  NNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAF  216

Query  171  QGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQ  221
            +G   L+ L L NN LT +  + F     L  L LS+N        S+L++
Sbjct  217  KGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSR  267


 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 57/142 (40%), Gaps = 11/142 (8%)

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLI  274
            DG F   P+LV+        T +    FE  S +Q L+L  N  K +I+ + F  L  L 
Sbjct  588  DGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK-EISNKMFLGLHQLK  646

Query  275  KLKLPE----LDQPNIEELCNLLKSIDNISFRHFDVSCY-----ELVLGTSFNESLITAT  325
             L L +       P   E  N L S+ N++   F+ +C+     E +   S N       
Sbjct  647  TLNLYDNQISCVMPGSFEHLNSLTSL-NLASNPFNCNCHLAWFAEWLRKKSLNGGAARCG  705

Query  326  DPPFIRITNLPTLATSTAKPAT  347
             P  +R   +  L  S  K ++
Sbjct  706  APSKVRDVQIKDLPHSEFKCSS  727


 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query  179  LRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELP  238
            L L +N + +I  +     + L +LDLSNN IT   + +F N   L     S      L 
Sbjct  771  LYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQ  830

Query  239  EQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLIKLKL  278
                  ++ L+VL L+ N     +   +F  LK+L  + L
Sbjct  831  RHALSGLNNLRVLSLHGNRIS-MLPEGSFEDLKSLTHIAL  869


>PXDN_DROME unnamed protein product
Length=1527

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 77/160 (48%), Gaps = 3/160 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP  C CLE  + V+C  A L+ VP  LP+    +DL  N I EL    F+ L++   + 
Sbjct  26   CPAGCTCLE--RTVRCIRAKLSAVP-KLPQDTQTLDLRFNHIEELPANAFSGLAQLTTLF  82

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            LN N ++ +      G   L+ + L NNRL+++    F     L  + L NN I Q   G
Sbjct  83   LNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAG  142

Query  217  SFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
             F N P L      N   T+LP   F  ++ L+ LRL+ N
Sbjct  143  LFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGN  182


>Q7KTA0_DROME unnamed protein product
Length=1360

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 116/287 (40%), Gaps = 37/287 (13%)

Query  26   PAGSEEAKLLPNTDDDYDYNDDDYSDETTDKEVPETAENRLMPELSSSSTTTTFRPIFNI  85
            P G  E  +LP+ D + +      +    +K + E   ++L       ST +T   +   
Sbjct  90   PTGIRENVMLPSADPEKE------AQILYEKSLQEYHGSQL-------STASTATDVIAG  136

Query  86   PRRSNHVLEPSCPRNCLCLEDFKYVQ--CTNAHLTHVPLDLPKTAAIIDLSHNVIAELRP  143
             R  + + E    ++C C    + ++  C    +  VP++LP    ++DL +N + +L  
Sbjct  137  KRTLHSICERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEA  196

Query  144  EDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQL  203
              F       E+TL+ N I N+D   F G  +L+RL L N  L  + P +F    +L  L
Sbjct  197  NSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSL  256

Query  204  DLSNNTITQRLDGSFLNQ-PNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN------  256
             L+ N +   LDG  L     L         +  +P      +  L+ L L +N      
Sbjct  257  QLNGNALVS-LDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIN  315

Query  257  --DF------------KQQINTRAFTPLKNLIKLKLPELDQPNIEEL  289
              DF            + QI   +   LKNL  LK+ ELD   I  L
Sbjct  316  DEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSL  362


 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 8/106 (8%)

Query  130  IIDLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKI  189
            ++DLS N I +++ + F  L +  ++ L++N I  + ++ FQG  +LQ L L  N ++ I
Sbjct  489  LLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYI  548

Query  190  DPDTFSAAKELIQLDLSNNTITQRLDGSF--------LNQPNLVEF  227
              + FS    L  L+L NN   +  +            N P L EF
Sbjct  549  HKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREF  594


 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 3/102 (3%)

Query  155  ITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRL  214
            + L+ N I  I  + F G ++L  L L+ NR+  +  D F    +L  LDL  N I+   
Sbjct  490  LDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIH  549

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
              +F     L + +  N  + ELPE     + AL  L+  NN
Sbjct  550  KEAFSGFTALEDLNLGNNIFPELPE---SGLRALLHLKTFNN  588



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016385.1 leucine-rich repeat and transmembrane
domain-containing protein 2 [Drosophila kikkawai]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIT_DROME  unnamed protein product                                   79.7    2e-15
PXDN_DROME  unnamed protein product                                   77.8    7e-15
Q7KTA0_DROME  unnamed protein product                                 72.0    4e-13


>SLIT_DROME unnamed protein product
Length=1504

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 89/189 (47%), Gaps = 3/189 (2%)

Query  92   VLEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSR  151
            + E  CPR C C      V C++  LT VP  +      ++L  N +  +   DF  L++
Sbjct  68   ITEARCPRVCSCTG--LNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTK  125

Query  152  AVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
               + L  N I  I++  FQ    L+RLRL NNRL  I  +  +++  L++LD+SNN IT
Sbjct  126  LRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVIT  185

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLK  271
                  F    +L      N   T L E  F+ +  L++L LNNN+    +    F  L 
Sbjct  186  TVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLT-SLPHNIFGGLG  244

Query  272  NLIKLKLPE  280
             L  L+L +
Sbjct  245  RLRALRLSD  253


 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 77/172 (45%), Gaps = 2/172 (1%)

Query  94   EPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAV  153
            E SCP  C C +    V C    LT VP+ LP     + L  N I EL P+ F++  R  
Sbjct  316  ENSCPHPCRCADGI--VDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLR  373

Query  154  EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQR  213
             I L++N IS I  +   G ++L  L L  N++  +    F     L  L L+ N I+  
Sbjct  374  RIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCI  433

Query  214  LDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTR  265
               +F +  +L   S  + +   L   TF+ M +++ + L  N F    N R
Sbjct  434  RKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLR  485


 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (50%), Gaps = 25/117 (21%)

Query  143  PEDFANLSRAV-EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELI  201
            PE+F   S ++  + +++N+I+ + + VF+G++ L+ L+L NN++T +D   F    EL 
Sbjct  164  PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELE  223

Query  202  QLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
             L L+NN +                        T LP   F  +  L+ LRL++N F
Sbjct  224  ILTLNNNNL------------------------TSLPHNIFGGLGRLRALRLSDNPF  256


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 68/167 (41%), Gaps = 27/167 (16%)

Query  93   LEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRA  152
            ++  CP  C C  +   V CT   L  +P D+P                           
Sbjct  539  MDSDCPAMCHC--EGTTVDCTGRGLKEIPRDIPL------------------------HT  572

Query  153  VEITLNHNLISNIDKE-VFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
             E+ LN N +  I  + +F     L +L L  N+LT I+P+ F  A  + +L L  N I 
Sbjct  573  TELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK  632

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
            +  +  FL    L   +  +   + +   +FE++++L  L L +N F
Sbjct  633  EISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPF  679


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 2/122 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP +C C      V+C+   L  +P  +P   + + L  N I ++  E   +L     + 
Sbjct  739  CPPSCTCTGTV--VRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLD  796

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            L++N I+ +    F    +L  L ++ N+L  +     S    L  L L  N I+   +G
Sbjct  797  LSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEG  856

Query  217  SF  218
            SF
Sbjct  857  SF  858


 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 3/111 (3%)

Query  114  NAHLTHVPLDLPKTAAII---DLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVF  170
            N  L  +P +   ++A +   D+S+NVI  +    F        + L++N I+ +D+  F
Sbjct  157  NNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAF  216

Query  171  QGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQ  221
            +G   L+ L L NN LT +  + F     L  L LS+N        S+L++
Sbjct  217  KGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSR  267


 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 57/142 (40%), Gaps = 11/142 (8%)

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLI  274
            DG F   P+LV+        T +    FE  S +Q L+L  N  K +I+ + F  L  L 
Sbjct  588  DGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK-EISNKMFLGLHQLK  646

Query  275  KLKLPE----LDQPNIEELCNLLKSIDNISFRHFDVSCY-----ELVLGTSFNESLITAT  325
             L L +       P   E  N L S+ N++   F+ +C+     E +   S N       
Sbjct  647  TLNLYDNQISCVMPGSFEHLNSLTSL-NLASNPFNCNCHLAWFAEWLRKKSLNGGAARCG  705

Query  326  DPPFIRITNLPTLATSTAKPAT  347
             P  +R   +  L  S  K ++
Sbjct  706  APSKVRDVQIKDLPHSEFKCSS  727


 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query  179  LRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELP  238
            L L +N + +I  +     + L +LDLSNN IT   + +F N   L     S      L 
Sbjct  771  LYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQ  830

Query  239  EQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLIKLKL  278
                  ++ L+VL L+ N     +   +F  LK+L  + L
Sbjct  831  RHALSGLNNLRVLSLHGNRIS-MLPEGSFEDLKSLTHIAL  869


>PXDN_DROME unnamed protein product
Length=1527

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 77/160 (48%), Gaps = 3/160 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP  C CLE  + V+C  A L+ VP  LP+    +DL  N I EL    F+ L++   + 
Sbjct  26   CPAGCTCLE--RTVRCIRAKLSAVP-KLPQDTQTLDLRFNHIEELPANAFSGLAQLTTLF  82

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            LN N ++ +      G   L+ + L NNRL+++    F     L  + L NN I Q   G
Sbjct  83   LNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAG  142

Query  217  SFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
             F N P L      N   T+LP   F  ++ L+ LRL+ N
Sbjct  143  LFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGN  182


>Q7KTA0_DROME unnamed protein product
Length=1360

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 116/287 (40%), Gaps = 37/287 (13%)

Query  26   PAGSEEAKLLPNTDDDYDYNDDDYSDETTDKEVPETAENRLMPELSSSSTTTTFRPIFNI  85
            P G  E  +LP+ D + +      +    +K + E   ++L       ST +T   +   
Sbjct  90   PTGIRENVMLPSADPEKE------AQILYEKSLQEYHGSQL-------STASTATDVIAG  136

Query  86   PRRSNHVLEPSCPRNCLCLEDFKYVQ--CTNAHLTHVPLDLPKTAAIIDLSHNVIAELRP  143
             R  + + E    ++C C    + ++  C    +  VP++LP    ++DL +N + +L  
Sbjct  137  KRTLHSICERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEA  196

Query  144  EDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQL  203
              F       E+TL+ N I N+D   F G  +L+RL L N  L  + P +F    +L  L
Sbjct  197  NSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSL  256

Query  204  DLSNNTITQRLDGSFLNQ-PNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN------  256
             L+ N +   LDG  L     L         +  +P      +  L+ L L +N      
Sbjct  257  QLNGNALVS-LDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIN  315

Query  257  --DF------------KQQINTRAFTPLKNLIKLKLPELDQPNIEEL  289
              DF            + QI   +   LKNL  LK+ ELD   I  L
Sbjct  316  DEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSL  362


 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 8/106 (8%)

Query  130  IIDLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKI  189
            ++DLS N I +++ + F  L +  ++ L++N I  + ++ FQG  +LQ L L  N ++ I
Sbjct  489  LLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYI  548

Query  190  DPDTFSAAKELIQLDLSNNTITQRLDGSF--------LNQPNLVEF  227
              + FS    L  L+L NN   +  +            N P L EF
Sbjct  549  HKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREF  594


 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 3/102 (3%)

Query  155  ITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRL  214
            + L+ N I  I  + F G ++L  L L+ NR+  +  D F    +L  LDL  N I+   
Sbjct  490  LDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIH  549

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
              +F     L + +  N  + ELPE     + AL  L+  NN
Sbjct  550  KEAFSGFTALEDLNLGNNIFPELPE---SGLRALLHLKTFNN  588



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016386.1 leucine-rich repeat and transmembrane
domain-containing protein 2 [Drosophila kikkawai]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIT_DROME  unnamed protein product                                   79.7    2e-15
PXDN_DROME  unnamed protein product                                   77.8    7e-15
Q7KTA0_DROME  unnamed protein product                                 72.0    4e-13


>SLIT_DROME unnamed protein product
Length=1504

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 89/189 (47%), Gaps = 3/189 (2%)

Query  92   VLEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSR  151
            + E  CPR C C      V C++  LT VP  +      ++L  N +  +   DF  L++
Sbjct  68   ITEARCPRVCSCTG--LNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTK  125

Query  152  AVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
               + L  N I  I++  FQ    L+RLRL NNRL  I  +  +++  L++LD+SNN IT
Sbjct  126  LRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVIT  185

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLK  271
                  F    +L      N   T L E  F+ +  L++L LNNN+    +    F  L 
Sbjct  186  TVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLT-SLPHNIFGGLG  244

Query  272  NLIKLKLPE  280
             L  L+L +
Sbjct  245  RLRALRLSD  253


 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 77/172 (45%), Gaps = 2/172 (1%)

Query  94   EPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAV  153
            E SCP  C C +    V C    LT VP+ LP     + L  N I EL P+ F++  R  
Sbjct  316  ENSCPHPCRCADGI--VDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLR  373

Query  154  EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQR  213
             I L++N IS I  +   G ++L  L L  N++  +    F     L  L L+ N I+  
Sbjct  374  RIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCI  433

Query  214  LDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTR  265
               +F +  +L   S  + +   L   TF+ M +++ + L  N F    N R
Sbjct  434  RKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLR  485


 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (50%), Gaps = 25/117 (21%)

Query  143  PEDFANLSRAV-EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELI  201
            PE+F   S ++  + +++N+I+ + + VF+G++ L+ L+L NN++T +D   F    EL 
Sbjct  164  PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELE  223

Query  202  QLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
             L L+NN +                        T LP   F  +  L+ LRL++N F
Sbjct  224  ILTLNNNNL------------------------TSLPHNIFGGLGRLRALRLSDNPF  256


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 68/167 (41%), Gaps = 27/167 (16%)

Query  93   LEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRA  152
            ++  CP  C C  +   V CT   L  +P D+P                           
Sbjct  539  MDSDCPAMCHC--EGTTVDCTGRGLKEIPRDIPL------------------------HT  572

Query  153  VEITLNHNLISNIDKE-VFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
             E+ LN N +  I  + +F     L +L L  N+LT I+P+ F  A  + +L L  N I 
Sbjct  573  TELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK  632

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
            +  +  FL    L   +  +   + +   +FE++++L  L L +N F
Sbjct  633  EISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPF  679


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 2/122 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP +C C      V+C+   L  +P  +P   + + L  N I ++  E   +L     + 
Sbjct  739  CPPSCTCTGTV--VRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLD  796

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            L++N I+ +    F    +L  L ++ N+L  +     S    L  L L  N I+   +G
Sbjct  797  LSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEG  856

Query  217  SF  218
            SF
Sbjct  857  SF  858


 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 3/111 (3%)

Query  114  NAHLTHVPLDLPKTAAII---DLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVF  170
            N  L  +P +   ++A +   D+S+NVI  +    F        + L++N I+ +D+  F
Sbjct  157  NNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAF  216

Query  171  QGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQ  221
            +G   L+ L L NN LT +  + F     L  L LS+N        S+L++
Sbjct  217  KGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSR  267


 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 57/142 (40%), Gaps = 11/142 (8%)

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLI  274
            DG F   P+LV+        T +    FE  S +Q L+L  N  K +I+ + F  L  L 
Sbjct  588  DGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK-EISNKMFLGLHQLK  646

Query  275  KLKLPE----LDQPNIEELCNLLKSIDNISFRHFDVSCY-----ELVLGTSFNESLITAT  325
             L L +       P   E  N L S+ N++   F+ +C+     E +   S N       
Sbjct  647  TLNLYDNQISCVMPGSFEHLNSLTSL-NLASNPFNCNCHLAWFAEWLRKKSLNGGAARCG  705

Query  326  DPPFIRITNLPTLATSTAKPAT  347
             P  +R   +  L  S  K ++
Sbjct  706  APSKVRDVQIKDLPHSEFKCSS  727


 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query  179  LRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELP  238
            L L +N + +I  +     + L +LDLSNN IT   + +F N   L     S      L 
Sbjct  771  LYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQ  830

Query  239  EQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLIKLKL  278
                  ++ L+VL L+ N     +   +F  LK+L  + L
Sbjct  831  RHALSGLNNLRVLSLHGNRIS-MLPEGSFEDLKSLTHIAL  869


>PXDN_DROME unnamed protein product
Length=1527

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 77/160 (48%), Gaps = 3/160 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP  C CLE  + V+C  A L+ VP  LP+    +DL  N I EL    F+ L++   + 
Sbjct  26   CPAGCTCLE--RTVRCIRAKLSAVP-KLPQDTQTLDLRFNHIEELPANAFSGLAQLTTLF  82

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            LN N ++ +      G   L+ + L NNRL+++    F     L  + L NN I Q   G
Sbjct  83   LNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAG  142

Query  217  SFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
             F N P L      N   T+LP   F  ++ L+ LRL+ N
Sbjct  143  LFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGN  182


>Q7KTA0_DROME unnamed protein product
Length=1360

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 116/287 (40%), Gaps = 37/287 (13%)

Query  26   PAGSEEAKLLPNTDDDYDYNDDDYSDETTDKEVPETAENRLMPELSSSSTTTTFRPIFNI  85
            P G  E  +LP+ D + +      +    +K + E   ++L       ST +T   +   
Sbjct  90   PTGIRENVMLPSADPEKE------AQILYEKSLQEYHGSQL-------STASTATDVIAG  136

Query  86   PRRSNHVLEPSCPRNCLCLEDFKYVQ--CTNAHLTHVPLDLPKTAAIIDLSHNVIAELRP  143
             R  + + E    ++C C    + ++  C    +  VP++LP    ++DL +N + +L  
Sbjct  137  KRTLHSICERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEA  196

Query  144  EDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQL  203
              F       E+TL+ N I N+D   F G  +L+RL L N  L  + P +F    +L  L
Sbjct  197  NSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSL  256

Query  204  DLSNNTITQRLDGSFLNQ-PNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN------  256
             L+ N +   LDG  L     L         +  +P      +  L+ L L +N      
Sbjct  257  QLNGNALVS-LDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIN  315

Query  257  --DF------------KQQINTRAFTPLKNLIKLKLPELDQPNIEEL  289
              DF            + QI   +   LKNL  LK+ ELD   I  L
Sbjct  316  DEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSL  362


 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 8/106 (8%)

Query  130  IIDLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKI  189
            ++DLS N I +++ + F  L +  ++ L++N I  + ++ FQG  +LQ L L  N ++ I
Sbjct  489  LLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYI  548

Query  190  DPDTFSAAKELIQLDLSNNTITQRLDGSF--------LNQPNLVEF  227
              + FS    L  L+L NN   +  +            N P L EF
Sbjct  549  HKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREF  594


 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 3/102 (3%)

Query  155  ITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRL  214
            + L+ N I  I  + F G ++L  L L+ NR+  +  D F    +L  LDL  N I+   
Sbjct  490  LDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIH  549

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
              +F     L + +  N  + ELPE     + AL  L+  NN
Sbjct  550  KEAFSGFTALEDLNLGNNIFPELPE---SGLRALLHLKTFNN  588



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016387.1 leucine-rich repeat and transmembrane
domain-containing protein 2 [Drosophila kikkawai]

Length=463
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SLIT_DROME  unnamed protein product                                   79.7    2e-15
PXDN_DROME  unnamed protein product                                   77.8    7e-15
Q7KTA0_DROME  unnamed protein product                                 72.0    4e-13


>SLIT_DROME unnamed protein product
Length=1504

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 89/189 (47%), Gaps = 3/189 (2%)

Query  92   VLEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSR  151
            + E  CPR C C      V C++  LT VP  +      ++L  N +  +   DF  L++
Sbjct  68   ITEARCPRVCSCTG--LNVDCSHRGLTSVPRKISADVERLELQGNNLTVIYETDFQRLTK  125

Query  152  AVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
               + L  N I  I++  FQ    L+RLRL NNRL  I  +  +++  L++LD+SNN IT
Sbjct  126  LRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRLKAIPENFVTSSASLLRLDISNNVIT  185

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLK  271
                  F    +L      N   T L E  F+ +  L++L LNNN+    +    F  L 
Sbjct  186  TVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELEILTLNNNNLT-SLPHNIFGGLG  244

Query  272  NLIKLKLPE  280
             L  L+L +
Sbjct  245  RLRALRLSD  253


 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 77/172 (45%), Gaps = 2/172 (1%)

Query  94   EPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAV  153
            E SCP  C C +    V C    LT VP+ LP     + L  N I EL P+ F++  R  
Sbjct  316  ENSCPHPCRCADGI--VDCREKSLTSVPVTLPDDTTELRLEQNFITELPPKSFSSFRRLR  373

Query  154  EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQR  213
             I L++N IS I  +   G ++L  L L  N++  +    F     L  L L+ N I+  
Sbjct  374  RIDLSNNNISRIAHDALSGLKQLTTLVLYGNKIKDLPSGVFKGLGSLQLLLLNANEISCI  433

Query  214  LDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTR  265
               +F +  +L   S  + +   L   TF+ M +++ + L  N F    N R
Sbjct  434  RKDAFRDLHSLSLLSLYDNNIQSLANGTFDAMKSIKTVHLAKNPFICDCNLR  485


 Score = 52.4 bits (124),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 58/117 (50%), Gaps = 25/117 (21%)

Query  143  PEDFANLSRAV-EITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELI  201
            PE+F   S ++  + +++N+I+ + + VF+G++ L+ L+L NN++T +D   F    EL 
Sbjct  164  PENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAFKGLVELE  223

Query  202  QLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
             L L+NN +                        T LP   F  +  L+ LRL++N F
Sbjct  224  ILTLNNNNL------------------------TSLPHNIFGGLGRLRALRLSDNPF  256


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/167 (25%), Positives = 68/167 (41%), Gaps = 27/167 (16%)

Query  93   LEPSCPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRA  152
            ++  CP  C C  +   V CT   L  +P D+P                           
Sbjct  539  MDSDCPAMCHC--EGTTVDCTGRGLKEIPRDIPL------------------------HT  572

Query  153  VEITLNHNLISNIDKE-VFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTIT  211
             E+ LN N +  I  + +F     L +L L  N+LT I+P+ F  A  + +L L  N I 
Sbjct  573  TELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK  632

Query  212  QRLDGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDF  258
            +  +  FL    L   +  +   + +   +FE++++L  L L +N F
Sbjct  633  EISNKMFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPF  679


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 53/122 (43%), Gaps = 2/122 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP +C C      V+C+   L  +P  +P   + + L  N I ++  E   +L     + 
Sbjct  739  CPPSCTCTGTV--VRCSRNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLD  796

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            L++N I+ +    F    +L  L ++ N+L  +     S    L  L L  N I+   +G
Sbjct  797  LSNNQITILSNYTFANLTKLSTLIISYNKLQCLQRHALSGLNNLRVLSLHGNRISMLPEG  856

Query  217  SF  218
            SF
Sbjct  857  SF  858


 Score = 42.0 bits (97),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/111 (28%), Positives = 53/111 (48%), Gaps = 3/111 (3%)

Query  114  NAHLTHVPLDLPKTAAII---DLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVF  170
            N  L  +P +   ++A +   D+S+NVI  +    F        + L++N I+ +D+  F
Sbjct  157  NNRLKAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCLDEHAF  216

Query  171  QGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQ  221
            +G   L+ L L NN LT +  + F     L  L LS+N        S+L++
Sbjct  217  KGLVELEILTLNNNNLTSLPHNIFGGLGRLRALRLSDNPFACDCHLSWLSR  267


 Score = 32.0 bits (71),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 57/142 (40%), Gaps = 11/142 (8%)

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLI  274
            DG F   P+LV+        T +    FE  S +Q L+L  N  K +I+ + F  L  L 
Sbjct  588  DGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLGENKIK-EISNKMFLGLHQLK  646

Query  275  KLKLPE----LDQPNIEELCNLLKSIDNISFRHFDVSCY-----ELVLGTSFNESLITAT  325
             L L +       P   E  N L S+ N++   F+ +C+     E +   S N       
Sbjct  647  TLNLYDNQISCVMPGSFEHLNSLTSL-NLASNPFNCNCHLAWFAEWLRKKSLNGGAARCG  705

Query  326  DPPFIRITNLPTLATSTAKPAT  347
             P  +R   +  L  S  K ++
Sbjct  706  APSKVRDVQIKDLPHSEFKCSS  727


 Score = 30.8 bits (68),  Expect = 2.8, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 44/100 (44%), Gaps = 1/100 (1%)

Query  179  LRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDGSFLNQPNLVEFSCSNCSWTELP  238
            L L +N + +I  +     + L +LDLSNN IT   + +F N   L     S      L 
Sbjct  771  LYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKLQCLQ  830

Query  239  EQTFENMSALQVLRLNNNDFKQQINTRAFTPLKNLIKLKL  278
                  ++ L+VL L+ N     +   +F  LK+L  + L
Sbjct  831  RHALSGLNNLRVLSLHGNRIS-MLPEGSFEDLKSLTHIAL  869


>PXDN_DROME unnamed protein product
Length=1527

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 77/160 (48%), Gaps = 3/160 (2%)

Query  97   CPRNCLCLEDFKYVQCTNAHLTHVPLDLPKTAAIIDLSHNVIAELRPEDFANLSRAVEIT  156
            CP  C CLE  + V+C  A L+ VP  LP+    +DL  N I EL    F+ L++   + 
Sbjct  26   CPAGCTCLE--RTVRCIRAKLSAVP-KLPQDTQTLDLRFNHIEELPANAFSGLAQLTTLF  82

Query  157  LNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRLDG  216
            LN N ++ +      G   L+ + L NNRL+++    F     L  + L NN I Q   G
Sbjct  83   LNDNELAYLQDGALNGLTALRFVYLNNNRLSRLPATIFQRMPRLEAIFLENNDIWQLPAG  142

Query  217  SFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
             F N P L      N   T+LP   F  ++ L+ LRL+ N
Sbjct  143  LFDNLPRLNRLIMYNNKLTQLPVDGFNRLNNLKRLRLDGN  182


>Q7KTA0_DROME unnamed protein product
Length=1360

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 72/287 (25%), Positives = 116/287 (40%), Gaps = 37/287 (13%)

Query  26   PAGSEEAKLLPNTDDDYDYNDDDYSDETTDKEVPETAENRLMPELSSSSTTTTFRPIFNI  85
            P G  E  +LP+ D + +      +    +K + E   ++L       ST +T   +   
Sbjct  90   PTGIRENVMLPSADPEKE------AQILYEKSLQEYHGSQL-------STASTATDVIAG  136

Query  86   PRRSNHVLEPSCPRNCLCLEDFKYVQ--CTNAHLTHVPLDLPKTAAIIDLSHNVIAELRP  143
             R  + + E    ++C C    + ++  C    +  VP++LP    ++DL +N + +L  
Sbjct  137  KRTLHSICERWLQKHCHCTGSLEVLRLSCRGIGILAVPVNLPNEVVVLDLGNNNLTKLEA  196

Query  144  EDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQL  203
              F       E+TL+ N I N+D   F G  +L+RL L N  L  + P +F    +L  L
Sbjct  197  NSFFMAPNLEELTLSDNSIINMDPNAFYGLAKLKRLSLQNCGLKSLPPQSFQGLAQLTSL  256

Query  204  DLSNNTITQRLDGSFLNQ-PNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN------  256
             L+ N +   LDG  L     L         +  +P      +  L+ L L +N      
Sbjct  257  QLNGNALVS-LDGDCLGHLQKLRTLRLEGNLFYRIPTNALAGLRTLEALNLGSNLLTIIN  315

Query  257  --DF------------KQQINTRAFTPLKNLIKLKLPELDQPNIEEL  289
              DF            + QI   +   LKNL  LK+ ELD   I  L
Sbjct  316  DEDFPRMPNLIVLLLKRNQIMKISAGALKNLTALKVLELDDNLISSL  362


 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 52/106 (49%), Gaps = 8/106 (8%)

Query  130  IIDLSHNVIAELRPEDFANLSRAVEITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKI  189
            ++DLS N I +++ + F  L +  ++ L++N I  + ++ FQG  +LQ L L  N ++ I
Sbjct  489  LLDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYI  548

Query  190  DPDTFSAAKELIQLDLSNNTITQRLDGSF--------LNQPNLVEF  227
              + FS    L  L+L NN   +  +            N P L EF
Sbjct  549  HKEAFSGFTALEDLNLGNNIFPELPESGLRALLHLKTFNNPKLREF  594


 Score = 38.5 bits (88),  Expect = 0.014, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 3/102 (3%)

Query  155  ITLNHNLISNIDKEVFQGSERLQRLRLANNRLTKIDPDTFSAAKELIQLDLSNNTITQRL  214
            + L+ N I  I  + F G ++L  L L+ NR+  +  D F    +L  LDL  N I+   
Sbjct  490  LDLSSNQIEKIQGKPFNGLKQLNDLLLSYNRIKALPQDAFQGIPKLQLLDLEGNEISYIH  549

Query  215  DGSFLNQPNLVEFSCSNCSWTELPEQTFENMSALQVLRLNNN  256
              +F     L + +  N  + ELPE     + AL  L+  NN
Sbjct  550  KEAFSGFTALEDLNLGNNIFPELPE---SGLRALLHLKTFNN  588



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016388.1 uncharacterized protein LOC108070431 isoform X1
[Drosophila kikkawai]

Length=1690
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU76_DROME  unnamed protein product                                 2225    0.0  
M9PFE5_DROME  unnamed protein product                                 2182    0.0  
M9PFI2_DROME  unnamed protein product                                 2178    0.0  


>Q9VU76_DROME unnamed protein product
Length=1657

 Score = 2225 bits (5766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1295/1734 (75%), Positives = 1417/1734 (82%), Gaps = 121/1734 (7%)

Query  1     MAPPLKQAADHGSSAS-----SNNNSVGGATGAVPKQQQQLQVNGASTGGTATNRSARSR  55
             MAPP K   D  ++++     SNNNSVGGATGAVPKQQ    VNGA T G++ + ++   
Sbjct  1     MAPPPKVVVDQANASARSNGSSNNNSVGGATGAVPKQQ--TPVNGAPTSGSSASVTSSRS  58

Query  56    R----QQEHLGEPDMDFVEP--LQRETLKTLNELLQRARITNGQIRTQEDQLSGISSTET  109
                  QQEHLGEPDM+ VEP  LQRETLKTLN+LLQRARITN + R+  +Q   +SS + 
Sbjct  59    ARSRRQQEHLGEPDMELVEPETLQRETLKTLNDLLQRARITNAKNRSPAEQ--HLSSKDH  116

Query  110   RPPAQQQ--REVLRQLAAEHSSSYDSSEQLQEQQQRYRFPVRPVQRVQHQPSTTSSSTAL  167
             R PAQQQ  RE LRQLAAEH + YD++EQLQEQQQRYRFPVRPVQRVQHQPS++++ST  
Sbjct  117   RSPAQQQQQREALRQLAAEHGN-YDTAEQLQEQQQRYRFPVRPVQRVQHQPSSSANSTG-  174

Query  168   AAPGSSSSTLQRLRQSTPPNAAVGVVIPNATTSNGNVNGNFSGTEEQQ-----SGLQTLV  222
              AP SSS+ L RLRQSTPPNA VGVVIPNATTSNGN  GN SG EEQ      +GLQ LV
Sbjct  175   -AP-SSSTALLRLRQSTPPNATVGVVIPNATTSNGN--GNLSGNEEQAPPLTPAGLQQLV  230

Query  223   HRLLSLPGLSSRSEAGRSQVEVWRSMLELVDNLNSNRQPSSANPVEDIYNMVHEINPSAE  282
             HRLL +   + R+E  RSQV+V R++L L +NLNS  QPS    V +  NMVHEINP+++
Sbjct  231   HRLLGVHHFAPRTEGFRSQVDVLRALLGLDENLNSRYQPSRK--VVETNNMVHEINPNSD  288

Query  283   QDEGIVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPTFDELQQRLEASNRNMQ  342
             Q EG+VNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTP+FDELQQRLEASNRNMQ
Sbjct  289   QGEGVVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPSFDELQQRLEASNRNMQ  348

Query  343   HLQDEQAKLLHIQNLAKSHLTEMEQLRQQADQLPHTSNGGEAPKYESVQQVQDDMASLVG  402
             HL DEQAKLL IQNLAK+HL EME+LRQQAD LPH  NGGEAPKYESVQQVQDDMASLVG
Sbjct  349   HLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYESVQQVQDDMASLVG  408

Query  403   RMKNLTAFIHNQNELSTVLGDDGPEILAEQQALQEKLEALRSQRADMRNLVDELNSINRT  462
             RMKNLTAFIHNQNELSTVLGDDGPEILAEQ+ALQEKLE+LR+QR DMRNLVDELNSINR 
Sbjct  409   RMKNLTAFIHNQNELSTVLGDDGPEILAEQEALQEKLESLRTQREDMRNLVDELNSINRA  468

Query  463   ARETARPVREETPTPPAKPAQAPAPTPAPAPAPASAPAKERVVPVEYTRNVPIMRQEAAN  522
             ARETAR ++E+  TP   P              A A  KERVVPVEY RNVPI+RQEAAN
Sbjct  469   ARETARVIKEKEETPTPPPKPE---------EAAPAAPKERVVPVEYQRNVPIIRQEAAN  519

Query  523   AAQRALHAQNMINKKTADIEALKAQMAKLKGMLNTVSQIEESVPAMGAALERRSEERTSV  582
             AAQRALHAQ MIN+KTADIEALKAQMA+LKGML TVSQIEES P+MG+ LERRSEERTSV
Sbjct  520   AAQRALHAQAMINQKTADIEALKAQMARLKGMLYTVSQIEESTPSMGSTLERRSEERTSV  579

Query  583   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGEEA  642
             ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMG++A
Sbjct  580   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGDDA  639

Query  643   LKRSSLTPTPTPMRQQQVAQEEEDEEEEDEDPSSLQATPSKEQLRDELRLQCERLRKEYE  702
             LKRSSLTPTPTPMRQ+    EEED  E D   +SLQATP+KEQLRDELR QCERLR EYE
Sbjct  640   LKRSSLTPTPTPMRQRMT--EEEDPSEVD---NSLQATPTKEQLRDELRSQCERLRTEYE  694

Query  703   QKQRELEQRYVASNNTTSEADDEGNDDTDSDKYFANARTASSATLKRAASANTVVEQRRS  762
             QKQRELEQRYVASNNTTSEADDE NDDTDSDKYFAN RTASSATLKRA SANTVVEQRR 
Sbjct  695   QKQRELEQRYVASNNTTSEADDEANDDTDSDKYFANVRTASSATLKRAPSANTVVEQRRG  754

Query  763   --QPSGTQPPAPPAPPAPPSTLNEDDLNVTIDTLSLGNDSLPSSS-RSQYMPPPMPPVPG  819
                    Q   PP PPAPPSTLNEDDLNVT+DTLSLGNDS+PSSS RSQYMPPPM PVPG
Sbjct  755   QQPNVPPQQAPPPPPPAPPSTLNEDDLNVTLDTLSLGNDSIPSSSNRSQYMPPPMQPVPG  814

Query  820   MWASHNSGTSWHGQQPIYGQASTNAGTEFKPTPAATQLGSSNASGSNASSDAMLLQQFMQ  879
             MWASHNSG+SWHGQQP+YGQ S++AGTEFK  PAA Q GSSN SGSNAS+DA+LLQQFMQ
Sbjct  815   MWASHNSGSSWHGQQPVYGQPSSSAGTEFKKLPAAQQGGSSNGSGSNASTDAVLLQQFMQ  874

Query  880   TQQMLINSVCQCNQTLWHQQREIDNLNTQIHALQDRLSVVACQDHGFGLRSESVPPPNLN  939
             TQQMLINSVCQCNQ LWHQQREIDNLN Q+HALQDR +VVACQDH FGLRSESVPPP   
Sbjct  875   TQQMLINSVCQCNQALWHQQREIDNLNHQLHALQDRFNVVACQDHSFGLRSESVPPP---  931

Query  940   VGPGLGQTPNNLCLGSSRAQSEQLYGFSAHQSAFSNYQRSCHRTGGDPHHHQQPPQQ---  996
             VGPG+GQ PNNLCLGSSRAQSEQL+ F AHQSAFSNYQRSCHR+G + HHHQQ   Q   
Sbjct  932   VGPGMGQMPNNLCLGSSRAQSEQLFNFGAHQSAFSNYQRSCHRSGAESHHHQQQQHQAQP  991

Query  997   FLNNAAPPPPPTHYNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNANLRTQNQYANNLHS  1056
             FLNNAAPPPPPTH+NNETPLSPPTYRSSPGPIFMNHHNNTIHQNN+NLRTQNQ+ANNLHS
Sbjct  992   FLNNAAPPPPPTHFNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNSNLRTQNQHANNLHS  1051

Query  1057  LPEGAGGAPGGGGGVSAGAGVTLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVD  1116
             LPEGA G        + G G+TLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVD
Sbjct  1052  LPEGAAGG------GAPGGGITLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVD  1105

Query  1117  LQLYRRQRARPSYFQPSQLLGALPSARNGLIHQQQQQQQRRQFFESPLTT----ALPGSN  1172
             LQ YRRQRARPSYFQP QLL   P+ R GL H    QQQRR FFE+PLT     +  GSN
Sbjct  1106  LQQYRRQRARPSYFQPPQLLP--PTTRGGLTH----QQQRRHFFEAPLTALHGSSSNGSN  1159

Query  1173  NLNNSGGSARKRDWREDPGSHVDRDHEDEDMDDVEENHDNVIFGAGRRRNRRRPQLSTLR  1232
             NLNNSG S RKRDWR+D G H+ RDH+DED+D+VEENHDNVIFG+GRRRNRRRPQLSTLR
Sbjct  1160  NLNNSGSSGRKRDWRDDAG-HI-RDHDDEDVDEVEENHDNVIFGSGRRRNRRRPQLSTLR  1217

Query  1233  DEDPEQANSSNLNMNVNYGNSPLYQRNKVPAKPSTSAVSLTPLQQRHLRFDFELPAQYME  1292
             D++ EQA+SSNLNMNVNYGNSPLYQRNKVPAKP+TS VSLTPLQQRHLRFDFELPA YM+
Sbjct  1218  DDESEQASSSNLNMNVNYGNSPLYQRNKVPAKPTTSTVSLTPLQQRHLRFDFELPAHYMD  1277

Query  1293  F-EMPQVA-ADTTPLLGQEATPADESNALEQTEETASEELNRNLLVNALKNDKFTTKFYE  1350
             + E+PQ+   DTTP LGQEA+PADESNA+EQTEETASEELNRNLLVNALKNDKFTTKFYE
Sbjct  1278  YIELPQITPVDTTPTLGQEASPADESNAMEQTEETASEELNRNLLVNALKNDKFTTKFYE  1337

Query  1351  SIKEDVYRRLETLFE--------QQQQQHQLQQSQEPHSLRKALNQEENEPAGDAEEDAD  1402
             SIKEDVYRRLETLFE        QQQQ  QLQ S EPH LRKALNQEENEP G       
Sbjct  1338  SIKEDVYRRLETLFEQQQQQQQQQQQQNQQLQHSHEPHGLRKALNQEENEPTG-------  1390

Query  1403  ADAEATESRSETPLEVMRLQLDSERPEDEKAAAVKQLTVVIPQNGHDLEESETSPSEEPT  1462
              DAEATESRSETPLEVMRLQLD++RPEDEK   VKQL++  PQNG  L+E E S S   +
Sbjct  1391  -DAEATESRSETPLEVMRLQLDNDRPEDEKGTPVKQLSLSNPQNGQHLDEMEDSASAVIS  1449

Query  1463  AASTENHELSDLWSYHCAKLNQLRLYCQQMLQVPVEPVAGSRLDACSIVEVTPDHELIEY  1522
             +  TEN E                    Q+L+  +E  +GS     + +E+ PDHELIEY
Sbjct  1450  SLRTENEE--------------------QILEGKLEQASGSGSGPGTSIELAPDHELIEY  1489

Query  1523  IIRRIRNQTHNNTVINDSLLAEVSKLTATAAQNSAANSPLISPKRIYAKIKKMDMPRQRD  1582
             II+RIRNQTHNNTVINDSLLAEVSKLTATAAQNS A+SPLISPKRIYAKIKKMD+PRQRD
Sbjct  1490  IIKRIRNQTHNNTVINDSLLAEVSKLTATAAQNSTASSPLISPKRIYAKIKKMDIPRQRD  1549

Query  1583  EFLLWYRSYLEQLFVVEQPHQGGCKVKSQEPSPLESPTK---KQANKREREREQDSNNDA  1639
             EFLLWYRSYLEQLFVVEQP Q  CK KS+      SP K   ++  K+ + + QDSNNDA
Sbjct  1550  EFLLWYRSYLEQLFVVEQP-QDSCKTKSKVTPSGASPAKLKNQRVRKQSQSQSQDSNNDA  1608

Query  1640  DLAEADQKNVSASGSGDQECENNENPDEEADG---GEPTGDSTSGVEKTDVSLD  1690
             DLAEADQKNVS++G+G+ ECENNENPDEEADG    EP     SG EK DVSL+
Sbjct  1609  DLAEADQKNVSSAGNGELECENNENPDEEADGQAAAEP-----SGAEKQDVSLE  1657


>M9PFE5_DROME unnamed protein product
Length=1624

 Score = 2182 bits (5655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1267/1732 (73%), Positives = 1389/1732 (80%), Gaps = 150/1732 (9%)

Query  1     MAPPLKQAADHGSSAS-----SNNNSVGGATGAVPKQQQQLQVNGASTGGTATNRSARSR  55
             MAPP K   D  ++++     SNNNSVGGATGAVPKQQ    VNGA T G++ + ++   
Sbjct  1     MAPPPKVVVDQANASARSNGSSNNNSVGGATGAVPKQQ--TPVNGAPTSGSSASVTSSRS  58

Query  56    R----QQEHLGEPDMDFVEP--LQRETLKTLNELLQRARITNGQIRTQEDQLSGISSTET  109
                  QQEHLGEPDM+ VEP  LQRETLKTLN+LLQRARITN + R+  +Q   +SS + 
Sbjct  59    ARSRRQQEHLGEPDMELVEPETLQRETLKTLNDLLQRARITNAKNRSPAEQ--HLSSKDH  116

Query  110   RPPAQQQ--REVLRQLAAEHSSSYDSSEQLQEQQQRYRFPVRPVQRVQHQPSTTSSSTAL  167
             R PAQQQ  RE LRQLAAEH + YD++EQLQEQQQRYRFPVRPVQRVQHQPS++++ST  
Sbjct  117   RSPAQQQQQREALRQLAAEHGN-YDTAEQLQEQQQRYRFPVRPVQRVQHQPSSSANSTG-  174

Query  168   AAPGSSSSTLQRLRQSTPPNAAVGVVIPNATTSNGNVNGNFSGTEEQQ-----SGLQTLV  222
              AP SSS+ L RLRQSTPPNA VGVVIPNATTSNGN  GN SG EEQ      +GLQ LV
Sbjct  175   -AP-SSSTALLRLRQSTPPNATVGVVIPNATTSNGN--GNLSGNEEQAPPLTPAGLQQLV  230

Query  223   HRLLSLPGLSSRSEAGRSQVEVWRSMLELVDNLNSNRQPSSANPVEDIYNMVHEINPSAE  282
             HRLL +   + R+E  RSQV+V R++L L +NLNS  QPS    V +  NMVHEINP+++
Sbjct  231   HRLLGVHHFAPRTEGFRSQVDVLRALLGLDENLNSRYQPSRK--VVETNNMVHEINPNSD  288

Query  283   QDEGIVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPTFDELQQRLEASNRNMQ  342
             Q EG+VNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTP+FDELQQRLEASNRNMQ
Sbjct  289   QGEGVVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPSFDELQQRLEASNRNMQ  348

Query  343   HLQDEQAKLLHIQNLAKSHLTEMEQLRQQADQLPHTSNGGEAPKYESVQQVQDDMASLVG  402
             HL DEQAKLL IQNLAK+HL EME+LRQQAD LPH  NGGEAPKYESVQQVQDDMASLVG
Sbjct  349   HLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYESVQQVQDDMASLVG  408

Query  403   RMKNLTAFIHNQNELSTVLGDDGPEILAEQQALQEKLEALRSQRADMRNLVDELNSINRT  462
             RMKNLTAFIHNQNELSTVLGDDGPEILAEQ+ALQEKLE+LR+QR DMRNLVDELNSINR 
Sbjct  409   RMKNLTAFIHNQNELSTVLGDDGPEILAEQEALQEKLESLRTQREDMRNLVDELNSINRA  468

Query  463   ARETARPVREETPTPPAKPAQAPAPTPAPAPAPASAPAKERVVPVEYTRNVPIMRQEAAN  522
             ARETAR ++E+  TP   P              A A  KERVVPVEY RNVPI+RQEAAN
Sbjct  469   ARETARVIKEKEETPTPPPKPE---------EAAPAAPKERVVPVEYQRNVPIIRQEAAN  519

Query  523   AAQRALHAQNMINKKTADIEALKAQMAKLKGMLNTVSQIEESVPAMGAALERRSEERTSV  582
             AAQRALHAQ MIN+KTADIEALKAQMA+LKGML TVSQIEES P+MG+ LERRSEERTSV
Sbjct  520   AAQRALHAQAMINQKTADIEALKAQMARLKGMLYTVSQIEESTPSMGSTLERRSEERTSV  579

Query  583   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGEEA  642
             ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMG++A
Sbjct  580   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGDDA  639

Query  643   LKRSSLTPTPTPMRQQQVAQEEEDEEEEDEDPSSLQATPSKEQLRDELRLQCERLRKEYE  702
             LKRSSLTPTPTPMRQ+    EEED  E D   +SLQATP+KEQLRDELR QCERLR EYE
Sbjct  640   LKRSSLTPTPTPMRQRMT--EEEDPSEVD---NSLQATPTKEQLRDELRSQCERLRTEYE  694

Query  703   QKQRELEQRYVASNNTTSEADDEGNDDTDSDKYFANARTASSATLKRAASANTVVEQRRS  762
             QKQRELEQRYVASNNTTSEADDE NDDTDSDKYFANA                       
Sbjct  695   QKQRELEQRYVASNNTTSEADDEANDDTDSDKYFANAPPPPPPAPP--------------  740

Query  763   QPSGTQPPAPPAPPAPPSTLNEDDLNVTIDTLSLGNDSLPSSS-RSQYMPPPMPPVPGMW  821
                              STLNEDDLNVT+DTLSLGNDS+PSSS RSQYMPPPM PVPGMW
Sbjct  741   -----------------STLNEDDLNVTLDTLSLGNDSIPSSSNRSQYMPPPMQPVPGMW  783

Query  822   ASHNSGTSWHGQQPIYGQASTNAGTEFKPTPAATQLGSSNASGSNASSDAMLLQQFMQTQ  881
             ASHNSG+SWHGQQP+YGQ S++AGTEFK  PAA Q GSSN SGSNAS+DA+LLQQFMQTQ
Sbjct  784   ASHNSGSSWHGQQPVYGQPSSSAGTEFKKLPAAQQGGSSNGSGSNASTDAVLLQQFMQTQ  843

Query  882   QMLINSVCQCNQTLWHQQREIDNLNTQIHALQDRLSVVACQDHGFGLRSESVPPPNLNVG  941
             QMLINSVCQCNQ LWHQQREIDNLN Q+HALQDR +VVACQDH FGLRSESVPPP   VG
Sbjct  844   QMLINSVCQCNQALWHQQREIDNLNHQLHALQDRFNVVACQDHSFGLRSESVPPP---VG  900

Query  942   PGLGQTPNNLCLGSSRAQSEQLYGFSAHQSAFSNYQRSCHRTGGDPHHHQQPPQQ---FL  998
             PG+GQ PNNLCLGSSRAQSEQL+ F AHQSAFSNYQRSCHR+G + HHHQQ   Q   FL
Sbjct  901   PGMGQMPNNLCLGSSRAQSEQLFNFGAHQSAFSNYQRSCHRSGAESHHHQQQQHQAQPFL  960

Query  999   NNAAPPPPPTHYNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNANLRTQNQYANNLHSLP  1058
             NNAAPPPPPTH+NNETPLSPPTYRSSPGPIFMNHHNNTIHQNN+NLRTQNQ+ANNLHSLP
Sbjct  961   NNAAPPPPPTHFNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNSNLRTQNQHANNLHSLP  1020

Query  1059  EGAGGAPGGGGGVSAGAGVTLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDLQ  1118
             EGA G        + G G+TLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDLQ
Sbjct  1021  EGAAGG------GAPGGGITLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDLQ  1074

Query  1119  LYRRQRARPSYFQPSQLLGALPSARNGLIHQQQQQQQRRQFFESPLTT----ALPGSNNL  1174
              YRRQRARPSYFQP QLL   P+ R GL H    QQQRR FFE+PLT     +  GSNNL
Sbjct  1075  QYRRQRARPSYFQPPQLLP--PTTRGGLTH----QQQRRHFFEAPLTALHGSSSNGSNNL  1128

Query  1175  NNSGGSARKRDWREDPGSHVDRDHEDEDMDDVEENHDNVIFGAGRRRNRRRPQLSTLRDE  1234
             NNSG S RKRDWR+D G H+ RDH+DED+D+VEENHDNVIFG+GRRRNRRRPQLSTLRD+
Sbjct  1129  NNSGSSGRKRDWRDDAG-HI-RDHDDEDVDEVEENHDNVIFGSGRRRNRRRPQLSTLRDD  1186

Query  1235  DPEQANSSNLNMNVNYGNSPLYQRNKVPAKPSTSAVSLTPLQQRHLRFDFELPAQYMEF-  1293
             + EQA+SSNLNMNVNYGNSPLYQRNKVPAKP+TS VSLTPLQQRHLRFDFELPA YM++ 
Sbjct  1187  ESEQASSSNLNMNVNYGNSPLYQRNKVPAKPTTSTVSLTPLQQRHLRFDFELPAHYMDYI  1246

Query  1294  EMPQVA-ADTTPLLGQEATPADESNALEQTEETASEELNRNLLVNALKNDKFTTKFYESI  1352
             E+PQ+   DTTP LGQEA+PADESNA+EQTEETASEELNRNLLVNALKNDKFTTKFYESI
Sbjct  1247  ELPQITPVDTTPTLGQEASPADESNAMEQTEETASEELNRNLLVNALKNDKFTTKFYESI  1306

Query  1353  KEDVYRRLETLFE--------QQQQQHQLQQSQEPHSLRKALNQEENEPAGDAEEDADAD  1404
             KEDVYRRLETLFE        QQQQ  QLQ S EPH LRKALNQEENEP G        D
Sbjct  1307  KEDVYRRLETLFEQQQQQQQQQQQQNQQLQHSHEPHGLRKALNQEENEPTG--------D  1358

Query  1405  AEATESRSETPLEVMRLQLDSERPEDEKAAAVKQLTVVIPQNGHDLEESETSPSEEPTAA  1464
             AEATESRSETPLEVMRLQLD++RPEDEK   VKQL++  PQNG  L+E E S S   ++ 
Sbjct  1359  AEATESRSETPLEVMRLQLDNDRPEDEKGTPVKQLSLSNPQNGQHLDEMEDSASAVISSL  1418

Query  1465  STENHELSDLWSYHCAKLNQLRLYCQQMLQVPVEPVAGSRLDACSIVEVTPDHELIEYII  1524
              TEN E                    Q+L+  +E  +GS     + +E+ PDHELIEYII
Sbjct  1419  RTENEE--------------------QILEGKLEQASGSGSGPGTSIELAPDHELIEYII  1458

Query  1525  RRIRNQTHNNTVINDSLLAEVSKLTATAAQNSAANSPLISPKRIYAKIKKMDMPRQRDEF  1584
             +RIRNQTHNNTVINDSLLAEVSKLTATAAQNS A+SPLISPKRIYAKIKKMD+PRQRDEF
Sbjct  1459  KRIRNQTHNNTVINDSLLAEVSKLTATAAQNSTASSPLISPKRIYAKIKKMDIPRQRDEF  1518

Query  1585  LLWYRSYLEQLFVVEQPHQGGCKVKSQEPSPLESPTK---KQANKREREREQDSNNDADL  1641
             LLWYRSYLEQLFVVEQP Q  CK KS+      SP K   ++  K+ + + QDSNNDADL
Sbjct  1519  LLWYRSYLEQLFVVEQP-QDSCKTKSKVTPSGASPAKLKNQRVRKQSQSQSQDSNNDADL  1577

Query  1642  AEADQKNVSASGSGDQECENNENPDEEADG---GEPTGDSTSGVEKTDVSLD  1690
             AEADQKNVS++G+G+ ECENNENPDEEADG    EP     SG EK DVSL+
Sbjct  1578  AEADQKNVSSAGNGELECENNENPDEEADGQAAAEP-----SGAEKQDVSLE  1624


>M9PFI2_DROME unnamed protein product
Length=1626

 Score = 2178 bits (5643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1266/1733 (73%), Positives = 1388/1733 (80%), Gaps = 150/1733 (9%)

Query  1     MAPPLKQAADHGSSAS-----SNNNSVGGATGAVPKQQQQLQVNGASTGGTATNRSARSR  55
             MAPP K   D  ++++     SNNNSVGGATGAVPKQQ    VNGA T G++ + ++   
Sbjct  1     MAPPPKVVVDQANASARSNGSSNNNSVGGATGAVPKQQ--TPVNGAPTSGSSASVTSSRS  58

Query  56    R----QQEHLGEPDMDFVEP--LQRETLKTLNELLQRARITNGQIRTQEDQLSGISSTET  109
                  QQEHLGEPDM+ VEP  LQRETLKTLN+LLQRARITN + R+  +Q   +SS + 
Sbjct  59    ARSRRQQEHLGEPDMELVEPETLQRETLKTLNDLLQRARITNAKNRSPAEQ--HLSSKDH  116

Query  110   RPPAQQQ--REVLRQLAAEHSSSYDSSEQLQEQQQRYRFPVRPVQRVQHQPSTTSSSTAL  167
             R PAQQQ  RE LRQLAAEH + YD++EQLQEQQQRYRFPVRPVQRVQHQPS++++ST  
Sbjct  117   RSPAQQQQQREALRQLAAEHGN-YDTAEQLQEQQQRYRFPVRPVQRVQHQPSSSANSTG-  174

Query  168   AAPGSSSSTLQRLRQSTPPNAAVGVVIPNATTSNGNVNGNFSGTEEQQ-----SGLQTLV  222
              AP SSS+ L RLRQSTPPNA VGVVIPNATTSNGN  GN SG EEQ      +GLQ LV
Sbjct  175   -AP-SSSTALLRLRQSTPPNATVGVVIPNATTSNGN--GNLSGNEEQAPPLTPAGLQQLV  230

Query  223   HRLLSLPGLSSRSEAGRSQVEVWRSMLELVDNLNSNRQPSSANPVEDIYNMVHEINPSAE  282
             HRLL +   + R+E  RSQV+V R++L L +NLNS  QPS    V +  NMVHEINP+++
Sbjct  231   HRLLGVHHFAPRTEGFRSQVDVLRALLGLDENLNSRYQPSRK--VVETNNMVHEINPNSD  288

Query  283   QDEGIVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPTFDELQQRLEASNRNMQ  342
             Q EG+VNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTP+FDELQQRLEASNRNMQ
Sbjct  289   QGEGVVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPSFDELQQRLEASNRNMQ  348

Query  343   HLQDEQAKLLHIQNLAKSHLTEMEQLRQQADQLPHTSNGGEAPKYESVQQVQDDMASLVG  402
             HL DEQAKLL IQNLAK+HL EME+LRQQAD LPH  NGGEAPKYESVQQVQDDMASLVG
Sbjct  349   HLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYESVQQVQDDMASLVG  408

Query  403   RMKNLTAFIHNQNELSTVLGDDGPEILAEQQALQEKLEALRSQRADMRNLVDELNSINRT  462
             RMKNLTAFIHNQNELSTVLGDDGPEILAEQ+ALQEKLE+LR+QR DMRNLVDELNSINR 
Sbjct  409   RMKNLTAFIHNQNELSTVLGDDGPEILAEQEALQEKLESLRTQREDMRNLVDELNSINRA  468

Query  463   ARETARPVREETPTPPAKPAQAPAPTPAPAPAPASAPAKERVVPVEYTRNVPIMRQEAAN  522
             ARETAR ++E+  TP   P              A A  KERVVPVEY RNVPI+RQEAAN
Sbjct  469   ARETARVIKEKEETPTPPPKPE---------EAAPAAPKERVVPVEYQRNVPIIRQEAAN  519

Query  523   AAQRALHAQNMINKKTADIEALKAQMAKLKGMLNTVSQIEESVPAMGAALERRSEERTSV  582
             AAQRALHAQ MIN+KTADIEALKAQMA+LKGML TVSQIEES P+MG+ LERRSEERTSV
Sbjct  520   AAQRALHAQAMINQKTADIEALKAQMARLKGMLYTVSQIEESTPSMGSTLERRSEERTSV  579

Query  583   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGEEA  642
             ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMG++A
Sbjct  580   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGDDA  639

Query  643   LKRSSLTPTPTPMRQQQVAQEEEDEEEEDEDPSSLQATPSKEQLRDELRLQCERLRKEYE  702
             LKRSSLTPTPTPMRQ+    EEED  E D   +SLQATP+KEQLRDELR QCERLR EYE
Sbjct  640   LKRSSLTPTPTPMRQRMT--EEEDPSEVD---NSLQATPTKEQLRDELRSQCERLRTEYE  694

Query  703   QKQRELEQRYVASNNTTSEADDEGNDDTDSDKYFANARTASSATLKRAASANTVVEQRRS  762
             QKQRELEQRYVASNNTTSEADDE NDDTDSDKYFAN                        
Sbjct  695   QKQRELEQRYVASNNTTSEADDEANDDTDSDKYFANQAPPPPPPAPP-------------  741

Query  763   QPSGTQPPAPPAPPAPPSTLNEDDLNVTIDTLSLGNDSLPSSS-RSQYMPPPMPPVPGMW  821
                              STLNEDDLNVT+DTLSLGNDS+PSSS RSQYMPPPM PVPGMW
Sbjct  742   -----------------STLNEDDLNVTLDTLSLGNDSIPSSSNRSQYMPPPMQPVPGMW  784

Query  822   -ASHNSGTSWHGQQPIYGQASTNAGTEFKPTPAATQLGSSNASGSNASSDAMLLQQFMQT  880
              ASHNSG+SWHGQQP+YGQ S++AGTEFK  PAA Q GSSN SGSNAS+DA+LLQQFMQT
Sbjct  785   AASHNSGSSWHGQQPVYGQPSSSAGTEFKKLPAAQQGGSSNGSGSNASTDAVLLQQFMQT  844

Query  881   QQMLINSVCQCNQTLWHQQREIDNLNTQIHALQDRLSVVACQDHGFGLRSESVPPPNLNV  940
             QQMLINSVCQCNQ LWHQQREIDNLN Q+HALQDR +VVACQDH FGLRSESVPPP   V
Sbjct  845   QQMLINSVCQCNQALWHQQREIDNLNHQLHALQDRFNVVACQDHSFGLRSESVPPP---V  901

Query  941   GPGLGQTPNNLCLGSSRAQSEQLYGFSAHQSAFSNYQRSCHRTGGDPHHHQQPPQQ---F  997
             GPG+GQ PNNLCLGSSRAQSEQL+ F AHQSAFSNYQRSCHR+G + HHHQQ   Q   F
Sbjct  902   GPGMGQMPNNLCLGSSRAQSEQLFNFGAHQSAFSNYQRSCHRSGAESHHHQQQQHQAQPF  961

Query  998   LNNAAPPPPPTHYNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNANLRTQNQYANNLHSL  1057
             LNNAAPPPPPTH+NNETPLSPPTYRSSPGPIFMNHHNNTIHQNN+NLRTQNQ+ANNLHSL
Sbjct  962   LNNAAPPPPPTHFNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNSNLRTQNQHANNLHSL  1021

Query  1058  PEGAGGAPGGGGGVSAGAGVTLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDL  1117
             PEGA G        + G G+TLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDL
Sbjct  1022  PEGAAGG------GAPGGGITLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDL  1075

Query  1118  QLYRRQRARPSYFQPSQLLGALPSARNGLIHQQQQQQQRRQFFESPLTT----ALPGSNN  1173
             Q YRRQRARPSYFQP QLL   P+ R GL H    QQQRR FFE+PLT     +  GSNN
Sbjct  1076  QQYRRQRARPSYFQPPQLLP--PTTRGGLTH----QQQRRHFFEAPLTALHGSSSNGSNN  1129

Query  1174  LNNSGGSARKRDWREDPGSHVDRDHEDEDMDDVEENHDNVIFGAGRRRNRRRPQLSTLRD  1233
             LNNSG S RKRDWR+D G H+ RDH+DED+D+VEENHDNVIFG+GRRRNRRRPQLSTLRD
Sbjct  1130  LNNSGSSGRKRDWRDDAG-HI-RDHDDEDVDEVEENHDNVIFGSGRRRNRRRPQLSTLRD  1187

Query  1234  EDPEQANSSNLNMNVNYGNSPLYQRNKVPAKPSTSAVSLTPLQQRHLRFDFELPAQYMEF  1293
             ++ EQA+SSNLNMNVNYGNSPLYQRNKVPAKP+TS VSLTPLQQRHLRFDFELPA YM++
Sbjct  1188  DESEQASSSNLNMNVNYGNSPLYQRNKVPAKPTTSTVSLTPLQQRHLRFDFELPAHYMDY  1247

Query  1294  -EMPQVA-ADTTPLLGQEATPADESNALEQTEETASEELNRNLLVNALKNDKFTTKFYES  1351
              E+PQ+   DTTP LGQEA+PADESNA+EQTEETASEELNRNLLVNALKNDKFTTKFYES
Sbjct  1248  IELPQITPVDTTPTLGQEASPADESNAMEQTEETASEELNRNLLVNALKNDKFTTKFYES  1307

Query  1352  IKEDVYRRLETLFE--------QQQQQHQLQQSQEPHSLRKALNQEENEPAGDAEEDADA  1403
             IKEDVYRRLETLFE        QQQQ  QLQ S EPH LRKALNQEENEP G        
Sbjct  1308  IKEDVYRRLETLFEQQQQQQQQQQQQNQQLQHSHEPHGLRKALNQEENEPTG--------  1359

Query  1404  DAEATESRSETPLEVMRLQLDSERPEDEKAAAVKQLTVVIPQNGHDLEESETSPSEEPTA  1463
             DAEATESRSETPLEVMRLQLD++RPEDEK   VKQL++  PQNG  L+E E S S   ++
Sbjct  1360  DAEATESRSETPLEVMRLQLDNDRPEDEKGTPVKQLSLSNPQNGQHLDEMEDSASAVISS  1419

Query  1464  ASTENHELSDLWSYHCAKLNQLRLYCQQMLQVPVEPVAGSRLDACSIVEVTPDHELIEYI  1523
               TEN E                    Q+L+  +E  +GS     + +E+ PDHELIEYI
Sbjct  1420  LRTENEE--------------------QILEGKLEQASGSGSGPGTSIELAPDHELIEYI  1459

Query  1524  IRRIRNQTHNNTVINDSLLAEVSKLTATAAQNSAANSPLISPKRIYAKIKKMDMPRQRDE  1583
             I+RIRNQTHNNTVINDSLLAEVSKLTATAAQNS A+SPLISPKRIYAKIKKMD+PRQRDE
Sbjct  1460  IKRIRNQTHNNTVINDSLLAEVSKLTATAAQNSTASSPLISPKRIYAKIKKMDIPRQRDE  1519

Query  1584  FLLWYRSYLEQLFVVEQPHQGGCKVKSQEPSPLESPTK---KQANKREREREQDSNNDAD  1640
             FLLWYRSYLEQLFVVEQP Q  CK KS+      SP K   ++  K+ + + QDSNNDAD
Sbjct  1520  FLLWYRSYLEQLFVVEQP-QDSCKTKSKVTPSGASPAKLKNQRVRKQSQSQSQDSNNDAD  1578

Query  1641  LAEADQKNVSASGSGDQECENNENPDEEADG---GEPTGDSTSGVEKTDVSLD  1690
             LAEADQKNVS++G+G+ ECENNENPDEEADG    EP     SG EK DVSL+
Sbjct  1579  LAEADQKNVSSAGNGELECENNENPDEEADGQAAAEP-----SGAEKQDVSLE  1626



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016389.1 uncharacterized protein LOC108070431 isoform X2
[Drosophila kikkawai]

Length=1670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU76_DROME  unnamed protein product                                 2240    0.0  
M9PFE5_DROME  unnamed protein product                                 2194    0.0  
M9PFI2_DROME  unnamed protein product                                 2189    0.0  


>Q9VU76_DROME unnamed protein product
Length=1657

 Score = 2240 bits (5805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1295/1714 (76%), Positives = 1417/1714 (83%), Gaps = 101/1714 (6%)

Query  1     MAPPLKQAADHGSSAS-----SNNNSVGGATGAVPKQQQQLQVNGASTGGTATNRSARSR  55
             MAPP K   D  ++++     SNNNSVGGATGAVPKQQ    VNGA T G++ + ++   
Sbjct  1     MAPPPKVVVDQANASARSNGSSNNNSVGGATGAVPKQQ--TPVNGAPTSGSSASVTSSRS  58

Query  56    R----QQEHLGEPDMDFVEP--LQRETLKTLNELLQRARITNGQIRTQEDQLSGISSTET  109
                  QQEHLGEPDM+ VEP  LQRETLKTLN+LLQRARITN + R+  +Q   +SS + 
Sbjct  59    ARSRRQQEHLGEPDMELVEPETLQRETLKTLNDLLQRARITNAKNRSPAEQ--HLSSKDH  116

Query  110   RPPAQQQ--REVLRQLAAEHSSSYDSSEQLQEQQQRYRFPVRPVQRVQHQPSTTSSSTAL  167
             R PAQQQ  RE LRQLAAEH + YD++EQLQEQQQRYRFPVRPVQRVQHQPS++++ST  
Sbjct  117   RSPAQQQQQREALRQLAAEHGN-YDTAEQLQEQQQRYRFPVRPVQRVQHQPSSSANSTG-  174

Query  168   AAPGSSSSTLQRLRQSTPPNAAVGVVIPNATTSNGNVNGNFSGTEEQQ-----SGLQTLV  222
              AP SSS+ L RLRQSTPPNA VGVVIPNATTSNGN  GN SG EEQ      +GLQ LV
Sbjct  175   -AP-SSSTALLRLRQSTPPNATVGVVIPNATTSNGN--GNLSGNEEQAPPLTPAGLQQLV  230

Query  223   HRLLSLPGLSSRSEAGRSQVEVWRSMLELVDNLNSNRQPSSANPVEDIYNMVHEINPSAE  282
             HRLL +   + R+E  RSQV+V R++L L +NLNS  QPS    V +  NMVHEINP+++
Sbjct  231   HRLLGVHHFAPRTEGFRSQVDVLRALLGLDENLNSRYQPSRK--VVETNNMVHEINPNSD  288

Query  283   QDEGIVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPTFDELQQRLEASNRNMQ  342
             Q EG+VNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTP+FDELQQRLEASNRNMQ
Sbjct  289   QGEGVVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPSFDELQQRLEASNRNMQ  348

Query  343   HLQDEQAKLLHIQNLAKSHLTEMEQLRQQADQLPHTSNGGEAPKYESVQQVQDDMASLVG  402
             HL DEQAKLL IQNLAK+HL EME+LRQQAD LPH  NGGEAPKYESVQQVQDDMASLVG
Sbjct  349   HLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYESVQQVQDDMASLVG  408

Query  403   RMKNLTAFIHNQNELSTVLGDDGPEILAEQQALQEKLEALRSQRADMRNLVDELNSINRT  462
             RMKNLTAFIHNQNELSTVLGDDGPEILAEQ+ALQEKLE+LR+QR DMRNLVDELNSINR 
Sbjct  409   RMKNLTAFIHNQNELSTVLGDDGPEILAEQEALQEKLESLRTQREDMRNLVDELNSINRA  468

Query  463   ARETARPVREETPTPPAKPAQAPAPTPAPAPAPASAPAKERVVPVEYTRNVPIMRQEAAN  522
             ARETAR ++E+  TP   P              A A  KERVVPVEY RNVPI+RQEAAN
Sbjct  469   ARETARVIKEKEETPTPPPKPE---------EAAPAAPKERVVPVEYQRNVPIIRQEAAN  519

Query  523   AAQRALHAQNMINKKTADIEALKAQMAKLKGMLNTVSQIEESVPAMGAALERRSEERTSV  582
             AAQRALHAQ MIN+KTADIEALKAQMA+LKGML TVSQIEES P+MG+ LERRSEERTSV
Sbjct  520   AAQRALHAQAMINQKTADIEALKAQMARLKGMLYTVSQIEESTPSMGSTLERRSEERTSV  579

Query  583   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGEEA  642
             ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMG++A
Sbjct  580   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGDDA  639

Query  643   LKRSSLTPTPTPMRQQQVAQEEEDEEEEDEDPSSLQATPSKEQLRDELRLQCERLRKEYE  702
             LKRSSLTPTPTPMRQ+    EEED  E D   +SLQATP+KEQLRDELR QCERLR EYE
Sbjct  640   LKRSSLTPTPTPMRQRMT--EEEDPSEVD---NSLQATPTKEQLRDELRSQCERLRTEYE  694

Query  703   QKQRELEQRYVASNNTTSEADDEGNDDTDSDKYFANARTASSATLKRAASANTVVEQRRS  762
             QKQRELEQRYVASNNTTSEADDE NDDTDSDKYFAN RTASSATLKRA SANTVVEQRR 
Sbjct  695   QKQRELEQRYVASNNTTSEADDEANDDTDSDKYFANVRTASSATLKRAPSANTVVEQRRG  754

Query  763   --QPSGTQPPAPPAPPAPPSTLNEDDLNVTIDTLSLGNDSLPSSS-RSQYMPPPMPPVPG  819
                    Q   PP PPAPPSTLNEDDLNVT+DTLSLGNDS+PSSS RSQYMPPPM PVPG
Sbjct  755   QQPNVPPQQAPPPPPPAPPSTLNEDDLNVTLDTLSLGNDSIPSSSNRSQYMPPPMQPVPG  814

Query  820   MWASHNSGTSWHGQQPIYGQASTNAGTEFKPTPAATQLGSSNASGSNASSDAMLLQQFMQ  879
             MWASHNSG+SWHGQQP+YGQ S++AGTEFK  PAA Q GSSN SGSNAS+DA+LLQQFMQ
Sbjct  815   MWASHNSGSSWHGQQPVYGQPSSSAGTEFKKLPAAQQGGSSNGSGSNASTDAVLLQQFMQ  874

Query  880   TQQMLINSVCQCNQTLWHQQREIDNLNTQIHALQDRLSVVACQDHGFGLRSESVPPPNLN  939
             TQQMLINSVCQCNQ LWHQQREIDNLN Q+HALQDR +VVACQDH FGLRSESVPPP   
Sbjct  875   TQQMLINSVCQCNQALWHQQREIDNLNHQLHALQDRFNVVACQDHSFGLRSESVPPP---  931

Query  940   VGPGLGQTPNNLCLGSSRAQSEQLYGFSAHQSAFSNYQRSCHRTGGDPHHHQQPPQQ---  996
             VGPG+GQ PNNLCLGSSRAQSEQL+ F AHQSAFSNYQRSCHR+G + HHHQQ   Q   
Sbjct  932   VGPGMGQMPNNLCLGSSRAQSEQLFNFGAHQSAFSNYQRSCHRSGAESHHHQQQQHQAQP  991

Query  997   FLNNAAPPPPPTHYNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNANLRTQNQYANNLHS  1056
             FLNNAAPPPPPTH+NNETPLSPPTYRSSPGPIFMNHHNNTIHQNN+NLRTQNQ+ANNLHS
Sbjct  992   FLNNAAPPPPPTHFNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNSNLRTQNQHANNLHS  1051

Query  1057  LPEGAGGAPGGGGGVSAGAGVTLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVD  1116
             LPEGA G        + G G+TLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVD
Sbjct  1052  LPEGAAGG------GAPGGGITLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVD  1105

Query  1117  LQLYRRQRARPSYFQPSQLLGALPSARNGLIHQQQQQQQRRQFFESPLTT----ALPGSN  1172
             LQ YRRQRARPSYFQP QLL   P+ R GL H    QQQRR FFE+PLT     +  GSN
Sbjct  1106  LQQYRRQRARPSYFQPPQLLP--PTTRGGLTH----QQQRRHFFEAPLTALHGSSSNGSN  1159

Query  1173  NLNNSGGSARKRDWREDPGSHVDRDHEDEDMDDVEENHDNVIFGAGRRRNRRRPQLSTLR  1232
             NLNNSG S RKRDWR+D G H+ RDH+DED+D+VEENHDNVIFG+GRRRNRRRPQLSTLR
Sbjct  1160  NLNNSGSSGRKRDWRDDAG-HI-RDHDDEDVDEVEENHDNVIFGSGRRRNRRRPQLSTLR  1217

Query  1233  DEDPEQANSSNLNMNVNYGNSPLYQRNKVPAKPSTSAVSLTPLQQRHLRFDFELPAQYME  1292
             D++ EQA+SSNLNMNVNYGNSPLYQRNKVPAKP+TS VSLTPLQQRHLRFDFELPA YM+
Sbjct  1218  DDESEQASSSNLNMNVNYGNSPLYQRNKVPAKPTTSTVSLTPLQQRHLRFDFELPAHYMD  1277

Query  1293  F-EMPQVA-ADTTPLLGQEATPADESNALEQTEETASEELNRNLLVNALKNDKFTTKFYE  1350
             + E+PQ+   DTTP LGQEA+PADESNA+EQTEETASEELNRNLLVNALKNDKFTTKFYE
Sbjct  1278  YIELPQITPVDTTPTLGQEASPADESNAMEQTEETASEELNRNLLVNALKNDKFTTKFYE  1337

Query  1351  SIKEDVYRRLETLFE--------QQQQQHQLQQSQEPHSLRKALNQEENEPAGDAEEDAD  1402
             SIKEDVYRRLETLFE        QQQQ  QLQ S EPH LRKALNQEENEP G       
Sbjct  1338  SIKEDVYRRLETLFEQQQQQQQQQQQQNQQLQHSHEPHGLRKALNQEENEPTG-------  1390

Query  1403  ADAEATESRSETPLEVMRLQLDSERPEDEKAAAVKQLTVVIPQNGHDLEESETSPSEEPT  1462
              DAEATESRSETPLEVMRLQLD++RPEDEK   VKQL++  PQNG  L+E E S S   +
Sbjct  1391  -DAEATESRSETPLEVMRLQLDNDRPEDEKGTPVKQLSLSNPQNGQHLDEMEDSASAVIS  1449

Query  1463  AASTENHEQMLQVPVEPVAGSRLDACSIVEVTPDHELIEYIIRRIRNQTHNNTVINDSLL  1522
             +  TEN EQ+L+  +E  +GS     + +E+ PDHELIEYII+RIRNQTHNNTVINDSLL
Sbjct  1450  SLRTENEEQILEGKLEQASGSGSGPGTSIELAPDHELIEYIIKRIRNQTHNNTVINDSLL  1509

Query  1523  AEVSKLTATAAQNSAANSPLISPKRIYAKIKKMDMPRQRDEFLLWYRSYLEQLFVVEQPH  1582
             AEVSKLTATAAQNS A+SPLISPKRIYAKIKKMD+PRQRDEFLLWYRSYLEQLFVVEQP 
Sbjct  1510  AEVSKLTATAAQNSTASSPLISPKRIYAKIKKMDIPRQRDEFLLWYRSYLEQLFVVEQP-  1568

Query  1583  QGGCKVKSQEPSPLESPTK---KQANKREREREQDSNNDADLAEADQKNVSASGSGDQEC  1639
             Q  CK KS+      SP K   ++  K+ + + QDSNNDADLAEADQKNVS++G+G+ EC
Sbjct  1569  QDSCKTKSKVTPSGASPAKLKNQRVRKQSQSQSQDSNNDADLAEADQKNVSSAGNGELEC  1628

Query  1640  ENNENPDEEADG---GEPTGDSTSGVEKTDVSLD  1670
             ENNENPDEEADG    EP     SG EK DVSL+
Sbjct  1629  ENNENPDEEADGQAAAEP-----SGAEKQDVSLE  1657


>M9PFE5_DROME unnamed protein product
Length=1624

 Score = 2194 bits (5686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1267/1712 (74%), Positives = 1389/1712 (81%), Gaps = 130/1712 (8%)

Query  1     MAPPLKQAADHGSSAS-----SNNNSVGGATGAVPKQQQQLQVNGASTGGTATNRSARSR  55
             MAPP K   D  ++++     SNNNSVGGATGAVPKQQ    VNGA T G++ + ++   
Sbjct  1     MAPPPKVVVDQANASARSNGSSNNNSVGGATGAVPKQQ--TPVNGAPTSGSSASVTSSRS  58

Query  56    R----QQEHLGEPDMDFVEP--LQRETLKTLNELLQRARITNGQIRTQEDQLSGISSTET  109
                  QQEHLGEPDM+ VEP  LQRETLKTLN+LLQRARITN + R+  +Q   +SS + 
Sbjct  59    ARSRRQQEHLGEPDMELVEPETLQRETLKTLNDLLQRARITNAKNRSPAEQ--HLSSKDH  116

Query  110   RPPAQQQ--REVLRQLAAEHSSSYDSSEQLQEQQQRYRFPVRPVQRVQHQPSTTSSSTAL  167
             R PAQQQ  RE LRQLAAEH + YD++EQLQEQQQRYRFPVRPVQRVQHQPS++++ST  
Sbjct  117   RSPAQQQQQREALRQLAAEHGN-YDTAEQLQEQQQRYRFPVRPVQRVQHQPSSSANSTG-  174

Query  168   AAPGSSSSTLQRLRQSTPPNAAVGVVIPNATTSNGNVNGNFSGTEEQQ-----SGLQTLV  222
              AP SSS+ L RLRQSTPPNA VGVVIPNATTSNGN  GN SG EEQ      +GLQ LV
Sbjct  175   -AP-SSSTALLRLRQSTPPNATVGVVIPNATTSNGN--GNLSGNEEQAPPLTPAGLQQLV  230

Query  223   HRLLSLPGLSSRSEAGRSQVEVWRSMLELVDNLNSNRQPSSANPVEDIYNMVHEINPSAE  282
             HRLL +   + R+E  RSQV+V R++L L +NLNS  QPS    V +  NMVHEINP+++
Sbjct  231   HRLLGVHHFAPRTEGFRSQVDVLRALLGLDENLNSRYQPSRK--VVETNNMVHEINPNSD  288

Query  283   QDEGIVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPTFDELQQRLEASNRNMQ  342
             Q EG+VNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTP+FDELQQRLEASNRNMQ
Sbjct  289   QGEGVVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPSFDELQQRLEASNRNMQ  348

Query  343   HLQDEQAKLLHIQNLAKSHLTEMEQLRQQADQLPHTSNGGEAPKYESVQQVQDDMASLVG  402
             HL DEQAKLL IQNLAK+HL EME+LRQQAD LPH  NGGEAPKYESVQQVQDDMASLVG
Sbjct  349   HLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYESVQQVQDDMASLVG  408

Query  403   RMKNLTAFIHNQNELSTVLGDDGPEILAEQQALQEKLEALRSQRADMRNLVDELNSINRT  462
             RMKNLTAFIHNQNELSTVLGDDGPEILAEQ+ALQEKLE+LR+QR DMRNLVDELNSINR 
Sbjct  409   RMKNLTAFIHNQNELSTVLGDDGPEILAEQEALQEKLESLRTQREDMRNLVDELNSINRA  468

Query  463   ARETARPVREETPTPPAKPAQAPAPTPAPAPAPASAPAKERVVPVEYTRNVPIMRQEAAN  522
             ARETAR ++E+  TP   P              A A  KERVVPVEY RNVPI+RQEAAN
Sbjct  469   ARETARVIKEKEETPTPPPKPE---------EAAPAAPKERVVPVEYQRNVPIIRQEAAN  519

Query  523   AAQRALHAQNMINKKTADIEALKAQMAKLKGMLNTVSQIEESVPAMGAALERRSEERTSV  582
             AAQRALHAQ MIN+KTADIEALKAQMA+LKGML TVSQIEES P+MG+ LERRSEERTSV
Sbjct  520   AAQRALHAQAMINQKTADIEALKAQMARLKGMLYTVSQIEESTPSMGSTLERRSEERTSV  579

Query  583   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGEEA  642
             ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMG++A
Sbjct  580   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGDDA  639

Query  643   LKRSSLTPTPTPMRQQQVAQEEEDEEEEDEDPSSLQATPSKEQLRDELRLQCERLRKEYE  702
             LKRSSLTPTPTPMRQ+    EEED  E D   +SLQATP+KEQLRDELR QCERLR EYE
Sbjct  640   LKRSSLTPTPTPMRQRMT--EEEDPSEVD---NSLQATPTKEQLRDELRSQCERLRTEYE  694

Query  703   QKQRELEQRYVASNNTTSEADDEGNDDTDSDKYFANARTASSATLKRAASANTVVEQRRS  762
             QKQRELEQRYVASNNTTSEADDE NDDTDSDKYFANA                       
Sbjct  695   QKQRELEQRYVASNNTTSEADDEANDDTDSDKYFANAPPPPPPAPP--------------  740

Query  763   QPSGTQPPAPPAPPAPPSTLNEDDLNVTIDTLSLGNDSLPSSS-RSQYMPPPMPPVPGMW  821
                              STLNEDDLNVT+DTLSLGNDS+PSSS RSQYMPPPM PVPGMW
Sbjct  741   -----------------STLNEDDLNVTLDTLSLGNDSIPSSSNRSQYMPPPMQPVPGMW  783

Query  822   ASHNSGTSWHGQQPIYGQASTNAGTEFKPTPAATQLGSSNASGSNASSDAMLLQQFMQTQ  881
             ASHNSG+SWHGQQP+YGQ S++AGTEFK  PAA Q GSSN SGSNAS+DA+LLQQFMQTQ
Sbjct  784   ASHNSGSSWHGQQPVYGQPSSSAGTEFKKLPAAQQGGSSNGSGSNASTDAVLLQQFMQTQ  843

Query  882   QMLINSVCQCNQTLWHQQREIDNLNTQIHALQDRLSVVACQDHGFGLRSESVPPPNLNVG  941
             QMLINSVCQCNQ LWHQQREIDNLN Q+HALQDR +VVACQDH FGLRSESVPPP   VG
Sbjct  844   QMLINSVCQCNQALWHQQREIDNLNHQLHALQDRFNVVACQDHSFGLRSESVPPP---VG  900

Query  942   PGLGQTPNNLCLGSSRAQSEQLYGFSAHQSAFSNYQRSCHRTGGDPHHHQQPPQQ---FL  998
             PG+GQ PNNLCLGSSRAQSEQL+ F AHQSAFSNYQRSCHR+G + HHHQQ   Q   FL
Sbjct  901   PGMGQMPNNLCLGSSRAQSEQLFNFGAHQSAFSNYQRSCHRSGAESHHHQQQQHQAQPFL  960

Query  999   NNAAPPPPPTHYNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNANLRTQNQYANNLHSLP  1058
             NNAAPPPPPTH+NNETPLSPPTYRSSPGPIFMNHHNNTIHQNN+NLRTQNQ+ANNLHSLP
Sbjct  961   NNAAPPPPPTHFNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNSNLRTQNQHANNLHSLP  1020

Query  1059  EGAGGAPGGGGGVSAGAGVTLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDLQ  1118
             EGA G        + G G+TLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDLQ
Sbjct  1021  EGAAGG------GAPGGGITLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDLQ  1074

Query  1119  LYRRQRARPSYFQPSQLLGALPSARNGLIHQQQQQQQRRQFFESPLTT----ALPGSNNL  1174
              YRRQRARPSYFQP QLL   P+ R GL H    QQQRR FFE+PLT     +  GSNNL
Sbjct  1075  QYRRQRARPSYFQPPQLLP--PTTRGGLTH----QQQRRHFFEAPLTALHGSSSNGSNNL  1128

Query  1175  NNSGGSARKRDWREDPGSHVDRDHEDEDMDDVEENHDNVIFGAGRRRNRRRPQLSTLRDE  1234
             NNSG S RKRDWR+D G H+ RDH+DED+D+VEENHDNVIFG+GRRRNRRRPQLSTLRD+
Sbjct  1129  NNSGSSGRKRDWRDDAG-HI-RDHDDEDVDEVEENHDNVIFGSGRRRNRRRPQLSTLRDD  1186

Query  1235  DPEQANSSNLNMNVNYGNSPLYQRNKVPAKPSTSAVSLTPLQQRHLRFDFELPAQYMEF-  1293
             + EQA+SSNLNMNVNYGNSPLYQRNKVPAKP+TS VSLTPLQQRHLRFDFELPA YM++ 
Sbjct  1187  ESEQASSSNLNMNVNYGNSPLYQRNKVPAKPTTSTVSLTPLQQRHLRFDFELPAHYMDYI  1246

Query  1294  EMPQVA-ADTTPLLGQEATPADESNALEQTEETASEELNRNLLVNALKNDKFTTKFYESI  1352
             E+PQ+   DTTP LGQEA+PADESNA+EQTEETASEELNRNLLVNALKNDKFTTKFYESI
Sbjct  1247  ELPQITPVDTTPTLGQEASPADESNAMEQTEETASEELNRNLLVNALKNDKFTTKFYESI  1306

Query  1353  KEDVYRRLETLFE--------QQQQQHQLQQSQEPHSLRKALNQEENEPAGDAEEDADAD  1404
             KEDVYRRLETLFE        QQQQ  QLQ S EPH LRKALNQEENEP G        D
Sbjct  1307  KEDVYRRLETLFEQQQQQQQQQQQQNQQLQHSHEPHGLRKALNQEENEPTG--------D  1358

Query  1405  AEATESRSETPLEVMRLQLDSERPEDEKAAAVKQLTVVIPQNGHDLEESETSPSEEPTAA  1464
             AEATESRSETPLEVMRLQLD++RPEDEK   VKQL++  PQNG  L+E E S S   ++ 
Sbjct  1359  AEATESRSETPLEVMRLQLDNDRPEDEKGTPVKQLSLSNPQNGQHLDEMEDSASAVISSL  1418

Query  1465  STENHEQMLQVPVEPVAGSRLDACSIVEVTPDHELIEYIIRRIRNQTHNNTVINDSLLAE  1524
              TEN EQ+L+  +E  +GS     + +E+ PDHELIEYII+RIRNQTHNNTVINDSLLAE
Sbjct  1419  RTENEEQILEGKLEQASGSGSGPGTSIELAPDHELIEYIIKRIRNQTHNNTVINDSLLAE  1478

Query  1525  VSKLTATAAQNSAANSPLISPKRIYAKIKKMDMPRQRDEFLLWYRSYLEQLFVVEQPHQG  1584
             VSKLTATAAQNS A+SPLISPKRIYAKIKKMD+PRQRDEFLLWYRSYLEQLFVVEQP Q 
Sbjct  1479  VSKLTATAAQNSTASSPLISPKRIYAKIKKMDIPRQRDEFLLWYRSYLEQLFVVEQP-QD  1537

Query  1585  GCKVKSQEPSPLESPTK---KQANKREREREQDSNNDADLAEADQKNVSASGSGDQECEN  1641
              CK KS+      SP K   ++  K+ + + QDSNNDADLAEADQKNVS++G+G+ ECEN
Sbjct  1538  SCKTKSKVTPSGASPAKLKNQRVRKQSQSQSQDSNNDADLAEADQKNVSSAGNGELECEN  1597

Query  1642  NENPDEEADG---GEPTGDSTSGVEKTDVSLD  1670
             NENPDEEADG    EP     SG EK DVSL+
Sbjct  1598  NENPDEEADGQAAAEP-----SGAEKQDVSLE  1624


>M9PFI2_DROME unnamed protein product
Length=1626

 Score = 2189 bits (5673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1266/1713 (74%), Positives = 1388/1713 (81%), Gaps = 130/1713 (8%)

Query  1     MAPPLKQAADHGSSAS-----SNNNSVGGATGAVPKQQQQLQVNGASTGGTATNRSARSR  55
             MAPP K   D  ++++     SNNNSVGGATGAVPKQQ    VNGA T G++ + ++   
Sbjct  1     MAPPPKVVVDQANASARSNGSSNNNSVGGATGAVPKQQ--TPVNGAPTSGSSASVTSSRS  58

Query  56    R----QQEHLGEPDMDFVEP--LQRETLKTLNELLQRARITNGQIRTQEDQLSGISSTET  109
                  QQEHLGEPDM+ VEP  LQRETLKTLN+LLQRARITN + R+  +Q   +SS + 
Sbjct  59    ARSRRQQEHLGEPDMELVEPETLQRETLKTLNDLLQRARITNAKNRSPAEQ--HLSSKDH  116

Query  110   RPPAQQQ--REVLRQLAAEHSSSYDSSEQLQEQQQRYRFPVRPVQRVQHQPSTTSSSTAL  167
             R PAQQQ  RE LRQLAAEH + YD++EQLQEQQQRYRFPVRPVQRVQHQPS++++ST  
Sbjct  117   RSPAQQQQQREALRQLAAEHGN-YDTAEQLQEQQQRYRFPVRPVQRVQHQPSSSANSTG-  174

Query  168   AAPGSSSSTLQRLRQSTPPNAAVGVVIPNATTSNGNVNGNFSGTEEQQ-----SGLQTLV  222
              AP SSS+ L RLRQSTPPNA VGVVIPNATTSNGN  GN SG EEQ      +GLQ LV
Sbjct  175   -AP-SSSTALLRLRQSTPPNATVGVVIPNATTSNGN--GNLSGNEEQAPPLTPAGLQQLV  230

Query  223   HRLLSLPGLSSRSEAGRSQVEVWRSMLELVDNLNSNRQPSSANPVEDIYNMVHEINPSAE  282
             HRLL +   + R+E  RSQV+V R++L L +NLNS  QPS    V +  NMVHEINP+++
Sbjct  231   HRLLGVHHFAPRTEGFRSQVDVLRALLGLDENLNSRYQPSRK--VVETNNMVHEINPNSD  288

Query  283   QDEGIVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPTFDELQQRLEASNRNMQ  342
             Q EG+VNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTP+FDELQQRLEASNRNMQ
Sbjct  289   QGEGVVNSTSLEDVALSEMSDNRAQSIQSLHSVLETPTPDTTPSFDELQQRLEASNRNMQ  348

Query  343   HLQDEQAKLLHIQNLAKSHLTEMEQLRQQADQLPHTSNGGEAPKYESVQQVQDDMASLVG  402
             HL DEQAKLL IQNLAK+HL EME+LRQQAD LPH  NGGEAPKYESVQQVQDDMASLVG
Sbjct  349   HLHDEQAKLLQIQNLAKTHLNEMERLRQQADSLPHNVNGGEAPKYESVQQVQDDMASLVG  408

Query  403   RMKNLTAFIHNQNELSTVLGDDGPEILAEQQALQEKLEALRSQRADMRNLVDELNSINRT  462
             RMKNLTAFIHNQNELSTVLGDDGPEILAEQ+ALQEKLE+LR+QR DMRNLVDELNSINR 
Sbjct  409   RMKNLTAFIHNQNELSTVLGDDGPEILAEQEALQEKLESLRTQREDMRNLVDELNSINRA  468

Query  463   ARETARPVREETPTPPAKPAQAPAPTPAPAPAPASAPAKERVVPVEYTRNVPIMRQEAAN  522
             ARETAR ++E+  TP   P              A A  KERVVPVEY RNVPI+RQEAAN
Sbjct  469   ARETARVIKEKEETPTPPPKPE---------EAAPAAPKERVVPVEYQRNVPIIRQEAAN  519

Query  523   AAQRALHAQNMINKKTADIEALKAQMAKLKGMLNTVSQIEESVPAMGAALERRSEERTSV  582
             AAQRALHAQ MIN+KTADIEALKAQMA+LKGML TVSQIEES P+MG+ LERRSEERTSV
Sbjct  520   AAQRALHAQAMINQKTADIEALKAQMARLKGMLYTVSQIEESTPSMGSTLERRSEERTSV  579

Query  583   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGEEA  642
             ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMG++A
Sbjct  580   ERELPAEIAQRVFALNDVTSELRAEAASLQKERDRILALKAEIERRKQQAAAAVQMGDDA  639

Query  643   LKRSSLTPTPTPMRQQQVAQEEEDEEEEDEDPSSLQATPSKEQLRDELRLQCERLRKEYE  702
             LKRSSLTPTPTPMRQ+    EEED  E D   +SLQATP+KEQLRDELR QCERLR EYE
Sbjct  640   LKRSSLTPTPTPMRQRMT--EEEDPSEVD---NSLQATPTKEQLRDELRSQCERLRTEYE  694

Query  703   QKQRELEQRYVASNNTTSEADDEGNDDTDSDKYFANARTASSATLKRAASANTVVEQRRS  762
             QKQRELEQRYVASNNTTSEADDE NDDTDSDKYFAN                        
Sbjct  695   QKQRELEQRYVASNNTTSEADDEANDDTDSDKYFANQAPPPPPPAPP-------------  741

Query  763   QPSGTQPPAPPAPPAPPSTLNEDDLNVTIDTLSLGNDSLPSSS-RSQYMPPPMPPVPGMW  821
                              STLNEDDLNVT+DTLSLGNDS+PSSS RSQYMPPPM PVPGMW
Sbjct  742   -----------------STLNEDDLNVTLDTLSLGNDSIPSSSNRSQYMPPPMQPVPGMW  784

Query  822   -ASHNSGTSWHGQQPIYGQASTNAGTEFKPTPAATQLGSSNASGSNASSDAMLLQQFMQT  880
              ASHNSG+SWHGQQP+YGQ S++AGTEFK  PAA Q GSSN SGSNAS+DA+LLQQFMQT
Sbjct  785   AASHNSGSSWHGQQPVYGQPSSSAGTEFKKLPAAQQGGSSNGSGSNASTDAVLLQQFMQT  844

Query  881   QQMLINSVCQCNQTLWHQQREIDNLNTQIHALQDRLSVVACQDHGFGLRSESVPPPNLNV  940
             QQMLINSVCQCNQ LWHQQREIDNLN Q+HALQDR +VVACQDH FGLRSESVPPP   V
Sbjct  845   QQMLINSVCQCNQALWHQQREIDNLNHQLHALQDRFNVVACQDHSFGLRSESVPPP---V  901

Query  941   GPGLGQTPNNLCLGSSRAQSEQLYGFSAHQSAFSNYQRSCHRTGGDPHHHQQPPQQ---F  997
             GPG+GQ PNNLCLGSSRAQSEQL+ F AHQSAFSNYQRSCHR+G + HHHQQ   Q   F
Sbjct  902   GPGMGQMPNNLCLGSSRAQSEQLFNFGAHQSAFSNYQRSCHRSGAESHHHQQQQHQAQPF  961

Query  998   LNNAAPPPPPTHYNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNANLRTQNQYANNLHSL  1057
             LNNAAPPPPPTH+NNETPLSPPTYRSSPGPIFMNHHNNTIHQNN+NLRTQNQ+ANNLHSL
Sbjct  962   LNNAAPPPPPTHFNNETPLSPPTYRSSPGPIFMNHHNNTIHQNNSNLRTQNQHANNLHSL  1021

Query  1058  PEGAGGAPGGGGGVSAGAGVTLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDL  1117
             PEGA G        + G G+TLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDL
Sbjct  1022  PEGAAGG------GAPGGGITLNNQVPPGNRANNYWDNFRSHSRQNLLSNKSNEELNVDL  1075

Query  1118  QLYRRQRARPSYFQPSQLLGALPSARNGLIHQQQQQQQRRQFFESPLTT----ALPGSNN  1173
             Q YRRQRARPSYFQP QLL   P+ R GL H    QQQRR FFE+PLT     +  GSNN
Sbjct  1076  QQYRRQRARPSYFQPPQLLP--PTTRGGLTH----QQQRRHFFEAPLTALHGSSSNGSNN  1129

Query  1174  LNNSGGSARKRDWREDPGSHVDRDHEDEDMDDVEENHDNVIFGAGRRRNRRRPQLSTLRD  1233
             LNNSG S RKRDWR+D G H+ RDH+DED+D+VEENHDNVIFG+GRRRNRRRPQLSTLRD
Sbjct  1130  LNNSGSSGRKRDWRDDAG-HI-RDHDDEDVDEVEENHDNVIFGSGRRRNRRRPQLSTLRD  1187

Query  1234  EDPEQANSSNLNMNVNYGNSPLYQRNKVPAKPSTSAVSLTPLQQRHLRFDFELPAQYMEF  1293
             ++ EQA+SSNLNMNVNYGNSPLYQRNKVPAKP+TS VSLTPLQQRHLRFDFELPA YM++
Sbjct  1188  DESEQASSSNLNMNVNYGNSPLYQRNKVPAKPTTSTVSLTPLQQRHLRFDFELPAHYMDY  1247

Query  1294  -EMPQVA-ADTTPLLGQEATPADESNALEQTEETASEELNRNLLVNALKNDKFTTKFYES  1351
              E+PQ+   DTTP LGQEA+PADESNA+EQTEETASEELNRNLLVNALKNDKFTTKFYES
Sbjct  1248  IELPQITPVDTTPTLGQEASPADESNAMEQTEETASEELNRNLLVNALKNDKFTTKFYES  1307

Query  1352  IKEDVYRRLETLFE--------QQQQQHQLQQSQEPHSLRKALNQEENEPAGDAEEDADA  1403
             IKEDVYRRLETLFE        QQQQ  QLQ S EPH LRKALNQEENEP G        
Sbjct  1308  IKEDVYRRLETLFEQQQQQQQQQQQQNQQLQHSHEPHGLRKALNQEENEPTG--------  1359

Query  1404  DAEATESRSETPLEVMRLQLDSERPEDEKAAAVKQLTVVIPQNGHDLEESETSPSEEPTA  1463
             DAEATESRSETPLEVMRLQLD++RPEDEK   VKQL++  PQNG  L+E E S S   ++
Sbjct  1360  DAEATESRSETPLEVMRLQLDNDRPEDEKGTPVKQLSLSNPQNGQHLDEMEDSASAVISS  1419

Query  1464  ASTENHEQMLQVPVEPVAGSRLDACSIVEVTPDHELIEYIIRRIRNQTHNNTVINDSLLA  1523
               TEN EQ+L+  +E  +GS     + +E+ PDHELIEYII+RIRNQTHNNTVINDSLLA
Sbjct  1420  LRTENEEQILEGKLEQASGSGSGPGTSIELAPDHELIEYIIKRIRNQTHNNTVINDSLLA  1479

Query  1524  EVSKLTATAAQNSAANSPLISPKRIYAKIKKMDMPRQRDEFLLWYRSYLEQLFVVEQPHQ  1583
             EVSKLTATAAQNS A+SPLISPKRIYAKIKKMD+PRQRDEFLLWYRSYLEQLFVVEQP Q
Sbjct  1480  EVSKLTATAAQNSTASSPLISPKRIYAKIKKMDIPRQRDEFLLWYRSYLEQLFVVEQP-Q  1538

Query  1584  GGCKVKSQEPSPLESPTK---KQANKREREREQDSNNDADLAEADQKNVSASGSGDQECE  1640
               CK KS+      SP K   ++  K+ + + QDSNNDADLAEADQKNVS++G+G+ ECE
Sbjct  1539  DSCKTKSKVTPSGASPAKLKNQRVRKQSQSQSQDSNNDADLAEADQKNVSSAGNGELECE  1598

Query  1641  NNENPDEEADG---GEPTGDSTSGVEKTDVSLD  1670
             NNENPDEEADG    EP     SG EK DVSL+
Sbjct  1599  NNENPDEEADGQAAAEP-----SGAEKQDVSLE  1626



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016390.1 bifunctional peptidase and (3S)-lysyl hydroxylase
Jmjd7 [Drosophila kikkawai]

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU77_DROME  unnamed protein product                                 593     0.0  
Q57VR2_TRYB2  unnamed protein product                                 88.2    3e-19
Q9W0M3_DROME  unnamed protein product                                 81.6    4e-17


>Q9VU77_DROME unnamed protein product
Length=316

 Score = 593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/310 (88%), Positives = 298/310 (96%), Gaps = 0/310 (0%)

Query  4    EYSEALDTLLQEAEELCIGSNVAELDQVPTAVEFCRDYYAKNQPVVIRQALSWPAIGKWT  63
            E   ALD LLQEAEELCIGS+V ELD++PTA+EFCR++Y+KNQPVVIR+AL+WPAIGKWT
Sbjct  3    EVERALDVLLQEAEELCIGSSVVELDRIPTALEFCREFYSKNQPVVIRKALNWPAIGKWT  62

Query  64   PEYLIQALHDRTVDVAITPNGYADGLATQKGQEYFVLPLETKMKLSEVVRRLDDPTGAVH  123
            P+YLI+AL DR+VDVAITPNGYADGLATQ GQEYFVLPLETKMKLSEVVRRLDDPTGAVH
Sbjct  63   PKYLIEALGDRSVDVAITPNGYADGLATQNGQEYFVLPLETKMKLSEVVRRLDDPTGAVH  122

Query  124  YIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDAINFWLGDERAITSMHKDPYENL  183
            YIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDA+NFWLGDERA+TSMHKDPYEN+
Sbjct  123  YIQKQNSNLSVDLPELAADLRVSDLDFAQQSFNKPPDAVNFWLGDERAVTSMHKDPYENV  182

Query  184  YCVISGHKDFILIPPHQLSCVPRRIYPTGVYRTSESGQFHIEPIRDEEGGVQLTEWVSID  243
            YCVISGHKDF+LIPPHQLSCVPR IYPTGVY+TS+SGQF+IEP+RDEEG  Q TEWVS+D
Sbjct  183  YCVISGHKDFVLIPPHQLSCVPRGIYPTGVYKTSDSGQFYIEPLRDEEGSDQFTEWVSVD  242

Query  244  PLAPDLATYPEYARARPLKVRVHAGDILYLPNYWFHHVSQSHKCIAVNFWYDLDYDSRYC  303
            PL+PDLA YPEYARA+PLKVRVHAGDILYLPNYWFHHVSQSHKCIAVNFWYDLDYDSRYC
Sbjct  243  PLSPDLAKYPEYARAKPLKVRVHAGDILYLPNYWFHHVSQSHKCIAVNFWYDLDYDSRYC  302

Query  304  YYRMLEQMTA  313
            YYRMLEQMT+
Sbjct  303  YYRMLEQMTS  312


>Q57VR2_TRYB2 unnamed protein product
Length=466

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 79/266 (30%), Positives = 110/266 (41%), Gaps = 58/266 (22%)

Query  71   LHDRTVDVAITPNGYADGLA---------------TQKGQEYFVL-------PLETKMKL  108
            L  R V VA+TPNG AD +                  +G+  FV+         E ++ L
Sbjct  145  LGPRRVTVALTPNGRADAVTYVTYNAVKNESQVHDKLEGKSDFVVTEKLFMSAAELRVTL  204

Query  109  SEVVR----------------RLDDPTGAVHYIQKQNSNLSVDLPELAADLRVSDLDFAQ  152
             E+ R                 L  P  ++ Y Q QN+ L+ +   L AD+  +   F  
Sbjct  205  PELYRLLRANPLVPPLKSQFVDLRRPQRSIAYAQMQNNCLAEEYQHLHADIDTALDRFGT  264

Query  153  QSFNKPPDAINFWLGDERAITSMHKDPYENLYCVISGHKDFILIPPHQLSCVPRRIYP--  210
            + F    +A N WLG   +++SMH+D  ENLY V+ G K+FIL+PP +   VP+   P  
Sbjct  265  RVFGGKREAANIWLGTPASVSSMHQDWVENLYAVVRGVKEFILVPPWEGVFVPKPELPAA  324

Query  211  -------TGVYRTSESGQFHIEPIRDEEG----GVQLTEWVSIDPLAPDLATYPEYARAR  259
                          E   F   P RD        V+LT     DPL        E  R +
Sbjct  325  AFTLKAAANCKEGEEEYIFSDSPTRDGTSVPWMDVELTPAAVDDPL-----HIKEELRDK  379

Query  260  --PLKVRVHAGDILYLPNYWFHHVSQ  283
              PL   V  G++LYLP  W H V+Q
Sbjct  380  LHPLIAYVQPGEVLYLPALWLHRVAQ  405


>Q9W0M3_DROME unnamed protein product
Length=401

 Score = 81.6 bits (200),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 116/279 (42%), Gaps = 46/279 (16%)

Query  24   NVAELDQVPTAVEFCRDYYAKNQPVVIRQALS-WPAIGKWTP-EYLIQALHDRTVDVAIT  81
            ++ +LD  P+  EF    +   QP ++   +  WPA+ KW    YL+Q   +RTV + I 
Sbjct  162  DIPQLD-APSLEEFQTKCFEAGQPTLLLNTIQHWPALHKWLDLNYLLQVAGNRTVPIEIG  220

Query  82   PNGYADGLATQKGQEYFVLPLETKMKLSEVVRRL--DDPTGAVHYIQ-KQNSNLSVDLPE  138
             N  +D  + Q             +K+ + + R    +P+ A   I+      L   +P 
Sbjct  221  SNYASDEWSQQL------------VKIRDFLSRQFGKEPSKAGQNIEYLAQHELFAQIPA  268

Query  139  LAADLRVSDLDFAQQSFNKPPDAINF--WLGDERAITSMHKDPYENLYCVISGHKDFILI  196
            L  D+ + D  +   S    P A++   WLG    ++ MH DP  NL C + G K  IL 
Sbjct  269  LKEDISIPD--YCTISNEDTPGAVDIKAWLGPAGTVSPMHYDPKHNLLCQVFGSKRIILA  326

Query  197  PPHQLSCVPRRIYPTGVYRTSESGQFHIEPIRDEEGGVQLTEWVSIDPLAPDLATYPEYA  256
             P         +YP                  D E    L     ID    D  TYP  A
Sbjct  327  APADTD----NLYP-----------------HDSEF---LANTARIDAAQLDPETYPLVA  362

Query  257  RARPLKVRVHAGDILYLPNYWFHHVSQSHKCIAVNFWYD  295
            + +  ++ +  GD LY+P  W+H+V       +V+FW++
Sbjct  363  KVKFYQLLLQPGDCLYMPPKWWHYVRSEAPSFSVSFWWE  401



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016391.1 alsin homolog [Drosophila kikkawai]

Length=1484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALS2_DROME  unnamed protein product                                   2701    0.0  
Q587D3_TRYB2  unnamed protein product                                 82.0    4e-16
Q57WF5_TRYB2  unnamed protein product                                 76.3    6e-14


>ALS2_DROME unnamed protein product
Length=1486

 Score = 2701 bits (7002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1319/1492 (88%), Positives = 1394/1492 (93%), Gaps = 15/1492 (1%)

Query  2     MASAAADSAGVSQEEEERESFVIYHDGRALQLHWRGVPPLTRTPASRICS-IGDVLLLLT  60
             MASAA DSA   QEE  RESF IYH+GR LQLHWRG+PPL R PASRICS  G  LLLLT
Sbjct  1     MASAADDSALGGQEE--RESFTIYHEGRELQLHWRGLPPLQRFPASRICSNAGGELLLLT  58

Query  61    TDHALYSAQLQTNRSSLDLQLLRTDVVDMDFCSGSQELFVVLSNGSVQRQLITASGRDIH  120
             TDHALYSA+LQ NR  +DLQLLRTDVVDMDFCSGSQELFVVL+NGSVQRQ  T SGRD+ 
Sbjct  59    TDHALYSAKLQANREHMDLQLLRTDVVDMDFCSGSQELFVVLTNGSVQRQ-ATGSGRDVG  117

Query  121   HPHAWQTLSFDPLELLAEGVRIQRVCCSAQGVVFVGAGGETYVMGTCGEVFKAEQQPRHM  180
             HPHAWQTL FDPLEL AEGVRI+RVCCSAQGVVFVGA GETYVMG+CGEVFKAEQQPRHM
Sbjct  118   HPHAWQTLGFDPLELHAEGVRIRRVCCSAQGVVFVGASGETYVMGSCGEVFKAEQQPRHM  177

Query  181   RLYEEGKELLDLAAGNEHFVMLVAPYNLADDVLQLQVANPRDEPEDDRASVKSLSSGNSE  240
             RLYEEGKELLDLAAGNEHFVMLVAPYNLADD LQL VA+ ++EPED+RASVKS+SSG+SE
Sbjct  178   RLYEEGKELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERASVKSISSGHSE  237

Query  241   RSFAANTRHLLHQGYALLHTQLFTFGASNNGLLGTGDHIRRANVMRVQKLDSMGVCSIAA  300
             RS AANTRHLLHQGYALLHTQLFTFGASNNGLLG+GDHIRRANVMR+QKLDSMGVCSIAA
Sbjct  238   RSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIAA  297

Query  301   GLEHTVSRTLDGRLYHWGLNSHAQLGEDLSSPMEITIADNATCLPMEQKSALEATCGDYH  360
             GLEHTV+RTLDGRLYHWGLN+H+QLGED+SSPMEITI +N   LP+EQ SALEATCGDYH
Sbjct  298   GLEHTVARTLDGRLYHWGLNNHSQLGEDVSSPMEITITENTAALPIEQNSALEATCGDYH  357

Query  361   TLLLNASGQIQSLQPPPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGGFTLQNQR  420
             TLLLNASGQI SLQP PPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGG+TLQNQR
Sbjct  358   TLLLNASGQIHSLQPAPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGGYTLQNQR  417

Query  421   QFQRQYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALETLSALGPLLVSWERMLCLLV  480
             QFQRQYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALE LSALGPLL++WER+LCLLV
Sbjct  418   QFQRQYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALEPLSALGPLLINWERILCLLV  477

Query  481   ATLHSLEGFYRADFVQPADLLFICHHKEYIDLFDGYTKAYCDVFSVNGFGEAVAAIAGLN  540
             ATLHSLEGFYRADFVQPADLLFICH+KEYIDLFDGYTKAYCDVFSVNGFGEAV AI GL+
Sbjct  478   ATLHSLEGFYRADFVQPADLLFICHYKEYIDLFDGYTKAYCDVFSVNGFGEAVVAITGLS  537

Query  541   SPLAELNEESYVTRLFQQPFSVYQLFVQFMELLVRTQPEYGEHRVAWTEFARHSCISQEL  600
             SPLAELNEESYVTRLFQQPFS+YQLFVQFMELLVRTQ EYGEHRVAW+EFARHSCISQEL
Sbjct  538   SPLAELNEESYVTRLFQQPFSIYQLFVQFMELLVRTQSEYGEHRVAWSEFARHSCISQEL  597

Query  601   AVNTRDFWSSNDRNPRIVQFRRRQRRVILTSALVPLKLVTTGISMSSNSFILFSDFLCQV  660
             AVNT+DFWSSNDRNPRIVQFR R RRVILTSALVPLKLVT+GIS SSNSFILFSDFLCQV
Sbjct  598   AVNTKDFWSSNDRNPRIVQFRGRHRRVILTSALVPLKLVTSGISRSSNSFILFSDFLCQV  657

Query  661   GGNSLYSYPLTTLWVWTEGELCLRLTTPEKSFLVATRTQEMRKVWLDQLQSSIVASLGRP  720
              GNSLYSYPLTTLWVWTEG+  LRLTTPEKSFLV+TR+QEMRKVWLDQLQSSI+ASLG+P
Sbjct  658   SGNSLYSYPLTTLWVWTEGD-SLRLTTPEKSFLVSTRSQEMRKVWLDQLQSSIIASLGKP  716

Query  721   LGSPVPSARSTGYEFSREHAKYSRVKACGTWRKGVMHGNCYLEYPDGSVYCGELNHGVIE  780
             LGSPVPS RSTGYEFSREH K+SRVKACGTWRKGV+HGNCYLEYPDGSVYCGEL HG+IE
Sbjct  717   LGSPVPSYRSTGYEFSREHPKFSRVKACGTWRKGVLHGNCYLEYPDGSVYCGELQHGIIE  776

Query  781   GYGKMVIPSTGLYVGHFKGGRFHGHGVYEMHCKDAPESEIYEGNFCEGLFHGHGMMRNNR  840
             G+GKMVIP+TGLYVG+FKGGRFHGHGVYEMHCKD+PESE+YEGNFCEGLFHGHG+MRNNR
Sbjct  777   GFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVMRNNR  836

Query  841   YIYVGEYQANARCGYGVLEDLVSGDKYMGMFADNKRAGIGSCITNRGDYFEGNFAADDLL  900
             YIYVGEYQANAR GYGV+EDLVSGDKYMGMFADNKR+GIGSCITNRGDYFEG+F+ DDL 
Sbjct  837   YIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLT  896

Query  901   GNGVAVFENDYYYEGELTLQGPSGRGEYYMP----CGEAGNV-SGESDDTCELIGNKMFG  955
             G+GVAVFENDYYYEGELTL GP+GRGEYYMP    CG +G + +GE DDTCELIGNKMFG
Sbjct  897   GSGVAVFENDYYYEGELTLLGPNGRGEYYMPSGDACGGSGAMGTGEFDDTCELIGNKMFG  956

Query  956   QLSGSWETVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFETDLANCTASSHP  1015
             QLSG+W+TVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFE+DLANCTAS+  
Sbjct  957   QLSGTWDTVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFESDLANCTASTSS  1016

Query  1016  SSA--PGGTLRKSSKPTLSTAQLWNCIAVYMSKQRAREGAKPGNYFNNILLSLPLPQKTS  1073
             S      GTLRKSSKPTLSTAQ+WNCIAVYMSKQRAREG KPGNYFNNILLSLPLPQKTS
Sbjct  1017  SGGNQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQRAREGTKPGNYFNNILLSLPLPQKTS  1076

Query  1074  SPLAKARTTTNALSKLQTEAASALDFLGFPPRRIHSQETLISKPGGLQRADSLLSMGHNS  1133
             SPLAKARTTT+ALSKLQTEAASALDFLGFPPRRI SQE L SKPGGLQRADSL+SMGHN+
Sbjct  1077  SPLAKARTTTSALSKLQTEAASALDFLGFPPRRIQSQEALNSKPGGLQRADSLISMGHNT  1136

Query  1134  TRDLDTSSLASFQLDQSLLNSTFNSEESTTLNESFASLGHNNNNNNGISKQKNSSDCSIT  1193
             +RDLD SSLASFQLDQSL+NST N +ES+T NESF+ L HNNNN+  ISK  N+ DCSIT
Sbjct  1137  SRDLDNSSLASFQLDQSLMNSTVNGDESSTFNESFSKLSHNNNNS--ISKHMNNIDCSIT  1194

Query  1194  STASTTSAMLDQVPSFGMASTLTEQDLASIRLYLEQAFKDRHHPLYALNERIANCFHYSY  1253
             ST STTSA+LDQVPSFGMA  LTEQD+ SIRLYLEQAFKDRHHPLY LNERIANCFHYSY
Sbjct  1195  STTSTTSAVLDQVPSFGMALVLTEQDVTSIRLYLEQAFKDRHHPLYVLNERIANCFHYSY  1254

Query  1254  GYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPEDYCHMEGSREVISHITLLYPL  1313
             GYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPE+ C MEGSREVISHITLLYPL
Sbjct  1255  GYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPEELCQMEGSREVISHITLLYPL  1314

Query  1314  VLSEGIYSTLFVLYANKYSRKDEMYRQNLNHAEKLKDQELVELMGHESFLQTVMLDPKFE  1373
             VLSEGIYSTLFVLYANKYSRKDEMYRQNLN AEKLKDQELVELMGHESFL  VMLDPKF 
Sbjct  1315  VLSEGIYSTLFVLYANKYSRKDEMYRQNLNLAEKLKDQELVELMGHESFLHNVMLDPKFV  1374

Query  1374  ESVQTLKQLQEKFSPQDMLTVIQRSTQLLTEAYEHAMSANAAQLNADNMIPLTMLTMLRA  1433
             ESVQTLK+LQEKFSPQDMLTVIQRSTQLLTEAYEHAM+ANAAQLNADNMIPLTMLTMLRA
Sbjct  1375  ESVQTLKELQEKFSPQDMLTVIQRSTQLLTEAYEHAMAANAAQLNADNMIPLTMLTMLRA  1434

Query  1434  AVPHLGAELALLDDLT-GPNFQAEMNGMAGYCYTTLKAAYEFVTLRALQKNP  1484
             AVPHLGAELALLDDLT GPNFQAEMNGMAGYCYTTLKAAYE VT RALQK P
Sbjct  1435  AVPHLGAELALLDDLTGGPNFQAEMNGMAGYCYTTLKAAYEHVTSRALQKIP  1486


>Q587D3_TRYB2 unnamed protein product
Length=358

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 61/191 (32%), Positives = 81/191 (42%), Gaps = 10/191 (5%)

Query  749  GTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVY  808
            G W  G  HG     Y DGS Y GE     + G G     S  +Y G +  GR +G GV 
Sbjct  28   GDWVFGKRHGTGVYVYADGSRYEGEWVDDKVHGNGACYYTSGNVYTGEWSMGRINGRGVL  87

Query  809  EMHCKDAPESEIYEGNFCEGLFHGHGMM-RNNRYIYVGEYQANARCGYGVL----EDLVS  863
            E H     + + YEG + +G  HG G    +N   Y GE++ + R G GV+     D   
Sbjct  88   EYH-----DGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEWKEDKRHGKGVVVYAAPDGCV  142

Query  864  GDKYMGMFADNKRAGIGSCITNRGDYFEGNFAADDLLGNGVAVFENDYYYEGELTLQGPS  923
             +KY G + + +  G G      G  +EG +    + G G  VF N   YEGE       
Sbjct  143  SEKYDGEWNEGRMQGWGKYFYADGGVYEGEWVDGRMHGRGTYVFPNGNKYEGEWVEDRKD  202

Query  924  GRGEYYMPCGE  934
            G G      GE
Sbjct  203  GYGILLYTNGE  213


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 68/250 (27%), Positives = 97/250 (39%), Gaps = 49/250 (20%)

Query  749  GTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVY  808
            G W  G ++G   LEY DG  Y GE   G + G G     +   Y G +K  + HG GV 
Sbjct  74   GEWSMGRINGRGVLEYHDGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEWKEDKRHGKGVV  133

Query  809  EMHCKDAPESE-----------------------IYEGNFCEGLFHGHGM-MRNNRYIYV  844
                 D   SE                       +YEG + +G  HG G  +  N   Y 
Sbjct  134  VYAAPDGCVSEKYDGEWNEGRMQGWGKYFYADGGVYEGEWVDGRMHGRGTYVFPNGNKYE  193

Query  845  GEYQANARCGYGVL----------------------EDLVSGDKYMGMFADNKRAGIGSC  882
            GE+  + + GYG+L                         + GD+Y+G +   K+ G G  
Sbjct  194  GEWVEDRKDGYGILLYTNGERYEGYWHLDKAHGKGTLTFLQGDRYVGEWHYGKKHGHGVL  253

Query  883  ITNRGDYFEGNFAADDLLGNGVAVFENDYYYEGELTLQGPSGRGEYYMPCG---EAGNVS  939
              + GD ++G +  DD  G GV  + N   YEGE       G+G   +P G   E     
Sbjct  254  SYSNGDTYDGEWRDDDAWGYGVLQYANGCRYEGEWAEDRRHGKGLLVLPDGSSYEGSFAH  313

Query  940  GESDDTCELI  949
            G+ D   ++I
Sbjct  314  GKKDGPGKII  323


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 54/179 (30%), Positives = 81/179 (45%), Gaps = 14/179 (8%)

Query  769  VYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVYEMHCKDAPESEIYEGNFCEG  828
            +Y GE+ +G + G G +  P+   Y G +  G+ HG GVY        +   YEG + + 
Sbjct  2    IYSGEIENGQMHGRGCLQYPNKEKYDGDWVFGKRHGTGVYVY-----ADGSRYEGEWVDD  56

Query  829  LFHGHGM-MRNNRYIYVGEYQANARCGYGVLEDLVSGDKYMGMFADNKRAGIGSCITNRG  887
              HG+G     +  +Y GE+      G GVLE    GD+Y G + D +  G G+   + G
Sbjct  57   KVHGNGACYYTSGNVYTGEWSMGRINGRGVLE-YHDGDRYEGEWKDGRMHGKGTYCYSNG  115

Query  888  DYFEGNFAADDLLGNGVAVFEN-----DYYYEGELTLQGPSGRGEYYMPCGEAGNVSGE  941
            D +EG +  D   G GV V+          Y+GE       G G+Y+    + G   GE
Sbjct  116  DKYEGEWKEDKRHGKGVVVYAAPDGCVSEKYDGEWNEGRMQGWGKYFY--ADGGVYEGE  172


>Q57WF5_TRYB2 unnamed protein product
Length=437

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 56/191 (29%), Positives = 87/191 (46%), Gaps = 30/191 (16%)

Query  729  RSTGYEFSREHAKYSRVKACGTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIP  788
            R  G    RE   Y      G W  GV  G+    Y +G+ Y G+  +G   G G M   
Sbjct  202  RGYGEYLYREGYAYK-----GDWVNGVYEGSGTFFYTNGARYEGQWRNGYEHGRGTMTYY  256

Query  789  STGLYVGHFKGGRFHGHGVY--------------EMH----CKDAPESEIYEGNFCEGLF  830
            +  +Y G +  GR HG G Y               +H    C  A +  +Y+G++C GL+
Sbjct  257  NGDVYTGDWCNGRKHGTGTYTSKLLQYEGGWSSGAVHGIGKCTYA-DGSMYKGSWCRGLY  315

Query  831  HGHG--MMRNNRYIYVGEYQANARCGYGVLEDLVSGD-KYMGMFADNKRAGIGSCITNRG  887
             G G  + ++ +  Y GE++   RCG GV +    G+ +Y G + D++R G+G   T  G
Sbjct  316  DGDGEFVSQDKKCSYKGEFRGGKRCGRGVYQ---CGEVEYSGDWLDDRRHGVGEIKTRDG  372

Query  888  DYFEGNFAADD  898
              F G ++ D+
Sbjct  373  RVFRGTWSHDE  383


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 81/188 (43%), Gaps = 12/188 (6%)

Query  749  GTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVY  808
            G W  G  HG   L  P+G +Y G+   G I GYG+ +      Y G +  G + G G +
Sbjct  172  GKWLAGKWHGRGELAEPEG-LYIGDFVDGQIRGYGEYLYREGYAYKGDWVNGVYEGSGTF  230

Query  809  EMHCKDAPESEIYEGNFCEGLFHGHGMMR-NNRYIYVGEYQANARCGYGVLEDLVSGDKY  867
              +   A     YEG +  G  HG G M   N  +Y G++    + G G     +   +Y
Sbjct  231  -FYTNGAR----YEGQWRNGYEHGRGTMTYYNGDVYTGDWCNGRKHGTGTYTSKLL--QY  283

Query  868  MGMFADNKRAGIGSCITNRGDYFEGNFAADDLLGNGVAVFENDY-YYEGELTLQGPSGRG  926
             G ++     GIG C    G  ++G++      G+G  V ++    Y+GE       GRG
Sbjct  284  EGGWSSGAVHGIGKCTYADGSMYKGSWCRGLYDGDGEFVSQDKKCSYKGEFRGGKRCGRG  343

Query  927  EYYMPCGE  934
             Y   CGE
Sbjct  344  VY--QCGE  349


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 44/154 (29%), Positives = 73/154 (47%), Gaps = 10/154 (6%)

Query  780  EGYGKMVIPSTGLYVGHFKGGRFHGHGVYEMHCKDAPESEIYEGNFCEGLFHGHGMMRNN  839
            EGY  +   +  +Y G++K  R HG GV     +   +++IYEG +  G+ +G+GM  + 
Sbjct  109  EGYQSITFDNGDMYEGNWKSCRMHGTGVM----RRVADNDIYEGEWFFGVRNGNGMCCSP  164

Query  840  RY--IYVGEYQANARCGYGVLEDLVSGDKYMGMFADNKRAGIGSCITNRGDYFEGNFAAD  897
             +  +Y G++ A    G G L +      Y+G F D +  G G  +   G  ++G++   
Sbjct  165  NFGTLYSGKWLAGKWHGRGELAE--PEGLYIGDFVDGQIRGYGEYLYREGYAYKGDWVNG  222

Query  898  DLLGNGVAVFENDYYYEGELTLQGPSGRG--EYY  929
               G+G   + N   YEG+       GRG   YY
Sbjct  223  VYEGSGTFFYTNGARYEGQWRNGYEHGRGTMTYY  256



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


Query= XP_017016392.1 alsin homolog [Drosophila kikkawai]

Length=1484
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ALS2_DROME  unnamed protein product                                   2701    0.0  
Q587D3_TRYB2  unnamed protein product                                 82.0    4e-16
Q57WF5_TRYB2  unnamed protein product                                 76.3    6e-14


>ALS2_DROME unnamed protein product
Length=1486

 Score = 2701 bits (7002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1319/1492 (88%), Positives = 1394/1492 (93%), Gaps = 15/1492 (1%)

Query  2     MASAAADSAGVSQEEEERESFVIYHDGRALQLHWRGVPPLTRTPASRICS-IGDVLLLLT  60
             MASAA DSA   QEE  RESF IYH+GR LQLHWRG+PPL R PASRICS  G  LLLLT
Sbjct  1     MASAADDSALGGQEE--RESFTIYHEGRELQLHWRGLPPLQRFPASRICSNAGGELLLLT  58

Query  61    TDHALYSAQLQTNRSSLDLQLLRTDVVDMDFCSGSQELFVVLSNGSVQRQLITASGRDIH  120
             TDHALYSA+LQ NR  +DLQLLRTDVVDMDFCSGSQELFVVL+NGSVQRQ  T SGRD+ 
Sbjct  59    TDHALYSAKLQANREHMDLQLLRTDVVDMDFCSGSQELFVVLTNGSVQRQ-ATGSGRDVG  117

Query  121   HPHAWQTLSFDPLELLAEGVRIQRVCCSAQGVVFVGAGGETYVMGTCGEVFKAEQQPRHM  180
             HPHAWQTL FDPLEL AEGVRI+RVCCSAQGVVFVGA GETYVMG+CGEVFKAEQQPRHM
Sbjct  118   HPHAWQTLGFDPLELHAEGVRIRRVCCSAQGVVFVGASGETYVMGSCGEVFKAEQQPRHM  177

Query  181   RLYEEGKELLDLAAGNEHFVMLVAPYNLADDVLQLQVANPRDEPEDDRASVKSLSSGNSE  240
             RLYEEGKELLDLAAGNEHFVMLVAPYNLADD LQL VA+ ++EPED+RASVKS+SSG+SE
Sbjct  178   RLYEEGKELLDLAAGNEHFVMLVAPYNLADDALQLSVASAKEEPEDERASVKSISSGHSE  237

Query  241   RSFAANTRHLLHQGYALLHTQLFTFGASNNGLLGTGDHIRRANVMRVQKLDSMGVCSIAA  300
             RS AANTRHLLHQGYALLHTQLFTFGASNNGLLG+GDHIRRANVMR+QKLDSMGVCSIAA
Sbjct  238   RSVAANTRHLLHQGYALLHTQLFTFGASNNGLLGSGDHIRRANVMRLQKLDSMGVCSIAA  297

Query  301   GLEHTVSRTLDGRLYHWGLNSHAQLGEDLSSPMEITIADNATCLPMEQKSALEATCGDYH  360
             GLEHTV+RTLDGRLYHWGLN+H+QLGED+SSPMEITI +N   LP+EQ SALEATCGDYH
Sbjct  298   GLEHTVARTLDGRLYHWGLNNHSQLGEDVSSPMEITITENTAALPIEQNSALEATCGDYH  357

Query  361   TLLLNASGQIQSLQPPPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGGFTLQNQR  420
             TLLLNASGQI SLQP PPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGG+TLQNQR
Sbjct  358   TLLLNASGQIHSLQPAPPMRHLQQSSTYAQTLLQLQLGAAWPRQLRLLMCSGGYTLQNQR  417

Query  421   QFQRQYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALETLSALGPLLVSWERMLCLLV  480
             QFQRQYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALE LSALGPLL++WER+LCLLV
Sbjct  418   QFQRQYHYYLSHLQSQLQLLLKHRQAVQTLEIWQRQSALEPLSALGPLLINWERILCLLV  477

Query  481   ATLHSLEGFYRADFVQPADLLFICHHKEYIDLFDGYTKAYCDVFSVNGFGEAVAAIAGLN  540
             ATLHSLEGFYRADFVQPADLLFICH+KEYIDLFDGYTKAYCDVFSVNGFGEAV AI GL+
Sbjct  478   ATLHSLEGFYRADFVQPADLLFICHYKEYIDLFDGYTKAYCDVFSVNGFGEAVVAITGLS  537

Query  541   SPLAELNEESYVTRLFQQPFSVYQLFVQFMELLVRTQPEYGEHRVAWTEFARHSCISQEL  600
             SPLAELNEESYVTRLFQQPFS+YQLFVQFMELLVRTQ EYGEHRVAW+EFARHSCISQEL
Sbjct  538   SPLAELNEESYVTRLFQQPFSIYQLFVQFMELLVRTQSEYGEHRVAWSEFARHSCISQEL  597

Query  601   AVNTRDFWSSNDRNPRIVQFRRRQRRVILTSALVPLKLVTTGISMSSNSFILFSDFLCQV  660
             AVNT+DFWSSNDRNPRIVQFR R RRVILTSALVPLKLVT+GIS SSNSFILFSDFLCQV
Sbjct  598   AVNTKDFWSSNDRNPRIVQFRGRHRRVILTSALVPLKLVTSGISRSSNSFILFSDFLCQV  657

Query  661   GGNSLYSYPLTTLWVWTEGELCLRLTTPEKSFLVATRTQEMRKVWLDQLQSSIVASLGRP  720
              GNSLYSYPLTTLWVWTEG+  LRLTTPEKSFLV+TR+QEMRKVWLDQLQSSI+ASLG+P
Sbjct  658   SGNSLYSYPLTTLWVWTEGD-SLRLTTPEKSFLVSTRSQEMRKVWLDQLQSSIIASLGKP  716

Query  721   LGSPVPSARSTGYEFSREHAKYSRVKACGTWRKGVMHGNCYLEYPDGSVYCGELNHGVIE  780
             LGSPVPS RSTGYEFSREH K+SRVKACGTWRKGV+HGNCYLEYPDGSVYCGEL HG+IE
Sbjct  717   LGSPVPSYRSTGYEFSREHPKFSRVKACGTWRKGVLHGNCYLEYPDGSVYCGELQHGIIE  776

Query  781   GYGKMVIPSTGLYVGHFKGGRFHGHGVYEMHCKDAPESEIYEGNFCEGLFHGHGMMRNNR  840
             G+GKMVIP+TGLYVG+FKGGRFHGHGVYEMHCKD+PESE+YEGNFCEGLFHGHG+MRNNR
Sbjct  777   GFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVMRNNR  836

Query  841   YIYVGEYQANARCGYGVLEDLVSGDKYMGMFADNKRAGIGSCITNRGDYFEGNFAADDLL  900
             YIYVGEYQANAR GYGV+EDLVSGDKYMGMFADNKR+GIGSCITNRGDYFEG+F+ DDL 
Sbjct  837   YIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLT  896

Query  901   GNGVAVFENDYYYEGELTLQGPSGRGEYYMP----CGEAGNV-SGESDDTCELIGNKMFG  955
             G+GVAVFENDYYYEGELTL GP+GRGEYYMP    CG +G + +GE DDTCELIGNKMFG
Sbjct  897   GSGVAVFENDYYYEGELTLLGPNGRGEYYMPSGDACGGSGAMGTGEFDDTCELIGNKMFG  956

Query  956   QLSGSWETVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFETDLANCTASSHP  1015
             QLSG+W+TVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFE+DLANCTAS+  
Sbjct  957   QLSGTWDTVRIQAGELVLNRRFPKYPSSLGRQVVDHNRKWRSLFNNFESDLANCTASTSS  1016

Query  1016  SSA--PGGTLRKSSKPTLSTAQLWNCIAVYMSKQRAREGAKPGNYFNNILLSLPLPQKTS  1073
             S      GTLRKSSKPTLSTAQ+WNCIAVYMSKQRAREG KPGNYFNNILLSLPLPQKTS
Sbjct  1017  SGGNQSAGTLRKSSKPTLSTAQIWNCIAVYMSKQRAREGTKPGNYFNNILLSLPLPQKTS  1076

Query  1074  SPLAKARTTTNALSKLQTEAASALDFLGFPPRRIHSQETLISKPGGLQRADSLLSMGHNS  1133
             SPLAKARTTT+ALSKLQTEAASALDFLGFPPRRI SQE L SKPGGLQRADSL+SMGHN+
Sbjct  1077  SPLAKARTTTSALSKLQTEAASALDFLGFPPRRIQSQEALNSKPGGLQRADSLISMGHNT  1136

Query  1134  TRDLDTSSLASFQLDQSLLNSTFNSEESTTLNESFASLGHNNNNNNGISKQKNSSDCSIT  1193
             +RDLD SSLASFQLDQSL+NST N +ES+T NESF+ L HNNNN+  ISK  N+ DCSIT
Sbjct  1137  SRDLDNSSLASFQLDQSLMNSTVNGDESSTFNESFSKLSHNNNNS--ISKHMNNIDCSIT  1194

Query  1194  STASTTSAMLDQVPSFGMASTLTEQDLASIRLYLEQAFKDRHHPLYALNERIANCFHYSY  1253
             ST STTSA+LDQVPSFGMA  LTEQD+ SIRLYLEQAFKDRHHPLY LNERIANCFHYSY
Sbjct  1195  STTSTTSAVLDQVPSFGMALVLTEQDVTSIRLYLEQAFKDRHHPLYVLNERIANCFHYSY  1254

Query  1254  GYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPEDYCHMEGSREVISHITLLYPL  1313
             GYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPE+ C MEGSREVISHITLLYPL
Sbjct  1255  GYWKVKPTPILAKQAMREWESISRRIYRFVRKMFPALPEELCQMEGSREVISHITLLYPL  1314

Query  1314  VLSEGIYSTLFVLYANKYSRKDEMYRQNLNHAEKLKDQELVELMGHESFLQTVMLDPKFE  1373
             VLSEGIYSTLFVLYANKYSRKDEMYRQNLN AEKLKDQELVELMGHESFL  VMLDPKF 
Sbjct  1315  VLSEGIYSTLFVLYANKYSRKDEMYRQNLNLAEKLKDQELVELMGHESFLHNVMLDPKFV  1374

Query  1374  ESVQTLKQLQEKFSPQDMLTVIQRSTQLLTEAYEHAMSANAAQLNADNMIPLTMLTMLRA  1433
             ESVQTLK+LQEKFSPQDMLTVIQRSTQLLTEAYEHAM+ANAAQLNADNMIPLTMLTMLRA
Sbjct  1375  ESVQTLKELQEKFSPQDMLTVIQRSTQLLTEAYEHAMAANAAQLNADNMIPLTMLTMLRA  1434

Query  1434  AVPHLGAELALLDDLT-GPNFQAEMNGMAGYCYTTLKAAYEFVTLRALQKNP  1484
             AVPHLGAELALLDDLT GPNFQAEMNGMAGYCYTTLKAAYE VT RALQK P
Sbjct  1435  AVPHLGAELALLDDLTGGPNFQAEMNGMAGYCYTTLKAAYEHVTSRALQKIP  1486


>Q587D3_TRYB2 unnamed protein product
Length=358

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 61/191 (32%), Positives = 81/191 (42%), Gaps = 10/191 (5%)

Query  749  GTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVY  808
            G W  G  HG     Y DGS Y GE     + G G     S  +Y G +  GR +G GV 
Sbjct  28   GDWVFGKRHGTGVYVYADGSRYEGEWVDDKVHGNGACYYTSGNVYTGEWSMGRINGRGVL  87

Query  809  EMHCKDAPESEIYEGNFCEGLFHGHGMM-RNNRYIYVGEYQANARCGYGVL----EDLVS  863
            E H     + + YEG + +G  HG G    +N   Y GE++ + R G GV+     D   
Sbjct  88   EYH-----DGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEWKEDKRHGKGVVVYAAPDGCV  142

Query  864  GDKYMGMFADNKRAGIGSCITNRGDYFEGNFAADDLLGNGVAVFENDYYYEGELTLQGPS  923
             +KY G + + +  G G      G  +EG +    + G G  VF N   YEGE       
Sbjct  143  SEKYDGEWNEGRMQGWGKYFYADGGVYEGEWVDGRMHGRGTYVFPNGNKYEGEWVEDRKD  202

Query  924  GRGEYYMPCGE  934
            G G      GE
Sbjct  203  GYGILLYTNGE  213


 Score = 80.5 bits (197),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 68/250 (27%), Positives = 97/250 (39%), Gaps = 49/250 (20%)

Query  749  GTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVY  808
            G W  G ++G   LEY DG  Y GE   G + G G     +   Y G +K  + HG GV 
Sbjct  74   GEWSMGRINGRGVLEYHDGDRYEGEWKDGRMHGKGTYCYSNGDKYEGEWKEDKRHGKGVV  133

Query  809  EMHCKDAPESE-----------------------IYEGNFCEGLFHGHGM-MRNNRYIYV  844
                 D   SE                       +YEG + +G  HG G  +  N   Y 
Sbjct  134  VYAAPDGCVSEKYDGEWNEGRMQGWGKYFYADGGVYEGEWVDGRMHGRGTYVFPNGNKYE  193

Query  845  GEYQANARCGYGVL----------------------EDLVSGDKYMGMFADNKRAGIGSC  882
            GE+  + + GYG+L                         + GD+Y+G +   K+ G G  
Sbjct  194  GEWVEDRKDGYGILLYTNGERYEGYWHLDKAHGKGTLTFLQGDRYVGEWHYGKKHGHGVL  253

Query  883  ITNRGDYFEGNFAADDLLGNGVAVFENDYYYEGELTLQGPSGRGEYYMPCG---EAGNVS  939
              + GD ++G +  DD  G GV  + N   YEGE       G+G   +P G   E     
Sbjct  254  SYSNGDTYDGEWRDDDAWGYGVLQYANGCRYEGEWAEDRRHGKGLLVLPDGSSYEGSFAH  313

Query  940  GESDDTCELI  949
            G+ D   ++I
Sbjct  314  GKKDGPGKII  323


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 54/179 (30%), Positives = 81/179 (45%), Gaps = 14/179 (8%)

Query  769  VYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVYEMHCKDAPESEIYEGNFCEG  828
            +Y GE+ +G + G G +  P+   Y G +  G+ HG GVY        +   YEG + + 
Sbjct  2    IYSGEIENGQMHGRGCLQYPNKEKYDGDWVFGKRHGTGVYVY-----ADGSRYEGEWVDD  56

Query  829  LFHGHGM-MRNNRYIYVGEYQANARCGYGVLEDLVSGDKYMGMFADNKRAGIGSCITNRG  887
              HG+G     +  +Y GE+      G GVLE    GD+Y G + D +  G G+   + G
Sbjct  57   KVHGNGACYYTSGNVYTGEWSMGRINGRGVLE-YHDGDRYEGEWKDGRMHGKGTYCYSNG  115

Query  888  DYFEGNFAADDLLGNGVAVFEN-----DYYYEGELTLQGPSGRGEYYMPCGEAGNVSGE  941
            D +EG +  D   G GV V+          Y+GE       G G+Y+    + G   GE
Sbjct  116  DKYEGEWKEDKRHGKGVVVYAAPDGCVSEKYDGEWNEGRMQGWGKYFY--ADGGVYEGE  172


>Q57WF5_TRYB2 unnamed protein product
Length=437

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 56/191 (29%), Positives = 87/191 (46%), Gaps = 30/191 (16%)

Query  729  RSTGYEFSREHAKYSRVKACGTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIP  788
            R  G    RE   Y      G W  GV  G+    Y +G+ Y G+  +G   G G M   
Sbjct  202  RGYGEYLYREGYAYK-----GDWVNGVYEGSGTFFYTNGARYEGQWRNGYEHGRGTMTYY  256

Query  789  STGLYVGHFKGGRFHGHGVY--------------EMH----CKDAPESEIYEGNFCEGLF  830
            +  +Y G +  GR HG G Y               +H    C  A +  +Y+G++C GL+
Sbjct  257  NGDVYTGDWCNGRKHGTGTYTSKLLQYEGGWSSGAVHGIGKCTYA-DGSMYKGSWCRGLY  315

Query  831  HGHG--MMRNNRYIYVGEYQANARCGYGVLEDLVSGD-KYMGMFADNKRAGIGSCITNRG  887
             G G  + ++ +  Y GE++   RCG GV +    G+ +Y G + D++R G+G   T  G
Sbjct  316  DGDGEFVSQDKKCSYKGEFRGGKRCGRGVYQ---CGEVEYSGDWLDDRRHGVGEIKTRDG  372

Query  888  DYFEGNFAADD  898
              F G ++ D+
Sbjct  373  RVFRGTWSHDE  383


 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 55/188 (29%), Positives = 81/188 (43%), Gaps = 12/188 (6%)

Query  749  GTWRKGVMHGNCYLEYPDGSVYCGELNHGVIEGYGKMVIPSTGLYVGHFKGGRFHGHGVY  808
            G W  G  HG   L  P+G +Y G+   G I GYG+ +      Y G +  G + G G +
Sbjct  172  GKWLAGKWHGRGELAEPEG-LYIGDFVDGQIRGYGEYLYREGYAYKGDWVNGVYEGSGTF  230

Query  809  EMHCKDAPESEIYEGNFCEGLFHGHGMMR-NNRYIYVGEYQANARCGYGVLEDLVSGDKY  867
              +   A     YEG +  G  HG G M   N  +Y G++    + G G     +   +Y
Sbjct  231  -FYTNGAR----YEGQWRNGYEHGRGTMTYYNGDVYTGDWCNGRKHGTGTYTSKLL--QY  283

Query  868  MGMFADNKRAGIGSCITNRGDYFEGNFAADDLLGNGVAVFENDY-YYEGELTLQGPSGRG  926
             G ++     GIG C    G  ++G++      G+G  V ++    Y+GE       GRG
Sbjct  284  EGGWSSGAVHGIGKCTYADGSMYKGSWCRGLYDGDGEFVSQDKKCSYKGEFRGGKRCGRG  343

Query  927  EYYMPCGE  934
             Y   CGE
Sbjct  344  VY--QCGE  349


 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 44/154 (29%), Positives = 73/154 (47%), Gaps = 10/154 (6%)

Query  780  EGYGKMVIPSTGLYVGHFKGGRFHGHGVYEMHCKDAPESEIYEGNFCEGLFHGHGMMRNN  839
            EGY  +   +  +Y G++K  R HG GV     +   +++IYEG +  G+ +G+GM  + 
Sbjct  109  EGYQSITFDNGDMYEGNWKSCRMHGTGVM----RRVADNDIYEGEWFFGVRNGNGMCCSP  164

Query  840  RY--IYVGEYQANARCGYGVLEDLVSGDKYMGMFADNKRAGIGSCITNRGDYFEGNFAAD  897
             +  +Y G++ A    G G L +      Y+G F D +  G G  +   G  ++G++   
Sbjct  165  NFGTLYSGKWLAGKWHGRGELAE--PEGLYIGDFVDGQIRGYGEYLYREGYAYKGDWVNG  222

Query  898  DLLGNGVAVFENDYYYEGELTLQGPSGRG--EYY  929
               G+G   + N   YEG+       GRG   YY
Sbjct  223  VYEGSGTFFYTNGARYEGQWRNGYEHGRGTMTYY  256



Lambda      K        H
   0.314    0.130    0.373 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10869416390


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016393.1 uncharacterized protein LOC108070435 [Drosophila
kikkawai]

Length=636
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q23539_CAEEL  unnamed protein product                                 60.8    2e-09
D3YT36_CAEEL  unnamed protein product                                 60.8    2e-09
D3YT37_CAEEL  unnamed protein product                                 58.5    9e-09


>Q23539_CAEEL unnamed protein product
Length=515

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 98/505 (19%), Positives = 195/505 (39%), Gaps = 62/505 (12%)

Query  128  PNENRKC-IELTENIACG--QGLQNYLLNGVRCFLINLAKGTQQGNQSLIVKLREAEINV  184
            P + RK  +  T   AC   + L+  +  G+    +N + GT + + + I  +REA  N 
Sbjct  30   PQKTRKTGVICTIGPACSDVETLRKMINTGMNIARLNFSHGTHEAHAATIKTIREAAENA  89

Query  185  SREFGFPVVSSVMAMLSPRHQYTGSLSPLILADDQRSVDLVKGNEVILTVERDFSDRCTA  244
                 FPV  + +    P  + TG     + A++ + V L  G  V ++ +       T+
Sbjct  90   P----FPVAIA-LDTKGPEIR-TG-----MFANNMKEVQLENGKSVRVSTDPSMEFAATS  138

Query  245  HIIYVNARFLLVDVRPYDFILIGEE-IQLMVRSAHMDHLKCCVAKAGALYDHMPLLFPAR  303
              IY + R L   V+P   I I +  I L+V S     + C +   GAL     +  P  
Sbjct  139  SHIYADYRNLPKVVQPGSRIYIDDGLISLIVESCEETAVICTIENGGALGTRKGVNLPGT  198

Query  304  CNRF-QMSYEELEDLTFAREVGLNVVISHIAGTPKYLDDLEQSMASMHCDGMRLYARVLL  362
                  ++ +++EDL F  E G++++ +        +  + Q +      G  +Y   ++
Sbjct  199  IVDLPAVTSKDIEDLLFGVEQGVDIIFASFIRNADGIHKIRQVLGE---KGKHIY---II  252

Query  363  NEVNGCDGELNW--AAKRYDGFLVDLAPPAIVPDIMHLCPDAECFMQLAYASQKPIIFDP  420
             ++   DG  N     +  DG +V      I      +    +  +     + KP+I   
Sbjct  253  AKIESEDGVTNCDEIIEASDGVMVARGDLGIEIPAEKVFLAQKMLIAKCNLAGKPVICAT  312

Query  421  RLLDEQKLRVDPAHYYYTFY---------------------YPDKYVA----SCPPPKHS  455
            ++L+    +  P     +                       YP + +A     C   + +
Sbjct  313  QMLESMITKPRPTRAECSDVANAVLDGVDCVMLSGETAKGDYPVEALAIMHNICKEAESA  372

Query  456  HY-FRFLQNAIFQQIGPTAVAKAPYCDRSHTGADSLARSIVFASMEVHAVAIVVIGVTTR  514
             +  +  +  I     PT +        +HT     A + V A++   AVAI++I  T +
Sbjct  373  FFHMKHFEELILHTKKPTGM--------THT----TAIAAVSATITCRAVAIILITTTGK  420

Query  515  MVQKIAHFRPQAPILFVSHMRSAEDYVTIYHNVNMLPFYTKQVLEHKRNILLRAMYALAF  574
              +  + +RP  PI+ VS        + ++  +  + +   ++ E   ++  R  Y +  
Sbjct  421  TARLCSRYRPPVPIITVSRDERISRQLHLHRGIFPVYYPKGRIDEWDVDVEERVQYGVNL  480

Query  575  LSKRKIAKQNDPIVLVYNYEEGTTF  599
               R      DP++++  +++G  F
Sbjct  481  GKTRGFIHLGDPLIVITGWKQGAGF  505


>D3YT36_CAEEL unnamed protein product
Length=513

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 98/505 (19%), Positives = 195/505 (39%), Gaps = 62/505 (12%)

Query  128  PNENRKC-IELTENIACG--QGLQNYLLNGVRCFLINLAKGTQQGNQSLIVKLREAEINV  184
            P + RK  +  T   AC   + L+  +  G+    +N + GT + + + I  +REA  N 
Sbjct  28   PQKTRKTGVICTIGPACSDVETLRKMINTGMNIARLNFSHGTHEAHAATIKTIREAAENA  87

Query  185  SREFGFPVVSSVMAMLSPRHQYTGSLSPLILADDQRSVDLVKGNEVILTVERDFSDRCTA  244
                 FPV  + +    P  + TG     + A++ + V L  G  V ++ +       T+
Sbjct  88   P----FPVAIA-LDTKGPEIR-TG-----MFANNMKEVQLENGKSVRVSTDPSMEFAATS  136

Query  245  HIIYVNARFLLVDVRPYDFILIGEE-IQLMVRSAHMDHLKCCVAKAGALYDHMPLLFPAR  303
              IY + R L   V+P   I I +  I L+V S     + C +   GAL     +  P  
Sbjct  137  SHIYADYRNLPKVVQPGSRIYIDDGLISLIVESCEETAVICTIENGGALGTRKGVNLPGT  196

Query  304  CNRF-QMSYEELEDLTFAREVGLNVVISHIAGTPKYLDDLEQSMASMHCDGMRLYARVLL  362
                  ++ +++EDL F  E G++++ +        +  + Q +      G  +Y   ++
Sbjct  197  IVDLPAVTSKDIEDLLFGVEQGVDIIFASFIRNADGIHKIRQVLGE---KGKHIY---II  250

Query  363  NEVNGCDGELNW--AAKRYDGFLVDLAPPAIVPDIMHLCPDAECFMQLAYASQKPIIFDP  420
             ++   DG  N     +  DG +V      I      +    +  +     + KP+I   
Sbjct  251  AKIESEDGVTNCDEIIEASDGVMVARGDLGIEIPAEKVFLAQKMLIAKCNLAGKPVICAT  310

Query  421  RLLDEQKLRVDPAHYYYTFY---------------------YPDKYVA----SCPPPKHS  455
            ++L+    +  P     +                       YP + +A     C   + +
Sbjct  311  QMLESMITKPRPTRAECSDVANAVLDGVDCVMLSGETAKGDYPVEALAIMHNICKEAESA  370

Query  456  HY-FRFLQNAIFQQIGPTAVAKAPYCDRSHTGADSLARSIVFASMEVHAVAIVVIGVTTR  514
             +  +  +  I     PT +        +HT     A + V A++   AVAI++I  T +
Sbjct  371  FFHMKHFEELILHTKKPTGM--------THT----TAIAAVSATITCRAVAIILITTTGK  418

Query  515  MVQKIAHFRPQAPILFVSHMRSAEDYVTIYHNVNMLPFYTKQVLEHKRNILLRAMYALAF  574
              +  + +RP  PI+ VS        + ++  +  + +   ++ E   ++  R  Y +  
Sbjct  419  TARLCSRYRPPVPIITVSRDERISRQLHLHRGIFPVYYPKGRIDEWDVDVEERVQYGVNL  478

Query  575  LSKRKIAKQNDPIVLVYNYEEGTTF  599
               R      DP++++  +++G  F
Sbjct  479  GKTRGFIHLGDPLIVITGWKQGAGF  503


>D3YT37_CAEEL unnamed protein product
Length=461

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 91/477 (19%), Positives = 183/477 (38%), Gaps = 59/477 (12%)

Query  153  NGVRCFLINLAKGTQQGNQSLIVKLREAEINVSREFGFPVVSSVMAMLSPRHQYTGSLSP  212
             G+    +N + GT + + + I  +REA  N      FPV  + +    P  + TG    
Sbjct  4    TGMNIARLNFSHGTHEAHAATIKTIREAAENAP----FPVAIA-LDTKGPEIR-TG----  53

Query  213  LILADDQRSVDLVKGNEVILTVERDFSDRCTAHIIYVNARFLLVDVRPYDFILIGEE-IQ  271
             + A++ + V L  G  V ++ +       T+  IY + R L   V+P   I I +  I 
Sbjct  54   -MFANNMKEVQLENGKSVRVSTDPSMEFAATSSHIYADYRNLPKVVQPGSRIYIDDGLIS  112

Query  272  LMVRSAHMDHLKCCVAKAGALYDHMPLLFPARCNRF-QMSYEELEDLTFAREVGLNVVIS  330
            L+V S     + C +   GAL     +  P        ++ +++EDL F  E G++++ +
Sbjct  113  LIVESCEETAVICTIENGGALGTRKGVNLPGTIVDLPAVTSKDIEDLLFGVEQGVDIIFA  172

Query  331  HIAGTPKYLDDLEQSMASMHCDGMRLYARVLLNEVNGCDGELNW--AAKRYDGFLVDLAP  388
                    +  + Q +      G  +Y   ++ ++   DG  N     +  DG +V    
Sbjct  173  SFIRNADGIHKIRQVLGE---KGKHIY---IIAKIESEDGVTNCDEIIEASDGVMVARGD  226

Query  389  PAIVPDIMHLCPDAECFMQLAYASQKPIIFDPRLLDEQKLRVDPAHYYYTFY--------  440
              I      +    +  +     + KP+I   ++L+    +  P     +          
Sbjct  227  LGIEIPAEKVFLAQKMLIAKCNLAGKPVICATQMLESMITKPRPTRAECSDVANAVLDGV  286

Query  441  -------------YPDKYVA----SCPPPKHSHY-FRFLQNAIFQQIGPTAVAKAPYCDR  482
                         YP + +A     C   + + +  +  +  I     PT +        
Sbjct  287  DCVMLSGETAKGDYPVEALAIMHNICKEAESAFFHMKHFEELILHTKKPTGM--------  338

Query  483  SHTGADSLARSIVFASMEVHAVAIVVIGVTTRMVQKIAHFRPQAPILFVSHMRSAEDYVT  542
            +HT     A + V A++   AVAI++I  T +  +  + +RP  PI+ VS        + 
Sbjct  339  THT----TAIAAVSATITCRAVAIILITTTGKTARLCSRYRPPVPIITVSRDERISRQLH  394

Query  543  IYHNVNMLPFYTKQVLEHKRNILLRAMYALAFLSKRKIAKQNDPIVLVYNYEEGTTF  599
            ++  +  + +   ++ E   ++  R  Y +     R      DP++++  +++G  F
Sbjct  395  LHRGIFPVYYPKGRIDEWDVDVEERVQYGVNLGKTRGFIHLGDPLIVITGWKQGAGF  451



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016394.1 protein LSM14 homolog A isoform X1 [Drosophila
kikkawai]

Length=674
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ0_DROME  unnamed protein product                                 660     0.0  
M9PI44_DROME  unnamed protein product                                 656     0.0  
M9PFB2_DROME  unnamed protein product                                 644     0.0  


>Q9VTZ0_DROME unnamed protein product
Length=652

 Score = 660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/682 (78%), Positives = 547/682 (80%), Gaps = 38/682 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTL  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  TL
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQVG-EKVEGVHTL  462

Query  474  NGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  533
            NGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER
Sbjct  463  NGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  522

Query  534  KLNTETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNY  593
            KLNTETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG    
Sbjct  523  KLNTETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG----  573

Query  594  RNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NAT  652
               +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NAT
Sbjct  574  GGGNFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNAT  630

Query  653  TATSKSTSLLPEQTQQVAAVSQ  674
            TAT+KSTSLLPEQTQQVAAVSQ
Sbjct  631  TATTKSTSLLPEQTQQVAAVSQ  652


>M9PI44_DROME unnamed protein product
Length=653

 Score = 656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/683 (77%), Positives = 547/683 (80%), Gaps = 39/683 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTL  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  TL
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQVG-EKVEGVHTL  462

Query  474  NGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  533
            NGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER
Sbjct  463  NGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  522

Query  534  KLNTETFGVSSTRRG-SYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGN  592
            KLNTETFGVSSTRRG SYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG   
Sbjct  523  KLNTETFGVSSTRRGSSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG---  574

Query  593  YRNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NA  651
                +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NA
Sbjct  575  -GGGNFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNA  630

Query  652  TTATSKSTSLLPEQTQQVAAVSQ  674
            TTAT+KSTSLLPEQTQQVAAVSQ
Sbjct  631  TTATTKSTSLLPEQTQQVAAVSQ  653


>M9PFB2_DROME unnamed protein product
Length=642

 Score = 644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/682 (77%), Positives = 541/682 (79%), Gaps = 48/682 (7%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTL  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQ           L
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPK---PATNATAATATATNEQ-----------L  452

Query  474  NGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  533
            NGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER
Sbjct  453  NGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  512

Query  534  KLNTETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNY  593
            KLNTETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG  
Sbjct  513  KLNTETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG-  566

Query  594  RNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NAT  652
               +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NAT
Sbjct  567  ---NFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNAT  620

Query  653  TATSKSTSLLPEQTQQVAAVSQ  674
            TAT+KSTSLLPEQTQQVAAVSQ
Sbjct  621  TATTKSTSLLPEQTQQVAAVSQ  642



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016395.1 protein LSM14 homolog B-A isoform X3 [Drosophila
kikkawai]

Length=672
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ0_DROME  unnamed protein product                                 657     0.0  
M9PI44_DROME  unnamed protein product                                 653     0.0  
M9PFB2_DROME  unnamed protein product                                 640     0.0  


>Q9VTZ0_DROME unnamed protein product
Length=652

 Score = 657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/680 (78%), Positives = 545/680 (80%), Gaps = 38/680 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTL  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  TL
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQVG-EKVEGVHTL  462

Query  474  NGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  533
            NGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER
Sbjct  463  NGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  522

Query  534  KLNTETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNY  593
            KLNTETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG    
Sbjct  523  KLNTETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG----  573

Query  594  RNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NAT  652
               +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NAT
Sbjct  574  GGGNFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNAT  630

Query  653  TATSKSTSLLPEQTQQVAAV  672
            TAT+KSTSLLPEQTQQVAAV
Sbjct  631  TATTKSTSLLPEQTQQVAAV  650


>M9PI44_DROME unnamed protein product
Length=653

 Score = 653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/681 (77%), Positives = 545/681 (80%), Gaps = 39/681 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTL  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  TL
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQVG-EKVEGVHTL  462

Query  474  NGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  533
            NGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER
Sbjct  463  NGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  522

Query  534  KLNTETFGVSSTRRG-SYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGN  592
            KLNTETFGVSSTRRG SYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG   
Sbjct  523  KLNTETFGVSSTRRGSSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG---  574

Query  593  YRNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NA  651
                +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NA
Sbjct  575  -GGGNFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNA  630

Query  652  TTATSKSTSLLPEQTQQVAAV  672
            TTAT+KSTSLLPEQTQQVAAV
Sbjct  631  TTATTKSTSLLPEQTQQVAAV  651


>M9PFB2_DROME unnamed protein product
Length=642

 Score = 640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/680 (77%), Positives = 539/680 (79%), Gaps = 48/680 (7%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTL  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQ           L
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQ-----------L  452

Query  474  NGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  533
            NGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER
Sbjct  453  NGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQER  512

Query  534  KLNTETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNY  593
            KLNTETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG  
Sbjct  513  KLNTETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG-  566

Query  594  RNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NAT  652
               +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NAT
Sbjct  567  ---NFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNAT  620

Query  653  TATSKSTSLLPEQTQQVAAV  672
            TAT+KSTSLLPEQTQQVAAV
Sbjct  621  TATTKSTSLLPEQTQQVAAV  640



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016396.1 protein toll [Drosophila kikkawai]

Length=796
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9NBK8_DROME  unnamed protein product                                 1347    0.0  
Q9VJX9_DROME  unnamed protein product                                 1345    0.0  
Q9XZF9_DROME  unnamed protein product                                 1345    0.0  


>Q9NBK8_DROME unnamed protein product
Length=795

 Score = 1347 bits (3485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/796 (82%), Positives = 707/796 (89%), Gaps = 1/796 (0%)

Query  1    MLSLLPVVWLLWAGTLPVQQATGQIIPLPTFCQGAREPCTCAAEANVVRFHCPDEYAMLL  60
            ML+ LPVVWL +A  L ++ ATGQIIPLPTFC G    CTCAAE NVVRFHCPDEYAMLL
Sbjct  1    MLTYLPVVWLFFA-LLVLRSATGQIIPLPTFCLGLSPQCTCAAEGNVVRFHCPDEYAMLL  59

Query  61   EVSEPGASLYLSYYAAGELHWLPRFNISELVKIEFDAYSFWPETFLEDLLHTMGVTKVKT  120
            EVSEPGASLY+SYYA+ EL WLPRFNIS LVKIEFDAY FWPE FL DLL T+GV  VKT
Sbjct  60   EVSEPGASLYMSYYASTELQWLPRFNISSLVKIEFDAYIFWPEKFLSDLLKTLGVQTVKT  119

Query  121  VLFRDRTAETVVTRDVHNAAGGYQNSGRPGNISTWHFGALPGLKKFKFYSDVKVLQESIF  180
            ++FRDRT ETVVTRDV N+  GY  + +P NI+TWHFG++PGLKKFKF+S V  LQESIF
Sbjct  120  IIFRDRTLETVVTRDVLNSGNGYMETSQPENITTWHFGSVPGLKKFKFFSHVPELQESIF  179

Query  181  HGFDSLTEVLLRVEVSELPHLLLSTVSETLETLTIESPGMVKFGYPLLSELKQLRNLSLL  240
            HGFD+L ++ L V V+ LP  +LSTV+ TL+TLTIESPG+V FG PLL EL+QLRNLSL 
Sbjct  180  HGFDTLRDLHLSVNVTTLPGNMLSTVNGTLKTLTIESPGIVSFGNPLLRELQQLRNLSLA  239

Query  241  LTDPQRGRNDQFQPHFFGAMKQLVEVRLARATGEVNRRMFKGTEKLQLIKINGNEDLLEL  300
            L  P   R+ Q QPHFFG+M  L EVRLA AT  VNR MFKGT KLQLIK+NGN+DL+EL
Sbjct  240  LIHPFHERDKQLQPHFFGSMTNLEEVRLASATSSVNRSMFKGTNKLQLIKMNGNDDLMEL  299

Query  301  PGEVFRDQLNLQTLDLSCNALSHLHDDAFLGLGNLTLLDLSKNKLTDLSSTIFAALASLN  360
            PGE+F DQ+NL+TLDLSCNA+  LH+D F GLGNLTLLDLSKN+LT+LSSTIFA L SLN
Sbjct  300  PGEIFLDQVNLKTLDLSCNAIVTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLN  359

Query  361  VLRLNKNSLTAMSPNVFRDVPSLNYIEMVNTQFYGATLLMSYEAVVCTNDETCQYKSAEW  420
            VLRLNKNSLTAMSP+VF+DV SLNYIEMVNTQFYGATLLM+YEAVVCTNDE CQYKSAEW
Sbjct  360  VLRLNKNSLTAMSPSVFQDVVSLNYIEMVNTQFYGATLLMNYEAVVCTNDEACQYKSAEW  419

Query  421  QCDPRCICWVQRNVKNLIVDCRGTSIEELPVLPRTTLVSTVVKVGNNSLNRLPTVGEHRG  480
            QCDPRCICWVQR+V +LIVDCRGTS+EELP LPRTTL+STV+KVGNNSL  LPTV EH G
Sbjct  420  QCDPRCICWVQRSVGSLIVDCRGTSLEELPDLPRTTLLSTVLKVGNNSLTSLPTVSEHSG  479

Query  481  YANVSGLFLSDNQLTSLGSGAQLPDNLTHLDVRRNLINEVSEEFVEFLQQANNTMTLSLS  540
            YANVSGLFLSDN LTSLGSG QLPDNLTHLDVR N I  +SEEF+ FLQ+ NNTMTLSLS
Sbjct  480  YANVSGLFLSDNNLTSLGSGDQLPDNLTHLDVRGNQIQSLSEEFLLFLQEPNNTMTLSLS  539

Query  541  GNPISCDCAALPLLFFVRTNPQRVIDIADVMCTKQKKALQRMEAFELCPSYVLLISCVIG  600
            GNPI+C C +L LLFFVRTNPQRV DIAD++CTKQKK+ Q+MEAFELCPSYVLLISCV+G
Sbjct  540  GNPITCGCESLSLLFFVRTNPQRVRDIADIVCTKQKKSFQQMEAFELCPSYVLLISCVVG  599

Query  601  GLVIIGCLLTVFYLMFQQELKIWMYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS  660
            GLVI+ CLLTVFYLMFQQELKIW+YNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS
Sbjct  600  GLVIVICLLTVFYLMFQQELKIWLYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS  659

Query  661  KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF  720
            KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF
Sbjct  660  KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF  719

Query  721  RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLCYAMPH  780
            RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKL YAMPH
Sbjct  720  RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLYYAMPH  779

Query  781  NRRVLKGQKKHAGPLI  796
            NRRVLKGQKKHAGPLI
Sbjct  780  NRRVLKGQKKHAGPLI  795


>Q9VJX9_DROME unnamed protein product
Length=795

 Score = 1345 bits (3481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/796 (82%), Positives = 707/796 (89%), Gaps = 1/796 (0%)

Query  1    MLSLLPVVWLLWAGTLPVQQATGQIIPLPTFCQGAREPCTCAAEANVVRFHCPDEYAMLL  60
            ML+ LPVVWL +A  L ++ ATGQIIPLPTFC G    CTCAAE NVVRFHCPDEYAMLL
Sbjct  1    MLTYLPVVWLFFA-LLVLRSATGQIIPLPTFCLGLSPQCTCAAEGNVVRFHCPDEYAMLL  59

Query  61   EVSEPGASLYLSYYAAGELHWLPRFNISELVKIEFDAYSFWPETFLEDLLHTMGVTKVKT  120
            EVSEPGASLY+SYYA+ EL WLPRFNIS LVKIEFDAY FWPE FL DLL T+GV  VKT
Sbjct  60   EVSEPGASLYMSYYASTELQWLPRFNISSLVKIEFDAYIFWPEKFLSDLLKTLGVQTVKT  119

Query  121  VLFRDRTAETVVTRDVHNAAGGYQNSGRPGNISTWHFGALPGLKKFKFYSDVKVLQESIF  180
            ++FRDRT ETVVTRDV N+  GY  + +P NI+TWHFG++PGLKKFKF+S V  LQESIF
Sbjct  120  IIFRDRTLETVVTRDVLNSGNGYMETSQPENITTWHFGSVPGLKKFKFFSHVPELQESIF  179

Query  181  HGFDSLTEVLLRVEVSELPHLLLSTVSETLETLTIESPGMVKFGYPLLSELKQLRNLSLL  240
            HGFD+L ++ L V V+ LP  +LSTV+ TL+TLTIESPG+V FG PLL EL+QLRNLSL 
Sbjct  180  HGFDTLRDLHLSVNVTTLPGNMLSTVNGTLKTLTIESPGIVSFGNPLLRELQQLRNLSLA  239

Query  241  LTDPQRGRNDQFQPHFFGAMKQLVEVRLARATGEVNRRMFKGTEKLQLIKINGNEDLLEL  300
            L  P   R+ Q QPHFFG+M  L EVRLA AT  VNR MFKGT KLQLIK+NGN+DL+EL
Sbjct  240  LIHPFHERDKQLQPHFFGSMTNLEEVRLASATSSVNRSMFKGTNKLQLIKMNGNDDLMEL  299

Query  301  PGEVFRDQLNLQTLDLSCNALSHLHDDAFLGLGNLTLLDLSKNKLTDLSSTIFAALASLN  360
            PGE+F DQ+NL+TLDLSCNA+  LH+D F GLGNLTLLDLSKN+LT+LSSTIFA L SLN
Sbjct  300  PGEIFLDQVNLKTLDLSCNAIVTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLN  359

Query  361  VLRLNKNSLTAMSPNVFRDVPSLNYIEMVNTQFYGATLLMSYEAVVCTNDETCQYKSAEW  420
            VLRLNKNSLTAMSP+VF+DV SLNYIEMVNTQFYGATLLM+YEAVVCTNDE CQYKSAEW
Sbjct  360  VLRLNKNSLTAMSPSVFQDVVSLNYIEMVNTQFYGATLLMNYEAVVCTNDEACQYKSAEW  419

Query  421  QCDPRCICWVQRNVKNLIVDCRGTSIEELPVLPRTTLVSTVVKVGNNSLNRLPTVGEHRG  480
            QCDPRCICWVQR+V +LIVDCRGTS+EELP LPRTTL+STV+KVGNNSL  LPTV EH G
Sbjct  420  QCDPRCICWVQRSVGSLIVDCRGTSLEELPDLPRTTLLSTVLKVGNNSLTSLPTVSEHSG  479

Query  481  YANVSGLFLSDNQLTSLGSGAQLPDNLTHLDVRRNLINEVSEEFVEFLQQANNTMTLSLS  540
            YANVSGLFLSDN LTSLGSG QLPDNLTHLDVR N I  +S+EF+ FLQ+ NNTMTLSLS
Sbjct  480  YANVSGLFLSDNNLTSLGSGDQLPDNLTHLDVRGNQIQSLSDEFLLFLQEPNNTMTLSLS  539

Query  541  GNPISCDCAALPLLFFVRTNPQRVIDIADVMCTKQKKALQRMEAFELCPSYVLLISCVIG  600
            GNPI+C C +L LLFFVRTNPQRV DIAD++CTKQKK+ Q+MEAFELCPSYVLLISCV+G
Sbjct  540  GNPITCGCESLSLLFFVRTNPQRVRDIADIVCTKQKKSFQQMEAFELCPSYVLLISCVVG  599

Query  601  GLVIIGCLLTVFYLMFQQELKIWMYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS  660
            GLVI+ CLLTVFYLMFQQELKIW+YNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS
Sbjct  600  GLVIVICLLTVFYLMFQQELKIWLYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS  659

Query  661  KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF  720
            KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF
Sbjct  660  KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF  719

Query  721  RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLCYAMPH  780
            RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKL YAMPH
Sbjct  720  RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLYYAMPH  779

Query  781  NRRVLKGQKKHAGPLI  796
            NRRVLKGQKKHAGPLI
Sbjct  780  NRRVLKGQKKHAGPLI  795


>Q9XZF9_DROME unnamed protein product
Length=795

 Score = 1345 bits (3480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/796 (82%), Positives = 707/796 (89%), Gaps = 1/796 (0%)

Query  1    MLSLLPVVWLLWAGTLPVQQATGQIIPLPTFCQGAREPCTCAAEANVVRFHCPDEYAMLL  60
            ML+ LPVVWL +A  L ++ ATGQIIPLPTFC G    CTCAAE NVVRFHCPDEYAMLL
Sbjct  1    MLTYLPVVWLFFA-LLVLRSATGQIIPLPTFCLGLSPQCTCAAEGNVVRFHCPDEYAMLL  59

Query  61   EVSEPGASLYLSYYAAGELHWLPRFNISELVKIEFDAYSFWPETFLEDLLHTMGVTKVKT  120
            EVSEPGASLY+SYYA+ EL WLPRFNIS LVKIEFDAY FWPE FL DLL T+GV  VKT
Sbjct  60   EVSEPGASLYMSYYASTELQWLPRFNISSLVKIEFDAYIFWPEKFLSDLLKTLGVQTVKT  119

Query  121  VLFRDRTAETVVTRDVHNAAGGYQNSGRPGNISTWHFGALPGLKKFKFYSDVKVLQESIF  180
            ++FRDRT ETVVTRDV N+  GY  + +P NI+TWHFG++PGLKKFKF+S V  LQESIF
Sbjct  120  IIFRDRTLETVVTRDVLNSGNGYMETSQPENITTWHFGSVPGLKKFKFFSHVPELQESIF  179

Query  181  HGFDSLTEVLLRVEVSELPHLLLSTVSETLETLTIESPGMVKFGYPLLSELKQLRNLSLL  240
            HGFD+L ++ L V V+ LP  +LSTV+ TL+TLTIESPG+V FG PLL EL+QLRNLSL 
Sbjct  180  HGFDTLRDLHLSVNVTTLPGNMLSTVNGTLKTLTIESPGIVSFGNPLLRELQQLRNLSLA  239

Query  241  LTDPQRGRNDQFQPHFFGAMKQLVEVRLARATGEVNRRMFKGTEKLQLIKINGNEDLLEL  300
            L  P   R+ Q QPHFFG+M  L EVRLA AT  VNR MFKGT KLQLIK+NGN+DL+EL
Sbjct  240  LIHPFHERDKQLQPHFFGSMTNLEEVRLASATSSVNRSMFKGTNKLQLIKMNGNDDLMEL  299

Query  301  PGEVFRDQLNLQTLDLSCNALSHLHDDAFLGLGNLTLLDLSKNKLTDLSSTIFAALASLN  360
            PGE+F DQ+NL+TLDLSCNA+  LH+D F GLGNLTLLDLSKN+LT+LSSTIFA L SLN
Sbjct  300  PGEIFLDQVNLKTLDLSCNAIVTLHEDVFKGLGNLTLLDLSKNRLTNLSSTIFAPLTSLN  359

Query  361  VLRLNKNSLTAMSPNVFRDVPSLNYIEMVNTQFYGATLLMSYEAVVCTNDETCQYKSAEW  420
            VLRLNKNSLTAMSP+VF+DV SLNYIEMVNTQFYGATLLM+YEAVVCTNDE CQYKSAEW
Sbjct  360  VLRLNKNSLTAMSPSVFQDVVSLNYIEMVNTQFYGATLLMNYEAVVCTNDEACQYKSAEW  419

Query  421  QCDPRCICWVQRNVKNLIVDCRGTSIEELPVLPRTTLVSTVVKVGNNSLNRLPTVGEHRG  480
            QCDPRCICWVQR+V +LIVDCRGTS+EELP LPRTTL+STV+KVGNNSL  LPTV EH G
Sbjct  420  QCDPRCICWVQRSVGSLIVDCRGTSLEELPDLPRTTLLSTVLKVGNNSLTSLPTVSEHSG  479

Query  481  YANVSGLFLSDNQLTSLGSGAQLPDNLTHLDVRRNLINEVSEEFVEFLQQANNTMTLSLS  540
            YANVSGLFLSDN LTSLGSG QLPDNLTHLDVR N I  +SEEF+ FLQ+ NNTMTLSLS
Sbjct  480  YANVSGLFLSDNNLTSLGSGDQLPDNLTHLDVRGNQIQSLSEEFLLFLQEPNNTMTLSLS  539

Query  541  GNPISCDCAALPLLFFVRTNPQRVIDIADVMCTKQKKALQRMEAFELCPSYVLLISCVIG  600
            GNPI+C C +L LLFFVRTNPQRV DIAD++CTKQKK+ Q+MEAFELCPSYVLLISCV+G
Sbjct  540  GNPITCGCESLSLLFFVRTNPQRVRDIADIVCTKQKKSFQQMEAFELCPSYVLLISCVVG  599

Query  601  GLVIIGCLLTVFYLMFQQELKIWMYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS  660
            GLVI+ CLLTVFYLMFQQELKIW+YNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS
Sbjct  600  GLVIVICLLTVFYLMFQQELKIWLYNNNLCLWWVSEEELDKDKTYDAFISYSHKDEELIS  659

Query  661  KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF  720
            KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF
Sbjct  660  KLLPKLESGPHPFRLCLHDRDWLVGDCIPEQIVRTVDDSKRVIIVLSQHFIDSVWARMEF  719

Query  721  RIAYQATLQDKRKRIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLCYAMPH  780
            RIAYQATLQDKR+RIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKL YAMPH
Sbjct  720  RIAYQATLQDKRERIIIILYRELEHMNGIDSELRAYLKLNTYLKWGDPLFWSKLYYAMPH  779

Query  781  NRRVLKGQKKHAGPLI  796
            NRRVLKGQKKHAGPLI
Sbjct  780  NRRVLKGQKKHAGPLI  795



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016397.1 protein LSM14 homolog B isoform X4 [Drosophila
kikkawai]

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ0_DROME  unnamed protein product                                 663     0.0  
M9PF14_DROME  unnamed protein product                                 661     0.0  
M9PI44_DROME  unnamed protein product                                 659     0.0  


>Q9VTZ0_DROME unnamed protein product
Length=652

 Score = 663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/679 (78%), Positives = 547/679 (81%), Gaps = 36/679 (5%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGN-QQQQKPQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  239
            GSLAPGSGAPGSGPFMHIGGN QQ +  QQKQPNMLAGASRSTTPISLIVSPTAELTQQQ
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  234

Query  240  QLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGNDFYN  298
            QLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG DFYN
Sbjct  235  QLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTDFYN  293

Query  299  QHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG---  355
               QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG   
Sbjct  294  ---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNGGGN  350

Query  356  --AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGDFDF  412
              AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGDFDF
Sbjct  351  NPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGDFDF  409

Query  413  EQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTLNGE  472
            EQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  TLNGE
Sbjct  410  EQANNKFEELRSQLAKLKVAEDGAPK---PATNATAATATATNEQVG-EKVEGVHTLNGE  465

Query  473  TDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLN  532
            TDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLN
Sbjct  466  TDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLN  525

Query  533  TETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNR  592
            TETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG       
Sbjct  526  TETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG----GGG  576

Query  593  SNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTAT  651
            +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT
Sbjct  577  NFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTAT  633

Query  652  SKSTSLLPEQTQQVAAVSQ  670
            +KSTSLLPEQTQQVAAVSQ
Sbjct  634  TKSTSLLPEQTQQVAAVSQ  652


>M9PF14_DROME unnamed protein product
Length=656

 Score = 661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/683 (77%), Positives = 548/683 (80%), Gaps = 40/683 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQP-----NMLAGASRSTTPISLIVSPTAEL  235
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ++      +MLAGASRSTTPISLIVSPTAEL
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQKQPISVLDMLAGASRSTTPISLIVSPTAEL  234

Query  236  TQQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGN  294
            TQQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG 
Sbjct  235  TQQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGT  293

Query  295  DFYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGN  354
            DFYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGN
Sbjct  294  DFYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGN  350

Query  355  G-----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEG  408
            G     AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEG
Sbjct  351  GGGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEG  409

Query  409  DFDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPT  468
            DFDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  T
Sbjct  410  DFDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQVG-EKVEGVHT  465

Query  469  LNGETDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQE  528
            LNGETDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQE
Sbjct  466  LNGETDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQE  525

Query  529  RKLNTETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGN  588
            RKLNTETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG   
Sbjct  526  RKLNTETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG---  577

Query  589  YRNRSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NA  647
                +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NA
Sbjct  578  -GGGNFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNA  633

Query  648  TTATSKSTSLLPEQTQQVAAVSQ  670
            TTAT+KSTSLLPEQTQQVAAVSQ
Sbjct  634  TTATTKSTSLLPEQTQQVAAVSQ  656


>M9PI44_DROME unnamed protein product
Length=653

 Score = 659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/680 (78%), Positives = 547/680 (80%), Gaps = 37/680 (5%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGN-QQQQKPQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  239
            GSLAPGSGAPGSGPFMHIGGN QQ +  QQKQPNMLAGASRSTTPISLIVSPTAELTQQQ
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  234

Query  240  QLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGNDFYN  298
            QLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG DFYN
Sbjct  235  QLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTDFYN  293

Query  299  QHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG---  355
               QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG   
Sbjct  294  ---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNGGGN  350

Query  356  --AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGDFDF  412
              AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGDFDF
Sbjct  351  NPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGDFDF  409

Query  413  EQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQVGEEKLEGAPTLNGE  472
            EQANNKFEELRSQLAKLKVA+D        + +    T TATNEQVG EK+EG  TLNGE
Sbjct  410  EQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQVG-EKVEGVHTLNGE  465

Query  473  TDKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLN  532
            TDKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLN
Sbjct  466  TDKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLN  525

Query  533  TETFGVSSTRRG-SYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRN  591
            TETFGVSSTRRG SYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG      
Sbjct  526  TETFGVSSTRRGSSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG----GG  576

Query  592  RSNNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTA  650
             +    +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTA
Sbjct  577  GNFRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTA  633

Query  651  TSKSTSLLPEQTQQVAAVSQ  670
            T+KSTSLLPEQTQQVAAVSQ
Sbjct  634  TTKSTSLLPEQTQQVAAVSQ  653



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016398.1 protein LSM14 homolog B-A isoform X6 [Drosophila
kikkawai]

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFB2_DROME  unnamed protein product                                 652     0.0  
M9PCB7_DROME  unnamed protein product                                 648     0.0  
Q9VTZ0_DROME  unnamed protein product                                 644     0.0  


>M9PFB2_DROME unnamed protein product
Length=642

 Score = 652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/671 (78%), Positives = 541/671 (81%), Gaps = 37/671 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQLNGETDKKDDSG  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQLNGETDKKDDSG
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQLNGETDKKDDSG  463

Query  474  NETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSS  533
            NETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSS
Sbjct  464  NETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSS  523

Query  534  TRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNRSNNRNNGG  593
            TRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG     +    +  
Sbjct  524  TRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG----NFRNRSNN  574

Query  594  GGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTATSKSTSLLP  652
               G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT+KSTSLLP
Sbjct  575  RNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTATTKSTSLLP  631

Query  653  EQTQQVAAVSQ  663
            EQTQQVAAVSQ
Sbjct  632  EQTQQVAAVSQ  642


>M9PCB7_DROME unnamed protein product
Length=643

 Score = 648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/672 (78%), Positives = 541/672 (81%), Gaps = 38/672 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQLNGETDKKDDSG  473
            FDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQLNGETDKKDDSG
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQLNGETDKKDDSG  463

Query  474  NETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSS  533
            NETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSS
Sbjct  464  NETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSS  523

Query  534  TRRG-SYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNRSNNRNNG  592
            TRRG SYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG     +    + 
Sbjct  524  TRRGSSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG----NFRNRSN  574

Query  593  GGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTATSKSTSLL  651
                G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT+KSTSLL
Sbjct  575  NRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTATTKSTSLL  631

Query  652  PEQTQQVAAVSQ  663
            PEQTQQVAAVSQ
Sbjct  632  PEQTQQVAAVSQ  643


>Q9VTZ0_DROME unnamed protein product
Length=652

 Score = 644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/678 (77%), Positives = 540/678 (80%), Gaps = 41/678 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQPISVLDMLAGASRSTTPISLIVSPTAELT  240
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ+      +MLAGASRSTTPISLIVSPTAELT
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQ---KQPNMLAGASRSTTPISLIVSPTAELT  231

Query  241  QQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGND  299
            QQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG D
Sbjct  232  QQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTD  290

Query  300  FYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG  359
            FYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG
Sbjct  291  FYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNG  347

Query  360  -----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGD  413
                 AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGD
Sbjct  348  GGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGD  406

Query  414  FDFEQANNKFEELRSQLAKLKVADD-ATTNKSVTSNSTATTTTTATNEQ------LNGET  466
            FDFEQANNKFEELRSQLAKLKVA+D A    +  + +TAT T     E+      LNGET
Sbjct  407  FDFEQANNKFEELRSQLAKLKVAEDGAPKPATNATAATATATNEQVGEKVEGVHTLNGET  466

Query  467  DKKDDSGNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNT  526
            DKKDDSGNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNT
Sbjct  467  DKKDDSGNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNT  526

Query  527  ETFGVSSTRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNRS  586
            ETFGVSSTRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGG       +
Sbjct  527  ETFGVSSTRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGG----GGGN  577

Query  587  NNRNNGGGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTATS  645
                +     G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT+
Sbjct  578  FRNRSNNRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTATT  634

Query  646  KSTSLLPEQTQQVAAVSQ  663
            KSTSLLPEQTQQVAAVSQ
Sbjct  635  KSTSLLPEQTQQVAAVSQ  652



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016399.2 protein LSM14 homolog B isoform X8 [Drosophila
kikkawai]

Length=659
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFB2_DROME  unnamed protein product                                 651     0.0  
M9PFF9_DROME  unnamed protein product                                 649     0.0  
M9PCB7_DROME  unnamed protein product                                 647     0.0  


>M9PFB2_DROME unnamed protein product
Length=642

 Score = 651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/668 (78%), Positives = 540/668 (81%), Gaps = 35/668 (5%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGN-QQQQKPQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  239
            GSLAPGSGAPGSGPFMHIGGN QQ +  QQKQPNMLAGASRSTTPISLIVSPTAELTQQQ
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  234

Query  240  QLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGNDFYN  298
            QLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG DFYN
Sbjct  235  QLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTDFYN  293

Query  299  QHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG---  355
               QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG   
Sbjct  294  ---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNGGGN  350

Query  356  --AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGDFDF  412
              AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGDFDF
Sbjct  351  NPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGDFDF  409

Query  413  EQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQLNGETDKKDDSGNET  472
            EQANNKFEELRSQLAKLKVA+D        + +    T TATNEQLNGETDKKDDSGNET
Sbjct  410  EQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQLNGETDKKDDSGNET  466

Query  473  GAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSSTRR  532
            GAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSSTRR
Sbjct  467  GAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSSTRR  526

Query  533  GSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNRSNNRNNGGGGG  592
            GSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG     +    +     
Sbjct  527  GSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG----NFRNRSNNRNN  577

Query  593  GNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTATSKSTSLLPEQT  651
            G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT+KSTSLLPEQT
Sbjct  578  GGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTATTKSTSLLPEQT  634

Query  652  QQVAAVCE  659
            QQVAAV +
Sbjct  635  QQVAAVSQ  642


>M9PFF9_DROME unnamed protein product
Length=646

 Score = 649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/672 (78%), Positives = 541/672 (81%), Gaps = 39/672 (6%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGNQQQQKPQQKQP-----NMLAGASRSTTPISLIVSPTAEL  235
            GSLAPGSGAPGSGPFMHIGGNQQQ KPQQ++      +MLAGASRSTTPISLIVSPTAEL
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQKQPISVLDMLAGASRSTTPISLIVSPTAEL  234

Query  236  TQQQQLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGN  294
            TQQQQLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG 
Sbjct  235  TQQQQLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGT  293

Query  295  DFYNQHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGN  354
            DFYN   QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGN
Sbjct  294  DFYN---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGN  350

Query  355  G-----AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEG  408
            G     AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEG
Sbjct  351  GGGNNPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEG  409

Query  409  DFDFEQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQLNGETDKKDDS  468
            DFDFEQANNKFEELRSQLAKLKVA+D        + +    T TATNEQLNGETDKKDDS
Sbjct  410  DFDFEQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQLNGETDKKDDS  466

Query  469  GNETGAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVS  528
            GNETGAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVS
Sbjct  467  GNETGAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVS  526

Query  529  STRRGSYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNRSNNRNNG  588
            STRRGSYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG     +    + 
Sbjct  527  STRRGSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG----NFRNRSN  577

Query  589  GGGGGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTATSKSTSLL  647
                G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT+KSTSLL
Sbjct  578  NRNNGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTATTKSTSLL  634

Query  648  PEQTQQVAAVCE  659
            PEQTQQVAAV +
Sbjct  635  PEQTQQVAAVSQ  646


>M9PCB7_DROME unnamed protein product
Length=643

 Score = 647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/669 (78%), Positives = 540/669 (81%), Gaps = 36/669 (5%)

Query  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60
            MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ
Sbjct  1    MSGGLPELGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQ  60

Query  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQVMPQHFPMPSGMNAPPQQ  120
            IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ MPQHFPMPSGM+ PPQQ
Sbjct  61   IYDYILFRGSDIKDIRVVNNHTLPHHNDPAIMQAQLQNGPPQ-MPQHFPMPSGMSGPPQQ  119

Query  121  QQQQQQVPPQQPPHGAPSMPGVGGGSGGSGAPGGPGYGNGNPFGNLGGPNLANMVGNSGG  180
            QQ   Q PPQ P  G     G  G  GG G   G G   GN    LGGPNLANMVGN+ G
Sbjct  120  QQVPSQQPPQMPSGGGSGGAGGAGAPGGGGPGYGNGNPFGN----LGGPNLANMVGNA-G  174

Query  181  GSLAPGSGAPGSGPFMHIGGN-QQQQKPQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  239
            GSLAPGSGAPGSGPFMHIGGN QQ +  QQKQPNMLAGASRSTTPISLIVSPTAELTQQQ
Sbjct  175  GSLAPGSGAPGSGPFMHIGGNQQQPKPQQQKQPNMLAGASRSTTPISLIVSPTAELTQQQ  234

Query  240  QLHQQQNAAQGGGNGRDAGHKRQNHQQHHQQAQQQRGGSNSNNM-QQQQRGGGSGNDFYN  298
            QLHQQQNA Q GGNGRDAGHKRQNHQQ   Q  QQRGG + NNM QQQQRGGGSG DFYN
Sbjct  235  QLHQQQNAGQ-GGNGRDAGHKRQNHQQQQNQQHQQRGGPSHNNMQQQQQRGGGSGTDFYN  293

Query  299  QHQQQRDRRDSGRQMDNNYNNNYNNNQRNRGGGNGMQQQQQQQRGGNGGGGGNGGNG---  355
               QQRDRRDSGRQMDNNY+NNYNNN  N+    G    QQQQRGGNGG GG GGNG   
Sbjct  294  ---QQRDRRDSGRQMDNNYSNNYNNNNNNQRNRGGGNGMQQQQRGGNGGSGGGGGNGGGN  350

Query  356  --AWNMHRGGNGQNTNNMMMRNRGMGSRGPMRPNQNYRPQSA-NQNKPRNKIKFEGDFDF  412
              AWNMHR GN  + N M MRNRGMGSRGPMRPNQ YRPQSA NQNKPRNKIKFEGDFDF
Sbjct  351  NPAWNMHR-GNQNSNNMMNMRNRGMGSRGPMRPNQGYRPQSANNQNKPRNKIKFEGDFDF  409

Query  413  EQANNKFEELRSQLAKLKVADDATTNKSVTSNSTATTTTTATNEQLNGETDKKDDSGNET  472
            EQANNKFEELRSQLAKLKVA+D        + +    T TATNEQLNGETDKKDDSGNET
Sbjct  410  EQANNKFEELRSQLAKLKVAEDGAPKP---ATNATAATATATNEQLNGETDKKDDSGNET  466

Query  473  GAGEHEPEEDDVHVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSSTRR  532
            GAGEHEPEEDDV VCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSSTRR
Sbjct  467  GAGEHEPEEDDVAVCYDKTKSFFDNISCEAAQDRSKNKKNDWRQERKLNTETFGVSSTRR  526

Query  533  G-SYRGRNHYYNNGNMGAGNGGMNSGYGGAQGYNRNNYNRMGGGGNYRNRSNNRNNGGGG  591
            G SYRGR    N      GNGG+NSGYGGA GYNRNNY RMGGGG     +    +    
Sbjct  527  GSSYRGR----NQYYNNNGNGGINSGYGGAPGYNRNNY-RMGGGGG----NFRNRSNNRN  577

Query  592  GGNGRGGNGQPNITNGNAANTAAALKAANNAAGSGSNATDSTS-NATTATSKSTSLLPEQ  650
             G GRGGNG PNITNGN A       AANNAAG GSNATDS++ NATTAT+KSTSLLPEQ
Sbjct  578  NGGGRGGNGMPNITNGNTAAALK---AANNAAGHGSNATDSSAPNATTATTKSTSLLPEQ  634

Query  651  TQQVAAVCE  659
            TQQVAAV +
Sbjct  635  TQQVAAVSQ  643



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016400.1 mucin-5AC isoform X1 [Drosophila kikkawai]

Length=1305
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQI0_DROME  unnamed protein product                                 1742    0.0  
Q8IQH9_DROME  unnamed protein product                                 1697    0.0  
Q9XZ09_DROME  unnamed protein product                                 1651    0.0  


>Q8IQI0_DROME unnamed protein product
Length=1294

 Score = 1742 bits (4511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1086/1312 (83%), Positives = 1139/1312 (87%), Gaps = 61/1312 (5%)

Query  20    STATAPSAPLKTIKIRTQQLHPHALPSLSLL---HPSSSS---VASASAFSSASLVSHSH  73
             STATAPSAPLKTIKIRTQQLH HA+PSLSLL   +PSSSS    A+ S  +SASLVSHSH
Sbjct  18    STATAPSAPLKTIKIRTQQLHTHAVPSLSLLPSIYPSSSSSSLAATGSLSASASLVSHSH  77

Query  74    PPLQLRGVINKYSLPSSHLPSSAAHSAVAAKITHVKADGGGGISISGTPILSAGTIKVAA  133
             PPLQLRGVINKYSLPS HLPSSAAH AVAAKITHVK+DGGGGISI+GTPILS GTIKVA+
Sbjct  78    PPLQLRGVINKYSLPS-HLPSSAAHPAVAAKITHVKSDGGGGISIAGTPILSGGTIKVAS  136

Query  134   ANPIQQASLAGTPISLNTGQATTAASIRAIGAGGQSTQVRVMMPMIKQLENVTATGRTQI  193
             AN +QQ SL GTPI+LN GQATTAASIRAIGAGGQSTQVRV+MPMIKQLENVTATGRTQI
Sbjct  137   ANQVQQTSLGGTPIALNAGQATTAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGRTQI  196

Query  194   TAIPAAPARSVSNASITVTRPVTQA-YLPRASVTATQMGGVGVGVGQRLVTPLRATSSAS  252
             TAIPAAPARS +NASITVTRPVTQA YLPRASVTATQMGGVGVGVGQRLVTPLRATSSA 
Sbjct  197   TAIPAAPARSGANASITVTRPVTQATYLPRASVTATQMGGVGVGVGQRLVTPLRATSSA-  255

Query  253   ATVTPAAPTGLSTSGGFVRGATASVSRSGVAVSSQPPSTVISSSNSATWMQSPTGQVQLI  312
              TVTP APT LS++GGFVRGATASVSRSGVA++SQP S VISSSNS  WMQS  GQVQLI
Sbjct  256   -TVTPTAPTVLSSTGGFVRGATASVSRSGVALTSQPSSAVISSSNSGAWMQS-QGQVQLI  313

Query  313   RAIHQPRQRIITTSAG---ASVVTTATPVPAPTALSVSTGQPLTPQQATGPGG-PQAYVA  368
             R IHQPRQRIITTSAG   ASVVTT TPV APTALSVS GQPL  QQATGPGG PQAYVA
Sbjct  314   RTIHQPRQRIITTSAGVSNASVVTT-TPVQAPTALSVSAGQPLATQQATGPGGGPQAYVA  372

Query  369   TVLPQRQHQATLVYSSNVSTPNANTNPGQQFNPRFAVATPTTTPGGTTVTP-----RQVR  423
             TVLPQRQHQATLVYSSNVS PNA+ NPGQQFNPRFAVATPT     TT        RQVR
Sbjct  373   TVLPQRQHQATLVYSSNVSAPNASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPRQVR  432

Query  424   PIPLGKSFPAAKLNTTSISIRAPSIPQLNASVTPSQTPVSVSGGATVAPGRGPGVGGTAL  483
             PIPLGKSFP AKLNTTSISIRAPSIPQLN SVT S T VSVSGGATVAPGRGPG GGTAL
Sbjct  433   PIPLGKSFPTAKLNTTSISIRAPSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGGTAL  492

Query  484   TATNLHTTRIIQLQQPATGTTQQIIGSAARLAGNVMLQPFVMSTTAAAKMGIRPPVTMTA  543
             TATNL TTRIIQLQQPATGTTQQIIGS ARLAGNVMLQPF+MSTTAAAKMGIRPPVTMTA
Sbjct  493   TATNLPTTRIIQLQQPATGTTQQIIGSGARLAGNVMLQPFLMSTTAAAKMGIRPPVTMTA  552

Query  544   KVQPSLTITQLNPIGKLSTAGGTGGPTMTPQGVASIQAVSVPSVSASVVNPSSVTGATSA  603
             KVQPSLTITQLNPIGKLS  GG+GG TM PQGVASIQAV VP+VSASVVN SSVTGATSA
Sbjct  553   KVQPSLTITQLNPIGKLSAGGGSGGQTMGPQGVASIQAVPVPNVSASVVNSSSVTGATSA  612

Query  604   AGGATVLPLTISGRGGAVGPGGNILTGTLTPIKNASGGI--KMMMTPAPTAAAPGSEGPG  661
             AGGATVLPLTISGRG  VGPGGNILTGTLTPIKNASG    KMMM PA  ++APG++G  
Sbjct  613   AGGATVLPLTISGRGAGVGPGGNILTGTLTPIKNASGITLGKMMMAPA--SSAPGADGSS  670

Query  662   NTGPAVGSFQRTWNPVVASQSQLMKIDDKGSAATIYYESMPASASTGVLSLTTTTVTQST  721
              +G  V  FQRTWNPVVASQSQLMKID+KGSAATIYYESMPASASTGVLSLTTTTVTQST
Sbjct  671   TSGATVTGFQRTWNPVVASQSQLMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQST  730

Query  722   QAQPQLVSSAGGSLSVSSLPFASHAPTGAGAGSAGVGSQATFTVLPSGAAGGGGAATRTI  781
             QAQ QLVSSAGGSLSVSSLPFASHA  GAG+G    GSQATFTVLPSGA   GG ATRTI
Sbjct  731   QAQAQLVSSAGGSLSVSSLPFASHATAGAGSGGG--GSQATFTVLPSGA---GGTATRTI  785

Query  782   GPHQQLIIPAGANSAPPQHMVIPLHTSVKVTTTGAGGNPQQATAGGGSLVPNFMRKRDAE  841
             G HQQLIIPAG NSAPPQHMVIPLHTSVKVTT    GNPQQATA  G+LV +FMRKRDAE
Sbjct  786   G-HQQLIIPAGPNSAPPQHMVIPLHTSVKVTT--GAGNPQQATA-SGALVSSFMRKRDAE  841

Query  842   GSPIRAAKNLAPTLLSMASNTSG----PSPGTTFNLQPVSVAVPTSSGLNSGLTVEALAK  897
             GSPIRAAKNL PTLLSMASN SG    P+PGTTFN+QPVSV VP S G  SGLTVEALAK
Sbjct  842   GSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTFNIQPVSVTVPQSVG--SGLTVEALAK  899

Query  898   KERERVTTHGGVLPTSGGGATNVAPTAAGTAVSSTRNSRAESPASSDGSTTVSANSSPGV  957
             KERERVT   GV  ++      V P      V+STRNSRA+SPASSDGSTTVSANSSPGV
Sbjct  900   KERERVT--HGVASSAASVPATVGP------VNSTRNSRADSPASSDGSTTVSANSSPGV  951

Query  958   DQQQLQDRIGDAP----AAARENATHFNPINELYSTHQSLQQGLSHASLGARSGNSAFVD  1013
             D QQLQDRIGD P    A  R+N+THFNPINE+YS+HQS+QQ L H+SLGARSG+SAFVD
Sbjct  952   D-QQLQDRIGDQPATGGAGGRDNSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVD  1010

Query  1014  VQQPTPQQQQPPQQQQQAAHLLVGSSSQQAGPRLNGTGNSSSSSYDCSSRKKPRRSTNDS  1073
             VQ PTPQQQQP Q        LVGS+  Q G R+NGTGNSSSSSYDCSSRKKPRRSTNDS
Sbjct  1011  VQAPTPQQQQPQQVPH-----LVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDS  1065

Query  1074  QHSAQSQASLSLPPPSAEPTAPTGAAYMQKHNNGGLLVAAAAAPTGVPTPNSAPGDANHR  1133
             QHS QSQASLSLPPPS+EPT P GA+YMQKHNNGGLLV AA    GV  PNSAPGDANHR
Sbjct  1066  QHSTQSQASLSLPPPSSEPTPPAGASYMQKHNNGGLLVTAATP--GV-APNSAPGDANHR  1122

Query  1134  NSTPAVTGNKENANPVDFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVI  1193
             NSTPAV GNKENANPVDFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVI
Sbjct  1123  NSTPAVAGNKENANPVDFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVI  1182

Query  1194  DLANQPNVQGKINGWKIYHLSSQMEDLNESEMVSLGQLEVMLKDLEKDKDKHSEMERVTE  1253
             DLANQPNVQGKINGWKIYHL SQMEDLNESE+ SLG+LE ML+DLEKDK+KHSE+ERVTE
Sbjct  1183  DLANQPNVQGKINGWKIYHLRSQMEDLNESEVFSLGRLETMLQDLEKDKEKHSEIERVTE  1242

Query  1254  LLKGNIQRSKIITEGINEAQSQLMKIFEHKPHVSDIINRCASKRNFKKREKI  1305
             LLKGNIQRSKIIT+GINEAQ+QLMKIFEHKPHVS+II RCASKRNFKKREKI
Sbjct  1243  LLKGNIQRSKIITDGINEAQNQLMKIFEHKPHVSNIITRCASKRNFKKREKI  1294


>Q8IQH9_DROME unnamed protein product
Length=1257

 Score = 1697 bits (4395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1044/1255 (83%), Positives = 1093/1255 (87%), Gaps = 55/1255 (4%)

Query  71    HSHPPLQLRGVINKYSLPSSHLPSSAAHSAVAAKITHVKADGGGGISISGTPILSAGTIK  130
             HSHPPLQLRGVINKYSLPS HLPSSAAH AVAAKITHVK+DGGGGISI+GTPILS GTIK
Sbjct  38    HSHPPLQLRGVINKYSLPS-HLPSSAAHPAVAAKITHVKSDGGGGISIAGTPILSGGTIK  96

Query  131   VAAANPIQQASLAGTPISLNTGQATTAASIRAIGAGGQSTQVRVMMPMIKQLENVTATGR  190
             VA+AN +QQ SL GTPI+LN GQATTAASIRAIGAGGQSTQVRV+MPMIKQLENVTATGR
Sbjct  97    VASANQVQQTSLGGTPIALNAGQATTAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGR  156

Query  191   TQITAIPAAPARSVSNASITVTRPVTQA-YLPRASVTATQMGGVGVGVGQRLVTPLRATS  249
             TQITAIPAAPARS +NASITVTRPVTQA YLPRASVTATQMGGVGVGVGQRLVTPLRATS
Sbjct  157   TQITAIPAAPARSGANASITVTRPVTQATYLPRASVTATQMGGVGVGVGQRLVTPLRATS  216

Query  250   SASATVTPAAPTGLSTSGGFVRGATASVSRSGVAVSSQPPSTVISSSNSATWMQSPTGQV  309
             SA  TVTP APT LS++GGFVRGATASVSRSGVA++SQP S VISSSNS  WMQS  GQV
Sbjct  217   SA--TVTPTAPTVLSSTGGFVRGATASVSRSGVALTSQPSSAVISSSNSGAWMQS-QGQV  273

Query  310   QLIRAIHQPRQRIITTSAG---ASVVTTATPVPAPTALSVSTGQPLTPQQATGPGG-PQA  365
             QLIR IHQPRQRIITTSAG   ASVVTT TPV APTALSVS GQPL  QQATGPGG PQA
Sbjct  274   QLIRTIHQPRQRIITTSAGVSNASVVTT-TPVQAPTALSVSAGQPLATQQATGPGGGPQA  332

Query  366   YVATVLPQRQHQATLVYSSNVSTPNANTNPGQQFNPRFAVATPTTTPGGTTVTP-----R  420
             YVATVLPQRQHQATLVYSSNVS PNA+ NPGQQFNPRFAVATPT     TT        R
Sbjct  333   YVATVLPQRQHQATLVYSSNVSAPNASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPR  392

Query  421   QVRPIPLGKSFPAAKLNTTSISIRAPSIPQLNASVTPSQTPVSVSGGATVAPGRGPGVGG  480
             QVRPIPLGKSFP AKLNTTSISIRAPSIPQLN SVT S T VSVSGGATVAPGRGPG GG
Sbjct  393   QVRPIPLGKSFPTAKLNTTSISIRAPSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGG  452

Query  481   TALTATNLHTTRIIQLQQPATGTTQQIIGSAARLAGNVMLQPFVMSTTAAAKMGIRPPVT  540
             TALTATNL TTRIIQLQQPATGTTQQIIGS ARLAGNVMLQPF+MSTTAAAKMGIRPPVT
Sbjct  453   TALTATNLPTTRIIQLQQPATGTTQQIIGSGARLAGNVMLQPFLMSTTAAAKMGIRPPVT  512

Query  541   MTAKVQPSLTITQLNPIGKLSTAGGTGGPTMTPQGVASIQAVSVPSVSASVVNPSSVTGA  600
             MTAKVQPSLTITQLNPIGKLS  GG+GG TM PQGVASIQAV VP+VSASVVN SSVTGA
Sbjct  513   MTAKVQPSLTITQLNPIGKLSAGGGSGGQTMGPQGVASIQAVPVPNVSASVVNSSSVTGA  572

Query  601   TSAAGGATVLPLTISGRGGAVGPGGNILTGTLTPIKNASGGI--KMMMTPAPTAAAPGSE  658
             TSAAGGATVLPLTISGRG  VGPGGNILTGTLTPIKNASG    KMMM PA  ++APG++
Sbjct  573   TSAAGGATVLPLTISGRGAGVGPGGNILTGTLTPIKNASGITLGKMMMAPA--SSAPGAD  630

Query  659   GPGNTGPAVGSFQRTWNPVVASQSQLMKIDDKGSAATIYYESMPASASTGVLSLTTTTVT  718
             G   +G  V  FQRTWNPVVASQSQLMKID+KGSAATIYYESMPASASTGVLSLTTTTVT
Sbjct  631   GSSTSGATVTGFQRTWNPVVASQSQLMKIDEKGSAATIYYESMPASASTGVLSLTTTTVT  690

Query  719   QSTQAQPQLVSSAGGSLSVSSLPFASHAPTGAGAGSAGVGSQATFTVLPSGAAGGGGAAT  778
             QSTQAQ QLVSSAGGSLSVSSLPFASHA  GAG+G    GSQATFTVLPSGA   GG AT
Sbjct  691   QSTQAQAQLVSSAGGSLSVSSLPFASHATAGAGSGGG--GSQATFTVLPSGA---GGTAT  745

Query  779   RTIGPHQQLIIPAGANSAPPQHMVIPLHTSVKVTTTGAGGNPQQATAGGGSLVPNFMRKR  838
             RTIG HQQLIIPAG NSAPPQHMVIPLHTSVKVTT    GNPQQATA  G+LV +FMRKR
Sbjct  746   RTIG-HQQLIIPAGPNSAPPQHMVIPLHTSVKVTT--GAGNPQQATA-SGALVSSFMRKR  801

Query  839   DAEGSPIRAAKNLAPTLLSMASNTSG----PSPGTTFNLQPVSVAVPTSSGLNSGLTVEA  894
             DAEGSPIRAAKNL PTLLSMASN SG    P+PGTTFN+QPVSV VP S G  SGLTVEA
Sbjct  802   DAEGSPIRAAKNLGPTLLSMASNNSGQNMPPAPGTTFNIQPVSVTVPQSVG--SGLTVEA  859

Query  895   LAKKERERVTTHGGVLPTSGGGATNVAPTAAGTAVSSTRNSRAESPASSDGSTTVSANSS  954
             LAKKERERVT   GV  ++      V P      V+STRNSRA+SPASSDGSTTVSANSS
Sbjct  860   LAKKERERVT--HGVASSAASVPATVGP------VNSTRNSRADSPASSDGSTTVSANSS  911

Query  955   PGVDQQQLQDRIGDAP----AAARENATHFNPINELYSTHQSLQQGLSHASLGARSGNSA  1010
             PGVD QQLQDRIGD P    A  R+N+THFNPINE+YS+HQS+QQ L H+SLGARSG+SA
Sbjct  912   PGVD-QQLQDRIGDQPATGGAGGRDNSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSA  970

Query  1011  FVDVQQPTPQQQQPPQQQQQAAHLLVGSSSQQAGPRLNGTGNSSSSSYDCSSRKKPRRST  1070
             FVDVQ PTPQQQQP Q        LVGS+  Q G R+NGTGNSSSSSYDCSSRKKPRRST
Sbjct  971   FVDVQAPTPQQQQPQQVPH-----LVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRST  1025

Query  1071  NDSQHSAQSQASLSLPPPSAEPTAPTGAAYMQKHNNGGLLVAAAAAPTGVPTPNSAPGDA  1130
             NDSQHS QSQASLSLPPPS+EPT P GA+YMQKHNNGGLLV AA    GV  PNSAPGDA
Sbjct  1026  NDSQHSTQSQASLSLPPPSSEPTPPAGASYMQKHNNGGLLVTAATP--GV-APNSAPGDA  1082

Query  1131  NHRNSTPAVTGNKENANPVDFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRA  1190
             NHRNSTPAV GNKENANPVDFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRA
Sbjct  1083  NHRNSTPAVAGNKENANPVDFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRA  1142

Query  1191  TVIDLANQPNVQGKINGWKIYHLSSQMEDLNESEMVSLGQLEVMLKDLEKDKDKHSEMER  1250
             TVIDLANQPNVQGKINGWKIYHL SQMEDLNESE+ SLG+LE ML+DLEKDK+KHSE+ER
Sbjct  1143  TVIDLANQPNVQGKINGWKIYHLRSQMEDLNESEVFSLGRLETMLQDLEKDKEKHSEIER  1202

Query  1251  VTELLKGNIQRSKIITEGINEAQSQLMKIFEHKPHVSDIINRCASKRNFKKREKI  1305
             VTELLKGNIQRSKIIT+GINEAQ+QLMKIFEHKPHVS+II RCASKRNFKKREKI
Sbjct  1203  VTELLKGNIQRSKIITDGINEAQNQLMKIFEHKPHVSNIITRCASKRNFKKREKI  1257


>Q9XZ09_DROME unnamed protein product
Length=1219

 Score = 1651 bits (4275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1019/1230 (83%), Positives = 1069/1230 (87%), Gaps = 54/1230 (4%)

Query  96    AAHSAVAAKITHVKADGGGGISISGTPILSAGTIKVAAANPIQQASLAGTPISLNTGQAT  155
             +AH AVAAKITHVK+DGGGGISI+GTPILS GTIKVA+AN +QQ SL GTPI+LN GQAT
Sbjct  24    SAHPAVAAKITHVKSDGGGGISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQAT  83

Query  156   TAASIRAIGAGGQSTQVRVMMPMIKQLENVTATGRTQITAIPAAPARSVSNASITVTRPV  215
             TAASIRAIGAGGQSTQVRV+MPMIKQLENVTATGRTQITAIPAAPARS +NASITVTRPV
Sbjct  84    TAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGRTQITAIPAAPARSGANASITVTRPV  143

Query  216   TQA-YLPRASVTATQMGGVGVGVGQRLVTPLRATSSASATVTPAAPTGLSTSGGFVRGAT  274
             TQA YLPRASVTATQMGGVGVGVGQRLVTPLRATSSA  TVTP APT LS++GGFVRGAT
Sbjct  144   TQATYLPRASVTATQMGGVGVGVGQRLVTPLRATSSA--TVTPTAPTVLSSTGGFVRGAT  201

Query  275   ASVSRSGVAVSSQPPSTVISSSNSATWMQSPTGQVQLIRAIHQPRQRIITTSAG---ASV  331
             ASVSRSGVA++SQP S VISSSNS  WMQS  GQVQLIR IHQPRQRIITTSAG   ASV
Sbjct  202   ASVSRSGVALTSQPSSAVISSSNSGAWMQS-QGQVQLIRTIHQPRQRIITTSAGVSNASV  260

Query  332   VTTATPVPAPTALSVSTGQPLTPQQATGPGG-PQAYVATVLPQRQHQATLVYSSNVSTPN  390
             VTT TPV APTALSVS GQPL  QQATGPGG PQAYVATVLPQRQHQATLVYSSNVS PN
Sbjct  261   VTT-TPVQAPTALSVSAGQPLATQQATGPGGGPQAYVATVLPQRQHQATLVYSSNVSAPN  319

Query  391   ANTNPGQQFNPRFAVATPTTTPGGTTVTP-----RQVRPIPLGKSFPAAKLNTTSISIRA  445
             A+ NPGQQFNPRFAVATPT     TT        RQVRPIPLGKSFP AKLNTTSISIRA
Sbjct  320   ASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPRQVRPIPLGKSFPTAKLNTTSISIRA  379

Query  446   PSIPQLNASVTPSQTPVSVSGGATVAPGRGPGVGGTALTATNLHTTRIIQLQQPATGTTQ  505
             PSIPQLN SVT S T VSVSGGATVAPGRGPG GGTALTATNL TTRIIQLQQPATGTTQ
Sbjct  380   PSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGGTALTATNLPTTRIIQLQQPATGTTQ  439

Query  506   QIIGSAARLAGNVMLQPFVMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSTAGG  565
             QIIGS ARLAGNVMLQPF+MSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLS  GG
Sbjct  440   QIIGSGARLAGNVMLQPFLMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSAGGG  499

Query  566   TGGPTMTPQGVASIQAVSVPSVSASVVNPSSVTGATSAAGGATVLPLTISGRGGAVGPGG  625
             +GG TM PQGVASIQAV VP+VSASVVN SSVTGATSAAGGATVLPLTISGRG  VGPGG
Sbjct  500   SGGQTMGPQGVASIQAVPVPNVSASVVNSSSVTGATSAAGGATVLPLTISGRGAGVGPGG  559

Query  626   NILTGTLTPIKNASGGI--KMMMTPAPTAAAPGSEGPGNTGPAVGSFQRTWNPVVASQSQ  683
             NILTGTLTPIKNASG    KMMM PA  ++APG++G   +G  V  FQRTWNPVVASQSQ
Sbjct  560   NILTGTLTPIKNASGITLGKMMMAPA--SSAPGADGSSTSGATVTGFQRTWNPVVASQSQ  617

Query  684   LMKIDDKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQPQLVSSAGGSLSVSSLPFA  743
             LMKID+KGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQ QLVSSAGGSLSVSSLPFA
Sbjct  618   LMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFA  677

Query  744   SHAPTGAGAGSAGVGSQATFTVLPSGAAGGGGAATRTIGPHQQLIIPAGANSAPPQHMVI  803
             SHA  GAG+G    GSQATFTVLPSGA   GG ATRTIG HQQLIIPAG NSAPPQHMVI
Sbjct  678   SHATAGAGSGGG--GSQATFTVLPSGA---GGTATRTIG-HQQLIIPAGPNSAPPQHMVI  731

Query  804   PLHTSVKVTTTGAGGNPQQATAGGGSLVPNFMRKRDAEGSPIRAAKNLAPTLLSMASNTS  863
             PLHTSVKVTT    GNPQQATA  G+LV +FMRKRDAEGSPIRAAKNL PTLLSMASN S
Sbjct  732   PLHTSVKVTT--GAGNPQQATA-SGALVSSFMRKRDAEGSPIRAAKNLGPTLLSMASNNS  788

Query  864   G----PSPGTTFNLQPVSVAVPTSSGLNSGLTVEALAKKERERVTTHGGVLPTSGGGATN  919
             G    P+PGTTFN+QPVSV VP S G  SGLTVEALAKKERERVT   GV  ++      
Sbjct  789   GQNMPPAPGTTFNIQPVSVTVPQSVG--SGLTVEALAKKERERVT--HGVASSAASVPAT  844

Query  920   VAPTAAGTAVSSTRNSRAESPASSDGSTTVSANSSPGVDQQQLQDRIGDAP----AAARE  975
             V P      V+STRNSRA+SPASSDGSTTVSANSSPGVD QQLQDRIGD P    A  R+
Sbjct  845   VGP------VNSTRNSRADSPASSDGSTTVSANSSPGVD-QQLQDRIGDQPATGGAGGRD  897

Query  976   NATHFNPINELYSTHQSLQQGLSHASLGARSGNSAFVDVQQPTPQQQQPPQQQQQAAHLL  1035
             N+THFNPINE+YS+HQS+QQ L H+SLGARSG+SAFVDVQ PTPQQQQP Q        L
Sbjct  898   NSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAPTPQQQQPQQVPH-----L  952

Query  1036  VGSSSQQAGPRLNGTGNSSSSSYDCSSRKKPRRSTNDSQHSAQSQASLSLPPPSAEPTAP  1095
             VGS+  Q G R+NGTGNSSSSSYDCSSRKKPRRSTNDSQHS QSQASLSLPPPS+EPT P
Sbjct  953   VGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQHSTQSQASLSLPPPSSEPTPP  1012

Query  1096  TGAAYMQKHNNGGLLVAAAAAPTGVPTPNSAPGDANHRNSTPAVTGNKENANPVDFVIRR  1155
              GA+YMQKHNNGGLLV AA    GV  PNSAPGDANHRNSTPAV GNKENANPVDFVIRR
Sbjct  1013  AGASYMQKHNNGGLLVTAATP--GV-APNSAPGDANHRNSTPAVAGNKENANPVDFVIRR  1069

Query  1156  PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLSS  1215
             PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHL S
Sbjct  1070  PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRS  1129

Query  1216  QMEDLNESEMVSLGQLEVMLKDLEKDKDKHSEMERVTELLKGNIQRSKIITEGINEAQSQ  1275
             QMEDLNESE+ SLG+LE ML+DLEKDK+KHSE+ERVTELLKGNIQRSKIIT+GINEAQ+Q
Sbjct  1130  QMEDLNESEVFSLGRLETMLQDLEKDKEKHSEIERVTELLKGNIQRSKIITDGINEAQNQ  1189

Query  1276  LMKIFEHKPHVSDIINRCASKRNFKKREKI  1305
             LMKIFEHKPHVS+II RCASKRNFKKREKI
Sbjct  1190  LMKIFEHKPHVSNIITRCASKRNFKKREKI  1219



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016401.1 mucin-5AC isoform X2 [Drosophila kikkawai]

Length=1235
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9XZ09_DROME  unnamed protein product                                 1662    0.0  
Q8IQH9_DROME  unnamed protein product                                 1651    0.0  
Q8IQI0_DROME  unnamed protein product                                 1650    0.0  


>Q9XZ09_DROME unnamed protein product
Length=1219

 Score = 1662 bits (4305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1027/1236 (83%), Positives = 1076/1236 (87%), Gaps = 54/1236 (4%)

Query  20    STATAPSAHSAVAAKITHVKADGGGGISISGTPILSAGTIKVAAANPIQQASLAGTPISL  79
             STATAPSAH AVAAKITHVK+DGGGGISI+GTPILS GTIKVA+AN +QQ SL GTPI+L
Sbjct  18    STATAPSAHPAVAAKITHVKSDGGGGISIAGTPILSGGTIKVASANQVQQTSLGGTPIAL  77

Query  80    NTGQATTAASIRAIGAGGQSTQVRVMMPMIKQLENVTATGRTQITAIPAAPARSVSNASI  139
             N GQATTAASIRAIGAGGQSTQVRV+MPMIKQLENVTATGRTQITAIPAAPARS +NASI
Sbjct  78    NAGQATTAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGRTQITAIPAAPARSGANASI  137

Query  140   TVTRPVTQA-YLPRASVTATQMGGVGVGVGQRLVTPLRATSSASATVTPAAPTGLSTSGG  198
             TVTRPVTQA YLPRASVTATQMGGVGVGVGQRLVTPLRATSSA  TVTP APT LS++GG
Sbjct  138   TVTRPVTQATYLPRASVTATQMGGVGVGVGQRLVTPLRATSSA--TVTPTAPTVLSSTGG  195

Query  199   FVRGATASVSRSGVAVSSQPPSTVISSSNSATWMQSPTGQVQLIRAIHQPRQRIITTSAG  258
             FVRGATASVSRSGVA++SQP S VISSSNS  WMQS  GQVQLIR IHQPRQRIITTSAG
Sbjct  196   FVRGATASVSRSGVALTSQPSSAVISSSNSGAWMQS-QGQVQLIRTIHQPRQRIITTSAG  254

Query  259   ---ASVVTTATPVPAPTALSVSTGQPLTPQQATGPGG-PQAYVATVLPQRQHQATLVYSS  314
                ASVVTT TPV APTALSVS GQPL  QQATGPGG PQAYVATVLPQRQHQATLVYSS
Sbjct  255   VSNASVVTT-TPVQAPTALSVSAGQPLATQQATGPGGGPQAYVATVLPQRQHQATLVYSS  313

Query  315   NVSTPNANTNPGQQFNPRFAVATPTTTPGGTTVTP-----RQVRPIPLGKSFPAAKLNTT  369
             NVS PNA+ NPGQQFNPRFAVATPT     TT        RQVRPIPLGKSFP AKLNTT
Sbjct  314   NVSAPNASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPRQVRPIPLGKSFPTAKLNTT  373

Query  370   SISIRAPSIPQLNASVTPSQTPVSVSGGATVAPGRGPGVGGTALTATNLHTTRIIQLQQP  429
             SISIRAPSIPQLN SVT S T VSVSGGATVAPGRGPG GGTALTATNL TTRIIQLQQP
Sbjct  374   SISIRAPSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGGTALTATNLPTTRIIQLQQP  433

Query  430   ATGTTQQIIGSAARLAGNVMLQPFVMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGK  489
             ATGTTQQIIGS ARLAGNVMLQPF+MSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGK
Sbjct  434   ATGTTQQIIGSGARLAGNVMLQPFLMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGK  493

Query  490   LSTAGGTGGPTMTPQGVASIQAVSVPSVSASVVNPSSVTGATSAAGGATVLPLTISGRGG  549
             LS  GG+GG TM PQGVASIQAV VP+VSASVVN SSVTGATSAAGGATVLPLTISGRG 
Sbjct  494   LSAGGGSGGQTMGPQGVASIQAVPVPNVSASVVNSSSVTGATSAAGGATVLPLTISGRGA  553

Query  550   AVGPGGNILTGTLTPIKNASGGI--KMMMTPAPTAAAPGSEGPGNTGPAVGSFQRTWNPV  607
              VGPGGNILTGTLTPIKNASG    KMMM PA  ++APG++G   +G  V  FQRTWNPV
Sbjct  554   GVGPGGNILTGTLTPIKNASGITLGKMMMAPA--SSAPGADGSSTSGATVTGFQRTWNPV  611

Query  608   VASQSQLMKIDDKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQPQLVSSAGGSLSV  667
             VASQSQLMKID+KGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQ QLVSSAGGSLSV
Sbjct  612   VASQSQLMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSV  671

Query  668   SSLPFASHAPTGAGAGSAGVGSQATFTVLPSGAAGGGGAATRTIGPHQQLIIPAGANSAP  727
             SSLPFASHA  GAG+G    GSQATFTVLPSGA   GG ATRTIG HQQLIIPAG NSAP
Sbjct  672   SSLPFASHATAGAGSGGG--GSQATFTVLPSGA---GGTATRTIG-HQQLIIPAGPNSAP  725

Query  728   PQHMVIPLHTSVKVTTTGAGGNPQQATAGGGSLVPNFMRKRDAEGSPIRAAKNLAPTLLS  787
             PQHMVIPLHTSVKVTT    GNPQQATA  G+LV +FMRKRDAEGSPIRAAKNL PTLLS
Sbjct  726   PQHMVIPLHTSVKVTT--GAGNPQQATA-SGALVSSFMRKRDAEGSPIRAAKNLGPTLLS  782

Query  788   MASNTSG----PSPGTTFNLQPVSVAVPTSSGLNSGLTVEALAKKERERVTTHGGVLPTS  843
             MASN SG    P+PGTTFN+QPVSV VP S G  SGLTVEALAKKERERVT   GV  ++
Sbjct  783   MASNNSGQNMPPAPGTTFNIQPVSVTVPQSVG--SGLTVEALAKKERERVT--HGVASSA  838

Query  844   GGGATNVAPTAAGTAVSSTRNSRAESPASSDGSTTVSANSSPGVDQQQLQDRIGDAP---  900
                   V P      V+STRNSRA+SPASSDGSTTVSANSSPGVD QQLQDRIGD P   
Sbjct  839   ASVPATVGP------VNSTRNSRADSPASSDGSTTVSANSSPGVD-QQLQDRIGDQPATG  891

Query  901   -AAARENATHFNPINELYSTHQSLQQGLSHASLGARSGNSAFVDVQQPTPQQQQPPQQQQ  959
              A  R+N+THFNPINE+YS+HQS+QQ L H+SLGARSG+SAFVDVQ PTPQQ    QQ Q
Sbjct  892   GAGGRDNSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAPTPQQ----QQPQ  947

Query  960   QAAHLLVGSSSQQAGPRLNGTGNSSSSSYDCSSRKKPRRSTNDSQHSAQSQASLSLPPPS  1019
             Q  H LVGS+  Q G R+NGTGNSSSSSYDCSSRKKPRRSTNDSQHS QSQASLSLPPPS
Sbjct  948   QVPH-LVGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQHSTQSQASLSLPPPS  1006

Query  1020  AEPTAPTGAAYMQKHNNGGLLVAAAAAPTGVPTPNSAPGDANHRNSTPAVTGNKENANPV  1079
             +EPT P GA+YMQKHNNGGLLV AA    GV  PNSAPGDANHRNSTPAV GNKENANPV
Sbjct  1007  SEPTPPAGASYMQKHNNGGLLVTAATP--GV-APNSAPGDANHRNSTPAVAGNKENANPV  1063

Query  1080  DFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWK  1139
             DFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWK
Sbjct  1064  DFVIRRPRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWK  1123

Query  1140  IYHLSSQMEDLNESEMVSLGQLEVMLKDLEKDKDKHSEMERVTELLKGNIQRSKIITEGI  1199
             IYHL SQMEDLNESE+ SLG+LE ML+DLEKDK+KHSE+ERVTELLKGNIQRSKIIT+GI
Sbjct  1124  IYHLRSQMEDLNESEVFSLGRLETMLQDLEKDKEKHSEIERVTELLKGNIQRSKIITDGI  1183

Query  1200  NEAQSQLMKIFEHKPHVSDIINRCASKRNFKKREKI  1235
             NEAQ+QLMKIFEHKPHVS+II RCASKRNFKKREKI
Sbjct  1184  NEAQNQLMKIFEHKPHVSNIITRCASKRNFKKREKI  1219


>Q8IQH9_DROME unnamed protein product
Length=1257

 Score = 1651 bits (4275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1019/1230 (83%), Positives = 1069/1230 (87%), Gaps = 54/1230 (4%)

Query  26    SAHSAVAAKITHVKADGGGGISISGTPILSAGTIKVAAANPIQQASLAGTPISLNTGQAT  85
             +AH AVAAKITHVK+DGGGGISI+GTPILS GTIKVA+AN +QQ SL GTPI+LN GQAT
Sbjct  62    AAHPAVAAKITHVKSDGGGGISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQAT  121

Query  86    TAASIRAIGAGGQSTQVRVMMPMIKQLENVTATGRTQITAIPAAPARSVSNASITVTRPV  145
             TAASIRAIGAGGQSTQVRV+MPMIKQLENVTATGRTQITAIPAAPARS +NASITVTRPV
Sbjct  122   TAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGRTQITAIPAAPARSGANASITVTRPV  181

Query  146   TQA-YLPRASVTATQMGGVGVGVGQRLVTPLRATSSASATVTPAAPTGLSTSGGFVRGAT  204
             TQA YLPRASVTATQMGGVGVGVGQRLVTPLRATSSA  TVTP APT LS++GGFVRGAT
Sbjct  182   TQATYLPRASVTATQMGGVGVGVGQRLVTPLRATSSA--TVTPTAPTVLSSTGGFVRGAT  239

Query  205   ASVSRSGVAVSSQPPSTVISSSNSATWMQSPTGQVQLIRAIHQPRQRIITTSAG---ASV  261
             ASVSRSGVA++SQP S VISSSNS  WMQS  GQVQLIR IHQPRQRIITTSAG   ASV
Sbjct  240   ASVSRSGVALTSQPSSAVISSSNSGAWMQS-QGQVQLIRTIHQPRQRIITTSAGVSNASV  298

Query  262   VTTATPVPAPTALSVSTGQPLTPQQATGPGG-PQAYVATVLPQRQHQATLVYSSNVSTPN  320
             VTT TPV APTALSVS GQPL  QQATGPGG PQAYVATVLPQRQHQATLVYSSNVS PN
Sbjct  299   VTT-TPVQAPTALSVSAGQPLATQQATGPGGGPQAYVATVLPQRQHQATLVYSSNVSAPN  357

Query  321   ANTNPGQQFNPRFAVATPTTTPGGTTVTP-----RQVRPIPLGKSFPAAKLNTTSISIRA  375
             A+ NPGQQFNPRFAVATPT     TT        RQVRPIPLGKSFP AKLNTTSISIRA
Sbjct  358   ASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPRQVRPIPLGKSFPTAKLNTTSISIRA  417

Query  376   PSIPQLNASVTPSQTPVSVSGGATVAPGRGPGVGGTALTATNLHTTRIIQLQQPATGTTQ  435
             PSIPQLN SVT S T VSVSGGATVAPGRGPG GGTALTATNL TTRIIQLQQPATGTTQ
Sbjct  418   PSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGGTALTATNLPTTRIIQLQQPATGTTQ  477

Query  436   QIIGSAARLAGNVMLQPFVMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSTAGG  495
             QIIGS ARLAGNVMLQPF+MSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLS  GG
Sbjct  478   QIIGSGARLAGNVMLQPFLMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSAGGG  537

Query  496   TGGPTMTPQGVASIQAVSVPSVSASVVNPSSVTGATSAAGGATVLPLTISGRGGAVGPGG  555
             +GG TM PQGVASIQAV VP+VSASVVN SSVTGATSAAGGATVLPLTISGRG  VGPGG
Sbjct  538   SGGQTMGPQGVASIQAVPVPNVSASVVNSSSVTGATSAAGGATVLPLTISGRGAGVGPGG  597

Query  556   NILTGTLTPIKNASGGI--KMMMTPAPTAAAPGSEGPGNTGPAVGSFQRTWNPVVASQSQ  613
             NILTGTLTPIKNASG    KMMM PA  ++APG++G   +G  V  FQRTWNPVVASQSQ
Sbjct  598   NILTGTLTPIKNASGITLGKMMMAPA--SSAPGADGSSTSGATVTGFQRTWNPVVASQSQ  655

Query  614   LMKIDDKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQPQLVSSAGGSLSVSSLPFA  673
             LMKID+KGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQ QLVSSAGGSLSVSSLPFA
Sbjct  656   LMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFA  715

Query  674   SHAPTGAGAGSAGVGSQATFTVLPSGAAGGGGAATRTIGPHQQLIIPAGANSAPPQHMVI  733
             SHA  GAG+G    GSQATFTVLPSGA   GG ATRTIG HQQLIIPAG NSAPPQHMVI
Sbjct  716   SHATAGAGSGGG--GSQATFTVLPSGA---GGTATRTIG-HQQLIIPAGPNSAPPQHMVI  769

Query  734   PLHTSVKVTTTGAGGNPQQATAGGGSLVPNFMRKRDAEGSPIRAAKNLAPTLLSMASNTS  793
             PLHTSVKVTT    GNPQQATA  G+LV +FMRKRDAEGSPIRAAKNL PTLLSMASN S
Sbjct  770   PLHTSVKVTT--GAGNPQQATA-SGALVSSFMRKRDAEGSPIRAAKNLGPTLLSMASNNS  826

Query  794   G----PSPGTTFNLQPVSVAVPTSSGLNSGLTVEALAKKERERVTTHGGVLPTSGGGATN  849
             G    P+PGTTFN+QPVSV VP S G  SGLTVEALAKKERERVT   GV  ++      
Sbjct  827   GQNMPPAPGTTFNIQPVSVTVPQSVG--SGLTVEALAKKERERVT--HGVASSAASVPAT  882

Query  850   VAPTAAGTAVSSTRNSRAESPASSDGSTTVSANSSPGVDQQQLQDRIGDAP----AAARE  905
             V P      V+STRNSRA+SPASSDGSTTVSANSSPGVD QQLQDRIGD P    A  R+
Sbjct  883   VGP------VNSTRNSRADSPASSDGSTTVSANSSPGVD-QQLQDRIGDQPATGGAGGRD  935

Query  906   NATHFNPINELYSTHQSLQQGLSHASLGARSGNSAFVDVQQPTPQQQQPPQQQQQAAHLL  965
             N+THFNPINE+YS+HQS+QQ L H+SLGARSG+SAFVDVQ PTPQQQQP Q        L
Sbjct  936   NSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAPTPQQQQPQQVPH-----L  990

Query  966   VGSSSQQAGPRLNGTGNSSSSSYDCSSRKKPRRSTNDSQHSAQSQASLSLPPPSAEPTAP  1025
             VGS+  Q G R+NGTGNSSSSSYDCSSRKKPRRSTNDSQHS QSQASLSLPPPS+EPT P
Sbjct  991   VGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQHSTQSQASLSLPPPSSEPTPP  1050

Query  1026  TGAAYMQKHNNGGLLVAAAAAPTGVPTPNSAPGDANHRNSTPAVTGNKENANPVDFVIRR  1085
              GA+YMQKHNNGGLLV AA    GV  PNSAPGDANHRNSTPAV GNKENANPVDFVIRR
Sbjct  1051  AGASYMQKHNNGGLLVTAATP--GV-APNSAPGDANHRNSTPAVAGNKENANPVDFVIRR  1107

Query  1086  PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLSS  1145
             PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHL S
Sbjct  1108  PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRS  1167

Query  1146  QMEDLNESEMVSLGQLEVMLKDLEKDKDKHSEMERVTELLKGNIQRSKIITEGINEAQSQ  1205
             QMEDLNESE+ SLG+LE ML+DLEKDK+KHSE+ERVTELLKGNIQRSKIIT+GINEAQ+Q
Sbjct  1168  QMEDLNESEVFSLGRLETMLQDLEKDKEKHSEIERVTELLKGNIQRSKIITDGINEAQNQ  1227

Query  1206  LMKIFEHKPHVSDIINRCASKRNFKKREKI  1235
             LMKIFEHKPHVS+II RCASKRNFKKREKI
Sbjct  1228  LMKIFEHKPHVSNIITRCASKRNFKKREKI  1257


>Q8IQI0_DROME unnamed protein product
Length=1294

 Score = 1650 bits (4272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1019/1230 (83%), Positives = 1069/1230 (87%), Gaps = 54/1230 (4%)

Query  26    SAHSAVAAKITHVKADGGGGISISGTPILSAGTIKVAAANPIQQASLAGTPISLNTGQAT  85
             +AH AVAAKITHVK+DGGGGISI+GTPILS GTIKVA+AN +QQ SL GTPI+LN GQAT
Sbjct  99    AAHPAVAAKITHVKSDGGGGISIAGTPILSGGTIKVASANQVQQTSLGGTPIALNAGQAT  158

Query  86    TAASIRAIGAGGQSTQVRVMMPMIKQLENVTATGRTQITAIPAAPARSVSNASITVTRPV  145
             TAASIRAIGAGGQSTQVRV+MPMIKQLENVTATGRTQITAIPAAPARS +NASITVTRPV
Sbjct  159   TAASIRAIGAGGQSTQVRVVMPMIKQLENVTATGRTQITAIPAAPARSGANASITVTRPV  218

Query  146   TQA-YLPRASVTATQMGGVGVGVGQRLVTPLRATSSASATVTPAAPTGLSTSGGFVRGAT  204
             TQA YLPRASVTATQMGGVGVGVGQRLVTPLRATSSA  TVTP APT LS++GGFVRGAT
Sbjct  219   TQATYLPRASVTATQMGGVGVGVGQRLVTPLRATSSA--TVTPTAPTVLSSTGGFVRGAT  276

Query  205   ASVSRSGVAVSSQPPSTVISSSNSATWMQSPTGQVQLIRAIHQPRQRIITTSAG---ASV  261
             ASVSRSGVA++SQP S VISSSNS  WMQS  GQVQLIR IHQPRQRIITTSAG   ASV
Sbjct  277   ASVSRSGVALTSQPSSAVISSSNSGAWMQS-QGQVQLIRTIHQPRQRIITTSAGVSNASV  335

Query  262   VTTATPVPAPTALSVSTGQPLTPQQATGPGG-PQAYVATVLPQRQHQATLVYSSNVSTPN  320
             VTT TPV APTALSVS GQPL  QQATGPGG PQAYVATVLPQRQHQATLVYSSNVS PN
Sbjct  336   VTT-TPVQAPTALSVSAGQPLATQQATGPGGGPQAYVATVLPQRQHQATLVYSSNVSAPN  394

Query  321   ANTNPGQQFNPRFAVATPTTTPGGTTVTP-----RQVRPIPLGKSFPAAKLNTTSISIRA  375
             A+ NPGQQFNPRFAVATPT     TT        RQVRPIPLGKSFP AKLNTTSISIRA
Sbjct  395   ASQNPGQQFNPRFAVATPTGGVTTTTPGGTTVTPRQVRPIPLGKSFPTAKLNTTSISIRA  454

Query  376   PSIPQLNASVTPSQTPVSVSGGATVAPGRGPGVGGTALTATNLHTTRIIQLQQPATGTTQ  435
             PSIPQLN SVT S T VSVSGGATVAPGRGPG GGTALTATNL TTRIIQLQQPATGTTQ
Sbjct  455   PSIPQLNTSVTASPTAVSVSGGATVAPGRGPGAGGTALTATNLPTTRIIQLQQPATGTTQ  514

Query  436   QIIGSAARLAGNVMLQPFVMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSTAGG  495
             QIIGS ARLAGNVMLQPF+MSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLS  GG
Sbjct  515   QIIGSGARLAGNVMLQPFLMSTTAAAKMGIRPPVTMTAKVQPSLTITQLNPIGKLSAGGG  574

Query  496   TGGPTMTPQGVASIQAVSVPSVSASVVNPSSVTGATSAAGGATVLPLTISGRGGAVGPGG  555
             +GG TM PQGVASIQAV VP+VSASVVN SSVTGATSAAGGATVLPLTISGRG  VGPGG
Sbjct  575   SGGQTMGPQGVASIQAVPVPNVSASVVNSSSVTGATSAAGGATVLPLTISGRGAGVGPGG  634

Query  556   NILTGTLTPIKNASGGI--KMMMTPAPTAAAPGSEGPGNTGPAVGSFQRTWNPVVASQSQ  613
             NILTGTLTPIKNASG    KMMM PA  ++APG++G   +G  V  FQRTWNPVVASQSQ
Sbjct  635   NILTGTLTPIKNASGITLGKMMMAPA--SSAPGADGSSTSGATVTGFQRTWNPVVASQSQ  692

Query  614   LMKIDDKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQPQLVSSAGGSLSVSSLPFA  673
             LMKID+KGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQ QLVSSAGGSLSVSSLPFA
Sbjct  693   LMKIDEKGSAATIYYESMPASASTGVLSLTTTTVTQSTQAQAQLVSSAGGSLSVSSLPFA  752

Query  674   SHAPTGAGAGSAGVGSQATFTVLPSGAAGGGGAATRTIGPHQQLIIPAGANSAPPQHMVI  733
             SHA  GAG+G    GSQATFTVLPSGA   GG ATRTIG HQQLIIPAG NSAPPQHMVI
Sbjct  753   SHATAGAGSGGG--GSQATFTVLPSGA---GGTATRTIG-HQQLIIPAGPNSAPPQHMVI  806

Query  734   PLHTSVKVTTTGAGGNPQQATAGGGSLVPNFMRKRDAEGSPIRAAKNLAPTLLSMASNTS  793
             PLHTSVKVTT    GNPQQATA  G+LV +FMRKRDAEGSPIRAAKNL PTLLSMASN S
Sbjct  807   PLHTSVKVTT--GAGNPQQATA-SGALVSSFMRKRDAEGSPIRAAKNLGPTLLSMASNNS  863

Query  794   G----PSPGTTFNLQPVSVAVPTSSGLNSGLTVEALAKKERERVTTHGGVLPTSGGGATN  849
             G    P+PGTTFN+QPVSV VP S G  SGLTVEALAKKERERVT   GV  ++      
Sbjct  864   GQNMPPAPGTTFNIQPVSVTVPQSVG--SGLTVEALAKKERERVT--HGVASSAASVPAT  919

Query  850   VAPTAAGTAVSSTRNSRAESPASSDGSTTVSANSSPGVDQQQLQDRIGDAP----AAARE  905
             V P      V+STRNSRA+SPASSDGSTTVSANSSPGVD QQLQDRIGD P    A  R+
Sbjct  920   VGP------VNSTRNSRADSPASSDGSTTVSANSSPGVD-QQLQDRIGDQPATGGAGGRD  972

Query  906   NATHFNPINELYSTHQSLQQGLSHASLGARSGNSAFVDVQQPTPQQQQPPQQQQQAAHLL  965
             N+THFNPINE+YS+HQS+QQ L H+SLGARSG+SAFVDVQ PTPQQQQP Q        L
Sbjct  973   NSTHFNPINEMYSSHQSIQQNLGHSSLGARSGSSAFVDVQAPTPQQQQPQQVPH-----L  1027

Query  966   VGSSSQQAGPRLNGTGNSSSSSYDCSSRKKPRRSTNDSQHSAQSQASLSLPPPSAEPTAP  1025
             VGS+  Q G R+NGTGNSSSSSYDCSSRKKPRRSTNDSQHS QSQASLSLPPPS+EPT P
Sbjct  1028  VGSTQMQQGTRMNGTGNSSSSSYDCSSRKKPRRSTNDSQHSTQSQASLSLPPPSSEPTPP  1087

Query  1026  TGAAYMQKHNNGGLLVAAAAAPTGVPTPNSAPGDANHRNSTPAVTGNKENANPVDFVIRR  1085
              GA+YMQKHNNGGLLV AA    GV  PNSAPGDANHRNSTPAV GNKENANPVDFVIRR
Sbjct  1088  AGASYMQKHNNGGLLVTAATP--GV-APNSAPGDANHRNSTPAVAGNKENANPVDFVIRR  1144

Query  1086  PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLSS  1145
             PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHL S
Sbjct  1145  PRNCALLNTYKPTHKLANNHFHRYTDVKPREERRATVIDLANQPNVQGKINGWKIYHLRS  1204

Query  1146  QMEDLNESEMVSLGQLEVMLKDLEKDKDKHSEMERVTELLKGNIQRSKIITEGINEAQSQ  1205
             QMEDLNESE+ SLG+LE ML+DLEKDK+KHSE+ERVTELLKGNIQRSKIIT+GINEAQ+Q
Sbjct  1205  QMEDLNESEVFSLGRLETMLQDLEKDKEKHSEIERVTELLKGNIQRSKIITDGINEAQNQ  1264

Query  1206  LMKIFEHKPHVSDIINRCASKRNFKKREKI  1235
             LMKIFEHKPHVS+II RCASKRNFKKREKI
Sbjct  1265  LMKIFEHKPHVSNIITRCASKRNFKKREKI  1294



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016402.1 splicing factor 3A subunit 2 [Drosophila kikkawai]

Length=262
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VU15_DROME  unnamed protein product                                 516     0.0   
Q19335_CAEEL  unnamed protein product                                 362     6e-128
Q586K6_TRYB2  unnamed protein product                                 75.9    3e-16 


>Q9VU15_DROME unnamed protein product
Length=264

 Score = 516 bits (1330),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/262 (96%), Positives = 259/262 (99%), Gaps = 2/262 (1%)

Query  1    MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL  60
            MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct  1    MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL  60

Query  61   TLHNNEGSYLAHTQGKKHQENLARRAAKEAKEAPSSLLAPEKPRVEPKKFVKIGRPGYRV  120
            TLHNNEGSYLAHTQGKKHQ+NLARRAAKEAKEAPSSLLAPEKPRVEPKKFVKIGRPGYRV
Sbjct  61   TLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPSSLLAPEKPRVEPKKFVKIGRPGYRV  120

Query  121  TKQRELSNGQQSLLFQIDYPEISDNIVPRHRFMSAYEQKIEPPDRKWQYLLFASEPYETI  180
            TKQRELSNGQQSLLFQ+DYPEI+++IVPRHRFMSAYEQKIEPPDRKWQYLLFA+EPYETI
Sbjct  121  TKQRELSNGQQSLLFQVDYPEITESIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYETI  180

Query  181  GFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFKFEPKILPPPPPNMHRAMGPPGGGFPM  240
            GFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFKFEPKILPPPPPN+HRA+GPP GGFPM
Sbjct  181  GFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFKFEPKILPPPPPNLHRALGPP-GGFPM  239

Query  241  PGPPRPAAMHPMFNGVPPPPPM  262
            PGPPRP AMHPMFNGV PPPPM
Sbjct  240  PGPPRP-AMHPMFNGVHPPPPM  260


>Q19335_CAEEL unnamed protein product
Length=222

 Score = 362 bits (928),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 192/216 (89%), Gaps = 2/216 (1%)

Query  1    MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL  60
            MDFQNRAGGKTGSGGVAS ++   DR+ERLRQLALETIDL KDPYFM+NH+G+YECKLCL
Sbjct  1    MDFQNRAGGKTGSGGVASAADAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCL  60

Query  61   TLHNNEGSYLAHTQGKKHQENLARRAAKEAKEAPSSLLAPEKPRVEPKKFVKIGRPGYRV  120
            TLHNNEGSYLAHTQGKKHQ NLARRAAKE  E P  L AP+K  VE KKFVKIGRPGY+V
Sbjct  61   TLHNNEGSYLAHTQGKKHQANLARRAAKEQSEQP-FLPAPQKAAVETKKFVKIGRPGYKV  119

Query  121  TKQRELSNGQQSLLFQIDYPEISDNIVPRHRFMSAYEQKIEPPDRKWQYLLFASEPYETI  180
            TK+R+   GQQ+LLFQIDYPEI+D I PRHRFMSAYEQKI+PPD++WQYLLFA+EPYETI
Sbjct  120  TKERDPGAGQQALLFQIDYPEIADGIAPRHRFMSAYEQKIQPPDKRWQYLLFAAEPYETI  179

Query  181  GFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFKFE  216
            GFK+PSREV+KSE KFWT WN+DTKQFFLQ AFK E
Sbjct  180  GFKIPSREVDKSE-KFWTMWNKDTKQFFLQVAFKLE  214


>Q586K6_TRYB2 unnamed protein product
Length=229

 Score = 75.9 bits (185),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 79/177 (45%), Gaps = 25/177 (14%)

Query  43   DPYFMKNHLGSYECKLCLTLHNNEGSYLAHTQGKKHQ---ENLARRAAKEAKEAPSSLLA  99
            DPY+ +NH+G   C LC    +++ +++ H  GK H    E L R A +E + A    L 
Sbjct  16   DPYYKRNHMGHVVCTLCDVCCSDDNNFIKHLAGKTHSLQLERLERSANREKRLAEEEELN  75

Query  100  PEK-PRVEPKK--------------------FVKIGRPGYRVTKQRELSNGQQSLLFQID  138
             E   R E +K                    F   GRP +    + +    Q  +  +  
Sbjct  76   KEAMRRAEQEKATRELLLQQTSAPHASSVTSFAPFGRPEFHYCTEHDPELYQTKVWLEFY  135

Query  139  YPEISDNIVPRHRFMSAYEQKIE-PPDRKWQYLLFASEPYETIGFKVPSREVEKSEG  194
            +P+  +   P HR+ SA EQ++E PP+    YLL A E Y T+G K PS+    S G
Sbjct  136  FPQAVEGARPLHRWRSAREQEVEKPPNDDVVYLLVACEGYMTVGLKFPSKLPRTSSG  192



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016403.1 ankyrin repeat domain-containing protein 12
[Drosophila kikkawai]

Length=643
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IQI3_DROME  unnamed protein product                                 1131    0.0  


>Q8IQI3_DROME unnamed protein product
Length=658

 Score = 1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/662 (89%), Positives = 610/662 (92%), Gaps = 23/662 (3%)

Query  1    MPPPRPKGIGFNTGVQTGARSNSNTPMSERQQMALLIQMTATSST---------------  45
            MPPPRPKGIGFNTG  T  RSNSNTPMSERQQMALLIQMTA SST               
Sbjct  1    MPPPRPKGIGFNTGA-TQPRSNSNTPMSERQQMALLIQMTANSSTVQSQSLELLLVGLNF  59

Query  46   ---DSSRTNLKKNECKKGDADSDESNLNEKQEVLDTKDKSSAEESSSDGKNSDSAHQGSS  102
                SSRT LKKNECKKGDA++DE +LNEKQEVLDTKDKSSAEESS+DGK+SD+ HQG+S
Sbjct  60   NLHHSSRTTLKKNECKKGDAETDEGSLNEKQEVLDTKDKSSAEESSNDGKSSDTNHQGTS  119

Query  103  GAKRCYSDIEEDYEESGEDVKKKKRKDSEHGKDLKSASLKLSSRVEKGSKLAATKGSPSG  162
             AKRCYSDIEEDYEESGEDVKKKKRKDSEHGKD+K ASLKL+SRVEK SKLAATKGSPSG
Sbjct  120  AAKRCYSDIEEDYEESGEDVKKKKRKDSEHGKDVKGASLKLTSRVEKSSKLAATKGSPSG  179

Query  163  NKSSATSNADKEQVEISKNVDIENETECSDDYKSNDSLYNGGLKVPPLKIVIPQQNCSID  222
            NKSSA SNA+KE  E SKNVDIENETECSDDYKSNDSLYNGGLKVPPLKIVIPQQNCSID
Sbjct  180  NKSSA-SNAEKEPAETSKNVDIENETECSDDYKSNDSLYNGGLKVPPLKIVIPQQNCSID  238

Query  223  TEGNVLRTGKVTASRNAALPYVVSSNSDSIDTVITSQSISPHESPQKS-SICSTVLDDKN  281
            TEGNVLRTGKVTASRNAALPYVVSSNSDSIDTVIT+QSISPHESPQKS SICST LDDKN
Sbjct  239  TEGNVLRTGKVTASRNAALPYVVSSNSDSIDTVITNQSISPHESPQKSNSICSTALDDKN  298

Query  282  IKLFNDEKNLRVLRSSHRTGVTSVERSSNNSSPQMQSSSPSPASSNHANDTADVKLSYSN  341
            IKLFNDEKNLRVLRSSHRTGVTSVERSSNNSSPQMQSSSPSPASSNHAND ADVKLSYSN
Sbjct  299  IKLFNDEKNLRVLRSSHRTGVTSVERSSNNSSPQMQSSSPSPASSNHANDPADVKLSYSN  358

Query  342  MTSSPIPQGHQFDQETITNVPSPSTSSTSSSKEINPSSNVDLHPRKRKIRPKNTDDSSKN  401
            MTSSPIPQGHQFDQE ITNVPSPSTSSTSSSK+INPS NV+LHPRKRKIRPKNTDDSSKN
Sbjct  359  MTSSPIPQGHQFDQEAITNVPSPSTSSTSSSKDINPS-NVELHPRKRKIRPKNTDDSSKN  417

Query  402  SNANMDSGANSEESHPHDHPFTNGFQMFLSIRRQIEKKWKSLYPIKPRPPQGYNDYLLTK  461
            SNA  DSG NSEESHPHDHPFTNGFQMFLSIRRQIEKKWKSLYP+KPRPPQGYN+YLLTK
Sbjct  418  SNA-ADSGVNSEESHPHDHPFTNGFQMFLSIRRQIEKKWKSLYPVKPRPPQGYNEYLLTK  476

Query  462  KSYLLSRNSESPAVNIPSTVPQAMTQIYEDQEKARRDLIQAHTVEREKLCMNVEQEIIRV  521
            KSYLL RN+     +IP TVPQAM +IY+DQEKARRDLI+AHTVEREKLCMNVEQEIIRV
Sbjct  477  KSYLLRRNATISVPDIPRTVPQAMERIYQDQEKARRDLIEAHTVEREKLCMNVEQEIIRV  536

Query  522  HSKAARSISGQSAPYSVCTYLKDDEVYNLFTPEQDEKEKSARCRFNGRLLLSWLQDVDDK  581
            HSKAARSISGQ APYSVCTYLKDDEVYN+ TPEQDEKEKSARCRFNGRLLLSWLQDVDDK
Sbjct  537  HSKAARSISGQPAPYSVCTYLKDDEVYNMITPEQDEKEKSARCRFNGRLLLSWLQDVDDK  596

Query  582  WEKIKESMVLRHHNEAESLHAVQVMDWNIFAKRNRLCDNPIEVNLEHVPIVSVGDDFDTL  641
            WEKIKESMVLRHHNEAESLHAVQVMDWNIFAKRNRLCDNPIEVNLEHVPIVSVGDDFDTL
Sbjct  597  WEKIKESMVLRHHNEAESLHAVQVMDWNIFAKRNRLCDNPIEVNLEHVPIVSVGDDFDTL  656

Query  642  PT  643
            PT
Sbjct  657  PT  658



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016405.1 kinesin light chain isoform X1 [Drosophila kikkawai]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLC_DROME  unnamed protein product                                    1024    0.0   
KLC_CAEEL  unnamed protein product                                    642     0.0   
Q21592_CAEEL  unnamed protein product                                 369     7e-123


>KLC_DROME unnamed protein product
Length=508

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/508 (96%), Positives = 505/508 (99%), Gaps = 0/508 (0%)

Query  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNDKSDMLRKNIENIELGLSE  60
            MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDN+KSDMLRKNIENIELGLSE
Sbjct  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSE  60

Query  61   AQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK  120
            AQVMMALTSH+QNIEAEK KLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK
Sbjct  61   AQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK  120

Query  121  KHLEFMASVKKYDENQDQDDSCEKSRTDPVVELFPDEENDDRNNMSPTPPSQFANQTSGY  180
            KHLEFMASVKKYDENQ+QDD+C+KSRTDPVVELFPDEEN+DR+NMSPTPPSQFANQTSGY
Sbjct  121  KHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY  180

Query  181  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRD  240
            EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE+TSGHDHPDVATMLNILALVYRD
Sbjct  181  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRD  240

Query  241  QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR  300
            QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
Sbjct  241  QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR  300

Query  301  EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL  360
            EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL
Sbjct  301  EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL  360

Query  361  AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREVNKYDNRENTPYG  420
            AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEERE +K+DNRENTPYG
Sbjct  361  AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYG  420

Query  421  EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKVS  480
            EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTK+S
Sbjct  421  EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLS  480

Query  481  QLLTSNEKRRSKQIKDDMDFTDEKNAKP  508
            QLLTSNEKRRSK IK+D+DF++EKNAKP
Sbjct  481  QLLTSNEKRRSKAIKEDLDFSEEKNAKP  508


>KLC_CAEEL unnamed protein product
Length=540

 Score = 642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/492 (67%), Positives = 383/492 (78%), Gaps = 27/492 (5%)

Query  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMN----GIAEVQKD-----NDKSDMLRKNI  51
            M+ MSQD++ T  +TV QGLEALR EH +I N     +  V++D       K   +  N+
Sbjct  1    MSNMSQDDVTTGLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNL  60

Query  52   ENIELGLSEAQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQ  111
            + +  G+ E  +M+ +    Q ++A+ QK + Q RRL QENAWLRDEL++TQ K Q SEQ
Sbjct  61   DKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQ  120

Query  112  LVAQLEEEKKHLEFMASVKKYDENQDQDDSCEKSRTD----PVV-----EL-FPDEENDD  161
            +VAQLEEE KHL++MAS+K++D+    D    K+  D    PV      EL F  E+ +D
Sbjct  121  MVAQLEEENKHLKYMASIKQFDDGTQSDT---KTSVDVGPQPVTNETLQELGFGPEDEED  177

Query  162  RNNMS---PTPPSQFANQTS-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE  217
             N      PTP +Q A   + GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE
Sbjct  178  MNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE  237

Query  218  KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLA  277
            KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLN+ALSIR K LGE+HPAVAATLNNLA
Sbjct  238  KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLA  297

Query  278  VLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQR  337
            VL+GKRGK+KDAEPLCKRALEIREKVLG DHPDVAKQLNNLALLCQNQGKY+EVEKYY+R
Sbjct  298  VLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKR  357

Query  338  ALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNK  397
            AL+IYESKLGPDDPNVAKTKNNL+  YLKQG+Y EAE LYKQ+LTRAHEREFG I  +NK
Sbjct  358  ALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENK  417

Query  398  PIWQVAEEREVNKYDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAE  457
            PIWQ+AEERE NK+   E     E  GW KAAKVDSPTVTTTLKNLGALYRRQG +EAAE
Sbjct  418  PIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAE  476

Query  458  TLEDCAMRSKKE  469
            TLED A+R+KK+
Sbjct  477  TLEDVALRAKKQ  488


>Q21592_CAEEL unnamed protein product
Length=516

 Score = 369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 221/487 (45%), Positives = 302/487 (62%), Gaps = 27/487 (6%)

Query  7    DEIITNTKTVLQGLEALRVEHVS---------IMNGIAEVQKDNDKSDMLRKNIENIELG  57
            D+I T  KTV Q L ALR EH +         I +  +E    ++K  ++ +++  +  G
Sbjct  7    DDITTVLKTVQQTLFALRDEHEAATRILEANLINSDSSEPSLPSEKMGLIDESLGKVMDG  66

Query  58   LSEAQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLE  117
              EA +++ +   MQ+ + +  K    +R L QEN WL DEL  TQ+K Q SE+ VA LE
Sbjct  67   GDEASLLIMMDKLMQSYDVQLSKNHESIRLLRQENTWLLDELTTTQRKLQESERTVAHLE  126

Query  118  EEKKHLEFMASVKKYDENQDQDDSCEKS--RTDPVVEL-FPDEENDDRNNMS--PTPPSQ  172
            EE+ H +F  S+   + +     S + +    D + EL F  EE D  NN +      S 
Sbjct  127  EERDHYKFQDSMNYLNSDFQHTTSVDATPMMVDTLQELGFGPEEEDQNNNQADQGCRSSS  186

Query  173  FANQTSG-YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATML  231
            F+N  S  Y++P RL+TL NLVIQY  QGR+EVA+PLCKQALED+ K  G+ H DVATML
Sbjct  187  FSNPISNDYQLPTRLQTLQNLVIQYMEQGRFEVAIPLCKQALEDVVKVHGNVHLDVATML  246

Query  232  NILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEP  291
            N+LA+VYR+Q  +K+AA  L  ALSIR +  GENH +VAATLNNLA+ YGKRGKYK++EP
Sbjct  247  NVLAIVYRNQENFKDAAIYLEKALSIRVQCCGENHHSVAATLNNLAIAYGKRGKYKESEP  306

Query  292  LCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDP  351
            LCKRALEIR+ +LG +HPDVAKQL NL ++ Q   KY+E E Y+++AL IY      +  
Sbjct  307  LCKRALEIRKNLLGPNHPDVAKQLTNLGIVTQQLEKYEETENYFKQALSIYNRAFPENHQ  366

Query  352  NVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREVNKY  411
            NV KTKN LA  +LKQG+Y EAE +YK +L++       AI + NKPIW++AE+RE  + 
Sbjct  367  NVIKTKNQLASVFLKQGKYQEAEEMYKNILSKV------AI-TGNKPIWRIAEDREERQ-  418

Query  412  DNRENTPYGEYGGWH-KAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA  470
              R   P  +   ++     V    V +T+KNL A+YR+QG  EAA TLE+ A+ +KK+ 
Sbjct  419  --RNGIPKVDDESFNVNPTTVMDSNVMSTIKNLAAVYRKQGKEEAAGTLEE-ALGAKKQI  475

Query  471  YDLAKQT  477
               A  T
Sbjct  476  NGGADHT  482



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016406.1 kinesin light chain isoform X2 [Drosophila kikkawai]

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLC_DROME  unnamed protein product                                    1025    0.0   
KLC_CAEEL  unnamed protein product                                    642     0.0   
Q21592_CAEEL  unnamed protein product                                 369     1e-122


>KLC_DROME unnamed protein product
Length=508

 Score = 1025 bits (2650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/508 (96%), Positives = 505/508 (99%), Gaps = 0/508 (0%)

Query  21   MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNDKSDMLRKNIENIELGLSE  80
            MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDN+KSDMLRKNIENIELGLSE
Sbjct  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSE  60

Query  81   AQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK  140
            AQVMMALTSH+QNIEAEK KLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK
Sbjct  61   AQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK  120

Query  141  KHLEFMASVKKYDENQDQDDSCEKSRTDPVVELFPDEENDDRNNMSPTPPSQFANQTSGY  200
            KHLEFMASVKKYDENQ+QDD+C+KSRTDPVVELFPDEEN+DR+NMSPTPPSQFANQTSGY
Sbjct  121  KHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY  180

Query  201  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRD  260
            EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE+TSGHDHPDVATMLNILALVYRD
Sbjct  181  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRD  240

Query  261  QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR  320
            QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
Sbjct  241  QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR  300

Query  321  EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL  380
            EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL
Sbjct  301  EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL  360

Query  381  AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREVNKYDNRENTPYG  440
            AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEERE +K+DNRENTPYG
Sbjct  361  AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYG  420

Query  441  EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKVS  500
            EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTK+S
Sbjct  421  EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLS  480

Query  501  QLLTSNEKRRSKQIKDDMDFTDEKNAKP  528
            QLLTSNEKRRSK IK+D+DF++EKNAKP
Sbjct  481  QLLTSNEKRRSKAIKEDLDFSEEKNAKP  508


>KLC_CAEEL unnamed protein product
Length=540

 Score = 642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/492 (67%), Positives = 383/492 (78%), Gaps = 27/492 (5%)

Query  21   MTQMSQDEIITNTKTVLQGLEALRVEHVSIMN----GIAEVQKD-----NDKSDMLRKNI  71
            M+ MSQD++ T  +TV QGLEALR EH +I N     +  V++D       K   +  N+
Sbjct  1    MSNMSQDDVTTGLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNL  60

Query  72   ENIELGLSEAQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQ  131
            + +  G+ E  +M+ +    Q ++A+ QK + Q RRL QENAWLRDEL++TQ K Q SEQ
Sbjct  61   DKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQ  120

Query  132  LVAQLEEEKKHLEFMASVKKYDENQDQDDSCEKSRTD----PVV-----EL-FPDEENDD  181
            +VAQLEEE KHL++MAS+K++D+    D    K+  D    PV      EL F  E+ +D
Sbjct  121  MVAQLEEENKHLKYMASIKQFDDGTQSDT---KTSVDVGPQPVTNETLQELGFGPEDEED  177

Query  182  RNNMS---PTPPSQFANQTS-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE  237
             N      PTP +Q A   + GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE
Sbjct  178  MNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE  237

Query  238  KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLA  297
            KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLN+ALSIR K LGE+HPAVAATLNNLA
Sbjct  238  KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLA  297

Query  298  VLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQR  357
            VL+GKRGK+KDAEPLCKRALEIREKVLG DHPDVAKQLNNLALLCQNQGKY+EVEKYY+R
Sbjct  298  VLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKR  357

Query  358  ALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNK  417
            AL+IYESKLGPDDPNVAKTKNNL+  YLKQG+Y EAE LYKQ+LTRAHEREFG I  +NK
Sbjct  358  ALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENK  417

Query  418  PIWQVAEEREVNKYDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAE  477
            PIWQ+AEERE NK+   E     E  GW KAAKVDSPTVTTTLKNLGALYRRQG +EAAE
Sbjct  418  PIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAE  476

Query  478  TLEDCAMRSKKE  489
            TLED A+R+KK+
Sbjct  477  TLEDVALRAKKQ  488


>Q21592_CAEEL unnamed protein product
Length=516

 Score = 369 bits (948),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 221/487 (45%), Positives = 302/487 (62%), Gaps = 27/487 (6%)

Query  27   DEIITNTKTVLQGLEALRVEHVS---------IMNGIAEVQKDNDKSDMLRKNIENIELG  77
            D+I T  KTV Q L ALR EH +         I +  +E    ++K  ++ +++  +  G
Sbjct  7    DDITTVLKTVQQTLFALRDEHEAATRILEANLINSDSSEPSLPSEKMGLIDESLGKVMDG  66

Query  78   LSEAQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLE  137
              EA +++ +   MQ+ + +  K    +R L QEN WL DEL  TQ+K Q SE+ VA LE
Sbjct  67   GDEASLLIMMDKLMQSYDVQLSKNHESIRLLRQENTWLLDELTTTQRKLQESERTVAHLE  126

Query  138  EEKKHLEFMASVKKYDENQDQDDSCEKS--RTDPVVEL-FPDEENDDRNNMS--PTPPSQ  192
            EE+ H +F  S+   + +     S + +    D + EL F  EE D  NN +      S 
Sbjct  127  EERDHYKFQDSMNYLNSDFQHTTSVDATPMMVDTLQELGFGPEEEDQNNNQADQGCRSSS  186

Query  193  FANQTSG-YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATML  251
            F+N  S  Y++P RL+TL NLVIQY  QGR+EVA+PLCKQALED+ K  G+ H DVATML
Sbjct  187  FSNPISNDYQLPTRLQTLQNLVIQYMEQGRFEVAIPLCKQALEDVVKVHGNVHLDVATML  246

Query  252  NILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEP  311
            N+LA+VYR+Q  +K+AA  L  ALSIR +  GENH +VAATLNNLA+ YGKRGKYK++EP
Sbjct  247  NVLAIVYRNQENFKDAAIYLEKALSIRVQCCGENHHSVAATLNNLAIAYGKRGKYKESEP  306

Query  312  LCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDP  371
            LCKRALEIR+ +LG +HPDVAKQL NL ++ Q   KY+E E Y+++AL IY      +  
Sbjct  307  LCKRALEIRKNLLGPNHPDVAKQLTNLGIVTQQLEKYEETENYFKQALSIYNRAFPENHQ  366

Query  372  NVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREVNKY  431
            NV KTKN LA  +LKQG+Y EAE +YK +L++       AI + NKPIW++AE+RE  + 
Sbjct  367  NVIKTKNQLASVFLKQGKYQEAEEMYKNILSKV------AI-TGNKPIWRIAEDREERQ-  418

Query  432  DNRENTPYGEYGGWH-KAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA  490
              R   P  +   ++     V    V +T+KNL A+YR+QG  EAA TLE+ A+ +KK+ 
Sbjct  419  --RNGIPKVDDESFNVNPTTVMDSNVMSTIKNLAAVYRKQGKEEAAGTLEE-ALGAKKQI  475

Query  491  YDLAKQT  497
               A  T
Sbjct  476  NGGADHT  482



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016407.1 kinesin light chain isoform X1 [Drosophila kikkawai]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

KLC_DROME  unnamed protein product                                    1024    0.0   
KLC_CAEEL  unnamed protein product                                    642     0.0   
Q21592_CAEEL  unnamed protein product                                 369     7e-123


>KLC_DROME unnamed protein product
Length=508

 Score = 1024 bits (2648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/508 (96%), Positives = 505/508 (99%), Gaps = 0/508 (0%)

Query  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNDKSDMLRKNIENIELGLSE  60
            MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDN+KSDMLRKNIENIELGLSE
Sbjct  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMNGIAEVQKDNEKSDMLRKNIENIELGLSE  60

Query  61   AQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK  120
            AQVMMALTSH+QNIEAEK KLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK
Sbjct  61   AQVMMALTSHLQNIEAEKHKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLEEEK  120

Query  121  KHLEFMASVKKYDENQDQDDSCEKSRTDPVVELFPDEENDDRNNMSPTPPSQFANQTSGY  180
            KHLEFMASVKKYDENQ+QDD+C+KSRTDPVVELFPDEEN+DR+NMSPTPPSQFANQTSGY
Sbjct  121  KHLEFMASVKKYDENQEQDDACDKSRTDPVVELFPDEENEDRHNMSPTPPSQFANQTSGY  180

Query  181  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRD  240
            EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE+TSGHDHPDVATMLNILALVYRD
Sbjct  181  EIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLERTSGHDHPDVATMLNILALVYRD  240

Query  241  QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR  300
            QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR
Sbjct  241  QNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEPLCKRALEIR  300

Query  301  EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL  360
            EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL
Sbjct  301  EKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDPNVAKTKNNL  360

Query  361  AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREVNKYDNRENTPYG  420
            AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEERE +K+DNRENTPYG
Sbjct  361  AGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREEHKFDNRENTPYG  420

Query  421  EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKVS  480
            EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTK+S
Sbjct  421  EYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEAYDLAKQTKLS  480

Query  481  QLLTSNEKRRSKQIKDDMDFTDEKNAKP  508
            QLLTSNEKRRSK IK+D+DF++EKNAKP
Sbjct  481  QLLTSNEKRRSKAIKEDLDFSEEKNAKP  508


>KLC_CAEEL unnamed protein product
Length=540

 Score = 642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/492 (67%), Positives = 383/492 (78%), Gaps = 27/492 (5%)

Query  1    MTQMSQDEIITNTKTVLQGLEALRVEHVSIMN----GIAEVQKD-----NDKSDMLRKNI  51
            M+ MSQD++ T  +TV QGLEALR EH +I N     +  V++D       K   +  N+
Sbjct  1    MSNMSQDDVTTGLRTVQQGLEALREEHSTISNTLETSVKGVKEDEAPLPKQKLSQINDNL  60

Query  52   ENIELGLSEAQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQ  111
            + +  G+ E  +M+ +    Q ++A+ QK + Q RRL QENAWLRDEL++TQ K Q SEQ
Sbjct  61   DKLVCGVDETSLMLMVFQLTQGMDAQHQKYQAQRRRLCQENAWLRDELSSTQIKLQQSEQ  120

Query  112  LVAQLEEEKKHLEFMASVKKYDENQDQDDSCEKSRTD----PVV-----EL-FPDEENDD  161
            +VAQLEEE KHL++MAS+K++D+    D    K+  D    PV      EL F  E+ +D
Sbjct  121  MVAQLEEENKHLKYMASIKQFDDGTQSDT---KTSVDVGPQPVTNETLQELGFGPEDEED  177

Query  162  RNNMS---PTPPSQFANQTS-GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE  217
             N      PTP +Q A   + GYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE
Sbjct  178  MNASQFNQPTPANQMAASANVGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLE  237

Query  218  KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLA  277
            KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLN+ALSIR K LGE+HPAVAATLNNLA
Sbjct  238  KTSGHDHPDVATMLNILALVYRDQNKYKEAANLLNEALSIREKCLGESHPAVAATLNNLA  297

Query  278  VLYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQR  337
            VL+GKRGK+KDAEPLCKRALEIREKVLG DHPDVAKQLNNLALLCQNQGKY+EVEKYY+R
Sbjct  298  VLFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKQLNNLALLCQNQGKYEEVEKYYKR  357

Query  338  ALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNK  397
            AL+IYESKLGPDDPNVAKTKNNL+  YLKQG+Y EAE LYKQ+LTRAHEREFG I  +NK
Sbjct  358  ALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHEREFGQISGENK  417

Query  398  PIWQVAEEREVNKYDNRENTPYGEYGGWHKAAKVDSPTVTTTLKNLGALYRRQGMFEAAE  457
            PIWQ+AEERE NK+   E     E  GW KAAKVDSPTVTTTLKNLGALYRRQG +EAAE
Sbjct  418  PIWQIAEEREENKHKG-EGATANEQAGWAKAAKVDSPTVTTTLKNLGALYRRQGKYEAAE  476

Query  458  TLEDCAMRSKKE  469
            TLED A+R+KK+
Sbjct  477  TLEDVALRAKKQ  488


>Q21592_CAEEL unnamed protein product
Length=516

 Score = 369 bits (948),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 221/487 (45%), Positives = 302/487 (62%), Gaps = 27/487 (6%)

Query  7    DEIITNTKTVLQGLEALRVEHVS---------IMNGIAEVQKDNDKSDMLRKNIENIELG  57
            D+I T  KTV Q L ALR EH +         I +  +E    ++K  ++ +++  +  G
Sbjct  7    DDITTVLKTVQQTLFALRDEHEAATRILEANLINSDSSEPSLPSEKMGLIDESLGKVMDG  66

Query  58   LSEAQVMMALTSHMQNIEAEKQKLKTQVRRLHQENAWLRDELANTQQKFQASEQLVAQLE  117
              EA +++ +   MQ+ + +  K    +R L QEN WL DEL  TQ+K Q SE+ VA LE
Sbjct  67   GDEASLLIMMDKLMQSYDVQLSKNHESIRLLRQENTWLLDELTTTQRKLQESERTVAHLE  126

Query  118  EEKKHLEFMASVKKYDENQDQDDSCEKS--RTDPVVEL-FPDEENDDRNNMS--PTPPSQ  172
            EE+ H +F  S+   + +     S + +    D + EL F  EE D  NN +      S 
Sbjct  127  EERDHYKFQDSMNYLNSDFQHTTSVDATPMMVDTLQELGFGPEEEDQNNNQADQGCRSSS  186

Query  173  FANQTSG-YEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATML  231
            F+N  S  Y++P RL+TL NLVIQY  QGR+EVA+PLCKQALED+ K  G+ H DVATML
Sbjct  187  FSNPISNDYQLPTRLQTLQNLVIQYMEQGRFEVAIPLCKQALEDVVKVHGNVHLDVATML  246

Query  232  NILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEP  291
            N+LA+VYR+Q  +K+AA  L  ALSIR +  GENH +VAATLNNLA+ YGKRGKYK++EP
Sbjct  247  NVLAIVYRNQENFKDAAIYLEKALSIRVQCCGENHHSVAATLNNLAIAYGKRGKYKESEP  306

Query  292  LCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYDEVEKYYQRALDIYESKLGPDDP  351
            LCKRALEIR+ +LG +HPDVAKQL NL ++ Q   KY+E E Y+++AL IY      +  
Sbjct  307  LCKRALEIRKNLLGPNHPDVAKQLTNLGIVTQQLEKYEETENYFKQALSIYNRAFPENHQ  366

Query  352  NVAKTKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIWQVAEEREVNKY  411
            NV KTKN LA  +LKQG+Y EAE +YK +L++       AI + NKPIW++AE+RE  + 
Sbjct  367  NVIKTKNQLASVFLKQGKYQEAEEMYKNILSKV------AI-TGNKPIWRIAEDREERQ-  418

Query  412  DNRENTPYGEYGGWH-KAAKVDSPTVTTTLKNLGALYRRQGMFEAAETLEDCAMRSKKEA  470
              R   P  +   ++     V    V +T+KNL A+YR+QG  EAA TLE+ A+ +KK+ 
Sbjct  419  --RNGIPKVDDESFNVNPTTVMDSNVMSTIKNLAAVYRKQGKEEAAGTLEE-ALGAKKQI  475

Query  471  YDLAKQT  477
               A  T
Sbjct  476  NGGADHT  482



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016408.1 uncharacterized protein LOC108070442 [Drosophila
kikkawai]

Length=237
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

G5EGI1_CAEEL  unnamed protein product                                 28.9    4.8  


>G5EGI1_CAEEL unnamed protein product
Length=2475

 Score = 28.9 bits (63),  Expect = 4.8, Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 0/45 (0%)

Query  61   FTGKLENVPEDILQATEALIIYFNPKDTSFIDTIPNTLSKNEQIQ  105
            F+ + E    + LQAT A ++Y N K        PN + + +QIQ
Sbjct  933  FSARWEEDEPNGLQATTAAVLYSNEKHGYLRQQFPNWVDRVKQIQ  977



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


Query= XP_017016409.1 very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
[Drosophila kikkawai]

Length=372
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q389R7_TRYB2  unnamed protein product                                 103     2e-25
Q21905_CAEEL  unnamed protein product                                 68.2    3e-13
DAF41_CAEEL  unnamed protein product                                  62.8    1e-11


>Q389R7_TRYB2 unnamed protein product
Length=266

 Score = 103 bits (257),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 108/213 (51%), Gaps = 7/213 (3%)

Query  148  KKVYMIFYNLAMFVGYLYMVAVMGVLYYRDGAESIGKMYANVGNAFKFVQLLQYLEVMHP  207
             KVY++ YN  +  G+     +M ++ +         +Y+ +       Q    LEV+H 
Sbjct  40   SKVYLLAYNGVLLAGW--STILMKIVQHLSTGGRFADVYSLIAPLLVVSQSAAVLEVLHA  97

Query  208  LFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRM-HAKPVVFYVFVIWSLVELVRYPFYLA  266
            LFG  +        QV  R  +L+  +++ P      P    + V WSL E++RY FY +
Sbjct  98   LFGLVRSPVGTTLLQVLSRLLVLYGALEIGPTAARMSPFATQMIVAWSLAEVIRYTFYAS  157

Query  267  QLLGREVGLLTWLRYTIWIPLYPMGILCEGIIILRNIPYIDETKRFTVEMPNTWNITFDM  326
             L G ++  +TWLRY+ +  LYPMGI  E    +  +PYI E K +TVE+PN  N +F  
Sbjct  158  NLAGVKLKPVTWLRYSAFTVLYPMGITGEIACFISALPYIREKKPWTVELPNRLNFSFSW  217

Query  327  VLFLKIYLLLLIL--PGSYLVMSHMAKLRAKKL  357
              +  + LLL ++   GSY++ ++M + R K L
Sbjct  218  --YYTVLLLLAVVYPAGSYVMYTYMLQQRRKAL  248


>Q21905_CAEEL unnamed protein product
Length=202

 Score = 68.2 bits (165),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 75/154 (49%), Gaps = 9/154 (6%)

Query  148  KKVYMIFYNLAMFVGYLYMVAVMGVLYYRDGAESIGKMYANVGNAFKFVQLLQYLEVMHP  207
            K + +  Y L +F+ + Y     G LY      +    Y  +     F+  LQYL++   
Sbjct  5    KNMILFIYTLVLFILHGY-----GFLYIFHAEYTSEFKYPEIMWFLLFITSLQYLDIPFS  59

Query  208  LFGYTKGSPVVPFFQVSGRNFILFLMIDMEPRMHAKPVVFYVFVIWSLVELVRYPFYLAQ  267
             F  TK +PV  F QVSGR  +L++   M    +A    F +  ++ L EL R P+YL+ 
Sbjct  60   FF-LTKSNPVAVFVQVSGRLLVLWVASHMVSWKYAA---FSLVAVYLLSELCRGPYYLSN  115

Query  268  LLGREVGLLTWLRYTIWIPLYPMGILCEGIIILR  301
             LG     LTWLRY  +  LYP+G  CE ++ + 
Sbjct  116  CLGTPNRSLTWLRYNAFKVLYPVGFTCEALVFIN  149


>DAF41_CAEEL unnamed protein product
Length=175

 Score = 62.8 bits (151),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (52%), Gaps = 5/106 (5%)

Query  6    PFVYWSQTKQTLLLKVDLKDAKGAIADFSPVSVNFSANGYGARGVNAYKFQLHFYSLIDD  65
            P V W+Q +  + L +++ +AK          ++F     G+   + Y+  L F+  ID 
Sbjct  5    PTVLWAQRESLVYLTIEVDEAKIEELKGEGNKLHFQ----GSSKTDKYEATLEFFDEIDP  60

Query  66   ETAGFVVSDNKI-ELQIRKLEPAWWPRLVATPQKPHWLKIDFDRWR  110
             +     S  ++ E+ ++K  PAWWPRL+    K HWLK+DF +W+
Sbjct  61   ASVKHTGSSTRVVEITVQKKTPAWWPRLLQNKGKVHWLKVDFGKWK  106



Lambda      K        H
   0.323    0.138    0.413 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 7613591134


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016410.1 melanotransferrin [Drosophila kikkawai]

Length=833
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ5_DROME  unnamed protein product                                 1544    0.0  
O97355_DROME  unnamed protein product                                 85.5    6e-17
Q9VWV6_DROME  unnamed protein product                                 85.1    8e-17


>Q9VTZ5_DROME unnamed protein product
Length=819

 Score = 1544 bits (3997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 738/833 (89%), Positives = 778/833 (93%), Gaps = 14/833 (2%)

Query  1    MARSLVFVALVGALCFTLAYAQHHYDEHRIKDIIWCTKSLEEQYKCGNLTVAIARDRALF  60
            MA SLVFVALVGALCFTLA AQHHYDEH+   ++WCTKS  EQYKC NLTVAI RDRALF
Sbjct  1    MASSLVFVALVGALCFTLANAQHHYDEHKTTRMVWCTKSQAEQYKCQNLTVAIERDRALF  60

Query  61   DDAFLNLTCFRAFSADECIHHIDREKAHITSLDAGDVFTGGRYNSLIPIMQEKLEGGFAE  120
            D+ FLNLTCF A+SADECIHHIDREKAHIT+LDAGDVFT GRYNSLIPIMQEKLEGGFA+
Sbjct  61   DEVFLNLTCFMAYSADECIHHIDREKAHITTLDAGDVFTAGRYNSLIPIMQEKLEGGFAD  120

Query  121  YQSVAVVKKGSLQDVTNLRDMRNKRACFPWVGSLAGWIVPIHTLQREGGMEVVDCNNQVK  180
            YQSVAV+KKGSL D+ NLRDMRNKR CFPWVGSLAGWIVPIHTLQREGGMEVVDCNNQVK
Sbjct  121  YQSVAVIKKGSLPDLNNLRDMRNKRVCFPWVGSLAGWIVPIHTLQREGGMEVVDCNNQVK  180

Query  181  TAASYFNNSCAVYSLSDKYNPIGDNSDKLCTLCTGKIPGGRCSAADPYYGYEGAFRCLLE  240
            TAASYFNNSCAVYSLSDK+NPIGDNSDKLCTLCTGKIPGGRCS+ADPY+GYEGAF+CLLE
Sbjct  181  TAASYFNNSCAVYSLSDKHNPIGDNSDKLCTLCTGKIPGGRCSSADPYFGYEGAFKCLLE  240

Query  241  KGDVAFLRHSTVAEMLQTTEFKNLQPNSFELLCRDGRRVPINDYRQCNWGQVPADAIVTS  300
            KGDVAFLRHSTV EMLQTTEFKN+ P++FELLCRDGRR  INDYRQCNWGQVPADAIVTS
Sbjct  241  KGDVAFLRHSTVNEMLQTTEFKNIAPDTFELLCRDGRRASINDYRQCNWGQVPADAIVTS  300

Query  301  SARSFADRKQYQQFLKRIAELYSDGLRDDRGRQNGQSGQGFNNNFDNNNYNQQQGQSGAY  360
            SARSF+DRKQYQQFLKRIAELYSDG RDD+ RQ GQS   FN+    NN N Q     AY
Sbjct  301  SARSFSDRKQYQQFLKRIAELYSDGTRDDQSRQGGQS---FNSR---NNINDQN----AY  350

Query  361  DQFNNQYDPNNQYRSQNQYDQYRSERLDSSFAADQNPLDGTNTSILYEKFRIFESKRYGK  420
             QF+N    N+ YR+QNQYDQYRSERLDSSFA ++N  DGTNTSILYEKFRIFESKRYGK
Sbjct  351  GQFDN----NDPYRTQNQYDQYRSERLDSSFAEERNQQDGTNTSILYEKFRIFESKRYGK  406

Query  421  PNLLFQDSSRALTVIPEDDQSFTKYLGNAIGYIYGIRECPVGAMTLCVTSETELDKCIKM  480
            PNLLFQDSSRALTVIPEDDQSFTKYLG AI +IYGIRECPV AMTLCVTSE ELDKCIKM
Sbjct  407  PNLLFQDSSRALTVIPEDDQSFTKYLGPAINFIYGIRECPVPAMTLCVTSENELDKCIKM  466

Query  481  RTALKAHILKPELICKKMHSHINCMQFIQSGRADIAVFDAGDVYTGGLNYDLVPFMSEVY  540
            RTALKAH+LKPELICKKMHSHINCMQFI++G+ADI+VFDAGDVYTGGLNYDLVPFMSEVY
Sbjct  467  RTALKAHLLKPELICKKMHSHINCMQFIEAGKADISVFDAGDVYTGGLNYDLVPFMSEVY  526

Query  541  NLGEPEYYVVAVAKEEDPDTELTYLKGKNTCHTGINTAAGWTYPMAHFISNGWIRPYGCD  600
            NLGEPEYYVVAVAKE+DPDTELTYLKGKNTCHTGINTAAGWTYPMA FISNGWIRPYGCD
Sbjct  527  NLGEPEYYVVAVAKEDDPDTELTYLKGKNTCHTGINTAAGWTYPMALFISNGWIRPYGCD  586

Query  601  SVRAAAEYFTKSCVPGALSSEYNTGVPYDSMCDLCHGTSYRYCRRDASEDYYGHTGAFRC  660
            SVRAAAEYFTKSCVPGA+S+EYNTGVPYDSMCDLCHGTSYRYCRRDASE+YYGHTGAFRC
Sbjct  587  SVRAAAEYFTKSCVPGAISNEYNTGVPYDSMCDLCHGTSYRYCRRDASEEYYGHTGAFRC  646

Query  661  LVEGGGHVAFMKHTTVMESTGGKRKEWWARNALNDDFELLCTDGTRAEINEYKRCNLGKV  720
            LVEGGGHVAFMKHTTVMESTGGKRKEWWARNALNDDFELLCTDGTRAEI +YKRCNLGKV
Sbjct  647  LVEGGGHVAFMKHTTVMESTGGKRKEWWARNALNDDFELLCTDGTRAEIQDYKRCNLGKV  706

Query  721  KANAVVTRGGPAYNETQLNAYINLLTYAQQLYGRKDVDAFSFSMFSSPIGHYDLIFQDAT  780
            KANAVVTRGG  YNETQ+NAYINLLTYAQQLYGRK+VDAFSFSMFSSPIGHYDLIFQDAT
Sbjct  707  KANAVVTRGGVNYNETQMNAYINLLTYAQQLYGRKEVDAFSFSMFSSPIGHYDLIFQDAT  766

Query  781  RQLQVIPANKRTYDAYLGSDFMRARRITDCYAGASQVALSLGLLLVGSLVAIL  833
            RQLQVIP NKR YDAYLGSDFMRARRITDCYAGASQ+ALS+GLLLVGSLVA+L
Sbjct  767  RQLQVIPPNKRRYDAYLGSDFMRARRITDCYAGASQLALSVGLLLVGSLVAML  819


>O97355_DROME unnamed protein product
Length=641

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 68/289 (24%), Positives = 128/289 (44%), Gaps = 32/289 (11%)

Query  62   DAFLNLTCFRAFSADECIHHIDREKAHITSLDAGDVFTG-----GRYNSLIPIMQEKLEG  116
            +A + + C       +C+  I++ KA + + +  D++         Y  +  I  ++ + 
Sbjct  55   EAGIRMECVAGRDRVDCLELIEQRKADVLATEPEDMYIAYHRKNEDYRVISEIRTQQDKN  114

Query  117  GFAEYQSVAVVKKGSLQDVTNLRDMRNKRACFPWVGSLAGWIVPI------HTLQREGGM  170
                Y+ + +VKK S   +  L+ +R  ++C    G   G+ +PI      H L+     
Sbjct  115  AAFRYEGIILVKKDS--PIRTLQQLRGAKSCHTGFGRNVGYKIPITKLKNTHVLKVSADP  172

Query  171  EVVDCNNQVKTAASYFNNSCAVYSLSDKYNPIGDNSDK-----LCTLCTGKIPGGRCSAA  225
            ++     ++K+ + +F  SC V + S   +P  D   K     LC LC       +C+  
Sbjct  173  QISATERELKSLSEFFTQSCLVGTYST--HPETDRLLKKKYANLCALCEKP---EQCNYP  227

Query  226  DPYYGYEGAFRCLLE-KGDVAFLRHSTVAEML------QTTEFKNLQPNSFELLCRDGRR  278
            D + GY+GA RCL + +G+VAF +   + +                 P +FE LC DG R
Sbjct  228  DKFSGYDGAIRCLDKGQGEVAFSKVQYIKKYFGLPGAGPDAPPAEGNPENFEYLCEDGTR  287

Query  279  VPINDYRQCNWGQVPADAIVTSSARSFADRKQYQQFLKRIAELYSDGLR  327
             P+     C+W Q P    + S+ ++  + +Q  Q   R+   +++GL+
Sbjct  288  RPVTG-PACSWAQRPWSGYI-SNEQAVHNSEQLHQLQSRLERFFANGLQ  334


 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 78/337 (23%), Positives = 139/337 (41%), Gaps = 50/337 (15%)

Query  495  CKKMHSHINCMQFIQSGRADIAVFDAGDVYTG--GLNYDLVPFMSEVYNLGEP----EYY  548
            C      ++C++ I+  +AD+   +  D+Y      N D    +SE+    +      Y 
Sbjct  62   CVAGRDRVDCLELIEQRKADVLATEPEDMYIAYHRKNEDYR-VISEIRTQQDKNAAFRYE  120

Query  549  VVAVAKEEDPDTELTYLKGKNTCHTGINTAAGWTYPMAHFISNGWIRPYGCD--------  600
             + + K++ P   L  L+G  +CHTG     G+  P+   + N  +     D        
Sbjct  121  GIILVKKDSPIRTLQQLRGAKSCHTGFGRNVGYKIPITK-LKNTHVLKVSADPQISATER  179

Query  601  SVRAAAEYFTKSCVPGALSSEYNT----GVPYDSMCDLCHGTSYRYCRRDASEDYYGHTG  656
             +++ +E+FT+SC+ G  S+   T       Y ++C LC       C  +  + + G+ G
Sbjct  180  ELKSLSEFFTQSCLVGTYSTHPETDRLLKKKYANLCALCEKPE--QC--NYPDKFSGYDG  235

Query  657  AFRCLVEGGGHVAFMKHTTVMESTG--GKRKEWWARNALNDDFELLCTDGTRAEINEYKR  714
            A RCL +G G VAF K   + +  G  G   +        ++FE LC DGTR  +     
Sbjct  236  AIRCLDKGQGEVAFSKVQYIKKYFGLPGAGPDAPPAEGNPENFEYLCEDGTRRPVTG-PA  294

Query  715  CNLGKVKANAVVTRGGPAYNETQL--------------------NAYINLLTYAQQLYGR  754
            C+  +   +  ++     +N  QL                    +A  +LL     +Y  
Sbjct  295  CSWAQRPWSGYISNEQAVHNSEQLHQLQSRLERFFANGLQAQNKDAAAHLLIQPNAVYHS  354

Query  755  KDVDAFSFSMFSSPIGHYDLIFQD--ATRQLQVIPAN  789
            KD  A    ++    G+ D+I +D  A R++++   N
Sbjct  355  KDA-AIDPKVYLERAGYKDVIERDGSAIRKIRLCAQN  390


>Q9VWV6_DROME unnamed protein product
Length=641

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 68/289 (24%), Positives = 128/289 (44%), Gaps = 32/289 (11%)

Query  62   DAFLNLTCFRAFSADECIHHIDREKAHITSLDAGDVFTG-----GRYNSLIPIMQEKLEG  116
            +A + + C       +C+  I++ KA + + +  D++         Y  +  I  ++ + 
Sbjct  55   EAGIRMECVAGRDRVDCLELIEQRKADVLATEPEDMYIAYHRKNEDYRVISEIRTQQDKD  114

Query  117  GFAEYQSVAVVKKGSLQDVTNLRDMRNKRACFPWVGSLAGWIVPI------HTLQREGGM  170
                Y+ + +VKK S   +  L+ +R  ++C    G   G+ +PI      H L+     
Sbjct  115  AAFRYEGIILVKKDS--PIRTLQQLRGAKSCHTGFGRNVGYKIPITKLKNTHVLKVSADP  172

Query  171  EVVDCNNQVKTAASYFNNSCAVYSLSDKYNPIGDNSDK-----LCTLCTGKIPGGRCSAA  225
            ++     ++K+ + +F  SC V + S   +P  D   K     LC LC       +C+  
Sbjct  173  QISATERELKSLSEFFTQSCLVGTYS--THPETDRLLKKKYANLCALCEKP---EQCNYP  227

Query  226  DPYYGYEGAFRCLLE-KGDVAFLRHSTVAEML------QTTEFKNLQPNSFELLCRDGRR  278
            D + GY+GA RCL + +G+VAF +   + +                 P +FE LC DG R
Sbjct  228  DKFSGYDGAIRCLDKGQGEVAFSKVQYIKKYFGLPGAGPDAPPAEGNPENFEYLCEDGTR  287

Query  279  VPINDYRQCNWGQVPADAIVTSSARSFADRKQYQQFLKRIAELYSDGLR  327
             P+     C+W Q P    + S+ ++  + +Q  Q   R+   +++GL+
Sbjct  288  RPVTG-PACSWAQRPWSGYI-SNEQAVHNSEQLHQLQSRLERFFANGLQ  334


 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 78/337 (23%), Positives = 140/337 (42%), Gaps = 50/337 (15%)

Query  495  CKKMHSHINCMQFIQSGRADIAVFDAGDVYTG--GLNYDLVPFMSEVYNLGEPE----YY  548
            C      ++C++ I+  +AD+   +  D+Y      N D    +SE+    + +    Y 
Sbjct  62   CVAGRDRVDCLELIEQRKADVLATEPEDMYIAYHRKNEDYR-VISEIRTQQDKDAAFRYE  120

Query  549  VVAVAKEEDPDTELTYLKGKNTCHTGINTAAGWTYPMAHFISNGWIRPYGCD--------  600
             + + K++ P   L  L+G  +CHTG     G+  P+   + N  +     D        
Sbjct  121  GIILVKKDSPIRTLQQLRGAKSCHTGFGRNVGYKIPITK-LKNTHVLKVSADPQISATER  179

Query  601  SVRAAAEYFTKSCVPGALSSEYNT----GVPYDSMCDLCHGTSYRYCRRDASEDYYGHTG  656
             +++ +E+FT+SC+ G  S+   T       Y ++C LC       C  +  + + G+ G
Sbjct  180  ELKSLSEFFTQSCLVGTYSTHPETDRLLKKKYANLCALCEKPE--QC--NYPDKFSGYDG  235

Query  657  AFRCLVEGGGHVAFMKHTTVMESTG--GKRKEWWARNALNDDFELLCTDGTRAEINEYKR  714
            A RCL +G G VAF K   + +  G  G   +        ++FE LC DGTR  +     
Sbjct  236  AIRCLDKGQGEVAFSKVQYIKKYFGLPGAGPDAPPAEGNPENFEYLCEDGTRRPVTG-PA  294

Query  715  CNLGKVKANAVVTRGGPAYNETQL--------------------NAYINLLTYAQQLYGR  754
            C+  +   +  ++     +N  QL                    +A  +LL     +Y  
Sbjct  295  CSWAQRPWSGYISNEQAVHNSEQLHQLQSRLERFFANGLQAQNKDAAAHLLIQPNAVYHS  354

Query  755  KDVDAFSFSMFSSPIGHYDLIFQD--ATRQLQVIPAN  789
            KD  A    ++    G+ D+I +D  A R++++   N
Sbjct  355  KDA-AIDPKVYLERAGYKDVIERDGSAIRKIRLCAQN  390



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016411.1 phosphoacetylglucosamine mutase [Drosophila kikkawai]

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ4_DROME  unnamed protein product                                 1061    0.0  
Q57XH7_TRYB2  unnamed protein product                                 274     2e-84
Q9VY44_DROME  unnamed protein product                                 31.6    1.9  


>Q9VTZ4_DROME unnamed protein product
Length=549

 Score = 1061 bits (2743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/549 (94%), Positives = 532/549 (97%), Gaps = 2/549 (0%)

Query  1    MSINLRTVYAFAREMYPKVSTEHVQYGTAGFRGKAEFLDSVMFRMGVLATLRSRYREGAV  60
            MSINLRTVYAFAREMYPK S E +QYGTAGFRGKAEFLDSVMFRMGVLATLRSRYR G+V
Sbjct  1    MSINLRTVYAFAREMYPKTSKETIQYGTAGFRGKAEFLDSVMFRMGVLATLRSRYRGGSV  60

Query  61   IGVMITASHNPEPDNGVKLVDPKGEMLEASWESIATDLVNVSDQELEQHVAKIIKENNID  120
            IGVMITASHNPEPDNGVKLVDPKGEMLEASWE+IATDLVNVSDQELEQ VAKIIK+NNID
Sbjct  61   IGVMITASHNPEPDNGVKLVDPKGEMLEASWEAIATDLVNVSDQELEQQVAKIIKDNNID  120

Query  121  VTTSSQVFVGMDNRYHSPRLLKAVADGVIALKGNVKEYGIVTTPMLHYFVVAANTKEAYG  180
            VTTSSQVFVGMDNRYHSPRLLKAVADGVIALKGNVKEYGIVTTPMLHYFVVAANTKEAYG
Sbjct  121  VTTSSQVFVGMDNRYHSPRLLKAVADGVIALKGNVKEYGIVTTPMLHYFVVAANTKEAYG  180

Query  181  KPTEEGYYEKLIKAFELLRNSRLENGNYRNNIIFDGANGVGARKMLQFIKRMKSSLNVTV  240
            KPTEEGYY+KLIKAFELLRN RLENGNYRN+II+DGANGVGARKMLQFIKRMK +LNVTV
Sbjct  181  KPTEEGYYDKLIKAFELLRNGRLENGNYRNSIIYDGANGVGARKMLQFIKRMKGTLNVTV  240

Query  241  INQGIGPGKINEDCGADYVKVQQRTPKSMPE-VEPFTRCVSVDGDADRVVYFFTDDKGEF  299
            INQGIG GKINEDCGADYVKVQQ  PKSMPE V+P+TRCVSVDGDADRVVYFFTDDKGEF
Sbjct  241  INQGIGVGKINEDCGADYVKVQQSPPKSMPEDVKPYTRCVSVDGDADRVVYFFTDDKGEF  300

Query  300  HLLDGDRIATLVAGYLMELVTQAEINLRLGLVQTAYANGASTDYIVNELKFPVSCVPTGV  359
            HLLDGDRIATL+AGYLMELVTQ+EI+LRLGLVQTAYANGASTDYIV++LKFPVSCVPTGV
Sbjct  301  HLLDGDRIATLIAGYLMELVTQSEISLRLGLVQTAYANGASTDYIVDQLKFPVSCVPTGV  360

Query  360  KHLHHKALAYDIGVYFEANGHGTIVFSDNAKATIAQAAETKESAKTLLLLIDLINETVGD  419
            KHLHHKAL YDIGVYFEANGHGTIVFSDNAKATIAQ A+TKESAKTLLLLIDLINETVGD
Sbjct  361  KHLHHKALEYDIGVYFEANGHGTIVFSDNAKATIAQVAQTKESAKTLLLLIDLINETVGD  420

Query  420  AISDMLLVETILNHKGWDVQDWISSYNDLPNRQLKVKVQDRNVIETTDAERVCVKPEGLQ  479
            AISDMLLVETILNHKGWDVQDWISSYNDLPNRQLKVKVQDRNVIETTDAERVCVKPEGLQ
Sbjct  421  AISDMLLVETILNHKGWDVQDWISSYNDLPNRQLKVKVQDRNVIETTDAERVCVKPEGLQ  480

Query  480  TEINKVVANYKRGRSFVRPSGTEDVVRVYAEAATKEDTDNLAYEVGILVQKLAGGVGPEL  539
            TEIN+VVA YKRGRSFVRPSGTEDVVRVYAEAATKEDTDNLAYEVG+LVQKLAGGVGP L
Sbjct  481  TEINQVVAKYKRGRSFVRPSGTEDVVRVYAEAATKEDTDNLAYEVGLLVQKLAGGVGPPL  540

Query  540  TKP-GSAHL  547
            TKP  SAHL
Sbjct  541  TKPNSSAHL  549


>Q57XH7_TRYB2 unnamed protein product
Length=602

 Score = 274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 206/576 (36%), Positives = 286/576 (50%), Gaps = 72/576 (13%)

Query  26   YGTAGFRGKAEFLDSVMFRMGVLATLRSRYR---------EGAVIGVMITASHNPEPDNG  76
            YGT+GFR     L  V  R+  +A LR  +           G  +G M+TASHNP  DNG
Sbjct  31   YGTSGFRTIGTLLPPVASRVVYVAVLRVWWAIKKGNFGGLNGCSVGCMVTASHNPCGDNG  90

Query  77   VKLVDPKGEMLEASWESIATDLVNVSDQE---------LEQHVAKIIKENNIDVTTS-SQ  126
            +KL+D  G MLE SWE+  T   N S  E         +  H  +  K  ++ +      
Sbjct  91   LKLIDVDGGMLETSWETTCTQAANASTGEELLKVLNDCINLHGLEQPKPEDVKIRCPFGA  150

Query  127  VFVGMDNRYHSPRLLKAVADGVIALKGNVKEYGIVTTPMLHYFVVAANTKEAYG----KP  182
            V +  D R     +L A+   + A+     ++G++TTP LHY V  AN ++  G    KP
Sbjct  151  VHLSRDTRPTGVDILSAIFSSLQAIGVTYADHGVLTTPQLHYLVGRANREQLTGPGAMKP  210

Query  183  ---TEEGYYEKLIKAF-ELLRNSRLENGN----YRNNIIFDGANGVGA---RKMLQFIKR  231
               T   Y +++  +  ELLR     NG      R  I+ D A+GVGA   + +L+  + 
Sbjct  211  ADFTSALYAKEVFGSLGELLRFVTEGNGGTNPRQRQKIVIDAASGVGAVALKSLLKCAQE  270

Query  232  MKSS-----LNVTVINQGIGP-GKINEDCGADYVKVQQ---------------RTPKSMP  270
            + S       +VTV++  +     +N  CGADY +  Q               R      
Sbjct  271  VTSGVFEEFFDVTVLHDNVDDINALNYMCGADYTQKAQYPSNDTKEWAAAYEKRRSDKNE  330

Query  271  EVEPFTRCVSVDGDADRVVYFFTD-DKGE--FHLLDGDRIATLVAGYLMELVTQAEINL-  326
            EV  +    S+DGDADRVV FF D + GE  + LLDGDRI+ L A  + E +    + L 
Sbjct  331  EVHYY----SLDGDADRVVAFFHDRETGEDVWRLLDGDRISILYALSVREWIGGEALKLL  386

Query  327  RLGLVQTAYANGASTDYIVNELKFPVSCVPTGVKHLHHKALAYDIGVYFEANGHGTIVFS  386
             +G+VQTAYANGASTDYI   L        TGVK+LH  A   DIG YFE+NGHGTI+ +
Sbjct  387  DVGVVQTAYANGASTDYIQRGLGLRTYSSQTGVKNLHPIAHKCDIGAYFESNGHGTILLN  446

Query  387  DNAKATIAQAAETKESAKTLLLLIDLINETVGDAISDMLLVETILNHKGWDVQDWISSYN  446
             +A      +  +K +   L LL  LI++  GDAI+++   E IL         W+  Y 
Sbjct  447  GDAIDAKVPSLPSK-TRHVLSLLPRLISQVCGDAIANVFACELILLAHKMSFDSWLRLYT  505

Query  447  DLPNRQLKVKVQDRNVIETTDAERVCVKPEGLQ--------TEINKVVANYKRGRSFVRP  498
            D+P+ QLKVKV++  VI  T  ER  + P GLQ               ++    R+F RP
Sbjct  506  DIPSTQLKVKVKNPKVITNTQDERRALTPPGLQEAIDAAVAAANEATPSSATVARAFARP  565

Query  499  SGTEDVVRVYAEAATKEDTDNLAYEVGILVQKLAGG  534
            SGTE +VRVYAEAAT   +  LA +V  +V++  GG
Sbjct  566  SGTEPIVRVYAEAATHAVSSKLANDVEEIVRRFCGG  601


>Q9VY44_DROME unnamed protein product
Length=649

 Score = 31.6 bits (70),  Expect = 1.9, Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 62/156 (40%), Gaps = 14/156 (9%)

Query  252  EDCGADYVKVQQRTPKSMPEVEPFTRCVSVDGDADRVVYFFTDDKGEFHLLDG-DRIATL  310
            E+ GA Y+K+Q R     P  E     + +    D  +     D    H   G +R   L
Sbjct  90   EELGAKYIKLQCRGHGETPSPEQTHSFIEI---VDNFINERPFDVIAVHCTHGFNRTGFL  146

Query  311  VAGYLMELVTQAEINLRLGLVQTAYANGASTDYIVNEL--KFPVSCVPTGVKHLHHKALA  368
            +  YL+E +    ++  L +  +A   G      +NEL  ++  +          +  L 
Sbjct  147  IVCYLVERL-DCSVSAALAIFASARPPGIYKQDYINELYKRYEDTNAAPAAPEQPNWCLD  205

Query  369  YDIGVYFEANGHGTIVFSDNAKATIAQAAETKESAK  404
            YD G     NG G +   DN+ +T  QA E  + A+
Sbjct  206  YDDG-----NGDGFV--QDNSSSTSQQAGEQDDDAE  234



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016412.1 citron rho-interacting kinase isoform X1 [Drosophila
kikkawai]

Length=1855
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PI41_DROME  unnamed protein product                                 3325    0.0  
Q9VTY8_DROME  unnamed protein product                                 3313    0.0  
Q6NR17_DROME  unnamed protein product                                 2157    0.0  


>M9PI41_DROME unnamed protein product
Length=1858

 Score = 3325 bits (8620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1618/1865 (87%), Positives = 1755/1865 (94%), Gaps = 17/1865 (1%)

Query  1     MPPQLDPISVRTARLNNLILGKGVGVCAKPAGNASGSSSSVSSVRRSVVPVSTTSAAVAE  60
             MPP+++PISVRTARLNNLILGKG GVCAKPAG+ASGS    S+ RRS+VPVSTTSAAVAE
Sbjct  1     MPPKMEPISVRTARLNNLILGKGAGVCAKPAGSASGSGIPAST-RRSIVPVSTTSAAVAE  59

Query  61    AVCREGLLDAFCLLYNECDKDALKKRDRNIAEFVNKFRPIVEETRKLRVNADDFLIKGLI  120
             A+CREGLLDAFCLLYNECDKD LKKRDRNIAEFVNKFRPI+EETRKLRVNADDFLIK LI
Sbjct  60    AICREGLLDAFCLLYNECDKDTLKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLI  119

Query  121   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRHSEWLINLQYAFQDN  180
             GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIR+SEWLINLQYAFQDN
Sbjct  120   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRNSEWLINLQYAFQDN  179

Query  181   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  240
             DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL
Sbjct  180   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  239

Query  241   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRTV  300
             IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSR V
Sbjct  240   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIV  299

Query  301   SCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELINFPSDLKVSHNYRN  360
             SCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELI+FP+DLKVS NYRN
Sbjct  300   SCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRN  359

Query  361   LIESLVTNPSKRLSYERIKKHPFFDDIQWGSIRSQVPPIIPTIKSDDDTSNFEDGTRHKS  420
             LIESLVTNPSKRLSYERIK HPFF +I WGSIRSQVPPIIPT++SDDDTSNFEDG RHK+
Sbjct  360   LIESLVTNPSKRLSYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKT  419

Query  421   RREQGGVAKRSLSTNMKSNDFSGKDLPFIGYSFVHMEKTSLTAGNDEKLQEKLKELLQKL  480
             RREQG VAK+SL+TNMKSNDFSGKDLPFIGYSFVHMEK++++A  DEKLQEKLKELLQKL
Sbjct  420   RREQG-VAKKSLTTNMKSNDFSGKDLPFIGYSFVHMEKSAISATTDEKLQEKLKELLQKL  478

Query  481   KARENEISMLKQDLMRAQQSLKKTDNKSQVVNDAKMEIKKLQHIIKEKTMELANCKTQIK  540
             K RENEISMLKQDL+RAQQSL+KTDNKSQVV DAKMEIKKLQ IIKEKTMEL  CKTQIK
Sbjct  479   KTRENEISMLKQDLLRAQQSLRKTDNKSQVVADAKMEIKKLQQIIKEKTMELTTCKTQIK  538

Query  541   TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELAATLQKM  600
             TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELA+TLQK+
Sbjct  539   TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELASTLQKL  598

Query  601   DARELEFIAKNDECRHITLKLENYKDMVQQLKDQHLKSEANSEEQRRQMAESYEQKLSEL  660
             DARELEF AK +EC+H+++KL+NYKDM+QQ+K+Q+LKSE N EEQRRQMAE YEQKL++L
Sbjct  599   DARELEFNAKFEECKHLSMKLQNYKDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDL  658

Query  661   RKKVRDSQDTHRRLTMEMKEIRTERDESISSSKSTQEAKDATERNIEQILRRLNQEIASN  720
             RKKVRDSQDT+RR+TME+KEIRTE DESISSSKSTQEAK+ATERNIE+ILRRLN+EIASN
Sbjct  659   RKKVRDSQDTNRRMTMEIKEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASN  718

Query  721   NALNSEKVKLETKLKLKENDMQEVKAECQRLERELQLIECRCQLAESSLASQASPYETAP  780
             N L++EKVKLETKL+LKEN+ QEV+AEC RLERELQL ECRCQLAESSLA+Q SPYETAP
Sbjct  719   NELHAEKVKLETKLQLKENETQEVRAECHRLERELQLAECRCQLAESSLATQVSPYETAP  778

Query  781   GSLTELNVVEDQLRADLEAAKESENHQKGRADQLQALVTKLEQMLERFNEQSLSPTKSHS  840
             GSLTELN +EDQLRADL AAKESENHQKGRADQLQ LVTKLEQMLERFNEQSLSPTKSHS
Sbjct  779   GSLTELNAIEDQLRADLLAAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHS  838

Query  841   ARKPGTETVGDMLERQNEKLEDKLAAVQEQMIVERQAARTANLSLWKVEKQLEEALSEKK  900
             +RK   ETVGDMLERQNEKLEDKLAAV+EQMIVERQAARTANLSLWKVEKQLEEALSEKK
Sbjct  839   SRKQEGETVGDMLERQNEKLEDKLAAVREQMIVERQAARTANLSLWKVEKQLEEALSEKK  898

Query  901   LLARRMELTEDRIKKAQNANEESQRMLKSSQEETRQREARIEELKQELAAAKRDVLKEHR  960
             LLARRMELTEDRIKK QNA++E+QRMLK+SQEETRQRE+RIEELKQELAAAKRDVLKEHR
Sbjct  899   LLARRMELTEDRIKKVQNASDEAQRMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHR  958

Query  961   QWEKAEQERMKCKSEIIEHLANVHKLQQQETEVRQKLKQVQARFDGLTLENKNTLRELQE  1020
             QWEKAEQERMKCKSEIIEHLANVH+L+QQETE+RQKL+Q+Q+RFDG+TLE KNT+RELQE
Sbjct  959   QWEKAEQERMKCKSEIIEHLANVHRLEQQETELRQKLRQIQSRFDGVTLEQKNTIRELQE  1018

Query  1021  ERERCRAAADSSLSLKKELKQLTENFQRLKYACSITDNQLTEVETMLKSEQDRNKSQKSQ  1080
             ERE+ R A DS L L+KELKQLT+NFQRLKYACSITD+QLTEVETMLKSEQ+RNKSQKSQ
Sbjct  1019  EREKSRKANDSCLVLQKELKQLTDNFQRLKYACSITDSQLTEVETMLKSEQERNKSQKSQ  1078

Query  1081  LDAVYEKLRERNDQLTELRKQMAAIESEKRLAEQRAQVLASELEETRLHLKDQQKKLVSQ  1140
             LD ++EKLRERNDQLT+LRKQ+  +ESEKRLAEQRAQVLASE++E RL+LK+QQKKLV+Q
Sbjct  1079  LDTLHEKLRERNDQLTDLRKQLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQ  1138

Query  1141  QDQLVEQTNALFATQERADLLDGENANYQVQTADSVREMLNLKEENARILSELFHKKEEV  1200
             QDQLVEQTNALFATQERA+LLDG+NANY+ QTADS REM++LKEENARILSELFHKKEEV
Sbjct  1139  QDQLVEQTNALFATQERAELLDGQNANYEAQTADSNREMVSLKEENARILSELFHKKEEV  1198

Query  1201  SNLQAAVRDLESAQADLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV  1260
              NLQA +R LESAQA+LHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV
Sbjct  1199  GNLQAEIRGLESAQANLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV  1258

Query  1261  EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKLSSMLKEQIAQ  1320
             EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQK++S+LKEQ+AQ
Sbjct  1259  EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKMNSLLKEQLAQ  1318

Query  1321  LNGTATLRSPRKTSAVNGDSDAPKQRPVSIAVLPRSPQKQVESLKRTASHVELKTTEKTT  1380
             LNGTATLRSPRK++AVNGDSDAPKQRPVSIA LPRSPQKQ + LKRT S VELKTT +  
Sbjct  1319  LNGTATLRSPRKSAAVNGDSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKP  1378

Query  1381  SSV---EQAHHRFELALQESKEGAADCVVCGQAIVAGSPFWKCKECKDVTHRKCRANVQG  1437
             + V    QAHHRFELALQESK  A +CVVC +A+VAGSPFWKCKECKDVTHRKCR+NVQ 
Sbjct  1379  TKVTIENQAHHRFELALQESKVDAVNCVVCEKAVVAGSPFWKCKECKDVTHRKCRSNVQS  1438

Query  1438  NCGTKQPTAPPADEDLGSIPSGSCINLDSEE-------NSDYIGTLVYSCDGPEDADQAA  1490
             +CG+ +PTAP AD DL SI S S + LDS +         +YIG+LVYS DG ED    A
Sbjct  1439  HCGSTKPTAPSAD-DLSSIQSVSSLTLDSVDVAGGTTSGGEYIGSLVYSSDGAED---QA  1494

Query  1491  RKDIEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLLHIKGIESVSCMSICLRLAKAIMV  1550
             RK+IEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRL+HI G+ESVSCMSIC RLAKAIMV
Sbjct  1495  RKEIEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLVHISGLESVSCMSICKRLAKAIMV  1554

Query  1551  DTVGEKLYQCDFRQLESRCHSSSACHKPVLETSAIELPFANRTSSEKWKLVLISDEAENA  1610
              TVGEKLYQCD+RQLESRC SSS+CHKPVLETSAIELPFANRT SEKWKLVLISDEAENA
Sbjct  1555  GTVGEKLYQCDYRQLESRCQSSSSCHKPVLETSAIELPFANRTPSEKWKLVLISDEAENA  1614

Query  1611  LDSVAIAATSTRIVILKYDLKVHMFKPVRALDTATPVTSIFFTRHSAIVTSDKFYEIDLV  1670
             LDSVAIAATSTRIVILKYDLK+HMFKPVRALDTATPVTSIFFTRHSAIV+SDKFYEIDL 
Sbjct  1615  LDSVAIAATSTRIVILKYDLKLHMFKPVRALDTATPVTSIFFTRHSAIVSSDKFYEIDLD  1674

Query  1671  NYAAEEFVDLAEKSMQNTAKWQPLTAVRISRQEYLLCFAESGVFVDEFGCRSRPYDLNWM  1730
             NYAAEEFVDL++KSM++TAK QPLTAVRISRQEYLLCFAE GVFVDEFGCRSRPYDLNW+
Sbjct  1675  NYAAEEFVDLSDKSMESTAKCQPLTAVRISRQEYLLCFAEYGVFVDEFGCRSRPYDLNWV  1734

Query  1731  YAPTGFVYREPFLFVSHYQSVQIIRLHRSFSKELANGEDNSSETSESPELQRVYLPHYMS  1790
             YAPTGFVYR+PFLF+SHYQSVQI+RLHRSFSKE+A+G DN+SE SESPELQRVYLPHYMS
Sbjct  1735  YAPTGFVYRDPFLFISHYQSVQIVRLHRSFSKEMASG-DNASENSESPELQRVYLPHYMS  1793

Query  1791  TLLANSGDVNLYTLSIDKRPCNGTQKIYHLDTIQAFKKKLNISLETISSMATTVTSGSTM  1850
             TLLANSGDVNLY ++ID+RPCNGTQKIYHLDT+QAFK+K NIS+ET+SS+AT+VT GST+
Sbjct  1794  TLLANSGDVNLYAVAIDQRPCNGTQKIYHLDTMQAFKQKFNISMETLSSVATSVTLGSTV  1853

Query  1851  TGDSV  1855
             TG+S+
Sbjct  1854  TGNSI  1858


>Q9VTY8_DROME unnamed protein product
Length=1854

 Score = 3313 bits (8589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1615/1865 (87%), Positives = 1752/1865 (94%), Gaps = 21/1865 (1%)

Query  1     MPPQLDPISVRTARLNNLILGKGVGVCAKPAGNASGSSSSVSSVRRSVVPVSTTSAAVAE  60
             MPP+++PISVRTARLNNLILGKG GVCAKPAG+ASGS    S+ RRS+VPVSTTSAAVAE
Sbjct  1     MPPKMEPISVRTARLNNLILGKGAGVCAKPAGSASGSGIPAST-RRSIVPVSTTSAAVAE  59

Query  61    AVCREGLLDAFCLLYNECDKDALKKRDRNIAEFVNKFRPIVEETRKLRVNADDFLIKGLI  120
             A+CREGLLDAFCLLYNECDKD LKKRDRNIAEFVNKFRPI+EETRKLRVNADDFLIK LI
Sbjct  60    AICREGLLDAFCLLYNECDKDTLKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLI  119

Query  121   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRHSEWLINLQYAFQDN  180
             GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIR+SEWLINLQYAFQDN
Sbjct  120   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRNSEWLINLQYAFQDN  179

Query  181   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  240
             DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL
Sbjct  180   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  239

Query  241   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRTV  300
             IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVS   
Sbjct  240   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVS---  296

Query  301   SCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELINFPSDLKVSHNYRN  360
              CDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELI+FP+DLKVS NYRN
Sbjct  297   -CDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRN  355

Query  361   LIESLVTNPSKRLSYERIKKHPFFDDIQWGSIRSQVPPIIPTIKSDDDTSNFEDGTRHKS  420
             LIESLVTNPSKRLSYERIK HPFF +I WGSIRSQVPPIIPT++SDDDTSNFEDG RHK+
Sbjct  356   LIESLVTNPSKRLSYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKT  415

Query  421   RREQGGVAKRSLSTNMKSNDFSGKDLPFIGYSFVHMEKTSLTAGNDEKLQEKLKELLQKL  480
             RREQG VAK+SL+TNMKSNDFSGKDLPFIGYSFVHMEK++++A  DEKLQEKLKELLQKL
Sbjct  416   RREQG-VAKKSLTTNMKSNDFSGKDLPFIGYSFVHMEKSAISATTDEKLQEKLKELLQKL  474

Query  481   KARENEISMLKQDLMRAQQSLKKTDNKSQVVNDAKMEIKKLQHIIKEKTMELANCKTQIK  540
             K RENEISMLKQDL+RAQQSL+KTDNKSQVV DAKMEIKKLQ IIKEKTMEL  CKTQIK
Sbjct  475   KTRENEISMLKQDLLRAQQSLRKTDNKSQVVADAKMEIKKLQQIIKEKTMELTTCKTQIK  534

Query  541   TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELAATLQKM  600
             TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELA+TLQK+
Sbjct  535   TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELASTLQKL  594

Query  601   DARELEFIAKNDECRHITLKLENYKDMVQQLKDQHLKSEANSEEQRRQMAESYEQKLSEL  660
             DARELEF AK +EC+H+++KL+NYKDM+QQ+K+Q+LKSE N EEQRRQMAE YEQKL++L
Sbjct  595   DARELEFNAKFEECKHLSMKLQNYKDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDL  654

Query  661   RKKVRDSQDTHRRLTMEMKEIRTERDESISSSKSTQEAKDATERNIEQILRRLNQEIASN  720
             RKKVRDSQDT+RR+TME+KEIRTE DESISSSKSTQEAK+ATERNIE+ILRRLN+EIASN
Sbjct  655   RKKVRDSQDTNRRMTMEIKEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASN  714

Query  721   NALNSEKVKLETKLKLKENDMQEVKAECQRLERELQLIECRCQLAESSLASQASPYETAP  780
             N L++EKVKLETKL+LKEN+ QEV+AEC RLERELQL ECRCQLAESSLA+Q SPYETAP
Sbjct  715   NELHAEKVKLETKLQLKENETQEVRAECHRLERELQLAECRCQLAESSLATQVSPYETAP  774

Query  781   GSLTELNVVEDQLRADLEAAKESENHQKGRADQLQALVTKLEQMLERFNEQSLSPTKSHS  840
             GSLTELN +EDQLRADL AAKESENHQKGRADQLQ LVTKLEQMLERFNEQSLSPTKSHS
Sbjct  775   GSLTELNAIEDQLRADLLAAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHS  834

Query  841   ARKPGTETVGDMLERQNEKLEDKLAAVQEQMIVERQAARTANLSLWKVEKQLEEALSEKK  900
             +RK   ETVGDMLERQNEKLEDKLAAV+EQMIVERQAARTANLSLWKVEKQLEEALSEKK
Sbjct  835   SRKQEGETVGDMLERQNEKLEDKLAAVREQMIVERQAARTANLSLWKVEKQLEEALSEKK  894

Query  901   LLARRMELTEDRIKKAQNANEESQRMLKSSQEETRQREARIEELKQELAAAKRDVLKEHR  960
             LLARRMELTEDRIKK QNA++E+QRMLK+SQEETRQRE+RIEELKQELAAAKRDVLKEHR
Sbjct  895   LLARRMELTEDRIKKVQNASDEAQRMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHR  954

Query  961   QWEKAEQERMKCKSEIIEHLANVHKLQQQETEVRQKLKQVQARFDGLTLENKNTLRELQE  1020
             QWEKAEQERMKCKSEIIEHLANVH+L+QQETE+RQKL+Q+Q+RFDG+TLE KNT+RELQE
Sbjct  955   QWEKAEQERMKCKSEIIEHLANVHRLEQQETELRQKLRQIQSRFDGVTLEQKNTIRELQE  1014

Query  1021  ERERCRAAADSSLSLKKELKQLTENFQRLKYACSITDNQLTEVETMLKSEQDRNKSQKSQ  1080
             ERE+ R A DS L L+KELKQLT+NFQRLKYACSITD+QLTEVETMLKSEQ+RNKSQKSQ
Sbjct  1015  EREKSRKANDSCLVLQKELKQLTDNFQRLKYACSITDSQLTEVETMLKSEQERNKSQKSQ  1074

Query  1081  LDAVYEKLRERNDQLTELRKQMAAIESEKRLAEQRAQVLASELEETRLHLKDQQKKLVSQ  1140
             LD ++EKLRERNDQLT+LRKQ+  +ESEKRLAEQRAQVLASE++E RL+LK+QQKKLV+Q
Sbjct  1075  LDTLHEKLRERNDQLTDLRKQLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQ  1134

Query  1141  QDQLVEQTNALFATQERADLLDGENANYQVQTADSVREMLNLKEENARILSELFHKKEEV  1200
             QDQLVEQTNALFATQERA+LLDG+NANY+ QTADS REM++LKEENARILSELFHKKEEV
Sbjct  1135  QDQLVEQTNALFATQERAELLDGQNANYEAQTADSNREMVSLKEENARILSELFHKKEEV  1194

Query  1201  SNLQAAVRDLESAQADLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV  1260
              NLQA +R LESAQA+LHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV
Sbjct  1195  GNLQAEIRGLESAQANLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV  1254

Query  1261  EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKLSSMLKEQIAQ  1320
             EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQK++S+LKEQ+AQ
Sbjct  1255  EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKMNSLLKEQLAQ  1314

Query  1321  LNGTATLRSPRKTSAVNGDSDAPKQRPVSIAVLPRSPQKQVESLKRTASHVELKTTEKTT  1380
             LNGTATLRSPRK++AVNGDSDAPKQRPVSIA LPRSPQKQ + LKRT S VELKTT +  
Sbjct  1315  LNGTATLRSPRKSAAVNGDSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKP  1374

Query  1381  SSV---EQAHHRFELALQESKEGAADCVVCGQAIVAGSPFWKCKECKDVTHRKCRANVQG  1437
             + V    QAHHRFELALQESK  A +CVVC +A+VAGSPFWKCKECKDVTHRKCR+NVQ 
Sbjct  1375  TKVTIENQAHHRFELALQESKVDAVNCVVCEKAVVAGSPFWKCKECKDVTHRKCRSNVQS  1434

Query  1438  NCGTKQPTAPPADEDLGSIPSGSCINLDSEE-------NSDYIGTLVYSCDGPEDADQAA  1490
             +CG+ +PTAP AD DL SI S S + LDS +         +YIG+LVYS DG ED    A
Sbjct  1435  HCGSTKPTAPSAD-DLSSIQSVSSLTLDSVDVAGGTTSGGEYIGSLVYSSDGAED---QA  1490

Query  1491  RKDIEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLLHIKGIESVSCMSICLRLAKAIMV  1550
             RK+IEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRL+HI G+ESVSCMSIC RLAKAIMV
Sbjct  1491  RKEIEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLVHISGLESVSCMSICKRLAKAIMV  1550

Query  1551  DTVGEKLYQCDFRQLESRCHSSSACHKPVLETSAIELPFANRTSSEKWKLVLISDEAENA  1610
              TVGEKLYQCD+RQLESRC SSS+CHKPVLETSAIELPFANRT SEKWKLVLISDEAENA
Sbjct  1551  GTVGEKLYQCDYRQLESRCQSSSSCHKPVLETSAIELPFANRTPSEKWKLVLISDEAENA  1610

Query  1611  LDSVAIAATSTRIVILKYDLKVHMFKPVRALDTATPVTSIFFTRHSAIVTSDKFYEIDLV  1670
             LDSVAIAATSTRIVILKYDLK+HMFKPVRALDTATPVTSIFFTRHSAIV+SDKFYEIDL 
Sbjct  1611  LDSVAIAATSTRIVILKYDLKLHMFKPVRALDTATPVTSIFFTRHSAIVSSDKFYEIDLD  1670

Query  1671  NYAAEEFVDLAEKSMQNTAKWQPLTAVRISRQEYLLCFAESGVFVDEFGCRSRPYDLNWM  1730
             NYAAEEFVDL++KSM++TAK QPLTAVRISRQEYLLCFAE GVFVDEFGCRSRPYDLNW+
Sbjct  1671  NYAAEEFVDLSDKSMESTAKCQPLTAVRISRQEYLLCFAEYGVFVDEFGCRSRPYDLNWV  1730

Query  1731  YAPTGFVYREPFLFVSHYQSVQIIRLHRSFSKELANGEDNSSETSESPELQRVYLPHYMS  1790
             YAPTGFVYR+PFLF+SHYQSVQI+RLHRSFSKE+A+G DN+SE SESPELQRVYLPHYMS
Sbjct  1731  YAPTGFVYRDPFLFISHYQSVQIVRLHRSFSKEMASG-DNASENSESPELQRVYLPHYMS  1789

Query  1791  TLLANSGDVNLYTLSIDKRPCNGTQKIYHLDTIQAFKKKLNISLETISSMATTVTSGSTM  1850
             TLLANSGDVNLY ++ID+RPCNGTQKIYHLDT+QAFK+K NIS+ET+SS+AT+VT GST+
Sbjct  1790  TLLANSGDVNLYAVAIDQRPCNGTQKIYHLDTMQAFKQKFNISMETLSSVATSVTLGSTV  1849

Query  1851  TGDSV  1855
             TG+S+
Sbjct  1850  TGNSI  1854


>Q6NR17_DROME unnamed protein product
Length=1242

 Score = 2157 bits (5588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1053/1247 (84%), Positives = 1161/1247 (93%), Gaps = 15/1247 (1%)

Query  619   LKLENYKDMVQQLKDQHLKSEANSEEQRRQMAESYEQKLSELRKKVRDSQDTHRRLTMEM  678
             +KL+NYKDM+QQ+K+Q+LKSE N EEQRRQMAE YEQKL++LRKKVRDSQDT+RR+TME+
Sbjct  1     MKLQNYKDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDLRKKVRDSQDTNRRMTMEI  60

Query  679   KEIRTERDESISSSKSTQEAKDATERNIEQILRRLNQEIASNNALNSEKVKLETKLKLKE  738
             KEIRTE DESISSSKSTQEAK+ATERNIE+ILRRLN+EIASNN L++EKVKLETKL+LKE
Sbjct  61    KEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASNNELHAEKVKLETKLQLKE  120

Query  739   NDMQEVKAECQRLERELQLIECRCQLAESSLASQASPYETAPGSLTELNVVEDQLRADLE  798
             N+ QEV+AEC RLERELQL ECRCQLAESSLA+Q SPYETAPGSLTELN +EDQLRADL 
Sbjct  121   NETQEVRAECHRLERELQLAECRCQLAESSLATQVSPYETAPGSLTELNAIEDQLRADLL  180

Query  799   AAKESENHQKGRADQLQALVTKLEQMLERFNEQSLSPTKSHSARKPGTETVGDMLERQNE  858
             AAKESENHQKGRADQLQ LVTKLEQMLERFNEQSLSPTKSHS+RK   ETVGDMLERQNE
Sbjct  181   AAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHSSRKQEGETVGDMLERQNE  240

Query  859   KLEDKLAAVQEQMIVERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKAQN  918
             KLEDKLAAV+EQMIVERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKK QN
Sbjct  241   KLEDKLAAVREQMIVERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKVQN  300

Query  919   ANEESQRMLKSSQEETRQREARIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEIIE  978
             A++E+QRMLK+SQEETRQRE+RIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEIIE
Sbjct  301   ASDEAQRMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEIIE  360

Query  979   HLANVHKLQQQETEVRQKLKQVQARFDGLTLENKNTLRELQEERERCRAAADSSLSLKKE  1038
             HLANVH+L+QQETE+RQKL+Q+Q+RFDG+TLE KNT+RELQEERE+ R A DS L L+KE
Sbjct  361   HLANVHRLEQQETELRQKLRQIQSRFDGVTLEQKNTIRELQEEREKSRKANDSCLVLQKE  420

Query  1039  LKQLTENFQRLKYACSITDNQLTEVETMLKSEQDRNKSQKSQLDAVYEKLRERNDQLTEL  1098
             LKQLT+NFQRLKYACSITD+QLTEVETMLKSEQ+RNKSQKSQLD ++EKLRERNDQLT+L
Sbjct  421   LKQLTDNFQRLKYACSITDSQLTEVETMLKSEQERNKSQKSQLDTLHEKLRERNDQLTDL  480

Query  1099  RKQMAAIESEKRLAEQRAQVLASELEETRLHLKDQQKKLVSQQDQLVEQTNALFATQERA  1158
             RKQ+  +ESEKRLAEQRAQVLASE++E RL+LK+QQKKLV+QQDQLVEQTNALFATQERA
Sbjct  481   RKQLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQQDQLVEQTNALFATQERA  540

Query  1159  DLLDGENANYQVQTADSVREMLNLKEENARILSELFHKKEEVSNLQAAVRDLESAQADLH  1218
             +LLDG+NANY+ QTADS REM++LKEENARILSELFHKKEEV NLQA +R LESAQA+LH
Sbjct  541   ELLDGQNANYEAQTADSNREMVSLKEENARILSELFHKKEEVGNLQAEIRGLESAQANLH  600

Query  1219  AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSAKKKKTLADKLFGS  1278
             AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSAKKKKTLADKLFGS
Sbjct  601   AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSAKKKKTLADKLFGS  660

Query  1279  SHTNKENVSPNDVESSILYRALKEELKREQKLSSMLKEQIAQLNGTATLRSPRKTSAVNG  1338
             SHTNKENVSPNDVESSILYRALKEELKREQK++S+LKEQ+AQLNGTATLRSPRK++AVNG
Sbjct  661   SHTNKENVSPNDVESSILYRALKEELKREQKMNSLLKEQLAQLNGTATLRSPRKSAAVNG  720

Query  1339  DSDAPKQRPVSIAVLPRSPQKQVESLKRTASHVELKTTEKTTSSV---EQAHHRFELALQ  1395
             DSDAPKQRPVSIA LPRSPQKQ + LKRT S VELKTT +  + V    QAHHRFELALQ
Sbjct  721   DSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKPTKVTIENQAHHRFELALQ  780

Query  1396  ESKEGAADCVVCGQAIVAGSPFWKCKECKDVTHRKCRANVQGNCGTKQPTAPPADEDLGS  1455
             ESK  A +CVVC +A+VAGSPFWKCKECKDVTHRKCR+NVQ +CG+ +PTAP AD DL S
Sbjct  781   ESKVDAVNCVVCEKAVVAGSPFWKCKECKDVTHRKCRSNVQSHCGSTKPTAPSAD-DLSS  839

Query  1456  IPSGSCINLDSEE-------NSDYIGTLVYSCDGPEDADQAARKDIEVNCAFEVAEQQIL  1508
             I S S + LDS +         +YIG+LVYS DG ED    ARK+IEVNCAFEVAEQQIL
Sbjct  840   IQSVSSLTLDSVDVAGGTTSGGEYIGSLVYSSDGAED---QARKEIEVNCAFEVAEQQIL  896

Query  1509  LLGCNTGLYAYHLDSQRLLHIKGIESVSCMSICLRLAKAIMVDTVGEKLYQCDFRQLESR  1568
             LLGCNTGLYAYHLDSQRL+HI G+ESVSCMSIC RLAKAIMV TVGEKLYQCD+RQLESR
Sbjct  897   LLGCNTGLYAYHLDSQRLVHISGLESVSCMSICKRLAKAIMVGTVGEKLYQCDYRQLESR  956

Query  1569  CHSSSACHKPVLETSAIELPFANRTSSEKWKLVLISDEAENALDSVAIAATSTRIVILKY  1628
             C SSS+CHKPVLETSAIELPFANRT SEKWKLVLISDEAENALDSVAIAATSTRIVILKY
Sbjct  957   CQSSSSCHKPVLETSAIELPFANRTPSEKWKLVLISDEAENALDSVAIAATSTRIVILKY  1016

Query  1629  DLKVHMFKPVRALDTATPVTSIFFTRHSAIVTSDKFYEIDLVNYAAEEFVDLAEKSMQNT  1688
             DLK+HMFKPVRALDTATPVTSIFFTRHSAIV+SDKFYEIDL NYAAEEFVDL++KSM++T
Sbjct  1017  DLKLHMFKPVRALDTATPVTSIFFTRHSAIVSSDKFYEIDLDNYAAEEFVDLSDKSMEST  1076

Query  1689  AKWQPLTAVRISRQEYLLCFAESGVFVDEFGCRSRPYDLNWMYAPTGFVYREPFLFVSHY  1748
             AK QPLTAVRISRQEYLLCFAE GVFVDEFGCRSRPYDLNW+YAPTGFVYR+PFLF+SHY
Sbjct  1077  AKCQPLTAVRISRQEYLLCFAEYGVFVDEFGCRSRPYDLNWVYAPTGFVYRDPFLFISHY  1136

Query  1749  QSVQIIRLHRSFSKELANGEDNSSETSESPELQRVYLPHYMSTLLANSGDVNLYTLSIDK  1808
             QSVQI+RLHRSFSKE+A+G DN+SE SESPELQRVYLPHYMSTLLANSGDVNLY ++ID+
Sbjct  1137  QSVQIVRLHRSFSKEMASG-DNASENSESPELQRVYLPHYMSTLLANSGDVNLYAVAIDQ  1195

Query  1809  RPCNGTQKIYHLDTIQAFKKKLNISLETISSMATTVTSGSTMTGDSV  1855
             RPCNGTQKIYHLDT+QAFK+K NIS+ET+SS+AT+VT GST+TG+S+
Sbjct  1196  RPCNGTQKIYHLDTMQAFKQKFNISMETLSSVATSVTLGSTVTGNSI  1242



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016413.1 citron rho-interacting kinase isoform X2 [Drosophila
kikkawai]

Length=1851
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTY8_DROME  unnamed protein product                                 3318    0.0  
M9PI41_DROME  unnamed protein product                                 3313    0.0  
Q6NR17_DROME  unnamed protein product                                 2157    0.0  


>Q9VTY8_DROME unnamed protein product
Length=1854

 Score = 3318 bits (8604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1615/1861 (87%), Positives = 1752/1861 (94%), Gaps = 17/1861 (1%)

Query  1     MPPQLDPISVRTARLNNLILGKGVGVCAKPAGNASGSSSSVSSVRRSVVPVSTTSAAVAE  60
             MPP+++PISVRTARLNNLILGKG GVCAKPAG+ASGS    S+ RRS+VPVSTTSAAVAE
Sbjct  1     MPPKMEPISVRTARLNNLILGKGAGVCAKPAGSASGSGIPAST-RRSIVPVSTTSAAVAE  59

Query  61    AVCREGLLDAFCLLYNECDKDALKKRDRNIAEFVNKFRPIVEETRKLRVNADDFLIKGLI  120
             A+CREGLLDAFCLLYNECDKD LKKRDRNIAEFVNKFRPI+EETRKLRVNADDFLIK LI
Sbjct  60    AICREGLLDAFCLLYNECDKDTLKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLI  119

Query  121   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRHSEWLINLQYAFQDN  180
             GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIR+SEWLINLQYAFQDN
Sbjct  120   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRNSEWLINLQYAFQDN  179

Query  181   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  240
             DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL
Sbjct  180   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  239

Query  241   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSCDY  300
             IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSCDY
Sbjct  240   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSCDY  299

Query  301   WSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELINFPSDLKVSHNYRNLIES  360
             WSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELI+FP+DLKVS NYRNLIES
Sbjct  300   WSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRNLIES  359

Query  361   LVTNPSKRLSYERIKKHPFFDDIQWGSIRSQVPPIIPTIKSDDDTSNFEDGTRHKSRREQ  420
             LVTNPSKRLSYERIK HPFF +I WGSIRSQVPPIIPT++SDDDTSNFEDG RHK+RREQ
Sbjct  360   LVTNPSKRLSYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKTRREQ  419

Query  421   GGVAKRSLSTNMKSNDFSGKDLPFIGYSFVHMEKTSLTAGNDEKLQEKLKELLQKLKARE  480
             G VAK+SL+TNMKSNDFSGKDLPFIGYSFVHMEK++++A  DEKLQEKLKELLQKLK RE
Sbjct  420   G-VAKKSLTTNMKSNDFSGKDLPFIGYSFVHMEKSAISATTDEKLQEKLKELLQKLKTRE  478

Query  481   NEISMLKQDLMRAQQSLKKTDNKSQVVNDAKMEIKKLQHIIKEKTMELANCKTQIKTLQS  540
             NEISMLKQDL+RAQQSL+KTDNKSQVV DAKMEIKKLQ IIKEKTMEL  CKTQIKTLQS
Sbjct  479   NEISMLKQDLLRAQQSLRKTDNKSQVVADAKMEIKKLQQIIKEKTMELTTCKTQIKTLQS  538

Query  541   SAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELAATLQKMDARE  600
             SAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELA+TLQK+DARE
Sbjct  539   SAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELASTLQKLDARE  598

Query  601   LEFIAKNDECRHITLKLENYKDMVQQLKDQHLKSEANSEEQRRQMAESYEQKLSELRKKV  660
             LEF AK +EC+H+++KL+NYKDM+QQ+K+Q+LKSE N EEQRRQMAE YEQKL++LRKKV
Sbjct  599   LEFNAKFEECKHLSMKLQNYKDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDLRKKV  658

Query  661   RDSQDTHRRLTMEMKEIRTERDESISSSKSTQEAKDATERNIEQILRRLNQEIASNNALN  720
             RDSQDT+RR+TME+KEIRTE DESISSSKSTQEAK+ATERNIE+ILRRLN+EIASNN L+
Sbjct  659   RDSQDTNRRMTMEIKEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASNNELH  718

Query  721   SEKVKLETKLKLKENDMQEVKAECQRLERELQLIECRCQLAESSLASQASPYETAPGSLT  780
             +EKVKLETKL+LKEN+ QEV+AEC RLERELQL ECRCQLAESSLA+Q SPYETAPGSLT
Sbjct  719   AEKVKLETKLQLKENETQEVRAECHRLERELQLAECRCQLAESSLATQVSPYETAPGSLT  778

Query  781   ELNVVEDQLRADLEAAKESENHQKGRADQLQALVTKLEQMLERFNEQSLSPTKSHSARKP  840
             ELN +EDQLRADL AAKESENHQKGRADQLQ LVTKLEQMLERFNEQSLSPTKSHS+RK 
Sbjct  779   ELNAIEDQLRADLLAAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHSSRKQ  838

Query  841   GTETVGDMLERQNEKLEDKLAAVQEQMIVERQAARTANLSLWKVEKQLEEALSEKKLLAR  900
               ETVGDMLERQNEKLEDKLAAV+EQMIVERQAARTANLSLWKVEKQLEEALSEKKLLAR
Sbjct  839   EGETVGDMLERQNEKLEDKLAAVREQMIVERQAARTANLSLWKVEKQLEEALSEKKLLAR  898

Query  901   RMELTEDRIKKAQNANEESQRMLKSSQEETRQREARIEELKQELAAAKRDVLKEHRQWEK  960
             RMELTEDRIKK QNA++E+QRMLK+SQEETRQRE+RIEELKQELAAAKRDVLKEHRQWEK
Sbjct  899   RMELTEDRIKKVQNASDEAQRMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHRQWEK  958

Query  961   AEQERMKCKSEIIEHLANVHKLQQQETEVRQKLKQVQARFDGLTLENKNTLRELQEERER  1020
             AEQERMKCKSEIIEHLANVH+L+QQETE+RQKL+Q+Q+RFDG+TLE KNT+RELQEERE+
Sbjct  959   AEQERMKCKSEIIEHLANVHRLEQQETELRQKLRQIQSRFDGVTLEQKNTIRELQEEREK  1018

Query  1021  CRAAADSSLSLKKELKQLTENFQRLKYACSITDNQLTEVETMLKSEQDRNKSQKSQLDAV  1080
              R A DS L L+KELKQLT+NFQRLKYACSITD+QLTEVETMLKSEQ+RNKSQKSQLD +
Sbjct  1019  SRKANDSCLVLQKELKQLTDNFQRLKYACSITDSQLTEVETMLKSEQERNKSQKSQLDTL  1078

Query  1081  YEKLRERNDQLTELRKQMAAIESEKRLAEQRAQVLASELEETRLHLKDQQKKLVSQQDQL  1140
             +EKLRERNDQLT+LRKQ+  +ESEKRLAEQRAQVLASE++E RL+LK+QQKKLV+QQDQL
Sbjct  1079  HEKLRERNDQLTDLRKQLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQQDQL  1138

Query  1141  VEQTNALFATQERADLLDGENANYQVQTADSVREMLNLKEENARILSELFHKKEEVSNLQ  1200
             VEQTNALFATQERA+LLDG+NANY+ QTADS REM++LKEENARILSELFHKKEEV NLQ
Sbjct  1139  VEQTNALFATQERAELLDGQNANYEAQTADSNREMVSLKEENARILSELFHKKEEVGNLQ  1198

Query  1201  AAVRDLESAQADLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLS  1260
             A +R LESAQA+LHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLS
Sbjct  1199  AEIRGLESAQANLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLS  1258

Query  1261  AKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKLSSMLKEQIAQLNGT  1320
             AKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQK++S+LKEQ+AQLNGT
Sbjct  1259  AKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKMNSLLKEQLAQLNGT  1318

Query  1321  ATLRSPRKTSAVNGDSDAPKQRPVSIAVLPRSPQKQVESLKRTASHVELKTTEKTTSSV-  1379
             ATLRSPRK++AVNGDSDAPKQRPVSIA LPRSPQKQ + LKRT S VELKTT +  + V 
Sbjct  1319  ATLRSPRKSAAVNGDSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKPTKVT  1378

Query  1380  --EQAHHRFELALQESKEGAADCVVCGQAIVAGSPFWKCKECKDVTHRKCRANVQGNCGT  1437
                QAHHRFELALQESK  A +CVVC +A+VAGSPFWKCKECKDVTHRKCR+NVQ +CG+
Sbjct  1379  IENQAHHRFELALQESKVDAVNCVVCEKAVVAGSPFWKCKECKDVTHRKCRSNVQSHCGS  1438

Query  1438  KQPTAPPADEDLGSIPSGSCINLDSEE-------NSDYIGTLVYSCDGPEDADQAARKDI  1490
              +PTAP AD DL SI S S + LDS +         +YIG+LVYS DG ED    ARK+I
Sbjct  1439  TKPTAPSAD-DLSSIQSVSSLTLDSVDVAGGTTSGGEYIGSLVYSSDGAED---QARKEI  1494

Query  1491  EVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLLHIKGIESVSCMSICLRLAKAIMVDTVG  1550
             EVNCAFEVAEQQILLLGCNTGLYAYHLDSQRL+HI G+ESVSCMSIC RLAKAIMV TVG
Sbjct  1495  EVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLVHISGLESVSCMSICKRLAKAIMVGTVG  1554

Query  1551  EKLYQCDFRQLESRCHSSSACHKPVLETSAIELPFANRTSSEKWKLVLISDEAENALDSV  1610
             EKLYQCD+RQLESRC SSS+CHKPVLETSAIELPFANRT SEKWKLVLISDEAENALDSV
Sbjct  1555  EKLYQCDYRQLESRCQSSSSCHKPVLETSAIELPFANRTPSEKWKLVLISDEAENALDSV  1614

Query  1611  AIAATSTRIVILKYDLKVHMFKPVRALDTATPVTSIFFTRHSAIVTSDKFYEIDLVNYAA  1670
             AIAATSTRIVILKYDLK+HMFKPVRALDTATPVTSIFFTRHSAIV+SDKFYEIDL NYAA
Sbjct  1615  AIAATSTRIVILKYDLKLHMFKPVRALDTATPVTSIFFTRHSAIVSSDKFYEIDLDNYAA  1674

Query  1671  EEFVDLAEKSMQNTAKWQPLTAVRISRQEYLLCFAESGVFVDEFGCRSRPYDLNWMYAPT  1730
             EEFVDL++KSM++TAK QPLTAVRISRQEYLLCFAE GVFVDEFGCRSRPYDLNW+YAPT
Sbjct  1675  EEFVDLSDKSMESTAKCQPLTAVRISRQEYLLCFAEYGVFVDEFGCRSRPYDLNWVYAPT  1734

Query  1731  GFVYREPFLFVSHYQSVQIIRLHRSFSKELANGEDNSSETSESPELQRVYLPHYMSTLLA  1790
             GFVYR+PFLF+SHYQSVQI+RLHRSFSKE+A+G DN+SE SESPELQRVYLPHYMSTLLA
Sbjct  1735  GFVYRDPFLFISHYQSVQIVRLHRSFSKEMASG-DNASENSESPELQRVYLPHYMSTLLA  1793

Query  1791  NSGDVNLYTLSIDKRPCNGTQKIYHLDTIQAFKKKLNISLETISSMATTVTSGSTMTGDS  1850
             NSGDVNLY ++ID+RPCNGTQKIYHLDT+QAFK+K NIS+ET+SS+AT+VT GST+TG+S
Sbjct  1794  NSGDVNLYAVAIDQRPCNGTQKIYHLDTMQAFKQKFNISMETLSSVATSVTLGSTVTGNS  1853

Query  1851  V  1851
             +
Sbjct  1854  I  1854


>M9PI41_DROME unnamed protein product
Length=1858

 Score = 3313 bits (8589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1615/1865 (87%), Positives = 1752/1865 (94%), Gaps = 21/1865 (1%)

Query  1     MPPQLDPISVRTARLNNLILGKGVGVCAKPAGNASGSSSSVSSVRRSVVPVSTTSAAVAE  60
             MPP+++PISVRTARLNNLILGKG GVCAKPAG+ASGS    S+ RRS+VPVSTTSAAVAE
Sbjct  1     MPPKMEPISVRTARLNNLILGKGAGVCAKPAGSASGSGIPAST-RRSIVPVSTTSAAVAE  59

Query  61    AVCREGLLDAFCLLYNECDKDALKKRDRNIAEFVNKFRPIVEETRKLRVNADDFLIKGLI  120
             A+CREGLLDAFCLLYNECDKD LKKRDRNIAEFVNKFRPI+EETRKLRVNADDFLIK LI
Sbjct  60    AICREGLLDAFCLLYNECDKDTLKKRDRNIAEFVNKFRPIIEETRKLRVNADDFLIKTLI  119

Query  121   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRHSEWLINLQYAFQDN  180
             GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIR+SEWLINLQYAFQDN
Sbjct  120   GQGYFGNVHLVVERQTNDIYAMKKIKKSVVTTSQVKEERDIMSIRNSEWLINLQYAFQDN  179

Query  181   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  240
             DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL
Sbjct  180   DNLYLVMEYMPGGDLLSLMSRHGPFDEDLARFYLAELTVALHTLHEMGYVHRDIKPENIL  239

Query  241   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVS---  297
             IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVS   
Sbjct  240   IDRFGHIKLADFGNAAALDRDGHVLSLSPVGTPDYIAPELLQTISTYKLSKSMHDVSRIV  299

Query  298   -CDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELINFPSDLKVSHNYRN  356
              CDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELI+FP+DLKVS NYRN
Sbjct  300   SCDYWSMGIIGYELICETTPFHEDNVHETYSKILSHCEESHLKELISFPADLKVSVNYRN  359

Query  357   LIESLVTNPSKRLSYERIKKHPFFDDIQWGSIRSQVPPIIPTIKSDDDTSNFEDGTRHKS  416
             LIESLVTNPSKRLSYERIK HPFF +I WGSIRSQVPPIIPT++SDDDTSNFEDG RHK+
Sbjct  360   LIESLVTNPSKRLSYERIKNHPFFSEIPWGSIRSQVPPIIPTVRSDDDTSNFEDGIRHKT  419

Query  417   RREQGGVAKRSLSTNMKSNDFSGKDLPFIGYSFVHMEKTSLTAGNDEKLQEKLKELLQKL  476
             RREQG VAK+SL+TNMKSNDFSGKDLPFIGYSFVHMEK++++A  DEKLQEKLKELLQKL
Sbjct  420   RREQG-VAKKSLTTNMKSNDFSGKDLPFIGYSFVHMEKSAISATTDEKLQEKLKELLQKL  478

Query  477   KARENEISMLKQDLMRAQQSLKKTDNKSQVVNDAKMEIKKLQHIIKEKTMELANCKTQIK  536
             K RENEISMLKQDL+RAQQSL+KTDNKSQVV DAKMEIKKLQ IIKEKTMEL  CKTQIK
Sbjct  479   KTRENEISMLKQDLLRAQQSLRKTDNKSQVVADAKMEIKKLQQIIKEKTMELTTCKTQIK  538

Query  537   TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELAATLQKM  596
             TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELA+TLQK+
Sbjct  539   TLQSSAKIDEEMWSKKEATITDLLRLNRQKYEEAKIASEQRYEKQLADKKQELASTLQKL  598

Query  597   DARELEFIAKNDECRHITLKLENYKDMVQQLKDQHLKSEANSEEQRRQMAESYEQKLSEL  656
             DARELEF AK +EC+H+++KL+NYKDM+QQ+K+Q+LKSE N EEQRRQMAE YEQKL++L
Sbjct  599   DARELEFNAKFEECKHLSMKLQNYKDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDL  658

Query  657   RKKVRDSQDTHRRLTMEMKEIRTERDESISSSKSTQEAKDATERNIEQILRRLNQEIASN  716
             RKKVRDSQDT+RR+TME+KEIRTE DESISSSKSTQEAK+ATERNIE+ILRRLN+EIASN
Sbjct  659   RKKVRDSQDTNRRMTMEIKEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASN  718

Query  717   NALNSEKVKLETKLKLKENDMQEVKAECQRLERELQLIECRCQLAESSLASQASPYETAP  776
             N L++EKVKLETKL+LKEN+ QEV+AEC RLERELQL ECRCQLAESSLA+Q SPYETAP
Sbjct  719   NELHAEKVKLETKLQLKENETQEVRAECHRLERELQLAECRCQLAESSLATQVSPYETAP  778

Query  777   GSLTELNVVEDQLRADLEAAKESENHQKGRADQLQALVTKLEQMLERFNEQSLSPTKSHS  836
             GSLTELN +EDQLRADL AAKESENHQKGRADQLQ LVTKLEQMLERFNEQSLSPTKSHS
Sbjct  779   GSLTELNAIEDQLRADLLAAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHS  838

Query  837   ARKPGTETVGDMLERQNEKLEDKLAAVQEQMIVERQAARTANLSLWKVEKQLEEALSEKK  896
             +RK   ETVGDMLERQNEKLEDKLAAV+EQMIVERQAARTANLSLWKVEKQLEEALSEKK
Sbjct  839   SRKQEGETVGDMLERQNEKLEDKLAAVREQMIVERQAARTANLSLWKVEKQLEEALSEKK  898

Query  897   LLARRMELTEDRIKKAQNANEESQRMLKSSQEETRQREARIEELKQELAAAKRDVLKEHR  956
             LLARRMELTEDRIKK QNA++E+QRMLK+SQEETRQRE+RIEELKQELAAAKRDVLKEHR
Sbjct  899   LLARRMELTEDRIKKVQNASDEAQRMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHR  958

Query  957   QWEKAEQERMKCKSEIIEHLANVHKLQQQETEVRQKLKQVQARFDGLTLENKNTLRELQE  1016
             QWEKAEQERMKCKSEIIEHLANVH+L+QQETE+RQKL+Q+Q+RFDG+TLE KNT+RELQE
Sbjct  959   QWEKAEQERMKCKSEIIEHLANVHRLEQQETELRQKLRQIQSRFDGVTLEQKNTIRELQE  1018

Query  1017  ERERCRAAADSSLSLKKELKQLTENFQRLKYACSITDNQLTEVETMLKSEQDRNKSQKSQ  1076
             ERE+ R A DS L L+KELKQLT+NFQRLKYACSITD+QLTEVETMLKSEQ+RNKSQKSQ
Sbjct  1019  EREKSRKANDSCLVLQKELKQLTDNFQRLKYACSITDSQLTEVETMLKSEQERNKSQKSQ  1078

Query  1077  LDAVYEKLRERNDQLTELRKQMAAIESEKRLAEQRAQVLASELEETRLHLKDQQKKLVSQ  1136
             LD ++EKLRERNDQLT+LRKQ+  +ESEKRLAEQRAQVLASE++E RL+LK+QQKKLV+Q
Sbjct  1079  LDTLHEKLRERNDQLTDLRKQLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQ  1138

Query  1137  QDQLVEQTNALFATQERADLLDGENANYQVQTADSVREMLNLKEENARILSELFHKKEEV  1196
             QDQLVEQTNALFATQERA+LLDG+NANY+ QTADS REM++LKEENARILSELFHKKEEV
Sbjct  1139  QDQLVEQTNALFATQERAELLDGQNANYEAQTADSNREMVSLKEENARILSELFHKKEEV  1198

Query  1197  SNLQAAVRDLESAQADLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV  1256
              NLQA +R LESAQA+LHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV
Sbjct  1199  GNLQAEIRGLESAQANLHAEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKV  1258

Query  1257  EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKLSSMLKEQIAQ  1316
             EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQK++S+LKEQ+AQ
Sbjct  1259  EDLSAKKKKTLADKLFGSSHTNKENVSPNDVESSILYRALKEELKREQKMNSLLKEQLAQ  1318

Query  1317  LNGTATLRSPRKTSAVNGDSDAPKQRPVSIAVLPRSPQKQVESLKRTASHVELKTTEKTT  1376
             LNGTATLRSPRK++AVNGDSDAPKQRPVSIA LPRSPQKQ + LKRT S VELKTT +  
Sbjct  1319  LNGTATLRSPRKSAAVNGDSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKP  1378

Query  1377  SSV---EQAHHRFELALQESKEGAADCVVCGQAIVAGSPFWKCKECKDVTHRKCRANVQG  1433
             + V    QAHHRFELALQESK  A +CVVC +A+VAGSPFWKCKECKDVTHRKCR+NVQ 
Sbjct  1379  TKVTIENQAHHRFELALQESKVDAVNCVVCEKAVVAGSPFWKCKECKDVTHRKCRSNVQS  1438

Query  1434  NCGTKQPTAPPADEDLGSIPSGSCINLDSEE-------NSDYIGTLVYSCDGPEDADQAA  1486
             +CG+ +PTAP AD DL SI S S + LDS +         +YIG+LVYS DG ED    A
Sbjct  1439  HCGSTKPTAPSAD-DLSSIQSVSSLTLDSVDVAGGTTSGGEYIGSLVYSSDGAED---QA  1494

Query  1487  RKDIEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLLHIKGIESVSCMSICLRLAKAIMV  1546
             RK+IEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRL+HI G+ESVSCMSIC RLAKAIMV
Sbjct  1495  RKEIEVNCAFEVAEQQILLLGCNTGLYAYHLDSQRLVHISGLESVSCMSICKRLAKAIMV  1554

Query  1547  DTVGEKLYQCDFRQLESRCHSSSACHKPVLETSAIELPFANRTSSEKWKLVLISDEAENA  1606
              TVGEKLYQCD+RQLESRC SSS+CHKPVLETSAIELPFANRT SEKWKLVLISDEAENA
Sbjct  1555  GTVGEKLYQCDYRQLESRCQSSSSCHKPVLETSAIELPFANRTPSEKWKLVLISDEAENA  1614

Query  1607  LDSVAIAATSTRIVILKYDLKVHMFKPVRALDTATPVTSIFFTRHSAIVTSDKFYEIDLV  1666
             LDSVAIAATSTRIVILKYDLK+HMFKPVRALDTATPVTSIFFTRHSAIV+SDKFYEIDL 
Sbjct  1615  LDSVAIAATSTRIVILKYDLKLHMFKPVRALDTATPVTSIFFTRHSAIVSSDKFYEIDLD  1674

Query  1667  NYAAEEFVDLAEKSMQNTAKWQPLTAVRISRQEYLLCFAESGVFVDEFGCRSRPYDLNWM  1726
             NYAAEEFVDL++KSM++TAK QPLTAVRISRQEYLLCFAE GVFVDEFGCRSRPYDLNW+
Sbjct  1675  NYAAEEFVDLSDKSMESTAKCQPLTAVRISRQEYLLCFAEYGVFVDEFGCRSRPYDLNWV  1734

Query  1727  YAPTGFVYREPFLFVSHYQSVQIIRLHRSFSKELANGEDNSSETSESPELQRVYLPHYMS  1786
             YAPTGFVYR+PFLF+SHYQSVQI+RLHRSFSKE+A+G DN+SE SESPELQRVYLPHYMS
Sbjct  1735  YAPTGFVYRDPFLFISHYQSVQIVRLHRSFSKEMASG-DNASENSESPELQRVYLPHYMS  1793

Query  1787  TLLANSGDVNLYTLSIDKRPCNGTQKIYHLDTIQAFKKKLNISLETISSMATTVTSGSTM  1846
             TLLANSGDVNLY ++ID+RPCNGTQKIYHLDT+QAFK+K NIS+ET+SS+AT+VT GST+
Sbjct  1794  TLLANSGDVNLYAVAIDQRPCNGTQKIYHLDTMQAFKQKFNISMETLSSVATSVTLGSTV  1853

Query  1847  TGDSV  1851
             TG+S+
Sbjct  1854  TGNSI  1858


>Q6NR17_DROME unnamed protein product
Length=1242

 Score = 2157 bits (5589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1053/1247 (84%), Positives = 1161/1247 (93%), Gaps = 15/1247 (1%)

Query  615   LKLENYKDMVQQLKDQHLKSEANSEEQRRQMAESYEQKLSELRKKVRDSQDTHRRLTMEM  674
             +KL+NYKDM+QQ+K+Q+LKSE N EEQRRQMAE YEQKL++LRKKVRDSQDT+RR+TME+
Sbjct  1     MKLQNYKDMLQQIKEQNLKSETNHEEQRRQMAELYEQKLTDLRKKVRDSQDTNRRMTMEI  60

Query  675   KEIRTERDESISSSKSTQEAKDATERNIEQILRRLNQEIASNNALNSEKVKLETKLKLKE  734
             KEIRTE DESISSSKSTQEAK+ATERNIE+ILRRLN+EIASNN L++EKVKLETKL+LKE
Sbjct  61    KEIRTELDESISSSKSTQEAKNATERNIEEILRRLNEEIASNNELHAEKVKLETKLQLKE  120

Query  735   NDMQEVKAECQRLERELQLIECRCQLAESSLASQASPYETAPGSLTELNVVEDQLRADLE  794
             N+ QEV+AEC RLERELQL ECRCQLAESSLA+Q SPYETAPGSLTELN +EDQLRADL 
Sbjct  121   NETQEVRAECHRLERELQLAECRCQLAESSLATQVSPYETAPGSLTELNAIEDQLRADLL  180

Query  795   AAKESENHQKGRADQLQALVTKLEQMLERFNEQSLSPTKSHSARKPGTETVGDMLERQNE  854
             AAKESENHQKGRADQLQ LVTKLEQMLERFNEQSLSPTKSHS+RK   ETVGDMLERQNE
Sbjct  181   AAKESENHQKGRADQLQTLVTKLEQMLERFNEQSLSPTKSHSSRKQEGETVGDMLERQNE  240

Query  855   KLEDKLAAVQEQMIVERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKAQN  914
             KLEDKLAAV+EQMIVERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKK QN
Sbjct  241   KLEDKLAAVREQMIVERQAARTANLSLWKVEKQLEEALSEKKLLARRMELTEDRIKKVQN  300

Query  915   ANEESQRMLKSSQEETRQREARIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEIIE  974
             A++E+QRMLK+SQEETRQRE+RIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEIIE
Sbjct  301   ASDEAQRMLKTSQEETRQRESRIEELKQELAAAKRDVLKEHRQWEKAEQERMKCKSEIIE  360

Query  975   HLANVHKLQQQETEVRQKLKQVQARFDGLTLENKNTLRELQEERERCRAAADSSLSLKKE  1034
             HLANVH+L+QQETE+RQKL+Q+Q+RFDG+TLE KNT+RELQEERE+ R A DS L L+KE
Sbjct  361   HLANVHRLEQQETELRQKLRQIQSRFDGVTLEQKNTIRELQEEREKSRKANDSCLVLQKE  420

Query  1035  LKQLTENFQRLKYACSITDNQLTEVETMLKSEQDRNKSQKSQLDAVYEKLRERNDQLTEL  1094
             LKQLT+NFQRLKYACSITD+QLTEVETMLKSEQ+RNKSQKSQLD ++EKLRERNDQLT+L
Sbjct  421   LKQLTDNFQRLKYACSITDSQLTEVETMLKSEQERNKSQKSQLDTLHEKLRERNDQLTDL  480

Query  1095  RKQMAAIESEKRLAEQRAQVLASELEETRLHLKDQQKKLVSQQDQLVEQTNALFATQERA  1154
             RKQ+  +ESEKRLAEQRAQVLASE++E RL+LK+QQKKLV+QQDQLVEQTNALFATQERA
Sbjct  481   RKQLTTVESEKRLAEQRAQVLASEIDELRLNLKEQQKKLVAQQDQLVEQTNALFATQERA  540

Query  1155  DLLDGENANYQVQTADSVREMLNLKEENARILSELFHKKEEVSNLQAAVRDLESAQADLH  1214
             +LLDG+NANY+ QTADS REM++LKEENARILSELFHKKEEV NLQA +R LESAQA+LH
Sbjct  541   ELLDGQNANYEAQTADSNREMVSLKEENARILSELFHKKEEVGNLQAEIRGLESAQANLH  600

Query  1215  AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSAKKKKTLADKLFGS  1274
             AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSAKKKKTLADKLFGS
Sbjct  601   AEIDSLQDTLAEKEQFYVQRDIKSNATLAQHKKLIDYLQLKVEDLSAKKKKTLADKLFGS  660

Query  1275  SHTNKENVSPNDVESSILYRALKEELKREQKLSSMLKEQIAQLNGTATLRSPRKTSAVNG  1334
             SHTNKENVSPNDVESSILYRALKEELKREQK++S+LKEQ+AQLNGTATLRSPRK++AVNG
Sbjct  661   SHTNKENVSPNDVESSILYRALKEELKREQKMNSLLKEQLAQLNGTATLRSPRKSAAVNG  720

Query  1335  DSDAPKQRPVSIAVLPRSPQKQVESLKRTASHVELKTTEKTTSSV---EQAHHRFELALQ  1391
             DSDAPKQRPVSIA LPRSPQKQ + LKRT S VELKTT +  + V    QAHHRFELALQ
Sbjct  721   DSDAPKQRPVSIAALPRSPQKQQQPLKRTTSQVELKTTAEKPTKVTIENQAHHRFELALQ  780

Query  1392  ESKEGAADCVVCGQAIVAGSPFWKCKECKDVTHRKCRANVQGNCGTKQPTAPPADEDLGS  1451
             ESK  A +CVVC +A+VAGSPFWKCKECKDVTHRKCR+NVQ +CG+ +PTAP AD DL S
Sbjct  781   ESKVDAVNCVVCEKAVVAGSPFWKCKECKDVTHRKCRSNVQSHCGSTKPTAPSAD-DLSS  839

Query  1452  IPSGSCINLDSEE-------NSDYIGTLVYSCDGPEDADQAARKDIEVNCAFEVAEQQIL  1504
             I S S + LDS +         +YIG+LVYS DG ED    ARK+IEVNCAFEVAEQQIL
Sbjct  840   IQSVSSLTLDSVDVAGGTTSGGEYIGSLVYSSDGAED---QARKEIEVNCAFEVAEQQIL  896

Query  1505  LLGCNTGLYAYHLDSQRLLHIKGIESVSCMSICLRLAKAIMVDTVGEKLYQCDFRQLESR  1564
             LLGCNTGLYAYHLDSQRL+HI G+ESVSCMSIC RLAKAIMV TVGEKLYQCD+RQLESR
Sbjct  897   LLGCNTGLYAYHLDSQRLVHISGLESVSCMSICKRLAKAIMVGTVGEKLYQCDYRQLESR  956

Query  1565  CHSSSACHKPVLETSAIELPFANRTSSEKWKLVLISDEAENALDSVAIAATSTRIVILKY  1624
             C SSS+CHKPVLETSAIELPFANRT SEKWKLVLISDEAENALDSVAIAATSTRIVILKY
Sbjct  957   CQSSSSCHKPVLETSAIELPFANRTPSEKWKLVLISDEAENALDSVAIAATSTRIVILKY  1016

Query  1625  DLKVHMFKPVRALDTATPVTSIFFTRHSAIVTSDKFYEIDLVNYAAEEFVDLAEKSMQNT  1684
             DLK+HMFKPVRALDTATPVTSIFFTRHSAIV+SDKFYEIDL NYAAEEFVDL++KSM++T
Sbjct  1017  DLKLHMFKPVRALDTATPVTSIFFTRHSAIVSSDKFYEIDLDNYAAEEFVDLSDKSMEST  1076

Query  1685  AKWQPLTAVRISRQEYLLCFAESGVFVDEFGCRSRPYDLNWMYAPTGFVYREPFLFVSHY  1744
             AK QPLTAVRISRQEYLLCFAE GVFVDEFGCRSRPYDLNW+YAPTGFVYR+PFLF+SHY
Sbjct  1077  AKCQPLTAVRISRQEYLLCFAEYGVFVDEFGCRSRPYDLNWVYAPTGFVYRDPFLFISHY  1136

Query  1745  QSVQIIRLHRSFSKELANGEDNSSETSESPELQRVYLPHYMSTLLANSGDVNLYTLSIDK  1804
             QSVQI+RLHRSFSKE+A+G DN+SE SESPELQRVYLPHYMSTLLANSGDVNLY ++ID+
Sbjct  1137  QSVQIVRLHRSFSKEMASG-DNASENSESPELQRVYLPHYMSTLLANSGDVNLYAVAIDQ  1195

Query  1805  RPCNGTQKIYHLDTIQAFKKKLNISLETISSMATTVTSGSTMTGDSV  1851
             RPCNGTQKIYHLDT+QAFK+K NIS+ET+SS+AT+VT GST+TG+S+
Sbjct  1196  RPCNGTQKIYHLDTMQAFKQKFNISMETLSSVATSVTLGSTVTGNSI  1242



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016414.1 guanine nucleotide exchange factor subunit Rich
[Drosophila kikkawai]

Length=1441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RIC1_DROME  unnamed protein product                                   2596    0.0  
Q382D3_TRYB2  unnamed protein product                                 53.1    2e-06
Q5U117_DROME  unnamed protein product                                 34.7    0.70 


>RIC1_DROME unnamed protein product
Length=1429

 Score = 2596 bits (6729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1297/1442 (90%), Positives = 1351/1442 (94%), Gaps = 14/1442 (1%)

Query  1     MYFPVGWPKRVGLALPGEGACIRHICCDAVKILVAAVGDDFLGIWYANPLIPIAYFRRSQ  60
             MY+PVGWPKRVGLALPGE A IRHICCDAVKILVAAVGDDFLGIWYANPLIPIAYFRR++
Sbjct  1     MYYPVGWPKRVGLALPGESASIRHICCDAVKILVAAVGDDFLGIWYANPLIPIAYFRRTE  60

Query  61    DSLRQYGSNQLIVWKPDSRQLAVLSAGGALLLYQLDFDANGSGILLQVDPPAASLKRDSA  120
             DSLRQYG+NQLIVWKPDSRQLA+L+A G+LLLYQLDF+ANG GIL Q+DPPAASLKRDSA
Sbjct  61    DSLRQYGANQLIVWKPDSRQLALLTASGSLLLYQLDFEANGMGILQQIDPPAASLKRDSA  120

Query  121   ELFIKENIPRLSLRELCSVTLGSVITTVCCISLSELLLATQSCELLRLQWAQLEQAENEL  180
             ELFIKENIPRLSLRELCSVTLGSVITTVCCISLSELLLATQSCELLRLQW +LE AEN+L
Sbjct  121   ELFIKENIPRLSLRELCSVTLGSVITTVCCISLSELLLATQSCELLRLQWTELEHAENDL  180

Query  181   EVPALAAIKLRDIPFYVQQQQAQQGSARNVPPLSRDSYVASLEYSPFIGGCAAVFSDRRA  240
             E+PAL++IKLRDIPFYVQQQ  Q  SARNVPPL+RDSYVASLEYSPFIGGCAAVFSDRRA
Sbjct  181   ELPALSSIKLRDIPFYVQQQPQQ--SARNVPPLNRDSYVASLEYSPFIGGCAAVFSDRRA  238

Query  241   AFLIANHLKFETDHMHGFWVPDVEDASVCSVNHKFRLLAYGQESSGVNVYAIDDATGGLE  300
             AFLIANHL+FETDHMHGFWVPDVEDASVCSVNHKFRLLAYGQESS V VYAIDDATGGLE
Sbjct  239   AFLIANHLRFETDHMHGFWVPDVEDASVCSVNHKFRLLAYGQESSAVKVYAIDDATGGLE  298

Query  301   FSHRLMLTENVLPGSLGAVNELKWSPDGCVLAVSWTNGGLSLWSTFGALLMSTLSWDFGL  360
             FSHRL+LTEN+LP SLG+VNELKWSPDGCVLAVSWTNGGLSLWSTFGALLMSTLSWDFGL
Sbjct  299   FSHRLILTENILPDSLGSVNELKWSPDGCVLAVSWTNGGLSLWSTFGALLMSTLSWDFGL  358

Query  361   NVDLLRQNPLKLRRLEWSTEGYQLFMLTQEQLQGSRDKEQSNVLQLQFVKSALSMNPCMT  420
             NVDL+ QNPLK+RRLEWSTEGYQLFML   +L   +DK  SNVLQLQFVKSALSMNPCMT
Sbjct  359   NVDLVCQNPLKIRRLEWSTEGYQLFML---KLHPEKDK--SNVLQLQFVKSALSMNPCMT  413

Query  421   TNPHILLQGDDCLYLNQGNNLERTYAGSQSTFPSSG-SSDQATATDSDSDCLELKQSPHT  479
             T+PHILLQGDDCLYLNQGNNLE TYAGS  TFPSSG  SD+  +   D DCLELKQSPHT
Sbjct  414   TSPHILLQGDDCLYLNQGNNLELTYAGSHGTFPSSGLGSDEDIS--GDGDCLELKQSPHT  471

Query  480   GSILTESKYWTVLQLPLNYAATNWPIRYAAIDADGLHLAVAGRTGLAHYSLVNRRWKLFG  539
             GSILTESKYWTVLQLPLNYAATNWPIRYAAID DGLHLAVAGRTGLAHYSLV RRWKLFG
Sbjct  472   GSILTESKYWTVLQLPLNYAATNWPIRYAAIDPDGLHLAVAGRTGLAHYSLVTRRWKLFG  531

Query  540   NESQEKDFVVSGGLLWWQGFVVMGCYSLLDRTDELRCYPAECKLDNQFGHKLQVRAPVIS  599
             NESQEKDFVVSGGLLWW GFVVMGCYSLLDRTDELRCYPA+CKLDNQ+GHKLQVRAPVIS
Sbjct  532   NESQEKDFVVSGGLLWWHGFVVMGCYSLLDRTDELRCYPADCKLDNQYGHKLQVRAPVIS  591

Query  600   LNSFRHQLIVLTADGIVSLFNMTKKSAYALDIECAYELDVKSICIHPACIVSLTVTNLKN  659
             LNSFRHQLIVLTADGIVSLFNM+K SAYALDIECAYELDVKSICIHPACIVSLTVTNLKN
Sbjct  592   LNSFRHQLIVLTADGIVSLFNMSKNSAYALDIECAYELDVKSICIHPACIVSLTVTNLKN  651

Query  660   ELKPQGQQLAEQAETIIVNVCGRILMIQRDAGEQVPNTLLATCLASCVEVFWLSHSLERC  719
             ELKPQGQ   +QAETIIVNVCGRILMIQRDAGEQVPNTLLATCLASCVEVFWLSHSLERC
Sbjct  652   ELKPQGQLGGDQAETIIVNVCGRILMIQRDAGEQVPNTLLATCLASCVEVFWLSHSLERC  711

Query  720   AMRDCLWLYSGAHGMRVWLPILPPGRERREGEQGGAQRLHSFMSKRIMLGFPLKLYPLVV  779
             AMRDCLWLYSGAHGMRVWLPILPPGRERREGEQGGAQRLHSFMSKRIML FPLKLYPLVV
Sbjct  712   AMRDCLWLYSGAHGMRVWLPILPPGRERREGEQGGAQRLHSFMSKRIMLSFPLKLYPLVV  771

Query  780   LFDNVIVLGVENESTLYANEEGSHFSLPFATMERKSQIYLHKVLRQLIKRNLGYSAWEIA  839
             LFDNVIVLGVENESTLYANE+ SHFSLPFA MERKSQIYLHKVLRQLIKRNLGYSAWE+A
Sbjct  772   LFDNVIVLGVENESTLYANEQVSHFSLPFAVMERKSQIYLHKVLRQLIKRNLGYSAWEMA  831

Query  840   QSCRSLPYFPHALELLLHEVLEEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKT  899
             QSC SLPYFPHALELLLHEVLEEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKT
Sbjct  832   QSCCSLPYFPHALELLLHEVLEEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKT  891

Query  900   EIALWPYLFSMAGKPKELFQLCLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQ  959
             EIALWPYLFSMAGKPK+LFQ+CLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQ
Sbjct  892   EIALWPYLFSMAGKPKDLFQMCLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQ  951

Query  960   QRKWELAKDLIRFLKAIDPNEIDSPRSSMVVNVKIAPPPQVNTQQQVNQNADAFNMVLGP  1019
             QRKWELAKDLIRFLKAIDPNEIDSPRSSMVVNVKIAPPPQVNTQQQVNQNADAFNMVLGP
Sbjct  952   QRKWELAKDLIRFLKAIDPNEIDSPRSSMVVNVKIAPPPQVNTQQQVNQNADAFNMVLGP  1011

Query  1020  IARERSFSTTVTSNLPKDKQALPGAGVPPVAESSSSGPPTVVRRRSTKQRETFCIDLILQ  1079
             IARERSFSTTVTSNLPKDKQA    GV PV ESSS+G P+VVRRRSTKQRETFCIDLILQ
Sbjct  1012  IARERSFSTTVTSNLPKDKQASGTPGVAPVTESSSAGAPSVVRRRSTKQRETFCIDLILQ  1071

Query  1080  RHARQLLQNHKLMDLGYMCAYLDFHLVTWLSQEAEKAAKLDDFAGALLALHAELQLPSPF  1139
             RHARQLLQNHKLMDLGYMCAYLDFHLV+WLSQE+E+AAKLDDFAGAL ALH EL LP PF
Sbjct  1072  RHARQLLQNHKLMDLGYMCAYLDFHLVSWLSQESERAAKLDDFAGALQALHEELDLPIPF  1131

Query  1140  PPPSKDDFAQLRGSHRQAGGGGSSSQTSESGYFSLATPNGAATQSPQLQPSIKEEEAEEP  1199
             P  +KDDFAQ+RGS RQ GGGG SSQTSESGYFSLATPNGAATQSPQLQPSI+EEE EE 
Sbjct  1132  PTAAKDDFAQIRGSLRQTGGGG-SSQTSESGYFSLATPNGAATQSPQLQPSIREEE-EEL  1189

Query  1200  QQPSSLPVLKTRSESQLSFDNFRYRRLYSLPASEDDLAVDPLPAKLSIKLRYLLQLFSEA  1259
             QQPSSLP+LKTRS SQLSFDNFRYRRLYSLP SEDDLAVD LP KLSIKLRYLLQLF EA
Sbjct  1190  QQPSSLPILKTRSGSQLSFDNFRYRRLYSLPTSEDDLAVDILPQKLSIKLRYLLQLFIEA  1249

Query  1260  NCTDYALVLSILLQDAASISRIVNGIIRSESVHTCRRTETALKQLSHSTFEHSGSLYRGF  1319
             NCTDYALVLSILLQDAASISRIVNGIIRSESVHTCRRTE+ALKQLS STFEHSGSLYRGF
Sbjct  1250  NCTDYALVLSILLQDAASISRIVNGIIRSESVHTCRRTESALKQLSQSTFEHSGSLYRGF  1309

Query  1320  VLTLQPHIYLLEQYIQSLGDAANTPLQDVGTASEQGVDAVTGIHELEDEEEDFVPKSQQA  1379
             VLTLQPH+YLLEQYIQSLGDA  + LQD G  +EQGVD  TG+  L++E  +FVP SQQA
Sbjct  1310  VLTLQPHVYLLEQYIQSLGDAPCSQLQDAGPGTEQGVDVSTGLQGLQNEVGEFVPNSQQA  1369

Query  1380  NGNQWMVTTADLRPNHQRLTRHASLESNGNATMVSGSSAQSTPTQRQMPRQSSGEREGCR  1439
             NGNQW  T ADL PNHQRLTRHASLESNGNA + SGSSA STPTQRQ+ RQ+S EREGCR
Sbjct  1370  NGNQW--TVADLNPNHQRLTRHASLESNGNAVVASGSSAHSTPTQRQLSRQNSREREGCR  1427

Query  1440  LM  1441
             LM
Sbjct  1428  LM  1429


>Q382D3_TRYB2 unnamed protein product
Length=1248

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 55/113 (49%), Gaps = 6/113 (5%)

Query  467  DSDCLELKQSPHTGSILTESKYWTVLQLPLNYAATNWPIRYAAIDADGLHLAVAGRTGLA  526
            D   L   +  HT   L  S   TVL  P  YA  N PI Y AI +DG  +A+AGR G  
Sbjct  412  DGSKLRFIEQQHTDGSLAFSD--TVLLNP-RYAVENNPITYGAISSDGSVVALAGRNGFL  468

Query  527  HYSLVNRRWKLFGNESQEKDFVVSGGLLWWQGFVVMGCYSLLDRTD--ELRCY  577
             +  + RRW+   +  +E++F      +W +  +V+     L+RT   ELR Y
Sbjct  469  LFDRLARRWRTMRDRKEEREFTCVAQPVWVKDLMVVFPVR-LERTHEYELRVY  520


 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 16/129 (12%)

Query  861  EEEATSKQPIPDAQLPSILDFIREFPVYLETIVQCARKTEIALWPYLFSMAGKPKELFQL  920
            E  + S    P + L   L  ++ +P Y   +V C RK E+   P +    G  K+LF  
Sbjct  844  ETSSLSDSEDPCSMLRLTLSLLQRYPEYHRIVVNCLRKLELPCCPVVVDNIGSTKKLFVS  903

Query  921  CLQSEQLDTAASYLII-------------LQNLEPSVVSKQYATMLLDIALQQRKWELAK  967
            CL+  +L+ AA  L +             L  L  ++V    AT +L +A+  +K +L  
Sbjct  904  CLEESRLEEAAHLLHLIMVDDGEGGKNGSLDTLRQTLVC---ATRILMLAVSCKKVQLIY  960

Query  968  DLIRFLKAI  976
             L+ F+  I
Sbjct  961  TLLPFMALI  969


>Q5U117_DROME unnamed protein product
Length=639

 Score = 34.7 bits (78),  Expect = 0.70, Method: Compositional matrix adjust.
 Identities = 21/85 (25%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query  919   QLCLQSEQLDTAASYLIILQNLEPSVVSKQYATMLLDIALQQRKWELAKDLIRFLKAIDP  978
             QLC Q E LDT   ++        ++   Q+A   ++  +++ +  L      F K +D 
Sbjct  441   QLCTQGESLDTLGMFI--------ALTGLQHAGQAMNTGVRKSRNPLFNPGHIFGKFLDN  492

Query  979   NEIDSPRSSMVVNVKIAPPPQVNTQ  1003
             N ID+P++ M ++  + P  +   Q
Sbjct  493   NSIDNPKTKMQLSEHVHPSLEAAAQ  517



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016415.1 myb-like protein Q [Drosophila kikkawai]

Length=512


***** No hits found *****



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016416.1 probable fumarate hydratase, mitochondrial
[Drosophila kikkawai]

Length=470
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8IRQ5_DROME  unnamed protein product                                 696     0.0  
Q9W3X6_DROME  unnamed protein product                                 696     0.0  
Q8SXM1_DROME  unnamed protein product                                 694     0.0  


>Q8IRQ5_DROME unnamed protein product
Length=467

 Score = 696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/465 (71%), Positives = 391/465 (84%), Gaps = 2/465 (0%)

Query  6    SGEMRQESDSLGPMEVPMDRYYGAQTMRCVLNFRIGGEEERMPRQIVQAIGILKKAAAET  65
            S E R ESD+ G ++VP D+YYGAQTMR  +NF IGG  ERMP+ +VQA+GILKKAAAE 
Sbjct  3    SQEFRVESDTFGELKVPADKYYGAQTMRSQINFPIGGATERMPKPVVQAMGILKKAAAEV  62

Query  66   NQEFGLDPKLSTAISNAADDVISGKLYDEGHFPLPIWQAGSGTQSNMNTNEVIGNRAIEM  125
            N+EFGLD K+S AIS AADDVISGKLYD+ HFPL IWQ GSGTQSNMN NEVI NRAIE+
Sbjct  63   NKEFGLDSKVSEAISKAADDVISGKLYDD-HFPLVIWQTGSGTQSNMNVNEVISNRAIEL  121

Query  126  LGGRVGSKDPIHPNDHVNMSQSSNDTFPSAIHIAVASGLNKELRPAITALRDSMQSKTNE  185
            LGG++GSK P+HPNDHVN SQSSNDTFP+AIHI+VA  LN  L+PAI  L D++++K+ E
Sbjct  122  LGGKLGSKTPVHPNDHVNKSQSSNDTFPTAIHISVALELNNNLKPAIKTLHDALRAKSEE  181

Query  186  WKDIIKIGRTHVQDSVPMTLGQEFSGYTQQLTNGLARIEAVLPRIYQLALGGTAVGTGLN  245
            +KDIIKIGRTH  D+VP+TLGQEFSGY QQL     RI+A LPR+Y+LALGGTAVGTGLN
Sbjct  182  FKDIIKIGRTHTMDAVPLTLGQEFSGYAQQLAYAQERIDACLPRVYELALGGTAVGTGLN  241

Query  246  CRRGFPEKCIKRIAQLTGLPFVVAPNFFEALASRDAMVEVHGALNVLAVSLMKIANDIRL  305
             R+GF EKC  +IA+LT LPFV APN FEALA+RDAMVEVHG LN +AVSLMKIANDIR 
Sbjct  242  TRKGFAEKCAAKIAELTSLPFVTAPNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRF  301

Query  306  MGSGPRCGLGEVHLPENEPGSSIMPGKVNPTQCEALTMICAQVMGNHVAVSVGGANGNFE  365
            +GSGPRCGLGE+ LPENEPGSSIMPGKVNPTQCE+LTM+ AQVMGN VAV++GG+NG+FE
Sbjct  302  LGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCESLTMLSAQVMGNQVAVTIGGSNGHFE  361

Query  366  LNVFKPLIVSNVLRSIKLLTDGCRSFNLNCVKGIKPNKDKLASNVNQSLSLAPALCPNIG  425
            LNVFKPLIVSNVLRSI+LL+DG R+F  NCV GI+ N++ +A  +N+SL L  AL P+IG
Sbjct  362  LNVFKPLIVSNVLRSIRLLSDGSRTFTANCVNGIQANRENIAKIMNESLMLVTALNPHIG  421

Query  426  CDKTTQIVKSAHQNGTTVKEEALKAG-ITEKDYNEWVRVDKMLGP  469
             DK  +I K+AH+NGTT+KEEA+  G +TE+ +N+WVR ++MLGP
Sbjct  422  YDKAAKIAKTAHKNGTTLKEEAINLGYLTEQQFNDWVRPEQMLGP  466


>Q9W3X6_DROME unnamed protein product
Length=495

 Score = 696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/465 (71%), Positives = 391/465 (84%), Gaps = 2/465 (0%)

Query  6    SGEMRQESDSLGPMEVPMDRYYGAQTMRCVLNFRIGGEEERMPRQIVQAIGILKKAAAET  65
            S E R ESD+ G ++VP D+YYGAQTMR  +NF IGG  ERMP+ +VQA+GILKKAAAE 
Sbjct  31   SQEFRVESDTFGELKVPADKYYGAQTMRSQINFPIGGATERMPKPVVQAMGILKKAAAEV  90

Query  66   NQEFGLDPKLSTAISNAADDVISGKLYDEGHFPLPIWQAGSGTQSNMNTNEVIGNRAIEM  125
            N+EFGLD K+S AIS AADDVISGKLYD+ HFPL IWQ GSGTQSNMN NEVI NRAIE+
Sbjct  91   NKEFGLDSKVSEAISKAADDVISGKLYDD-HFPLVIWQTGSGTQSNMNVNEVISNRAIEL  149

Query  126  LGGRVGSKDPIHPNDHVNMSQSSNDTFPSAIHIAVASGLNKELRPAITALRDSMQSKTNE  185
            LGG++GSK P+HPNDHVN SQSSNDTFP+AIHI+VA  LN  L+PAI  L D++++K+ E
Sbjct  150  LGGKLGSKTPVHPNDHVNKSQSSNDTFPTAIHISVALELNNNLKPAIKTLHDALRAKSEE  209

Query  186  WKDIIKIGRTHVQDSVPMTLGQEFSGYTQQLTNGLARIEAVLPRIYQLALGGTAVGTGLN  245
            +KDIIKIGRTH  D+VP+TLGQEFSGY QQL     RI+A LPR+Y+LALGGTAVGTGLN
Sbjct  210  FKDIIKIGRTHTMDAVPLTLGQEFSGYAQQLAYAQERIDACLPRVYELALGGTAVGTGLN  269

Query  246  CRRGFPEKCIKRIAQLTGLPFVVAPNFFEALASRDAMVEVHGALNVLAVSLMKIANDIRL  305
             R+GF EKC  +IA+LT LPFV APN FEALA+RDAMVEVHG LN +AVSLMKIANDIR 
Sbjct  270  TRKGFAEKCAAKIAELTSLPFVTAPNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRF  329

Query  306  MGSGPRCGLGEVHLPENEPGSSIMPGKVNPTQCEALTMICAQVMGNHVAVSVGGANGNFE  365
            +GSGPRCGLGE+ LPENEPGSSIMPGKVNPTQCE+LTM+ AQVMGN VAV++GG+NG+FE
Sbjct  330  LGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCESLTMLSAQVMGNQVAVTIGGSNGHFE  389

Query  366  LNVFKPLIVSNVLRSIKLLTDGCRSFNLNCVKGIKPNKDKLASNVNQSLSLAPALCPNIG  425
            LNVFKPLIVSNVLRSI+LL+DG R+F  NCV GI+ N++ +A  +N+SL L  AL P+IG
Sbjct  390  LNVFKPLIVSNVLRSIRLLSDGSRTFTANCVNGIQANRENIAKIMNESLMLVTALNPHIG  449

Query  426  CDKTTQIVKSAHQNGTTVKEEALKAG-ITEKDYNEWVRVDKMLGP  469
             DK  +I K+AH+NGTT+KEEA+  G +TE+ +N+WVR ++MLGP
Sbjct  450  YDKAAKIAKTAHKNGTTLKEEAINLGYLTEQQFNDWVRPEQMLGP  494


>Q8SXM1_DROME unnamed protein product
Length=495

 Score = 694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/465 (71%), Positives = 391/465 (84%), Gaps = 2/465 (0%)

Query  6    SGEMRQESDSLGPMEVPMDRYYGAQTMRCVLNFRIGGEEERMPRQIVQAIGILKKAAAET  65
            S E R ESD+ G ++VP D+YYGAQTMR  +NF IGG  ERMP+ +VQA+GILKKAAAE 
Sbjct  31   SQEFRVESDTFGELKVPADKYYGAQTMRSQINFPIGGATERMPKPVVQAMGILKKAAAEV  90

Query  66   NQEFGLDPKLSTAISNAADDVISGKLYDEGHFPLPIWQAGSGTQSNMNTNEVIGNRAIEM  125
            N+EFGLD K+S AIS AADDVISGKLYD+ HFPL IWQ GSGTQSNMN NEVI NRAIE+
Sbjct  91   NKEFGLDSKVSEAISKAADDVISGKLYDD-HFPLVIWQTGSGTQSNMNVNEVISNRAIEL  149

Query  126  LGGRVGSKDPIHPNDHVNMSQSSNDTFPSAIHIAVASGLNKELRPAITALRDSMQSKTNE  185
            LGG++GSK P+HPNDHVN SQSSNDTFP+AIHI+VA  LN  L+PAI  L D++++K+ E
Sbjct  150  LGGKLGSKTPVHPNDHVNKSQSSNDTFPTAIHISVALELNNNLKPAIKTLHDALRAKSEE  209

Query  186  WKDIIKIGRTHVQDSVPMTLGQEFSGYTQQLTNGLARIEAVLPRIYQLALGGTAVGTGLN  245
            +KDIIKIGRTH  D+VP+TLGQEFSGY QQL     RI+A LPR+Y+LALGGTAVGTGLN
Sbjct  210  FKDIIKIGRTHTMDAVPLTLGQEFSGYAQQLAYAQERIDACLPRVYELALGGTAVGTGLN  269

Query  246  CRRGFPEKCIKRIAQLTGLPFVVAPNFFEALASRDAMVEVHGALNVLAVSLMKIANDIRL  305
             R+GF EKC  +IA+LT LPFV APN FEALA+RDAMVEVHG LN +AVSLMKIANDIR 
Sbjct  270  TRKGFAEKCAAKIAELTSLPFVTAPNKFEALAARDAMVEVHGVLNTIAVSLMKIANDIRF  329

Query  306  MGSGPRCGLGEVHLPENEPGSSIMPGKVNPTQCEALTMICAQVMGNHVAVSVGGANGNFE  365
            +GSGPRCGLGE+ LPENEPGSSIMPGKVNPTQCE+LTM+ AQVMGN VAV++GG+NG+FE
Sbjct  330  LGSGPRCGLGELSLPENEPGSSIMPGKVNPTQCESLTMLSAQVMGNLVAVTIGGSNGHFE  389

Query  366  LNVFKPLIVSNVLRSIKLLTDGCRSFNLNCVKGIKPNKDKLASNVNQSLSLAPALCPNIG  425
            LNVFKPLIVSNVLRSI+LL+DG R+F  NCV GI+ N++ +A  +N+SL L  AL P+IG
Sbjct  390  LNVFKPLIVSNVLRSIRLLSDGSRTFTANCVNGIQANRENIAKIMNESLMLVTALNPHIG  449

Query  426  CDKTTQIVKSAHQNGTTVKEEALKAG-ITEKDYNEWVRVDKMLGP  469
             DK  +I K+AH+NGTT+KEEA+  G +TE+ +N+WVR ++MLGP
Sbjct  450  YDKAAKIAKTAHKNGTTLKEEAINLGYLTEQQFNDWVRPEQMLGP  494



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016417.1 galactose mutarotase [Drosophila kikkawai]

Length=377
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VRU1_DROME  unnamed protein product                                 373     2e-128
Q8MT28_DROME  unnamed protein product                                 372     9e-128
PARP_DROME  unnamed protein product                                   30.8    2.0   


>Q9VRU1_DROME unnamed protein product
Length=364

 Score = 373 bits (958),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/364 (49%), Positives = 250/364 (69%), Gaps = 4/364 (1%)

Query  3    IQLEEEIFG-LAVNPFTKSPEMVRRYTLRNSKGMSVSVIQLGAIIQSVSLPDAYDKVDDV  61
            + + E++F   AVNPFTKS + ++R+TL N  GMSV +I  GA I S+  PDA  ++DDV
Sbjct  2    VNVTEDVFANGAVNPFTKSKDTIKRFTLTNGAGMSVQLITRGATITSIKTPDASGQIDDV  61

Query  62   CLGFEDIASYLATKSAYIGGTLGRVANRVANGEYEVNDTKVKVTKNFQDKYQLHGGFVGF  121
             LGF+D+A Y + ++ Y G T+GRV NR+ANG + ++   V+V+KN  +K+QLHGGFVGF
Sbjct  62   TLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGKLVQVSKNRDNKFQLHGGFVGF  121

Query  122  DSVIWEVVQKSEEGVVFRHMSRHNHEGYPGNLKCLITYSLDEENRLWVRFEATTDRSTMV  181
            D   WEVV+   +GV   H +   HEGYPG +    +++L E+N L V+  A  D++T V
Sbjct  122  DKAHWEVVEVRVDGVTLSHTNPDGHEGYPGKVTATASFTLSEDNCLHVQMSALADKTTPV  181

Query  182  NISNHAYFNLAGHGAGAKGLAEHTVEIASDRIVETDGDQIPTGKLVSVDDTVYDLRLPVL  241
            N++NH+YFNLAGH +GA GL EHT+EI +  I ETD   IPTG++  V+ T +DLR+   
Sbjct  182  NLTNHSYFNLAGHKSGANGLYEHTIEINAYGITETDQSSIPTGRITPVEGTGFDLRVSSN  241

Query  242  IGDRLRQFEDRPIKGYDNCFVINDGQMQKSVNKVAKIVHPPSCRVLEVWTNQPGMQFYTA  301
            +G+RL+  +  P +GYD+ F +     Q  + KVA+  HPPS R LEV +NQPG+QFYT+
Sbjct  242  LGERLKALQ--PARGYDDNFCVTFSPPQP-LAKVARATHPPSGRWLEVVSNQPGVQFYTS  298

Query  302  NNLPDEKKGDAPMIGKDCIHYSKHGSFCVETEKFPDSMNHPEFPSISLEPNEKYLHEVMY  361
            N +PD ++G++P+ GKD   Y+KH +FC+ET+KFPDS+NH  FPS  L P E Y HEV+Y
Sbjct  299  NFMPDVERGESPIPGKDGAAYAKHCAFCLETQKFPDSVNHSNFPSTILRPGESYQHEVIY  358

Query  362  WFKV  365
             F V
Sbjct  359  KFGV  362


>Q8MT28_DROME unnamed protein product
Length=364

 Score = 372 bits (954),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 177/365 (48%), Positives = 250/365 (68%), Gaps = 4/365 (1%)

Query  3    IQLEEEIFG-LAVNPFTKSPEMVRRYTLRNSKGMSVSVIQLGAIIQSVSLPDAYDKVDDV  61
            + + E++F   AVNPFTKS + ++R+TL N  GMSV +I  GA I S+  PDA  ++DDV
Sbjct  2    VNVTEDVFANGAVNPFTKSKDTIKRFTLTNGAGMSVQLITRGATITSIKTPDASGQIDDV  61

Query  62   CLGFEDIASYLATKSAYIGGTLGRVANRVANGEYEVNDTKVKVTKNFQDKYQLHGGFVGF  121
             LGF+D+A Y + ++ Y G T+GRV NR+ANG + ++   V+V+KN  +K+QLHGGFVGF
Sbjct  62   TLGFDDLAGYQSERNPYFGATIGRVCNRIANGSFYLDGKLVQVSKNRDNKFQLHGGFVGF  121

Query  122  DSVIWEVVQKSEEGVVFRHMSRHNHEGYPGNLKCLITYSLDEENRLWVRFEATTDRSTMV  181
            D   WEVV+   +GV   H +   HEGYPG +    +++L E+N L V+  A  D++T V
Sbjct  122  DKAHWEVVEVRVDGVTLSHTNPDGHEGYPGKVTATASFTLSEDNCLHVQMSALADKTTPV  181

Query  182  NISNHAYFNLAGHGAGAKGLAEHTVEIASDRIVETDGDQIPTGKLVSVDDTVYDLRLPVL  241
            N++NH+YFNLAGH +GA GL EHT++I +  I ETD   IPTG++  V+ T +DLR+   
Sbjct  182  NLTNHSYFNLAGHKSGANGLYEHTIKINAYGITETDQSSIPTGRITPVEGTGFDLRVSSN  241

Query  242  IGDRLRQFEDRPIKGYDNCFVINDGQMQKSVNKVAKIVHPPSCRVLEVWTNQPGMQFYTA  301
            +G+RL+  +  P +GYD+ F +     Q  + KVA+  HPPS R LEV +NQPG+QFYT+
Sbjct  242  LGERLKALQ--PARGYDDNFCVTFSPPQP-LAKVARATHPPSGRWLEVVSNQPGVQFYTS  298

Query  302  NNLPDEKKGDAPMIGKDCIHYSKHGSFCVETEKFPDSMNHPEFPSISLEPNEKYLHEVMY  361
            N +PD ++G++P+ GKD   Y+KH +FC+ET+KFPDS+NH  FPS  L P E Y HEV+Y
Sbjct  299  NFMPDVERGESPIPGKDGAAYAKHCAFCLETQKFPDSVNHSNFPSTILRPGESYQHEVIY  358

Query  362  WFKVE  366
             F V 
Sbjct  359  KFGVS  363


>PARP_DROME unnamed protein product
Length=994

 Score = 30.8 bits (68),  Expect = 2.0, Method: Compositional matrix adjust.
 Identities = 38/181 (21%), Positives = 74/181 (41%), Gaps = 24/181 (13%)

Query  78   YIGGTLGRVANRVANGEYEVNDTKVKVTKNFQD--------KYQLHGGFVGFDSVIWEV-  128
            +I  + GR+   + N + E  DT     +NF++        +Y+    FV     ++ + 
Sbjct  567  WIFRSWGRIGTNIGNSKLEEFDTSESAKRNFKEIYADKTGNEYEQRDNFVKRTGRMYPIE  626

Query  129  VQKSEEGVVFRHMSRHNHEGYPGNLKCLI--TYSLDEENRLWVRFEATTDRSTMVNISNH  186
            +Q  ++  + +H S         +++ LI   + +D  N+  + F    D+  +  +S H
Sbjct  627  IQYDDDQKLVKHESHFFTSKLEISVQNLIKLIFDIDSMNKTLMEFHIDMDKMPLGKLSAH  686

Query  187  ----AY------FNLAGHGAGAKGLAEHTVEIASDRIVETDGDQIPTGKLVSVDDTVYDL  236
                AY      +N+   G+    L + T    +  I    G Q+PT  L+     + DL
Sbjct  687  QIQSAYRVVKEIYNVLECGSNTAKLIDATNRFYT-LIPHNFGVQLPT--LIETHQQIEDL  743

Query  237  R  237
            R
Sbjct  744  R  744



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016418.1 uncharacterized protein LOC108070451 [Drosophila
kikkawai]

Length=309
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RBP2A_PLAF7  unnamed protein product                                  30.0    3.1  


>RBP2A_PLAF7 unnamed protein product
Length=3130

 Score = 30.0 bits (66),  Expect = 3.1, Method: Composition-based stats.
 Identities = 26/87 (30%), Positives = 40/87 (46%), Gaps = 8/87 (9%)

Query  218   QEQEMPEEQSQEQLQ-------SESNRMLLEAARERQRQ-LIAEYNRLPISMGTLRVRNL  269
             QEQE  E + QEQLQ        E  R+  E A +RQ Q  + +   L         R  
Sbjct  2756  QEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQEQERLQKEEELKRQEQERLEREK  2815

Query  270   QRQLEQQLDVADHDVRVLSEEKANMQQ  296
             Q QL+++ ++   +   L +E+A  +Q
Sbjct  2816  QEQLQKEEELKRQEQERLQKEEALKRQ  2842


 Score = 30.0 bits (66),  Expect = 3.3, Method: Composition-based stats.
 Identities = 24/101 (24%), Positives = 49/101 (49%), Gaps = 4/101 (4%)

Query  195   DEALSMRSQTSCDLFSDSPQEQPQEQEMPEEQSQEQLQSESNRMLLEAARERQRQLIAEY  254
             +EAL  + Q   +      + + QEQE  E + QEQLQ E      E  R ++ + +   
Sbjct  2786  EEALKRQEQ---ERLQKEEELKRQEQERLEREKQEQLQKEEELKRQEQERLQKEEALKRQ  2842

Query  255   NRLPISMGTLRVRNLQRQLE-QQLDVADHDVRVLSEEKANM  294
              +  +       R  Q +LE +++++A+ +  + S+ +++M
Sbjct  2843  EQERLQKEEELKRQEQERLERKKIELAEREQHIKSKLESDM  2883



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016419.1 ankyrin repeat domain-containing protein SOWAHC
isoform X1 [Drosophila kikkawai]

Length=656
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q20KN0_CARRO  unnamed protein product                                 57.8    1e-08
X2JCM1_DROME  unnamed protein product                                 54.3    3e-07
M9MRX4_DROME  unnamed protein product                                 54.3    4e-07


>Q20KN0_CARRO unnamed protein product
Length=439

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTN-GGYTPLHLATQFGRDNIFELLWNVYK  391
            G T LH A + G+ DV++ +     ADVN +    G T LHLA +  RD++ + L N   
Sbjct  315  GQTCLHLAVQQGHMDVIRYLVQC-DADVNGKEGKSGRTSLHLAVEAQRDDLVQFLLNTCH  373

Query  392  ANRDIMDYSGNKPLDYSRQRPSVSASTCSKIK  423
            A+ +I +Y+G+ PL  +     +   TCSK+K
Sbjct  374  ADVNIQNYAGHSPLHVAWSVYQLEP-TCSKLK  404


 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 37/73 (51%), Gaps = 20/73 (27%)

Query  327  LQCPA--------TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFG  378
            +QC A        +G T+LH A +   +D+V+ +  T  ADVN +   G++PLH+A    
Sbjct  335  VQCDADVNGKEGKSGRTSLHLAVEAQRDDLVQFLLNTCHADVNIQNYAGHSPLHVA----  390

Query  379  RDNIFELLWNVYK  391
                    W+VY+
Sbjct  391  --------WSVYQ  395


>X2JCM1_DROME unnamed protein product
Length=11634

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 2/79 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G TALH A+  G E+VVKL+   + A VN ++  G+TPL++A Q   D +  LL +   A
Sbjct  77   GNTALHIASLAGQEEVVKLLL-EHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGA  134

Query  393  NRDIMDYSGNKPLDYSRQR  411
            N+ +    G  PL  + Q+
Sbjct  135  NQSLATEDGFTPLAVAMQQ  153


 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKAN  393
            YTALH AAK G ++V  ++     A ++A T  G+TPLHL  ++G   + +LL    +A+
Sbjct  503  YTALHIAAKEGQDEVAAVLIENGAA-LDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEAD  560

Query  394  RDIMDYSGNKPL  405
             D    +G  PL
Sbjct  561  VDAQGKNGVTPL  572


 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 38/64 (59%), Gaps = 1/64 (2%)

Query  331  ATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVY  390
            + GYT LH  A+ G+  +V L+   +KA+ NA+T  G TPLH+A + G  ++ + L  + 
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLL-EHKANANAQTVNGQTPLHIARKLGYISVLDSLKTIT  789

Query  391  KANR  394
            K + 
Sbjct  790  KEDE  793


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 2/79 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G T +H  A+  N +V +++     A+++  T  GYTPLH+A+ FG+ N+   L     A
Sbjct  667  GLTPMHLCAQEDNVNVAEILEKNG-ANIDMATKAGYTPLHVASHFGQANMVRFLLQ-NGA  724

Query  393  NRDIMDYSGNKPLDYSRQR  411
            N D     G  PL  + Q+
Sbjct  725  NVDAATSIGYTPLHQTAQQ  743


 Score = 47.8 bits (112),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (2%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
             TALH AA  G+  V KL+     AD NAR   G+TPLH+A +  R  + ELL 
Sbjct  338  LTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLL  390


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 38/68 (56%), Gaps = 5/68 (7%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW----  387
            +G+T LH A+ +GN+++  L+     ADVN       +PLH+A ++G+ N+  LL     
Sbjct  204  SGFTPLHIASHYGNQNIANLLIQKG-ADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG  262

Query  388  NVYKANRD  395
            N+    RD
Sbjct  263  NIEAKTRD  270


 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G+T LH  AK+G+  V +L+    +ADV+A+   G TPLH+A  +    +  LL  
Sbjct  535  GFTPLHLTAKYGHIKVAQLLL-QKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G+T LH AA+    D+   +   Y A  NA +  G+TPLHL++Q G   I  LL  
Sbjct  601  GHTPLHIAARKNQMDIATTLL-EYGALANAESKAGFTPLHLSSQEGHAEISNLLIE  655


 Score = 45.4 bits (106),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 2/73 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G+T LH A K     VV+L+   + A ++A T  G TPLH+A   G  NI   L   + A
Sbjct  370  GFTPLHIACKKNRLKVVELLL-RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDA  427

Query  393  NRDIMDYSGNKPL  405
            + D+    G  PL
Sbjct  428  SPDVPTVRGETPL  440


 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 1/54 (2%)

Query  335  TALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            T LH A++ GN D+V L+   + A V+A T   YT LH+A + G+D +  +L  
Sbjct  471  TPLHIASRLGNVDIVMLLL-QHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIE  523


 Score = 43.5 bits (101),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G T LH AA+    D+++++     A V+AR     TPLH+A++ G  +I  LL  
Sbjct  436  GETPLHLAARANQTDIIRILLRNG-AQVDARAREQQTPLHIASRLGNVDIVMLLLQ  490


 Score = 43.5 bits (101),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (53%), Gaps = 2/80 (3%)

Query  309  ANYQELAKMASEFPELVKLQCPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGY  368
            A  +E+ K+  E    V +Q    G+T L+ AA+  ++ VV+L+     A+ +  T  G+
Sbjct  87   AGQEEVVKLLLEHNASVNVQS-QNGFTPLYMAAQENHDAVVRLLLSNG-ANQSLATEDGF  144

Query  369  TPLHLATQFGRDNIFELLWN  388
            TPL +A Q G D +  +L  
Sbjct  145  TPLAVAMQQGHDKVVAVLLE  164


 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 2/68 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGR-DNIFELLWNVYK  391
            G T LH AA+ G+E VV ++     A ++A+T  G  PLH+A Q    D    LL++   
Sbjct  271  GLTPLHCAARSGHEQVVDMLL-ERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAP  329

Query  392  ANRDIMDY  399
             +   +DY
Sbjct  330  VDEVTVDY  337


 Score = 40.0 bits (92),  Expect = 0.007, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 9/57 (16%)

Query  336  ALHWAAKHGNEDVVK----LIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            ALH AAK   +D VK    L+   +  DV +++  G+TPLH+A+ +G  NI  LL  
Sbjct  175  ALHIAAK---KDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQ  226


 Score = 39.7 bits (91),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 1/52 (2%)

Query  337  LHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            LH AAK G  ++V L+      ++ A+T  G TPLH A + G + + ++L  
Sbjct  242  LHVAAKWGKTNMVSLLL-EKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLE  292


 Score = 34.3 bits (77),  Expect = 0.44, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 1/56 (2%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            +G T LH AA  G  ++V +    + A  +  T  G TPLHLA +  + +I  +L 
Sbjct  402  SGLTPLHVAAFMGCMNIV-IYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL  456


>M9MRX4_DROME unnamed protein product
Length=13559

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 2/79 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G TALH A+  G E+VVKL+   + A VN ++  G+TPL++A Q   D +  LL +   A
Sbjct  77   GNTALHIASLAGQEEVVKLLL-EHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGA  134

Query  393  NRDIMDYSGNKPLDYSRQR  411
            N+ +    G  PL  + Q+
Sbjct  135  NQSLATEDGFTPLAVAMQQ  153


 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKAN  393
            YTALH AAK G ++V  ++     A ++A T  G+TPLHL  ++G   + +LL    +A+
Sbjct  503  YTALHIAAKEGQDEVAAVLIENGAA-LDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEAD  560

Query  394  RDIMDYSGNKPL  405
             D    +G  PL
Sbjct  561  VDAQGKNGVTPL  572


 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/64 (36%), Positives = 38/64 (59%), Gaps = 1/64 (2%)

Query  331  ATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVY  390
            + GYT LH  A+ G+  +V L+   +KA+ NA+T  G TPLH+A + G  ++ + L  + 
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLL-EHKANANAQTVNGQTPLHIARKLGYISVLDSLKTIT  789

Query  391  KANR  394
            K + 
Sbjct  790  KEDE  793


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 2/79 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G T +H  A+  N +V +++     A+++  T  GYTPLH+A+ FG+ N+   L     A
Sbjct  667  GLTPMHLCAQEDNVNVAEILEKNG-ANIDMATKAGYTPLHVASHFGQANMVRFLLQ-NGA  724

Query  393  NRDIMDYSGNKPLDYSRQR  411
            N D     G  PL  + Q+
Sbjct  725  NVDAATSIGYTPLHQTAQQ  743


 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (2%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
             TALH AA  G+  V KL+     AD NAR   G+TPLH+A +  R  + ELL 
Sbjct  338  LTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLL  390


 Score = 47.4 bits (111),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 38/68 (56%), Gaps = 5/68 (7%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW----  387
            +G+T LH A+ +GN+++  L+     ADVN       +PLH+A ++G+ N+  LL     
Sbjct  204  SGFTPLHIASHYGNQNIANLLI-QKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG  262

Query  388  NVYKANRD  395
            N+    RD
Sbjct  263  NIEAKTRD  270


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 32/56 (57%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G+T LH  AK+G+  V +L+    +ADV+A+   G TPLH+A  +    +  LL  
Sbjct  535  GFTPLHLTAKYGHIKVAQLLL-QKEADVDAQGKNGVTPLHVACHYNNQQVALLLLE  589


 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G+T LH AA+    D+   +   Y A  NA +  G+TPLHL++Q G   I  LL  
Sbjct  601  GHTPLHIAARKNQMDIATTLL-EYGALANAESKAGFTPLHLSSQEGHAEISNLLIE  655


 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 2/73 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G+T LH A K     VV+L+   + A ++A T  G TPLH+A   G  NI   L   + A
Sbjct  370  GFTPLHIACKKNRLKVVELLL-RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDA  427

Query  393  NRDIMDYSGNKPL  405
            + D+    G  PL
Sbjct  428  SPDVPTVRGETPL  440


 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 32/54 (59%), Gaps = 1/54 (2%)

Query  335  TALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            T LH A++ GN D+V L+   + A V+A T   YT LH+A + G+D +  +L  
Sbjct  471  TPLHIASRLGNVDIVMLLL-QHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIE  523


 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (53%), Gaps = 2/80 (3%)

Query  309  ANYQELAKMASEFPELVKLQCPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGY  368
            A  +E+ K+  E    V +Q    G+T L+ AA+  ++ VV+L+     A+ +  T  G+
Sbjct  87   AGQEEVVKLLLEHNASVNVQS-QNGFTPLYMAAQENHDAVVRLLLSNG-ANQSLATEDGF  144

Query  369  TPLHLATQFGRDNIFELLWN  388
            TPL +A Q G D +  +L  
Sbjct  145  TPLAVAMQQGHDKVVAVLLE  164


 Score = 43.1 bits (100),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G T LH AA+    D+++++     A V+AR     TPLH+A++ G  +I  LL  
Sbjct  436  GETPLHLAARANQTDIIRILLRNG-AQVDARAREQQTPLHIASRLGNVDIVMLLLQ  490


 Score = 41.2 bits (95),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 2/68 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGR-DNIFELLWNVYK  391
            G T LH AA+ G+E VV ++     A ++A+T  G  PLH+A Q    D    LL++   
Sbjct  271  GLTPLHCAARSGHEQVVDMLL-ERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAP  329

Query  392  ANRDIMDY  399
             +   +DY
Sbjct  330  VDEVTVDY  337


 Score = 40.0 bits (92),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 9/57 (16%)

Query  336  ALHWAAKHGNEDVVK----LIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            ALH AAK   +D VK    L+   +  DV +++  G+TPLH+A+ +G  NI  LL  
Sbjct  175  ALHIAAK---KDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQ  226


 Score = 39.7 bits (91),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 18/52 (35%), Positives = 29/52 (56%), Gaps = 1/52 (2%)

Query  337  LHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            LH AAK G  ++V L+      ++ A+T  G TPLH A + G + + ++L  
Sbjct  242  LHVAAKWGKTNMVSLLL-EKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLE  292


 Score = 33.9 bits (76),  Expect = 0.56, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 1/56 (2%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            +G T LH AA  G  ++V +    + A  +  T  G TPLHLA +  + +I  +L 
Sbjct  402  SGLTPLHVAAFMGCMNIV-IYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL  456



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016421.1 ankyrin repeat domain-containing protein SOWAHC
isoform X3 [Drosophila kikkawai]

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q20KN0_CARRO  unnamed protein product                                 56.2    3e-08
Q0KIE7_DROME  unnamed protein product                                 55.1    1e-07
X2JCM1_DROME  unnamed protein product                                 55.1    1e-07


>Q20KN0_CARRO unnamed protein product
Length=439

 Score = 56.2 bits (134),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 3/94 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTN-GGYTPLHLATQFGRDNIFELLWNVYK  391
            G T LH A + G+ DV++ +     ADVN +    G T LHLA +  RD++ + L N   
Sbjct  315  GQTCLHLAVQQGHMDVIRYLVQC-DADVNGKEGKSGRTSLHLAVEAQRDDLVQFLLNTCH  373

Query  392  ANRDIMDYSGNKPLDYSRQRPSVSASTCSKIQAM  425
            A+ +I +Y+G+ PL  +     +   TCSK++ +
Sbjct  374  ADVNIQNYAGHSPLHVAWSVYQLEP-TCSKLKNI  406


 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 37/73 (51%), Gaps = 20/73 (27%)

Query  327  LQCPA--------TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFG  378
            +QC A        +G T+LH A +   +D+V+ +  T  ADVN +   G++PLH+A    
Sbjct  335  VQCDADVNGKEGKSGRTSLHLAVEAQRDDLVQFLLNTCHADVNIQNYAGHSPLHVA----  390

Query  379  RDNIFELLWNVYK  391
                    W+VY+
Sbjct  391  --------WSVYQ  395


>Q0KIE7_DROME unnamed protein product
Length=1549

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            GYT LH AA +G+ D+VK       AD+   +N GYTPLH A Q G   I  LL   +KA
Sbjct  727  GYTPLHMAAHYGHLDLVKFFIEN-DADIEMSSNIGYTPLHQAAQQGHIMIINLLLR-HKA  784

Query  393  NRDIMDYSGNKPLDYSRQRPSVSASTCSKI  422
            N + +   GN  L  +     V+     KI
Sbjct  785  NPNALTKDGNTALHIASNLGYVTVMESLKI  814


 Score = 52.8 bits (125),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 38/54 (70%), Gaps = 1/54 (2%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            Y+ALH AAK G E++V+++     A+ NA T  G+TPLHLA ++G+ N+ ++L 
Sbjct  531  YSALHIAAKEGQENIVQVLLEN-GAENNAVTKKGFTPLHLACKYGKQNVVQILL  583


 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 2/71 (3%)

Query  335  TALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKANR  394
            TALH AA  G+  V KL+   YKA+ NAR   G+TPLH+A +  R  + ELL   + AN 
Sbjct  368  TALHVAAHCGHVKVAKLLLD-YKANPNARALNGFTPLHIACKKNRIKMVELLIK-HGANI  425

Query  395  DIMDYSGNKPL  405
                 SG  PL
Sbjct  426  GATTESGLTPL  436


 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            +G+T LH AA +GN D+  L+    KADVN       TPLH+A ++G+ ++  LL 
Sbjct  233  SGFTPLHIAAHYGNVDIATLLLNN-KADVNYVAKHNITPLHVACKWGKLSLCTLLL  287


 Score = 44.7 bits (104),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 38/55 (69%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G T LH A++ GN +++ L+   + A++NA++N  Y+ LH+A + G++NI ++L 
Sbjct  497  GQTPLHVASRLGNINIIMLLL-QHGAEINAQSNDKYSALHIAAKEGQENIVQVLL  550


 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (4%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G T LH AA+    D+++++  + K D  AR   G TPLH+A++ G  NI  LL 
Sbjct  465  GETPLHLAARANQADIIRILLRSAKVDAIARE--GQTPLHVASRLGNINIIMLLL  517


 Score = 43.5 bits (101),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query  333  GYTALHWAAKHGNEDVV-KLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFE-LLWNVY  390
            G TALH A+  G  DV+ +LI   Y A+VN ++  G+TPL++A Q   DN    LL N  
Sbjct  106  GNTALHIASLAGQHDVINQLI--LYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLAN--  161

Query  391  KANRDIMDYSGNKPLDYSRQRPSVSASTCSKIQAMRFSGGLNGTWR  436
             AN  +    G  PL  + Q+         KI A+     + G  R
Sbjct  162  GANPSLSTEDGFTPLAVAMQQGH------DKIVAVLLENDVRGKVR  201


 Score = 43.1 bits (100),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 4/83 (5%)

Query  329  CPATGYTALHWAAKHGNEDV-VKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            C A G  ALH AAK G  D+  +L+    K D NA T  G T LH+A+  G+ ++   L 
Sbjct  69   CNANGLNALHLAAKDGYVDICCELLRRGIKID-NA-TKKGNTALHIASLAGQHDVINQLI  126

Query  388  NVYKANRDIMDYSGNKPLDYSRQ  410
             +Y AN ++   +G  PL  + Q
Sbjct  127  -LYNANVNVQSLNGFTPLYMAAQ  148


 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G+T LH A K+G ++VV+++     A ++ +     TPLH+AT +   +I ELL 
Sbjct  563  GFTPLHLACKYGKQNVVQILLQN-GASIDFQGKNDVTPLHVATHYNNPSIVELLL  616


 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 3/81 (4%)

Query  307  AKANYQELAKMASEFPELVKLQCPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNG  366
             K NY E+A    +    V +    +G++ LH AA+ GN D+V+L+   Y   ++A    
Sbjct  637  CKKNYLEIAMQLLQHGADVNI-ISKSGFSPLHLAAQGGNVDMVQLLL-EYGV-ISAAAKN  693

Query  367  GYTPLHLATQFGRDNIFELLW  387
            G TPLH+A Q G   + ++L 
Sbjct  694  GLTPLHVAAQEGHVLVSQILL  714


 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 1/54 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELL  386
            G T LH AA+ G+  V +++   + A+++ RT  GYTPLH+A  +G  ++ +  
Sbjct  694  GLTPLHVAAQEGHVLVSQILL-EHGANISERTRNGYTPLHMAAHYGHLDLVKFF  746


 Score = 40.4 bits (93),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G+T LH A K     +V+L+   + A++ A T  G TPLH+A+  G  NI   L   ++A
Sbjct  399  GFTPLHIACKKNRIKMVELLI-KHGANIGATTESGLTPLHVASFMGCINIVIYLLQ-HEA  456

Query  393  NRDIMDYSGNKPL  405
            + D+    G  PL
Sbjct  457  SADLPTIRGETPL  469


 Score = 38.9 bits (89),  Expect = 0.011, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 1/59 (2%)

Query  329  CPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            C   G  A+H A K    ++   +   + ADVN  +  G++PLHLA Q G  ++ +LL 
Sbjct  625  CARNGQCAIHIACKKNYLEIAMQLL-QHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL  682


 Score = 37.0 bits (84),  Expect = 0.056, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 1/53 (2%)

Query  336  ALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            ALH AAK  + +  KL+   +  + +  +  G+TPLH+A  +G  +I  LL N
Sbjct  204  ALHIAAKKNDVNAAKLLL-QHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLN  255


 Score = 30.0 bits (66),  Expect = 7.5, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (52%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G T LH A++ G+ +V+K +     A +  +T  G + LH+A Q   D    LL +
Sbjct  300  GLTPLHCASRSGHVEVIKHLL-QQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD  354


 Score = 29.6 bits (65),  Expect = 8.8, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (49%), Gaps = 3/84 (4%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYK  391
            +G T LH A+  G  ++V  +   ++A  +  T  G TPLHLA +  + +I  +L     
Sbjct  431  SGLTPLHVASFMGCINIVIYLL-QHEASADLPTIRGETPLHLAARANQADIIRILLR--S  487

Query  392  ANRDIMDYSGNKPLDYSRQRPSVS  415
            A  D +   G  PL  + +  +++
Sbjct  488  AKVDAIAREGQTPLHVASRLGNIN  511


>X2JCM1_DROME unnamed protein product
Length=11634

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 8/104 (8%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G TALH A+  G E+VVKL+   + A VN ++  G+TPL++A Q   D +  LL +   A
Sbjct  77   GNTALHIASLAGQEEVVKLLL-EHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGA  134

Query  393  NRDIMDYSGNKPLDYSRQRPSVSASTCSKIQAMRFSGGLNGTWR  436
            N+ +    G  PL  + Q+         K+ A+       G  R
Sbjct  135  NQSLATEDGFTPLAVAMQQ------GHDKVVAVLLESDTRGKVR  172


 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKAN  393
            YTALH AAK G ++V  ++     A ++A T  G+TPLHL  ++G   + +LL    +A+
Sbjct  503  YTALHIAAKEGQDEVAAVLIENGAA-LDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEAD  560

Query  394  RDIMDYSGNKPL  405
             D    +G  PL
Sbjct  561  VDAQGKNGVTPL  572


 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  331  ATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVY  390
            + GYT LH  A+ G+  +V L+   +KA+ NA+T  G TPLH+A + G  ++ + L  + 
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLL-EHKANANAQTVNGQTPLHIARKLGYISVLDSLKTIT  789

Query  391  KAN  393
            K +
Sbjct  790  KED  792


 Score = 49.7 bits (117),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 2/79 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G T +H  A+  N +V +++     A+++  T  GYTPLH+A+ FG+ N+   L     A
Sbjct  667  GLTPMHLCAQEDNVNVAEILEKNG-ANIDMATKAGYTPLHVASHFGQANMVRFLLQ-NGA  724

Query  393  NRDIMDYSGNKPLDYSRQR  411
            N D     G  PL  + Q+
Sbjct  725  NVDAATSIGYTPLHQTAQQ  743


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (2%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
             TALH AA  G+  V KL+     AD NAR   G+TPLH+A +  R  + ELL 
Sbjct  338  LTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLL  390


 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 38/68 (56%), Gaps = 5/68 (7%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW----  387
            +G+T LH A+ +GN+++  L+     ADVN       +PLH+A ++G+ N+  LL     
Sbjct  204  SGFTPLHIASHYGNQNIANLLIQKG-ADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG  262

Query  388  NVYKANRD  395
            N+    RD
Sbjct  263  NIEAKTRD  270


 Score = 46.6 bits (109),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G+T LH  AK+G+  V +L+    +ADV+A+   G TPLH+A  +    +  LL 
Sbjct  535  GFTPLHLTAKYGHIKVAQLLL-QKEADVDAQGKNGVTPLHVACHYNNQQVALLLL  588


 Score = 45.8 bits (107),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G+T LH AA+    D+   +   Y A  NA +  G+TPLHL++Q G   I  LL 
Sbjct  601  GHTPLHIAARKNQMDIATTLL-EYGALANAESKAGFTPLHLSSQEGHAEISNLLI  654


 Score = 45.8 bits (107),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 2/73 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G+T LH A K     VV+L+   + A ++A T  G TPLH+A   G  NI   L   + A
Sbjct  370  GFTPLHIACKKNRLKVVELLL-RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDA  427

Query  393  NRDIMDYSGNKPL  405
            + D+    G  PL
Sbjct  428  SPDVPTVRGETPL  440


 Score = 44.7 bits (104),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 1/53 (2%)

Query  335  TALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            T LH A++ GN D+V L+   + A V+A T   YT LH+A + G+D +  +L 
Sbjct  471  TPLHIASRLGNVDIVMLLL-QHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI  522


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 42/79 (53%), Gaps = 2/79 (3%)

Query  309  ANYQELAKMASEFPELVKLQCPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGY  368
            A  +E+ K+  E    V +Q    G+T L+ AA+  ++ VV+L+     A+ +  T  G+
Sbjct  87   AGQEEVVKLLLEHNASVNVQS-QNGFTPLYMAAQENHDAVVRLLLSNG-ANQSLATEDGF  144

Query  369  TPLHLATQFGRDNIFELLW  387
            TPL +A Q G D +  +L 
Sbjct  145  TPLAVAMQQGHDKVVAVLL  163


 Score = 43.9 bits (102),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G T LH AA+    D+++++     A V+AR     TPLH+A++ G  +I  LL  
Sbjct  436  GETPLHLAARANQTDIIRILLRNG-AQVDARAREQQTPLHIASRLGNVDIVMLLLQ  490


 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 2/68 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGR-DNIFELLWNVYK  391
            G T LH AA+ G+E VV ++     A ++A+T  G  PLH+A Q    D    LL++   
Sbjct  271  GLTPLHCAARSGHEQVVDMLL-ERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAP  329

Query  392  ANRDIMDY  399
             +   +DY
Sbjct  330  VDEVTVDY  337


 Score = 41.6 bits (96),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 9/57 (16%)

Query  336  ALHWAAKHGNEDVVK----LIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            ALH AAK   +D VK    L+   +  DV +++  G+TPLH+A+ +G  NI  LL  
Sbjct  175  ALHIAAK---KDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQ  226


 Score = 39.3 bits (90),  Expect = 0.010, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (57%), Gaps = 1/51 (2%)

Query  337  LHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            LH AAK G  ++V L+      ++ A+T  G TPLH A + G + + ++L 
Sbjct  242  LHVAAKWGKTNMVSLLL-EKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLL  291


 Score = 34.7 bits (78),  Expect = 0.26, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 1/56 (2%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            +G T LH AA  G  ++V +    + A  +  T  G TPLHLA +  + +I  +L 
Sbjct  402  SGLTPLHVAAFMGCMNIV-IYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL  456



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016422.1 ankyrin repeat domain-containing protein SOWAHC
isoform X4 [Drosophila kikkawai]

Length=453
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q20KN0_CARRO  unnamed protein product                                 56.6    2e-08
X2JCM1_DROME  unnamed protein product                                 54.3    2e-07
Q0KIE7_DROME  unnamed protein product                                 54.3    2e-07


>Q20KN0_CARRO unnamed protein product
Length=439

 Score = 56.6 bits (135),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTN-GGYTPLHLATQFGRDNIFELLWNVYK  391
            G T LH A + G+ DV++ +     ADVN +    G T LHLA +  RD++ + L N   
Sbjct  315  GQTCLHLAVQQGHMDVIRYLVQC-DADVNGKEGKSGRTSLHLAVEAQRDDLVQFLLNTCH  373

Query  392  ANRDIMDYSGNKPLDYSRQRPSVSASTCSKIQ  423
            A+ +I +Y+G+ PL  +     +   TCSK++
Sbjct  374  ADVNIQNYAGHSPLHVAWSVYQLEP-TCSKLK  404


 Score = 42.7 bits (99),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 37/73 (51%), Gaps = 20/73 (27%)

Query  327  LQCPA--------TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFG  378
            +QC A        +G T+LH A +   +D+V+ +  T  ADVN +   G++PLH+A    
Sbjct  335  VQCDADVNGKEGKSGRTSLHLAVEAQRDDLVQFLLNTCHADVNIQNYAGHSPLHVA----  390

Query  379  RDNIFELLWNVYK  391
                    W+VY+
Sbjct  391  --------WSVYQ  395


>X2JCM1_DROME unnamed protein product
Length=11634

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 8/104 (8%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G TALH A+  G E+VVKL+   + A VN ++  G+TPL++A Q   D +  LL +   A
Sbjct  77   GNTALHIASLAGQEEVVKLLL-EHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLS-NGA  134

Query  393  NRDIMDYSGNKPLDYSRQRPSVSASTCSKIQAMRFSGGLNGTWR  436
            N+ +    G  PL  + Q+         K+ A+       G  R
Sbjct  135  NQSLATEDGFTPLAVAMQQ------GHDKVVAVLLESDTRGKVR  172


 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/63 (37%), Positives = 38/63 (60%), Gaps = 1/63 (2%)

Query  331  ATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVY  390
            + GYT LH  A+ G+  +V L+   +KA+ NA+T  G TPLH+A + G  ++ + L  + 
Sbjct  731  SIGYTPLHQTAQQGHCHIVNLLL-EHKANANAQTVNGQTPLHIARKLGYISVLDSLKTIT  789

Query  391  KAN  393
            K +
Sbjct  790  KED  792


 Score = 51.6 bits (122),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 2/72 (3%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKAN  393
            YTALH AAK G ++V  ++     A ++A T  G+TPLHL  ++G   + +LL    +A+
Sbjct  503  YTALHIAAKEGQDEVAAVLIENGAA-LDAATKKGFTPLHLTAKYGHIKVAQLLLQ-KEAD  560

Query  394  RDIMDYSGNKPL  405
             D    +G  PL
Sbjct  561  VDAQGKNGVTPL  572


 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 41/79 (52%), Gaps = 2/79 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G T +H  A+  N +V +++     A+++  T  GYTPLH+A+ FG+ N+   L     A
Sbjct  667  GLTPMHLCAQEDNVNVAEILEKNG-ANIDMATKAGYTPLHVASHFGQANMVRFLLQ-NGA  724

Query  393  NRDIMDYSGNKPLDYSRQR  411
            N D     G  PL  + Q+
Sbjct  725  NVDAATSIGYTPLHQTAQQ  743


 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 38/68 (56%), Gaps = 5/68 (7%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW----  387
            +G+T LH A+ +GN+++  L+     ADVN       +PLH+A ++G+ N+  LL     
Sbjct  204  SGFTPLHIASHYGNQNIANLLI-QKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGG  262

Query  388  NVYKANRD  395
            N+    RD
Sbjct  263  NIEAKTRD  270


 Score = 47.8 bits (112),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 31/54 (57%), Gaps = 1/54 (2%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
             TALH AA  G+  V KL+     AD NAR   G+TPLH+A +  R  + ELL 
Sbjct  338  LTALHVAAHCGHVRVAKLLLD-RNADANARALNGFTPLHIACKKNRLKVVELLL  390


 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G+T LH  AK+G+  V +L+    +ADV+A+   G TPLH+A  +    +  LL 
Sbjct  535  GFTPLHLTAKYGHIKVAQLLL-QKEADVDAQGKNGVTPLHVACHYNNQQVALLLL  588


 Score = 45.8 bits (107),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (55%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G+T LH AA+    D+   +   Y A  NA +  G+TPLHL++Q G   I  LL 
Sbjct  601  GHTPLHIAARKNQMDIATTLL-EYGALANAESKAGFTPLHLSSQEGHAEISNLLI  654


 Score = 45.4 bits (106),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 37/73 (51%), Gaps = 2/73 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G+T LH A K     VV+L+   + A ++A T  G TPLH+A   G  NI   L   + A
Sbjct  370  GFTPLHIACKKNRLKVVELLL-RHGASISATTESGLTPLHVAAFMGCMNIVIYLLQ-HDA  427

Query  393  NRDIMDYSGNKPL  405
            + D+    G  PL
Sbjct  428  SPDVPTVRGETPL  440


 Score = 43.5 bits (101),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 1/53 (2%)

Query  335  TALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            T LH A++ GN D+V L+   + A V+A T   YT LH+A + G+D +  +L 
Sbjct  471  TPLHIASRLGNVDIVMLLL-QHGAQVDATTKDMYTALHIAAKEGQDEVAAVLI  522


 Score = 43.5 bits (101),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 42/79 (53%), Gaps = 2/79 (3%)

Query  309  ANYQELAKMASEFPELVKLQCPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGY  368
            A  +E+ K+  E    V +Q    G+T L+ AA+  ++ VV+L+     A+ +  T  G+
Sbjct  87   AGQEEVVKLLLEHNASVNVQS-QNGFTPLYMAAQENHDAVVRLLLSNG-ANQSLATEDGF  144

Query  369  TPLHLATQFGRDNIFELLW  387
            TPL +A Q G D +  +L 
Sbjct  145  TPLAVAMQQGHDKVVAVLL  163


 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 31/56 (55%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G T LH AA+    D+++++     A V+AR     TPLH+A++ G  +I  LL  
Sbjct  436  GETPLHLAARANQTDIIRILLRNG-AQVDARAREQQTPLHIASRLGNVDIVMLLLQ  490


 Score = 42.4 bits (98),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (53%), Gaps = 2/68 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGR-DNIFELLWNVYK  391
            G T LH AA+ G+E VV ++     A ++A+T  G  PLH+A Q    D    LL++   
Sbjct  271  GLTPLHCAARSGHEQVVDMLL-ERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAP  329

Query  392  ANRDIMDY  399
             +   +DY
Sbjct  330  VDEVTVDY  337


 Score = 41.2 bits (95),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 33/57 (58%), Gaps = 9/57 (16%)

Query  336  ALHWAAKHGNEDVVK----LIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            ALH AAK   +D VK    L+   +  DV +++  G+TPLH+A+ +G  NI  LL  
Sbjct  175  ALHIAAK---KDDVKAATLLLDNDHNPDVTSKS--GFTPLHIASHYGNQNIANLLIQ  226


 Score = 40.0 bits (92),  Expect = 0.005, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (57%), Gaps = 1/51 (2%)

Query  337  LHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            LH AAK G  ++V L+      ++ A+T  G TPLH A + G + + ++L 
Sbjct  242  LHVAAKWGKTNMVSLLL-EKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLL  291


 Score = 33.9 bits (76),  Expect = 0.34, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 29/56 (52%), Gaps = 1/56 (2%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            +G T LH AA  G  ++V +    + A  +  T  G TPLHLA +  + +I  +L 
Sbjct  402  SGLTPLHVAAFMGCMNIV-IYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILL  456


>Q0KIE7_DROME unnamed protein product
Length=1549

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 45/90 (50%), Gaps = 2/90 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            GYT LH AA +G+ D+VK       AD+   +N GYTPLH A Q G   I  LL   +KA
Sbjct  727  GYTPLHMAAHYGHLDLVKFFIEN-DADIEMSSNIGYTPLHQAAQQGHIMIINLLLR-HKA  784

Query  393  NRDIMDYSGNKPLDYSRQRPSVSASTCSKI  422
            N + +   GN  L  +     V+     KI
Sbjct  785  NPNALTKDGNTALHIASNLGYVTVMESLKI  814


 Score = 52.8 bits (125),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 5/68 (7%)

Query  334  YTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKAN  393
            Y+ALH AAK G E++V+++     A+ NA T  G+TPLHLA ++G+ N+ ++L      N
Sbjct  531  YSALHIAAKEGQENIVQVLLEN-GAENNAVTKKGFTPLHLACKYGKQNVVQILLQ----N  585

Query  394  RDIMDYSG  401
               +D+ G
Sbjct  586  GASIDFQG  593


 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 2/71 (3%)

Query  335  TALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKANR  394
            TALH AA  G+  V KL+   YKA+ NAR   G+TPLH+A +  R  + ELL   + AN 
Sbjct  368  TALHVAAHCGHVKVAKLLL-DYKANPNARALNGFTPLHIACKKNRIKMVELLIK-HGANI  425

Query  395  DIMDYSGNKPL  405
                 SG  PL
Sbjct  426  GATTESGLTPL  436


 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (61%), Gaps = 1/56 (2%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            +G+T LH AA +GN D+  L+    KADVN       TPLH+A ++G+ ++  LL 
Sbjct  233  SGFTPLHIAAHYGNVDIATLLLNN-KADVNYVAKHNITPLHVACKWGKLSLCTLLL  287


 Score = 44.3 bits (103),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 38/55 (69%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G T LH A++ GN +++ L+   + A++NA++N  Y+ LH+A + G++NI ++L 
Sbjct  497  GQTPLHVASRLGNINIIMLLL-QHGAEINAQSNDKYSALHIAAKEGQENIVQVLL  550


 Score = 43.1 bits (100),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 51/106 (48%), Gaps = 12/106 (11%)

Query  333  GYTALHWAAKHGNEDVV-KLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFE-LLWNVY  390
            G TALH A+  G  DV+ +LI   Y A+VN ++  G+TPL++A Q   DN    LL N  
Sbjct  106  GNTALHIASLAGQHDVINQLI--LYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLAN--  161

Query  391  KANRDIMDYSGNKPLDYSRQRPSVSASTCSKIQAMRFSGGLNGTWR  436
             AN  +    G  PL  + Q+         KI A+     + G  R
Sbjct  162  GANPSLSTEDGFTPLAVAMQQGH------DKIVAVLLENDVRGKVR  201


 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (4%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G T LH AA+    D+++++  + K D  AR   G TPLH+A++ G  NI  LL 
Sbjct  465  GETPLHLAARANQADIIRILLRSAKVDAIARE--GQTPLHVASRLGNINIIMLLL  517


 Score = 42.7 bits (99),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 44/83 (53%), Gaps = 4/83 (5%)

Query  329  CPATGYTALHWAAKHGNEDV-VKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            C A G  ALH AAK G  D+  +L+    K D NA T  G T LH+A+  G+ ++   L 
Sbjct  69   CNANGLNALHLAAKDGYVDICCELLRRGIKID-NA-TKKGNTALHIASLAGQHDVINQLI  126

Query  388  NVYKANRDIMDYSGNKPLDYSRQ  410
             +Y AN ++   +G  PL  + Q
Sbjct  127  -LYNANVNVQSLNGFTPLYMAAQ  148


 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 3/81 (4%)

Query  307  AKANYQELAKMASEFPELVKLQCPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNG  366
             K NY E+A    +    V +    +G++ LH AA+ GN D+V+L+   Y   ++A    
Sbjct  637  CKKNYLEIAMQLLQHGADVNI-ISKSGFSPLHLAAQGGNVDMVQLLL-EYGV-ISAAAKN  693

Query  367  GYTPLHLATQFGRDNIFELLW  387
            G TPLH+A Q G   + ++L 
Sbjct  694  GLTPLHVAAQEGHVLVSQILL  714


 Score = 40.8 bits (94),  Expect = 0.002, Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 1/54 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELL  386
            G T LH AA+ G+  V +++   + A+++ RT  GYTPLH+A  +G  ++ +  
Sbjct  694  GLTPLHVAAQEGHVLVSQILL-EHGANISERTRNGYTPLHMAAHYGHLDLVKFF  746


 Score = 40.8 bits (94),  Expect = 0.003, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            G+T LH A K+G ++VV+++     A ++ +     TPLH+AT +   +I ELL 
Sbjct  563  GFTPLHLACKYGKQNVVQILLQN-GASIDFQGKNDVTPLHVATHYNNPSIVELLL  616


 Score = 40.4 bits (93),  Expect = 0.004, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 39/73 (53%), Gaps = 2/73 (3%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYKA  392
            G+T LH A K     +V+L+   + A++ A T  G TPLH+A+  G  NI   L   ++A
Sbjct  399  GFTPLHIACKKNRIKMVELLI-KHGANIGATTESGLTPLHVASFMGCINIVIYLLQ-HEA  456

Query  393  NRDIMDYSGNKPL  405
            + D+    G  PL
Sbjct  457  SADLPTIRGETPL  469


 Score = 39.3 bits (90),  Expect = 0.008, Method: Compositional matrix adjust.
 Identities = 20/59 (34%), Positives = 31/59 (53%), Gaps = 1/59 (2%)

Query  329  CPATGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLW  387
            C   G  A+H A K    ++   +   + ADVN  +  G++PLHLA Q G  ++ +LL 
Sbjct  625  CARNGQCAIHIACKKNYLEIAMQLL-QHGADVNIISKSGFSPLHLAAQGGNVDMVQLLL  682


 Score = 36.2 bits (82),  Expect = 0.066, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 30/53 (57%), Gaps = 1/53 (2%)

Query  336  ALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            ALH AAK  + +  KL+   +  + +  +  G+TPLH+A  +G  +I  LL N
Sbjct  204  ALHIAAKKNDVNAAKLLL-QHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLN  255


 Score = 30.0 bits (66),  Expect = 5.0, Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (52%), Gaps = 1/56 (2%)

Query  333  GYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWN  388
            G T LH A++ G+ +V+K +     A +  +T  G + LH+A Q   D    LL +
Sbjct  300  GLTPLHCASRSGHVEVIKHLL-QQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLD  354


 Score = 29.3 bits (64),  Expect = 8.9, Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 3/84 (4%)

Query  332  TGYTALHWAAKHGNEDVVKLIAGTYKADVNARTNGGYTPLHLATQFGRDNIFELLWNVYK  391
            +G T LH A+  G  ++V  +   ++A  +  T  G TPLHLA +  + +I  +L  +  
Sbjct  431  SGLTPLHVASFMGCINIVIYLL-QHEASADLPTIRGETPLHLAARANQADIIRIL--LRS  487

Query  392  ANRDIMDYSGNKPLDYSRQRPSVS  415
            A  D +   G  PL  + +  +++
Sbjct  488  AKVDAIAREGQTPLHVASRLGNIN  511



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


Query= XP_017016423.1 nuclear exosome regulator NRDE2 isoform X1
[Drosophila kikkawai]

Length=973
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXW9_DROME  unnamed protein product                                 862     0.0  
Q8T048_DROME  unnamed protein product                                 702     0.0  
Q8IR40_DROME  unnamed protein product                                 661     0.0  


>Q9VXW9_DROME unnamed protein product
Length=984

 Score = 862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/1005 (48%), Positives = 670/1005 (67%), Gaps = 55/1005 (5%)

Query  1    MSLFPAYGGGEPPAATEATATS-------STA--WKSNKSYEKEMPNV---GREIIEQTH  48
            MSLFPAYG G   AA  A  T+       ST   WK N+SY K+  N+   G E    + 
Sbjct  1    MSLFPAYGAGRTSAAGSAKQTTKPGEEEPSTGGNWKKNESYIKKHVNIATQGPESDSSSS  60

Query  49   ISSDDSFSSSGEEETPPPKESVHQLR-LEFDARSDGFYVDKKGNNSLRTVRTLTKPTRPH  107
                +  +   +++     ++VH+ + LEFD+ SDGFYVDK GN+S R ++TL KP RP 
Sbjct  61   TEDSEDEADKRKQDDVTKTKNVHRGKTLEFDS-SDGFYVDKVGNSSYRNIKTLKKPARPR  119

Query  108  YKRRLPHLLDN-------SQVQAKL-WPRSKLQRYTKLAPVPSESGPTPEEIAKLQAQLM  159
            YK R+  L D        S+  +K    RS+  R   +A  PSE     +E+++LQ QL+
Sbjct  120  YKTRMKRLGDGKYNPHDFSRAHSKFSLKRSRYVREKLIADAPSE-----DEVSRLQEQLI  174

Query  160  DTKVLVQREPQHLEHWLQLHRLLELNLDKANRLAVSEHQLHTLETALGHHPSNERLLRLY  219
             TKVLVQ+EP+ L+HWLQLHRLL LNLDKANRLAV+E Q+H+LETA+ HHPSN+++LRLY
Sbjct  175  RTKVLVQQEPEVLDHWLQLHRLLNLNLDKANRLAVAEQQIHSLETAMEHHPSNQQILRLY  234

Query  220  TETASAAYPASEVAVRLEAMLQQSPFVFSLWSSLIMATQGTMARCNVPDVLRIYEDSMRR  279
            T  A+A Y A+EVA R E ML+++PF ++LWS+LIM TQG MA CNV  VLRIYE SMRR
Sbjct  235  THVANATYQANEVARRFEKMLKRNPFQYTLWSNLIMITQGDMACCNVSAVLRIYEYSMRR  294

Query  280  MHLGHTDTSSRQLDTVDTDKIMLDLFHNCVLFLRQSANNNHVFALLRLALELNFPGLTVD  339
            MH+GH D  +R+    +TD IML LFHNC+LFLRQS + N +FAL+RL++ELNFP LT +
Sbjct  295  MHVGHNDEITRRFIIKETDVIMLKLFHNCLLFLRQSGHTNWMFALIRLSMELNFPYLTFE  354

Query  340  CLEARAADELPLIEFEELVLQSGMPLPEIWTRVERLRQAYNFLPYPQMQHSSTDAVEGGL  399
            CL+A A  E  LI FEE+VL+SGMP+PEIWTRVE+LRQAY FLP      SST+  +  +
Sbjct  355  CLQAHAGREKALIGFEEVVLRSGMPMPEIWTRVEQLRQAYCFLPLKDKLASSTNVFKNKM  414

Query  400  DPQRFIFSDDVCHYIYPLKAPGNRLQLLLLVVQLTKMPLVRSDCLAEKLSKRIDAQLGDS  459
            + +R+  SD +  Y++ LK+  NRL L+L+VVQL K+PL+RS  LA+KL+  I+   G+S
Sbjct  415  NAERYFCSDKLVPYVHALKSQNNRLHLVLVVVQLMKLPLIRSASLADKLNPCIE-DFGES  473

Query  460  EAIEMLLAGLADRSSYALPPTDQDHDFLSALLDLSRELCVTPSFMPHCLGSDLYAATIGG  519
            EAIEML A + DR SYA+      + F +A++DL+RE+ VTPS+MPH +G  LYA T+  
Sbjct  474  EAIEMLFAAIVDRHSYAVASL--QYQFDAAMIDLAREMSVTPSYMPHLVGHKLYADTVSN  531

Query  520  LLLKCSEAFQGDEDKRRLFVVLWLRFQRLQLVLHKLTGKLTEQYLKESRSRIRKMFSLEQ  579
            +LLKC E F G+E KRRL ++L+LRFQ+L +VLHK  GKLT+++ K+ R+R+RK+ +L +
Sbjct  532  MLLKCVEVFIGEESKRRLLLILYLRFQKLLIVLHKSMGKLTKKFFKDKRTRMRKLINLTE  591

Query  580  NRHVFRFYTELAMCEFEVLERDDDPVRAFSIFRTLLAKQEEEEDDVSFGSPDVLHAYLIY  639
            NR+V  FYTE A+CE E           FSI   ++ K+ EE   +S    D +H YL+ 
Sbjct  592  NRNVISFYTEQALCEIEA----KHYRLGFSIISRIITKKSEESSCIS--CVDTMHLYLVC  645

Query  640  AEMLISRNSHDQALQLLYRICMGRANG---RMCHSLDEI-----TSREQINMEILALDGM  691
            AE+ I R    +A+ +L  +C+ +  G      +S +++      + + +  E+ +LD  
Sbjct  646  AELHIHRGRISKAIGILVSLCLEKHAGVKQTTVYSKEQVLKGLRNAEKMVRAELKSLDTQ  705

Query  692  PQEMPLEEYFQPHRLLILLRAHCLAWNLEHRS-AETNVLLDRLLAKQLSFAATRNSERRR  750
            P EM LEEYFQP++LLILLRA CL   L +R   E  + L+ L   +    A ++SER+R
Sbjct  706  PAEMSLEEYFQPNKLLILLRAICLIEVLNNRRHKEARMWLNDLQNNEFGPEAVKDSERKR  765

Query  751  FFREQVLEMQLVLSQLRVPEKPLAEKAFTS---KNQVVQLVEQGLHEYPRNLVFLQRWAT  807
            F REQ++E+Q++   LR+      E  F +   K ++ +L+E GL E+PRN+VFLQ WA+
Sbjct  766  FLREQIMEIQML--HLRLSFLVFGEVEFYTGFKKIKLHELLENGLEEFPRNMVFLQLWAS  823

Query  808  FGTLQWHKLRARIIRTQAGILSLLHLVIAARCRFARILDHDQQQSHPELRSHVEATVRNR  867
              ++ WHK R+R+IRT+AGI SL HLV+A   RF  I+D + + S    R      V NR
Sbjct  824  LKSIMWHKQRSRLIRTKAGIASLAHLVVAIHNRFG-IVDTNDKFSKEATRK----MVCNR  878

Query  868  VLSMFETFLPRNTNRSEIEANQYQILRRNSLYWRIYLRCLSDTRTSFERSKECLVSALDE  927
            ++S+ ETFLP N +R ++E   Y+ILRRNS+YWR+Y+  LS T  SF RSKE L+ A+DE
Sbjct  879  LVSIVETFLPTNLDRLDVEEEHYRILRRNSIYWRLYMIALSKTNASFRRSKEVLIMAMDE  938

Query  928  CPWDKALYMDGAIYVPQELAHLQDVMIEKQLRIYALPEELNILRG  972
            CPWDK+L M+GA  +P +LA LQD+M EK++RI+A+PEE+++LRG
Sbjct  939  CPWDKSLLMEGAKVLPVKLASLQDLMTEKEIRIFAMPEEVDVLRG  983


>Q8T048_DROME unnamed protein product
Length=764

 Score = 702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/777 (49%), Positives = 532/777 (68%), Gaps = 28/777 (4%)

Query  208  HHPSNERLLRLYTETASAAYPASEVAVRLEAMLQQSPFVFSLWSSLIMATQGTMARCNVP  267
            HHPSN+++LRLYT  A+A Y A+EVA R E ML+++PF ++LWS+LIM TQG MA CNV 
Sbjct  3    HHPSNQQILRLYTHVANATYQANEVARRFEKMLKRNPFQYTLWSNLIMITQGDMACCNVS  62

Query  268  DVLRIYEDSMRRMHLGHTDTSSRQLDTVDTDKIMLDLFHNCVLFLRQSANNNHVFALLRL  327
             VLRIYE SMRRMH+GH D  +R+    +TD IML LFHNC+LFLRQS + N +FAL+RL
Sbjct  63   AVLRIYEYSMRRMHVGHNDEITRRFIIKETDVIMLKLFHNCLLFLRQSGHTNWMFALIRL  122

Query  328  ALELNFPGLTVDCLEARAADELPLIEFEELVLQSGMPLPEIWTRVERLRQAYNFLPYPQM  387
            ++ELNFP LT +CL+A A  E  LI FEE+VL+SGMP+PEIWTRVE+LRQAY FLP    
Sbjct  123  SMELNFPYLTFECLQAHAGREKALIGFEEVVLRSGMPMPEIWTRVEQLRQAYCFLPLKDK  182

Query  388  QHSSTDAVEGGLDPQRFIFSDDVCHYIYPLKAPGNRLQLLLLVVQLTKMPLVRSDCLAEK  447
              SST+  +  ++ +R+  SD +  Y++ LK+  NRL L+L+VVQL K+PL+RS  LA+K
Sbjct  183  LASSTNVFKNKMNAERYFCSDKLVPYVHALKSQNNRLHLVLVVVQLMKLPLIRSASLADK  242

Query  448  LSKRIDAQLGDSEAIEMLLAGLADRSSYALPPTDQDHDFLSALLDLSRELCVTPSFMPHC  507
            L+  I+   G+SEAIEML A + DR SYA+      + F +A++DL+RE+ VTPS+MPH 
Sbjct  243  LNPCIE-DFGESEAIEMLFAAIVDRHSYAVASL--QYQFDAAMIDLAREMSVTPSYMPHL  299

Query  508  LGSDLYAATIGGLLLKCSEAFQGDEDKRRLFVVLWLRFQRLQLVLHKLTGKLTEQYLKES  567
            +G  LYA T+  +LLKC E F G+E KRRL ++L+LRFQ+L +VLHK  GKLT+++ K+ 
Sbjct  300  VGHKLYADTVSNMLLKCVEVFIGEESKRRLLLILYLRFQKLLIVLHKSMGKLTKKFFKDK  359

Query  568  RSRIRKMFSLEQNRHVFRFYTELAMCEFEVLERDDDPVRAFSIFRTLLAKQEEEEDDVSF  627
            R+R+RK+ +L +NR+V  FYTE A+CE E           FSI   ++ K+ EE   +S 
Sbjct  360  RTRMRKLINLTENRNVISFYTEQALCEIEA----KHYRLGFSIISRIITKKSEESSCIS-  414

Query  628  GSPDVLHAYLIYAEMLISRNSHDQALQLLYRICMGRANG---RMCHSLDEI-----TSRE  679
               D +H YL+ AE+ I R    +A+ +L  +C+ +  G      +S +++      + +
Sbjct  415  -CVDTMHLYLVCAELHIHRGRISKAIGILVSLCLEKHAGVKQTTVYSKEQVLKGLRNAEK  473

Query  680  QINMEILALDGMPQEMPLEEYFQPHRLLILLRAHCLAWNLEH-RSAETNVLLDRLLAKQL  738
             +  E+ +LD  P EM LEEYFQP++LLILLRA CL   L + R  E  + L+ L   + 
Sbjct  474  MVRAELKSLDTQPAEMSLEEYFQPNKLLILLRAICLIEVLNNRRHKEARMWLNDLQNNEF  533

Query  739  SFAATRNSERRRFFREQVLEMQLVLSQLRVPEKPLAEKAFTS---KNQVVQLVEQGLHEY  795
               A ++SER+RF REQ++E+Q++   LR+      E  F +   K ++ +L+E GL E+
Sbjct  534  GPEAVKDSERKRFLREQIMEIQML--HLRLSFLVFGEVEFYTGFKKIKLHELLENGLEEF  591

Query  796  PRNLVFLQRWATFGTLQWHKLRARIIRTQAGILSLLHLVIAARCRFARILDHDQQQSHPE  855
            PRN+VFLQ WA+  ++ WHK R+R+IRT+AGI SL HLV+A   RF  I+D + + S   
Sbjct  592  PRNMVFLQLWASLKSIMWHKQRSRLIRTKAGIASLAHLVVAIHNRFG-IVDTNDKFSKEA  650

Query  856  LRSHVEATVRNRVLSMFETFLPRNTNRSEIEANQYQILRRNSLYWRIYLRCLSDTRTSFE  915
             R      V NR++S+ ETFLP N +R ++E   Y+ILRRNS+YWR+Y+  LS T  SF 
Sbjct  651  TRK----MVCNRLVSIVETFLPTNLDRLDVEEEHYRILRRNSIYWRLYMIALSKTNASFR  706

Query  916  RSKECLVSALDECPWDKALYMDGAIYVPQELAHLQDVMIEKQLRIYALPEELNILRG  972
            RSKE L+ A+DECPWDK+L M+GA  +P +LA LQD+M EK++RI+A+PEE+++LRG
Sbjct  707  RSKEVLIMAMDECPWDKSLLMEGAKVLPVKLASLQDLMTEKEIRIFAMPEEVDVLRG  763


>Q8IR40_DROME unnamed protein product
Length=731

 Score = 661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/746 (48%), Positives = 507/746 (68%), Gaps = 28/746 (4%)

Query  239  MLQQSPFVFSLWSSLIMATQGTMARCNVPDVLRIYEDSMRRMHLGHTDTSSRQLDTVDTD  298
            ML+++PF ++LWS+LIM TQG MA CNV  VLRIYE SMRRMH+GH D  +R+    +TD
Sbjct  1    MLKRNPFQYTLWSNLIMITQGDMACCNVSAVLRIYEYSMRRMHVGHNDEITRRFIIKETD  60

Query  299  KIMLDLFHNCVLFLRQSANNNHVFALLRLALELNFPGLTVDCLEARAADELPLIEFEELV  358
             IML LFHNC+LFLRQS + N +FAL+RL++ELNFP LT +CL+A A  E  LI FEE+V
Sbjct  61   VIMLKLFHNCLLFLRQSGHTNWMFALIRLSMELNFPYLTFECLQAHAGREKALIGFEEVV  120

Query  359  LQSGMPLPEIWTRVERLRQAYNFLPYPQMQHSSTDAVEGGLDPQRFIFSDDVCHYIYPLK  418
            L+SGMP+PEIWTRVE+LRQAY FLP      SST+  +  ++ +R+  SD +  Y++ LK
Sbjct  121  LRSGMPMPEIWTRVEQLRQAYCFLPLKDKLASSTNVFKNKMNAERYFCSDKLVPYVHALK  180

Query  419  APGNRLQLLLLVVQLTKMPLVRSDCLAEKLSKRIDAQLGDSEAIEMLLAGLADRSSYALP  478
            +  NRL L+L+VVQL K+PL+RS  LA+KL+  I+   G+SEAIEML A + DR SYA+ 
Sbjct  181  SQNNRLHLVLVVVQLMKLPLIRSASLADKLNPCIE-DFGESEAIEMLFAAIVDRHSYAVA  239

Query  479  PTDQDHDFLSALLDLSRELCVTPSFMPHCLGSDLYAATIGGLLLKCSEAFQGDEDKRRLF  538
                  D  +A++DL+RE+ VTPS+MPH +G  LYA T+  +LLKC E F G+E KRRL 
Sbjct  240  SLQYQFD--AAMIDLAREMSVTPSYMPHLVGHKLYADTVSNMLLKCVEVFIGEESKRRLL  297

Query  539  VVLWLRFQRLQLVLHKLTGKLTEQYLKESRSRIRKMFSLEQNRHVFRFYTELAMCEFEVL  598
            ++L+LRFQ+L +VLHK  GKLT+++ K+ R+R+RK+ +L +NR+V  FYTE A+CE E  
Sbjct  298  LILYLRFQKLLIVLHKSMGKLTKKFFKDKRTRMRKLINLTENRNVISFYTEQALCEIEA-  356

Query  599  ERDDDPVRAFSIFRTLLAKQEEEEDDVSFGSPDVLHAYLIYAEMLISRNSHDQALQLLYR  658
                     FSI   ++ K+ EE   +S    D +H YL+ AE+ I R    +A+ +L  
Sbjct  357  ---KHYRLGFSIISRIITKKSEESSCIS--CVDTMHLYLVCAELHIHRGRISKAIGILVS  411

Query  659  ICMGRANG---RMCHSLDEI-----TSREQINMEILALDGMPQEMPLEEYFQPHRLLILL  710
            +C+ +  G      +S +++      + + +  E+ +LD  P EM LEEYFQP++LLILL
Sbjct  412  LCLEKHAGVKQTTVYSKEQVLKGLRNAEKMVRAELKSLDTQPAEMSLEEYFQPNKLLILL  471

Query  711  RAHCLAWNLEHRS-AETNVLLDRLLAKQLSFAATRNSERRRFFREQVLEMQLVLSQLRVP  769
            RA CL   L +R   E  + L+ L   +    A ++SER+RF REQ++E+Q++   LR+ 
Sbjct  472  RAICLIEVLNNRRHKEARMWLNDLQNNEFGPEAVKDSERKRFLREQIMEIQML--HLRLS  529

Query  770  EKPLAEKAFTS---KNQVVQLVEQGLHEYPRNLVFLQRWATFGTLQWHKLRARIIRTQAG  826
                 E  F +   K ++ +L+E GL E+PRN+VFLQ WA+  ++ WHK R+R+IRT+AG
Sbjct  530  FLVFGEVEFYTGFKKIKLHELLENGLEEFPRNMVFLQLWASLKSIMWHKQRSRLIRTKAG  589

Query  827  ILSLLHLVIAARCRFARILDHDQQQSHPELRSHVEATVRNRVLSMFETFLPRNTNRSEIE  886
            I SL HLV+A   RF  I+D + + S    R      V NR++S+ ETFLP N +R ++E
Sbjct  590  IASLAHLVVAIHNRFG-IVDTNDKFSKEATRK----MVCNRLVSIVETFLPTNLDRLDVE  644

Query  887  ANQYQILRRNSLYWRIYLRCLSDTRTSFERSKECLVSALDECPWDKALYMDGAIYVPQEL  946
               Y+ILRRNS+YWR+Y+  LS T  SF RSKE L+ A+DECPWDK+L M+GA  +P +L
Sbjct  645  EEHYRILRRNSIYWRLYMIALSKTNASFRRSKEVLIMAMDECPWDKSLLMEGAKVLPVKL  704

Query  947  AHLQDVMIEKQLRIYALPEELNILRG  972
            A LQD+M EK++RI+A+PEE+++LRG
Sbjct  705  ASLQDLMTEKEIRIFAMPEEVDVLRG  730



Lambda      K        H
   0.321    0.136    0.419 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 10394329316


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016424.1 uncharacterized protein LOC108070454 isoform X2
[Drosophila kikkawai]

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VXW9_DROME  unnamed protein product                                 534     6e-180
Q8T048_DROME  unnamed protein product                                 374     2e-120
Q8IR40_DROME  unnamed protein product                                 333     3e-105


>Q9VXW9_DROME unnamed protein product
Length=984

 Score = 534 bits (1375),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 300/578 (52%), Positives = 398/578 (69%), Gaps = 30/578 (5%)

Query  1    MSLFPAYGGGEPPAATEATATS-------STA--WKSNKSYEKEMPNV---GREIIEQTH  48
            MSLFPAYG G   AA  A  T+       ST   WK N+SY K+  N+   G E    + 
Sbjct  1    MSLFPAYGAGRTSAAGSAKQTTKPGEEEPSTGGNWKKNESYIKKHVNIATQGPESDSSSS  60

Query  49   ISSDDSFSSSGEEETPPPKESVHQLR-LEFDARSDGFYVDKKGNNSLRTVRTLTKPTRPH  107
                +  +   +++     ++VH+ + LEFD+ SDGFYVDK GN+S R ++TL KP RP 
Sbjct  61   TEDSEDEADKRKQDDVTKTKNVHRGKTLEFDS-SDGFYVDKVGNSSYRNIKTLKKPARPR  119

Query  108  YKRRLPHLLDN-------SQVQAKL-WPRSKLQRYTKLAPVPSESGPTPEEIAKLQAQLM  159
            YK R+  L D        S+  +K    RS+  R   +A  PSE     +E+++LQ QL+
Sbjct  120  YKTRMKRLGDGKYNPHDFSRAHSKFSLKRSRYVREKLIADAPSE-----DEVSRLQEQLI  174

Query  160  DTKVLVQREPQHLEHWLQLHRLLELNLDKANRLAVSEHQLHTLETALGHHPSNERLLRLY  219
             TKVLVQ+EP+ L+HWLQLHRLL LNLDKANRLAV+E Q+H+LETA+ HHPSN+++LRLY
Sbjct  175  RTKVLVQQEPEVLDHWLQLHRLLNLNLDKANRLAVAEQQIHSLETAMEHHPSNQQILRLY  234

Query  220  TETASAAYPASEVAVRLEAMLQQSPFVFSLWSSLIMATQGTMARCNVPDVLRIYEDSMRR  279
            T  A+A Y A+EVA R E ML+++PF ++LWS+LIM TQG MA CNV  VLRIYE SMRR
Sbjct  235  THVANATYQANEVARRFEKMLKRNPFQYTLWSNLIMITQGDMACCNVSAVLRIYEYSMRR  294

Query  280  MHLGHTDTSSRQLDTVDTDKIMLDLFHNCVLFLRQSANNNHVFALLRLALELNFPGLTVD  339
            MH+GH D  +R+    +TD IML LFHNC+LFLRQS + N +FAL+RL++ELNFP LT +
Sbjct  295  MHVGHNDEITRRFIIKETDVIMLKLFHNCLLFLRQSGHTNWMFALIRLSMELNFPYLTFE  354

Query  340  CLEARAADELPLIEFEELVLQSGMPLPEIWTRVERLRQAYNFLPYPQMQHSSTDAVEGGL  399
            CL+A A  E  LI FEE+VL+SGMP+PEIWTRVE+LRQAY FLP      SST+  +  +
Sbjct  355  CLQAHAGREKALIGFEEVVLRSGMPMPEIWTRVEQLRQAYCFLPLKDKLASSTNVFKNKM  414

Query  400  DPQRFIFSDDVCHYIYPLKAPGNRLQLLLLVVQLTKMPLVRSDCLAEKLSKRIDAQLGDS  459
            + +R+  SD +  Y++ LK+  NRL L+L+VVQL K+PL+RS  LA+KL+  I+   G+S
Sbjct  415  NAERYFCSDKLVPYVHALKSQNNRLHLVLVVVQLMKLPLIRSASLADKLNPCIE-DFGES  473

Query  460  EAIEMLLAGLADRSSYALPPTDQDHDFLSALLDLSRELCVTPSFMPHCLGSDLYAATIGG  519
            EAIEML A + DR SYA+      + F +A++DL+RE+ VTPS+MPH +G  LYA T+  
Sbjct  474  EAIEMLFAAIVDRHSYAVASL--QYQFDAAMIDLAREMSVTPSYMPHLVGHKLYADTVSN  531

Query  520  LLLKCSEAFQGDEDKRRLFVVLWLRFQRLQLVLHKLTG  557
            +LLKC E F G+E KRRL ++L+LRFQ+L +VLHK  G
Sbjct  532  MLLKCVEVFIGEESKRRLLLILYLRFQKLLIVLHKSMG  569


>Q8T048_DROME unnamed protein product
Length=764

 Score = 374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 197/352 (56%), Positives = 260/352 (74%), Gaps = 3/352 (1%)

Query  206  LGHHPSNERLLRLYTETASAAYPASEVAVRLEAMLQQSPFVFSLWSSLIMATQGTMARCN  265
            + HHPSN+++LRLYT  A+A Y A+EVA R E ML+++PF ++LWS+LIM TQG MA CN
Sbjct  1    MEHHPSNQQILRLYTHVANATYQANEVARRFEKMLKRNPFQYTLWSNLIMITQGDMACCN  60

Query  266  VPDVLRIYEDSMRRMHLGHTDTSSRQLDTVDTDKIMLDLFHNCVLFLRQSANNNHVFALL  325
            V  VLRIYE SMRRMH+GH D  +R+    +TD IML LFHNC+LFLRQS + N +FAL+
Sbjct  61   VSAVLRIYEYSMRRMHVGHNDEITRRFIIKETDVIMLKLFHNCLLFLRQSGHTNWMFALI  120

Query  326  RLALELNFPGLTVDCLEARAADELPLIEFEELVLQSGMPLPEIWTRVERLRQAYNFLPYP  385
            RL++ELNFP LT +CL+A A  E  LI FEE+VL+SGMP+PEIWTRVE+LRQAY FLP  
Sbjct  121  RLSMELNFPYLTFECLQAHAGREKALIGFEEVVLRSGMPMPEIWTRVEQLRQAYCFLPLK  180

Query  386  QMQHSSTDAVEGGLDPQRFIFSDDVCHYIYPLKAPGNRLQLLLLVVQLTKMPLVRSDCLA  445
                SST+  +  ++ +R+  SD +  Y++ LK+  NRL L+L+VVQL K+PL+RS  LA
Sbjct  181  DKLASSTNVFKNKMNAERYFCSDKLVPYVHALKSQNNRLHLVLVVVQLMKLPLIRSASLA  240

Query  446  EKLSKRIDAQLGDSEAIEMLLAGLADRSSYALPPTDQDHDFLSALLDLSRELCVTPSFMP  505
            +KL+  I+   G+SEAIEML A + DR SYA+       D  +A++DL+RE+ VTPS+MP
Sbjct  241  DKLNPCIE-DFGESEAIEMLFAAIVDRHSYAVASLQYQFD--AAMIDLAREMSVTPSYMP  297

Query  506  HCLGSDLYAATIGGLLLKCSEAFQGDEDKRRLFVVLWLRFQRLQLVLHKLTG  557
            H +G  LYA T+  +LLKC E F G+E KRRL ++L+LRFQ+L +VLHK  G
Sbjct  298  HLVGHKLYADTVSNMLLKCVEVFIGEESKRRLLLILYLRFQKLLIVLHKSMG  349


>Q8IR40_DROME unnamed protein product
Length=731

 Score = 333 bits (853),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/319 (56%), Positives = 235/319 (74%), Gaps = 3/319 (1%)

Query  239  MLQQSPFVFSLWSSLIMATQGTMARCNVPDVLRIYEDSMRRMHLGHTDTSSRQLDTVDTD  298
            ML+++PF ++LWS+LIM TQG MA CNV  VLRIYE SMRRMH+GH D  +R+    +TD
Sbjct  1    MLKRNPFQYTLWSNLIMITQGDMACCNVSAVLRIYEYSMRRMHVGHNDEITRRFIIKETD  60

Query  299  KIMLDLFHNCVLFLRQSANNNHVFALLRLALELNFPGLTVDCLEARAADELPLIEFEELV  358
             IML LFHNC+LFLRQS + N +FAL+RL++ELNFP LT +CL+A A  E  LI FEE+V
Sbjct  61   VIMLKLFHNCLLFLRQSGHTNWMFALIRLSMELNFPYLTFECLQAHAGREKALIGFEEVV  120

Query  359  LQSGMPLPEIWTRVERLRQAYNFLPYPQMQHSSTDAVEGGLDPQRFIFSDDVCHYIYPLK  418
            L+SGMP+PEIWTRVE+LRQAY FLP      SST+  +  ++ +R+  SD +  Y++ LK
Sbjct  121  LRSGMPMPEIWTRVEQLRQAYCFLPLKDKLASSTNVFKNKMNAERYFCSDKLVPYVHALK  180

Query  419  APGNRLQLLLLVVQLTKMPLVRSDCLAEKLSKRIDAQLGDSEAIEMLLAGLADRSSYALP  478
            +  NRL L+L+VVQL K+PL+RS  LA+KL+  I+   G+SEAIEML A + DR SYA+ 
Sbjct  181  SQNNRLHLVLVVVQLMKLPLIRSASLADKLNPCIE-DFGESEAIEMLFAAIVDRHSYAVA  239

Query  479  PTDQDHDFLSALLDLSRELCVTPSFMPHCLGSDLYAATIGGLLLKCSEAFQGDEDKRRLF  538
                  D  +A++DL+RE+ VTPS+MPH +G  LYA T+  +LLKC E F G+E KRRL 
Sbjct  240  SLQYQFD--AAMIDLAREMSVTPSYMPHLVGHKLYADTVSNMLLKCVEVFIGEESKRRLL  297

Query  539  VVLWLRFQRLQLVLHKLTG  557
            ++L+LRFQ+L +VLHK  G
Sbjct  298  LILYLRFQKLLIVLHKSMG  316



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016425.1 1,5-anhydro-D-fructose reductase isoform X1
[Drosophila kikkawai]

Length=317
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PI17_DROME  unnamed protein product                                 279     4e-93
Q8IQF8_DROME  unnamed protein product                                 275     8e-91
Q9VTK9_DROME  unnamed protein product                                 271     6e-90


>M9PI17_DROME unnamed protein product
Length=316

 Score = 279 bits (714),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/316 (52%), Positives = 204/316 (65%), Gaps = 6/316 (2%)

Query  5    PTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAFFYQNEAEVGKAIRDK  64
            P VK NNG E+PI+GLGT+ S   +   AVK AID GYRHID A+ YQNE EVG  +  K
Sbjct  4    PNVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAK  63

Query  65   IAEGVVKREDIFLVTKLWNVFHDPALVEGICRKQLANFGLDYIDLYLMHMPVGYKYTDET  124
            I EGVVKRED+F+ +KLWN FH P LV+      L++  L Y+DLYL+H P+GYK  +  
Sbjct  64   IKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYK--EGC  121

Query  125  NLMPKDENDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVT  184
            +L P D++     S VDY+DT+KAMEKLV+ GLV+SIGVSNFN  Q+ RVL    I PVT
Sbjct  122  DLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVT  181

Query  185  NQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQK---PDFIYSPEVTAIAQKYG  241
            NQ+EC P L QK L  FCK  D+T+T Y+PLG P     K   P  +   ++  IA K  
Sbjct  182  NQIECHPYLTQKKLIDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKK  241

Query  242  KTTPQVVLRYLVGLGVIPIPKSSNPKRISENFDVFDFELTPEEMTVLDGYHTGERVVPLN  301
            KT  Q+++RY V    I IPKS    RI  NF VFDFELTPEE+ +++ +    R+VPL 
Sbjct  242  KTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPL-  300

Query  302  LIKGQNHKYYPFAIEF  317
            L     HKYYPF  E+
Sbjct  301  LKDAGTHKYYPFHDEY  316


>Q8IQF8_DROME unnamed protein product
Length=350

 Score = 275 bits (702),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 161/317 (51%), Positives = 204/317 (64%), Gaps = 6/317 (2%)

Query  4    APTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAFFYQNEAEVGKAIRD  63
            AP V   +G E+P++GLGT+NS   +   AVK AID GYRHID A+ YQNE EVG  +  
Sbjct  37   APKVVCLDGNEIPVIGLGTFNSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEA  96

Query  64   KIAEGVVKREDIFLVTKLWNVFHDPALVEGICRKQLANFGLDYIDLYLMHMPVGYKYTDE  123
            KI EGVVKRED+F+ +KLWN FH P LV+      L++  L Y+DLYL+H P+GYK  + 
Sbjct  97   KIKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYK--EG  154

Query  124  TNLMPKDENDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPV  183
             +L P D++     S VDY+DT+KAMEKLV+ GLV+SIGVSNFN  Q+ RVL    I PV
Sbjct  155  CDLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPV  214

Query  184  TNQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQK---PDFIYSPEVTAIAQKY  240
            TNQ+EC P L QK L  FCK  D+T+T Y+PLG P     K   P  +   ++  IA K 
Sbjct  215  TNQIECHPYLTQKKLIDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKK  274

Query  241  GKTTPQVVLRYLVGLGVIPIPKSSNPKRISENFDVFDFELTPEEMTVLDGYHTGERVVPL  300
             KT  Q+++RY V    I IPKS    RI  NF VFDFELTPEE+ +++ +    R+VPL
Sbjct  275  KKTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVPL  334

Query  301  NLIKGQNHKYYPFAIEF  317
             L     HKYYPF  E+
Sbjct  335  -LKDAGTHKYYPFHDEY  350


>Q9VTK9_DROME unnamed protein product
Length=316

 Score = 271 bits (693),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 158/312 (51%), Positives = 201/312 (64%), Gaps = 7/312 (2%)

Query  5    PTVKLNNGYEMPILGLGTYNSKDNEGEAAVKHAIDVGYRHIDTAFFYQNEAEVGKAIRDK  64
            P VK NNG E+PI+GLGT+ S   +   AVK AID GYRHID A+ YQNE EVG  +  K
Sbjct  4    PNVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAK  63

Query  65   IAEGVVKREDIFLVTKLWNVFHDPALVEGICRKQLANFGLDYIDLYLMHMPVGYKYTDET  124
            I EGVVKRED+F+ +KLWN FH P LV+      L++  L Y+DLYL+H P+GYK  +  
Sbjct  64   IKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMGYK--EGC  121

Query  125  NLMPKDENDVLQLSDVDYLDTYKAMEKLVKLGLVRSIGVSNFNSEQLARVLANCEIKPVT  184
            +L P D++     S VDY+DT+KAMEKLV+ GLV+SIGVSNFN  Q+ RVL    I PVT
Sbjct  122  DLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVT  181

Query  185  NQVECSPALNQKALTAFCKKNDVTLTGYTPLGKPKPDIQK---PDFIYSPEVTAIAQKYG  241
            NQ+EC P L QK L  FCK  D+T+T Y+PLG P     K   P  +   ++  IA K  
Sbjct  182  NQIECHPYLTQKKLIDFCKSKDITITAYSPLGSPNRPWAKAGDPVILEEAKIKEIAAKKK  241

Query  242  KTTPQVVLRYLVGLGVIPIPKSSNPKRISENFDVFDFELTPEEMTVLDGYHTGERVVPLN  301
            KT  Q+++RY V    I IPKS    RI  NF VFDFELTPEE+ +++ +    R+VP  
Sbjct  242  KTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVP--  299

Query  302  LIKGQNHKYYPF  313
            L+    H ++PF
Sbjct  300  LLNQYGHPHHPF  311



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016426.1 aldo-keto reductase family 1 member B1 isoform X2
[Drosophila kikkawai]

Length=311
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8T492_DROME  unnamed protein product                                 229     1e-73
Q9VTL0_DROME  unnamed protein product                                 228     5e-73
M9PI17_DROME  unnamed protein product                                 224     8e-72


>Q8T492_DROME unnamed protein product
Length=322

 Score = 229 bits (584),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/311 (38%), Positives = 182/311 (59%), Gaps = 4/311 (1%)

Query  5    PTVKLNNGYEMPILGLGTYNLKKSRCVDAVRHALELGYRHIDTAFLYRNEGLVGKVLGEF  64
            P   L+NG  MP+LGLGT+         AV+ A+++GYRH D A +Y NE  VG  L E 
Sbjct  4    PNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREK  63

Query  65   VGARKVQREQVFLVTKLWDIYHEPKRVQYACELQLKQLDVDYIDLYLMHSPVGVHYNSDE  124
            +    V R+++F+ +KLW+ +H+P  V+ ACE  ++ L V Y++LYLMH P+     SD 
Sbjct  64   MDEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDN  123

Query  125  DMMPHLENGELWTNNVDYLDTYKSMEQLVDLGLVRSLGLSNFNLDQLQRLLLSCRIKPAA  184
                  +  +    ++DY+DT+++ME LVD GL +++G+SNFN  Q+ RLL   ++KP  
Sbjct  124  LYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVV  183

Query  185  LQIECHPELVQIPLMELCKLHNITVVAYSPLGRPTTGRPLPEFY---KDTKVVEMAKKYQ  241
            LQIECHP L Q PL+ LC  + I V AYS LG   T    P  Y   +   ++ +A+KY+
Sbjct  184  LQIECHPYLSQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYE  243

Query  242  KTPAQVVLRYLIDLGTVPIPKAAQKGHLKENLD-VFDFKLTTEELLHFESFNRGQRIWKF  300
            +T AQV+LRY    G + IP++  K H+ +N   ++DF+L  +++      +   R    
Sbjct  244  RTAAQVLLRYQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTM  303

Query  301  EKAKHHQYYPY  311
            + A  H ++P+
Sbjct  304  KAAYGHPHHPF  314


>Q9VTL0_DROME unnamed protein product
Length=322

 Score = 228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 117/311 (38%), Positives = 182/311 (59%), Gaps = 4/311 (1%)

Query  5    PTVKLNNGYEMPILGLGTYNLKKSRCVDAVRHALELGYRHIDTAFLYRNEGLVGKVLGEF  64
            P   L+NG  MP+LGLGT+         AV+ A+++GYRH D A +Y NE  VG  L E 
Sbjct  4    PNFLLSNGKNMPMLGLGTWRSPPEVVTQAVKDAIDIGYRHFDCAHIYGNEAQVGAALREK  63

Query  65   VGARKVQREQVFLVTKLWDIYHEPKRVQYACELQLKQLDVDYIDLYLMHSPVGVHYNSDE  124
            +    V R+++F+ +KLW+ +H+P  V+ ACE  ++ L V Y++LYLMH P+     SD 
Sbjct  64   MDEGVVTRDELFITSKLWNTHHKPDLVRPACETSIRNLGVKYLNLYLMHWPMAYKSGSDN  123

Query  125  DMMPHLENGELWTNNVDYLDTYKSMEQLVDLGLVRSLGLSNFNLDQLQRLLLSCRIKPAA  184
                  +  +    ++DY+DT+++ME LVD GL +++G+SNFN  Q+ RLL   ++KP  
Sbjct  124  LYPTCPDTNKAAFEDIDYVDTWRAMENLVDEGLCQAIGVSNFNEQQMNRLLSVAKLKPVV  183

Query  185  LQIECHPELVQIPLMELCKLHNITVVAYSPLGRPTTGRPLPEFY---KDTKVVEMAKKYQ  241
            LQIECHP L Q PL+ LC  + I V AYS LG   T    P  Y   +   ++ +A+KY+
Sbjct  184  LQIECHPYLSQKPLITLCYDNAIAVTAYSCLGSGHTPYEKPGAYPLLQHPTILAIAEKYE  243

Query  242  KTPAQVVLRYLIDLGTVPIPKAAQKGHLKENLD-VFDFKLTTEELLHFESFNRGQRIWKF  300
            +T AQV+LR+    G + IP++  K H+ +N   ++DF+L  +++      +   R    
Sbjct  244  RTAAQVLLRFQTQSGIIVIPRSVSKQHMLDNFKRIWDFELAVDDIQAINELDCNGRFMTM  303

Query  301  EKAKHHQYYPY  311
            + A  H ++P+
Sbjct  304  KAAYGHPHHPF  314


>M9PI17_DROME unnamed protein product
Length=316

 Score = 224 bits (572),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 134/313 (43%), Positives = 198/313 (63%), Gaps = 10/313 (3%)

Query  5    PTVKLNNGYEMPILGLGTYNLKKSRCVDAVRHALELGYRHIDTAFLYRNEGLVGKVLGEF  64
            P VK NNG E+PI+GLGT+   K +  +AV+ A++ GYRHID A++Y+NE  VG  +   
Sbjct  4    PNVKFNNGKEVPIIGLGTWGSPKGQVTEAVKVAIDAGYRHIDCAYVYQNEDEVGDGVEAK  63

Query  65   VGARKVQREQVFLVTKLWDIYHEPKRVQYACELQLKQLDVDYIDLYLMHSPVGVHYNSDE  124
            +    V+RE +F+ +KLW+ +H P  V+ A E  L  L + Y+DLYL+H P+G  Y    
Sbjct  64   IKEGVVKREDLFITSKLWNTFHRPDLVKSALENTLSSLKLKYLDLYLIHWPMG--YKEGC  121

Query  125  DMMPHLENGELWTNNVDYLDTYKSMEQLVDLGLVRSLGLSNFNLDQLQRLLLSCRIKPAA  184
            D+ P  ++G+   + VDY+DT+K+ME+LV+ GLV+S+G+SNFN  Q++R+L    I P  
Sbjct  122  DLFPTDKDGKTLYSPVDYVDTWKAMEKLVEEGLVKSIGVSNFNRRQIERVLEVATIPPVT  181

Query  185  LQIECHPELVQIPLMELCKLHNITVVAYSPLGRPTTGRPL-----PEFYKDTKVVEMAKK  239
             QIECHP L Q  L++ CK  +IT+ AYSPLG P   RP      P   ++ K+ E+A K
Sbjct  182  NQIECHPYLTQKKLIDFCKSKDITITAYSPLGSPN--RPWAKAGDPVILEEAKIKEIAAK  239

Query  240  YQKTPAQVVLRYLIDLGTVPIPKAAQKGHLKENLDVFDFKLTTEELLHFESFN-RGQRIW  298
             +KTP Q+++RY +    + IPK+  K  ++ N  VFDF+LT EE+   ESF   G+ + 
Sbjct  240  KKKTPGQILIRYQVQRANIVIPKSVTKDRIESNFQVFDFELTPEEIEIIESFECNGRLVP  299

Query  299  KFEKAKHHQYYPY  311
              + A  H+YYP+
Sbjct  300  LLKDAGTHKYYPF  312



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016427.1 iroquois-class homeodomain protein IRX-6 [Drosophila
kikkawai]

Length=650
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

O01667_DROME  unnamed protein product                                 1225    0.0  
M9PI45_DROME  unnamed protein product                                 1222    0.0  
Q9VU01_DROME  unnamed protein product                                 1221    0.0  


>O01667_DROME unnamed protein product
Length=641

 Score = 1225 bits (3169),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/650 (95%), Positives = 625/650 (96%), Gaps = 9/650 (1%)

Query  1    MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGISGP  60
            MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGI+GP
Sbjct  1    MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGIAGP  60

Query  61   GHSGMVTSTVPPGARSTSPCGPTAGLPALPLPLVGGPPPPGGPHSAGPPGGGAPGGGPGS  120
            GHSGMVTSTVPPGARSTSPCGP+AGLPAL L  VG PPP  GPHS+ P G  APG G   
Sbjct  61   GHSGMVTSTVPPGARSTSPCGPSAGLPALSL--VGAPPP--GPHSSAPGGAPAPGAG-NP  115

Query  121  GNRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ  180
             NRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ
Sbjct  116  PNRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ  175

Query  181  PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET  240
            PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET
Sbjct  176  PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET  235

Query  241  TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR  300
            TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR
Sbjct  236  TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR  295

Query  301  VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMLADRPGESNNSEWSES  360
            VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDM+ DRPGESNNSEWSES
Sbjct  296  VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSES  355

Query  361  RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ  420
            RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ
Sbjct  356  RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ  415

Query  421  QAQQNSLQTAVGGTAKPRIWSLADMASKDSKESSSGAKDNLAAELPPTHPGFYGHPGQQP  480
            QAQQNSLQTAVGGTAKPRIWSLADMASKDSK+SSSGAKDN   ELPP HPGFYGHPGQQP
Sbjct  416  QAQQNSLQTAVGGTAKPRIWSLADMASKDSKDSSSGAKDN-HPELPPAHPGFYGHPGQQP  474

Query  481  SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHLSAPTQEFLEHQRSFGASLAAHNGP  540
            SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHL APTQEFLEHQR+FGASLAAHNGP
Sbjct  475  SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHLGAPTQEFLEHQRTFGASLAAHNGP  534

Query  541  LGMNPLLWKAAVSGAANGPHFAPLSLTTSGGGGASGAQHQVAPPPVASPSASSSSSSMGC  600
            LGMNPLLWKAAVSGAANGPHFAPLSLTTS  GG+SG Q QVAPPPVASPSASSSSSSMGC
Sbjct  535  LGMNPLLWKAAVSGAANGPHFAPLSLTTS--GGSSGGQ-QVAPPPVASPSASSSSSSMGC  591

Query  601  DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP  650
            DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP
Sbjct  592  DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP  641


>M9PI45_DROME unnamed protein product
Length=682

 Score = 1222 bits (3162),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/650 (95%), Positives = 624/650 (96%), Gaps = 9/650 (1%)

Query  1    MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGISGP  60
            MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGI+GP
Sbjct  1    MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGIAGP  60

Query  61   GHSGMVTSTVPPGARSTSPCGPTAGLPALPLPLVGGPPPPGGPHSAGPPGGGAPGGGPGS  120
            GHSGMVTSTVPPGARSTSPCGP+AGLPAL L  VG PPP  GPHS+ P G  APG G   
Sbjct  61   GHSGMVTSTVPPGARSTSPCGPSAGLPALSL--VGAPPP--GPHSSAPGGAPAPGAG-NP  115

Query  121  GNRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ  180
             NRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ
Sbjct  116  PNRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ  175

Query  181  PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET  240
            PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET
Sbjct  176  PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET  235

Query  241  TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR  300
            TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR
Sbjct  236  TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR  295

Query  301  VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMLADRPGESNNSEWSES  360
            VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDM+ DRPGESNNSEWSES
Sbjct  296  VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSES  355

Query  361  RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ  420
            RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ
Sbjct  356  RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ  415

Query  421  QAQQNSLQTAVGGTAKPRIWSLADMASKDSKESSSGAKDNLAAELPPTHPGFYGHPGQQP  480
            QAQQNSLQTAVGGTAKPRIWSLADMASKDSK+SSSGAKDN   ELPP HPGFYGHPGQQP
Sbjct  416  QAQQNSLQTAVGGTAKPRIWSLADMASKDSKDSSSGAKDN-HPELPPAHPGFYGHPGQQP  474

Query  481  SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHLSAPTQEFLEHQRSFGASLAAHNGP  540
            SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHL APTQEFLEHQR+FGASLAAHNGP
Sbjct  475  SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHLGAPTQEFLEHQRTFGASLAAHNGP  534

Query  541  LGMNPLLWKAAVSGAANGPHFAPLSLTTSGGGGASGAQHQVAPPPVASPSASSSSSSMGC  600
            LGMNPLLWKAAVSGAANG HFAPLSLTTS  GG+SG Q QVAPPPVASPSASSSSSSMGC
Sbjct  535  LGMNPLLWKAAVSGAANGHHFAPLSLTTS--GGSSGGQ-QVAPPPVASPSASSSSSSMGC  591

Query  601  DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP  650
            DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP
Sbjct  592  DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP  641


>Q9VU01_DROME unnamed protein product
Length=641

 Score = 1221 bits (3160),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/650 (95%), Positives = 624/650 (96%), Gaps = 9/650 (1%)

Query  1    MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGISGP  60
            MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGI+GP
Sbjct  1    MTVHSNETGICLVMNAVSTHLATSSPNTPPTNAPQSPPSTLPTLACPAAQPLSAPGIAGP  60

Query  61   GHSGMVTSTVPPGARSTSPCGPTAGLPALPLPLVGGPPPPGGPHSAGPPGGGAPGGGPGS  120
            GHSGMVTSTVPPGARSTSPCGP+AGLPAL L  VG PPP  GPHS+ P G  APG G   
Sbjct  61   GHSGMVTSTVPPGARSTSPCGPSAGLPALSL--VGAPPP--GPHSSAPGGAPAPGAG-NP  115

Query  121  GNRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ  180
             NRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ
Sbjct  116  PNRCCDTGRTIYTDPVSGQTICSCQYDMLNYQRLAAAGGVPLGVYPEGMSAYLSGIAADQ  175

Query  181  PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET  240
            PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET
Sbjct  176  PPFYANPAGIDLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGMDLNGARRKNATRET  235

Query  241  TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR  300
            TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR
Sbjct  236  TSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMTWEPRNR  295

Query  301  VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMLADRPGESNNSEWSES  360
            VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDM+ DRPGESNNSEWSES
Sbjct  296  VDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRSGRLGDMMTDRPGESNNSEWSES  355

Query  361  RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ  420
            RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ
Sbjct  356  RPGSPNGSPDLYDRPGSMPPGAHPLFHPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQHQ  415

Query  421  QAQQNSLQTAVGGTAKPRIWSLADMASKDSKESSSGAKDNLAAELPPTHPGFYGHPGQQP  480
            QAQQNSLQTAVGGTAKPRIWSLADMASKDSK+SSSGAKDN   ELPP HPGFYGHPGQQP
Sbjct  416  QAQQNSLQTAVGGTAKPRIWSLADMASKDSKDSSSGAKDN-HPELPPAHPGFYGHPGQQP  474

Query  481  SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHLSAPTQEFLEHQRSFGASLAAHNGP  540
            SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHL APTQEFLEHQR+FGASLAAHNGP
Sbjct  475  SPGKILSPLAARIPNYSPYVRPDLYRGFYGPAAAHLGAPTQEFLEHQRTFGASLAAHNGP  534

Query  541  LGMNPLLWKAAVSGAANGPHFAPLSLTTSGGGGASGAQHQVAPPPVASPSASSSSSSMGC  600
            LGMNPLLWKAAVSGAANG HFAPLSLTTS  GG+SG Q QVAPPPVASPSASSSSSSMGC
Sbjct  535  LGMNPLLWKAAVSGAANGHHFAPLSLTTS--GGSSGGQ-QVAPPPVASPSASSSSSSMGC  591

Query  601  DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP  650
            DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP
Sbjct  592  DVVHIPTSSGQSAAQHMMGPISSNSTASSSSSHSGKISPGVNVTSLSAKP  641



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016428.1 uncharacterized protein LOC108070459 [Drosophila
kikkawai]

Length=2739
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q54CF8_DICDI  unnamed protein product                                 35.0    1.2  


>Q54CF8_DICDI unnamed protein product
Length=3071

 Score = 35.0 bits (79),  Expect = 1.2, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 1/54 (2%)

Query  899   QSKEDKEQQGVRKSKNDEERQEVRESKDDEEGQEVRKSKADEENQEVREFKEVD  952
             +SK+D++ +   KSK+DE+ Q+  +SKDDE+ ++  KSK  EENQ+     EVD
Sbjct  1950  KSKDDEKSKDDEKSKDDEKSQDDEKSKDDEKSKDDEKSKL-EENQDESTPMEVD  2002



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016429.1 tyrosine-protein phosphatase 69D isoform X1
[Drosophila kikkawai]

Length=1460
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PTP69_DROME  unnamed protein product                                  2717    0.0   
LAR_DROME  unnamed protein product                                    395     7e-113
PTPR_CAEEL  unnamed protein product                                   385     2e-111


>PTP69_DROME unnamed protein product
Length=1462

 Score = 2717 bits (7043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1295/1465 (88%), Positives = 1375/1465 (94%), Gaps = 8/1465 (1%)

Query  1     MALLCRRMSTLLIIILAYIFLGTICVQGSVKREWVEIGKNLSLECASENEAAVWTLGNQT  60
             MALL RRMS LL IILAYIFL  ICVQGSVK+EW EIGKN+SLECASENEA  W LGNQT
Sbjct  1     MALLYRRMSMLLNIILAYIFLCAICVQGSVKQEWAEIGKNVSLECASENEAVAWKLGNQT  60

Query  61    IDKNTTRFELRTDPLNPNEGVSETNESPDFIKYKNVLTLRHINIKDSGKYTCTSPSGQNH  120
             I+KN TR+++RT+PL  N+  SE N+S DFIKYKNVL L  +NIKDSG YTCT+ +GQNH
Sbjct  61    INKNHTRYKIRTEPLKSNDDGSENNDSQDFIKYKNVLALLDVNIKDSGNYTCTAQTGQNH  120

Query  121   STEFHVEPYLPAKVLQSTADRIKRKVGQDVVLHCLIEMYPQNETTSKNMKWLKDGSPFEF  180
             STEF V PYLP+KVLQST DRIKRK+ QDV+L+CLIEMYPQNETT++N+KWLKDGS FEF
Sbjct  121   STEFQVRPYLPSKVLQSTPDRIKRKIKQDVMLYCLIEMYPQNETTNRNLKWLKDGSQFEF  180

Query  181   LDTFSSIAKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDTGLEAAFKEITLYVMEEPQVS  240
             LDTFSSI+KLNDTHLNFTLEFTEVYKKENGTYKCTVFDDTGLE   KEITL+VME PQVS
Sbjct  181   LDTFSSISKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDTGLEITSKEITLFVMEVPQVS  240

Query  241   IDFAKAVGSNKIYLNWTVNDGNDPVQKFFITFQEAGTPTFLYYKDIINGNQTSYILDNFK  300
             IDFAKAVG+NKIYLNWTVNDGNDP+QKFFIT QEAGTPTF Y+KD ING+ TSYILD+FK
Sbjct  241   IDFAKAVGANKIYLNWTVNDGNDPIQKFFITLQEAGTPTFTYHKDFINGSHTSYILDHFK  300

Query  301   PNTTYFLRISGKNSIGNGQTTQYPLGVNTLSFDPIFIPKVETTGSTASTITIGWDPPPPD  360
             PNTTYFLRI GKNSIGNGQ TQYP G+ TLS+DPIFIPKVETTGSTASTITIGW+PPPPD
Sbjct  301   PNTTYFLRIVGKNSIGNGQPTQYPQGITTLSYDPIFIPKVETTGSTASTITIGWNPPPPD  360

Query  361   LIEYIQYYELVVSESN---KTIEEAIYQQNSRNLPYMFDKLKTATDYEFKVRACSDLTKT  417
             LI+YIQYYEL+VSES    K IEEAIYQQNSRNLPYMFDKLKTATDYEF+VRACSDLTKT
Sbjct  361   LIDYIQYYELIVSESGEVPKVIEEAIYQQNSRNLPYMFDKLKTATDYEFRVRACSDLTKT  420

Query  418   CGPWSEIVNGTTMDGVATKPTNLTIHCHHDNVTRSNSISINWDVPKTPNGKVVSYLIHLQ  477
             CGPWSE VNGTTMDGVATKPTNL+I CHHDNVTR NSI+INWDVPKTPNGKVVSYLIHL 
Sbjct  421   CGPWSENVNGTTMDGVATKPTNLSIQCHHDNVTRGNSIAINWDVPKTPNGKVVSYLIHLL  480

Query  478   GNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPAAGSCRM  537
             GNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPA GSC M
Sbjct  481   GNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPATGSCLM  540

Query  538   PVSTPDTIGRTMWTKVNLGSKYILKSYLPKISERNGPICCYRLYLVRINNANNNELPEPE  597
             PVSTPD IGRTMW+KVNL SKY+LK YLPKISERNGPICCYRLYLVRINN +N ELP+PE
Sbjct  541   PVSTPDAIGRTMWSKVNLDSKYVLKLYLPKISERNGPICCYRLYLVRINN-DNKELPDPE  599

Query  598   KLNVATYQQVHSDNVTRSSAYIAEMMSSKYFRPEVFLGDEVRFSENNEIIRENDDICRRC  657
             KLN+ATYQ+VHSDNVTRSSAYIAEM+SSKYFRPE+FLGDE RFSENN+IIR+ND+ICR+C
Sbjct  600   KLNIATYQEVHSDNVTRSSAYIAEMISSKYFRPEIFLGDEKRFSENNDIIRDNDEICRKC  659

Query  658   LAGTTFLRKPETVHRPPPLSSLSNSDLEAG--DRDNNLIKGANLTEHALKILENKLRARR  715
             L GT FLRKPE +H PP   SLSNSD E       +NLIKGANLTEHALKILE+KLR +R
Sbjct  660   LEGTPFLRKPEIIHIPPQ-GSLSNSDSELPILSEKDNLIKGANLTEHALKILESKLRDKR  718

Query  716   NAVTSEESPVLSSSVNPTVPLLDTSRDVYDGQIDINSNYTGFLEIIVRDRDNVLMAYSKY  775
             NAVTS+E+P+LS+ VNP VPL D+SRDV+DG+IDINSNYTGFLEIIVRDR+N LMAYSKY
Sbjct  719   NAVTSDENPILSA-VNPNVPLHDSSRDVFDGEIDINSNYTGFLEIIVRDRNNALMAYSKY  777

Query  776   FDIITPATEAEPIPSLDNMDYYLNIGIKAGGILFGILIVIIVLWVFHHKKSKNALQGEDT  835
             FDIITPATEAEPI SL+NMDYYL+IG+KAG +L G+++V IVLWVFHHKK+KN LQGEDT
Sbjct  778   FDIITPATEAEPIQSLNNMDYYLSIGVKAGAVLLGVILVFIVLWVFHHKKTKNELQGEDT  837

Query  836   LTLRDSLSRAFFGRRSHNHSHFITSGSHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY  895
             LTLRDSLSRA FGRR+HNHSHFITSG+HKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY
Sbjct  838   LTLRDSLSRALFGRRNHNHSHFITSGNHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY  897

Query  896   EMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLSPVNGLQTADYINANFVIGYK  955
             EMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKL+ +NGLQT DYINANFVIGYK
Sbjct  898   EMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGYK  957

Query  956   ERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG  1015
             ERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG
Sbjct  958   ERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG  1017

Query  1016  DILVKFAQERKTGDYIERILNVSKNKANAGEEEDRRQITQYHYLTWKDFMAPEHPNGIIK  1075
             DILVKFAQERKTGDYIER LNVSKNKAN GEEEDRRQITQYHYLTWKDFMAPEHP+GIIK
Sbjct  1018  DILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGIIK  1077

Query  1076  FIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRN  1135
             FIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRN
Sbjct  1078  FIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRN  1137

Query  1136  FLVQSLKQYIFLYRALLDTGTFGNTDIGIETMSSAIESLKRKPNEGKCKLELEFEKLLAT  1195
             FLVQSLKQYIFLYRALLDTGTFGNTDI I+TM+SAIESLKRKPNEGKCKLE+EFEKLLAT
Sbjct  1138  FLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNEGKCKLEVEFEKLLAT  1197

Query  1196  TDEISKSCCVGDTEENNMKNRSQEIIPYDRNRVILTPLPLRDNSTYINASFIEGYDNSDT  1255
              DEISKSC VG+ EENNMKNRSQEIIPYDRNRVILTPLP+R+NSTYINASFIEGYDNS+T
Sbjct  1198  ADEISKSCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINASFIEGYDNSET  1257

Query  1256  FIIAQDPLENTIGDFWRMVSEQSVTTLVMISEIGDGPRKCPRYWADDEVQYDHILVKYVH  1315
             FIIAQDPLENTIGDFWRM+SEQSVTTLVMISEIGDGPRKCPRYWADDEVQYDHILVKYVH
Sbjct  1258  FIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGDGPRKCPRYWADDEVQYDHILVKYVH  1317

Query  1316  SESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKN  1375
             SESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKN
Sbjct  1318  SESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKN  1377

Query  1376  NKNTGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSY  1435
             NKN+GCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSY
Sbjct  1378  NKNSGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSY  1437

Query  1436  AQYEFLHRAIINYSDLHHIAESTSD  1460
             AQYEFLHRAIINYSDLHHIAEST D
Sbjct  1438  AQYEFLHRAIINYSDLHHIAESTLD  1462


>LAR_DROME unnamed protein product
Length=2029

 Score = 395 bits (1014),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 206/582 (35%), Positives = 330/582 (57%), Gaps = 17/582 (3%)

Query  870   PIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQ  929
             PI   +  N  +    + +  F +EYE +       T  NS+L+ N  KNRY ++ AYD 
Sbjct  1453  PIPISEFANHIERLKSNDNQKFSQEYESI-EPGQQFTWDNSNLEHNKSKNRYANVTAYDH  1511

Query  930   TRVKLSPVNGLQTADYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVML  989
             +RV+L  V G+  +DYINAN+  GY++   ++  QGP++ T  DFWRM WE     IVM+
Sbjct  1512  SRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMM  1571

Query  990   TNLEEYNKAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERILNVSKNKANAGEEED  1049
             T LEE  + KC +YWP +   T+ +G I V   + ++   Y  R   + +   N     D
Sbjct  1572  TRLEERTRIKCDQYWPTR--GTETYGQIFVTITETQELATYSIRTFQLCRQGFN-----D  1624

Query  1050  RRQITQYHYLTWKDFMAPEHPNGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALD  1109
             RR+I Q  +  W D   P+HP   ++F+R+  ++   + GP++VHCSAGVGRTG  + +D
Sbjct  1625  RREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVID  1684

Query  1110  SLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDIGIETMSS  1169
             S++++++ E  + IY  V  LR QRN++VQ+  QYIF++ A+L+    G T++    + +
Sbjct  1685  SMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHT  1744

Query  1170  AIESLK-RKPNEGKCKLELEFEKLLATTDEISKSCCVGDTEENNMKNRSQEIIPYDRNRV  1228
              ++ L   +P E    +E+EF+KL     + SK     +   N  KNR   I+PY+ +RV
Sbjct  1745  HLQKLLITEPGETISGMEVEFKKLSNVKMDSSK-FVTANLPCNKHKNRLVHILPYESSRV  1803

Query  1229  ILTPLPLRDNSTYINASFIEGYDNSDTFIIAQDPLENTIGDFWRMVSEQSVTTLVMISEI  1288
              LTP+   + S Y+NASFI+GY     +I AQ P+++   DFWRM+ E + T +VM++++
Sbjct  1804  YLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKL  1863

Query  1289  GD-GPRKCPRYWADDE-VQYDHILVKYVHSESCPYYTRREFYVTNCKIDDTLKVTQFQYN  1346
              + G  KC +YW  +  V+Y + +V  +   + P Y  REF VT+ +   +  V QFQ+ 
Sbjct  1864  KEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFI  1923

Query  1347  GWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNTGCRSPLTVHCSLGTDRSSIFVAMCILV  1406
              WP  +  VP+   G I+ + Q    +K  +  G   P+TVHCS G  RS +F+ + I++
Sbjct  1924  DWP--EQGVPKSGEGFIDFIGQV---HKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVL  1978

Query  1407  QHLRLEKCVDICATTRKLRSQRTGLINSYAQYEFLHRAIINY  1448
             + ++ E  +D+  T R LRSQR  ++ +  QY F +RA + Y
Sbjct  1979  ERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY  2020


 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 68/265 (26%), Positives = 119/265 (45%), Gaps = 31/265 (12%)

Query  290  NQTSYILDNFKPNTTYFLRISGKNSIGNGQTTQYPLGVNTLSFDPIFIPK-VETTGSTAS  348
            N  +Y LD   P+T Y++ ++ ++  G G TT  P+ V T  + P   P+ +    ++++
Sbjct  567  NSEAYTLDGLYPDTLYYIWLAARSQRGEGATTP-PIPVRTKQYVPGAPPRNITAIATSST  625

Query  349  TITIGWDPPPPDLIE-YIQYYELVVSESNKTIEEAIYQQ-NSRNLPYMFDKLKTATDYEF  406
            TI++ W PPP +     I YY++   E  +  +EA     N  ++  + D+LK  T+Y+ 
Sbjct  626  TISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSI--VLDELKRWTEYKI  683

Query  407  KVRACSDLTKTCGPWSEIVNGTTMDGVATKPTNLTIHCHHDNVTRSNSISINWDVP--KT  464
             V A + +    GP S  +   T + V   P ++           S SI ++W  P  K 
Sbjct  684  WVLAGTSVGD--GPRSHPIILRTQEDVPGDPQDVKA-----TPLNSTSIHVSWKPPLEKD  736

Query  465  PNGKVVSYLIHLQGNPMSTVDREMWGPKIRRIDEPHHKTLYES-------VSPNTNYTVT  517
             NG +  Y IH Q         E+       ++EP    + ++       + P+T Y++ 
Sbjct  737  RNGIIRGYHIHAQ---------ELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQ  787

Query  518  VSAITRHKKNGEPAAGSCRMPVSTP  542
            V+A+TR       AA   + P   P
Sbjct  788  VAALTRKGDGDRSAAIVVKTPGGVP  812


 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 132/331 (40%), Gaps = 84/331 (25%)

Query  177   PFEF--LDT--FSSIAKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDT-GLEAAFKEITL  231
             PF+F  +DT  F+      DT   ++++   + +K +G     +   T G       ++L
Sbjct  762   PFKFDVVDTLEFNVTGLQPDT--KYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSL  819

Query  232   YVME-EPQVSIDF-----AKAVGSNKIY-LNWTVNDGNDPVQKFFITFQEAGTPTFLYYK  284
              +ME EP VSI+      A+  G  + Y L W V D                       +
Sbjct  820   KIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQ-------------------ALKE  860

Query  285   DIINGNQ-TSYILDNFKPNTTYFLRISGKNSIGNGQTTQYPLGVNTLSFDPIFIPKVETT  343
             ++++G Q T    DN +    Y  R++G N IG GQ T             IF     T 
Sbjct  861   EMLSGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVK-----------IFQTPEGTP  909

Query  344   GSTASTITI----------GWDPPPPD-----LIEY-IQYYELV----VSESNKTIEEAI  383
             G   S ITI           WDPP  +     +  Y +Q+++ +     SE N T+ +A+
Sbjct  910   GGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAV  969

Query  384   YQQNSRNLPYMFDKLKTATDYEFKVRACSDLTKTCGPWSEIVNGTTMDGVATKPTNLTIH  443
                        F  L+  T+Y F+VRA +   +  GP+S+ +   T   +   P +L   
Sbjct  970   -----------FTNLEENTEYIFRVRAYTK--QGAGPFSDKLIVETERDMGRAPMSL---  1013

Query  444   CHHDNVTRSNSISINWDVPKTPNGKVVSYLI  474
                   T   +  I W+ P T  GK++ Y I
Sbjct  1014  --QAEATSEQTAEIWWE-PVTSRGKLLGYKI  1041


 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 27/203 (13%)

Query  340  VETTGSTASTITIGWDPPPPDLIEY--IQYYELVVSESNKTIEEAIYQQNSRNLPYMFDK  397
            V+ +  TA+++ + W    P+ ++Y  IQY     +++   I   I       + Y+   
Sbjct  328  VQISEVTATSVRLEWSYKGPEDLQYYVIQYKPKNANQAFSEISGII------TMYYVVRA  381

Query  398  LKTATDYEFKVRACSDLTKTCGPWSEIVNGTTMD-GVATKPTNLTIHCHHDNVTRSNSIS  456
            L   T+YEF V A +++ +  GP S     TT +  + + P N+ +         S+++ 
Sbjct  382  LSPYTEYEFYVIAVNNIGR--GPPSAPATCTTGETKMESAPRNVQVRT-----LSSSTMV  434

Query  457  INWDVPKTPNGKVVSYLIHLQGNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTV  516
            I W+ P+TPNG+V  Y ++   N  S      W  ++  +D     T+ E ++P+  YTV
Sbjct  435  ITWEPPETPNGQVTGYKVYYTTN--SNQPEASWNSQM--VDNSELTTVSE-LTPHAIYTV  489

Query  517  TVSAITRHKKNGEPAAGSCRMPV  539
             V A T         AG    PV
Sbjct  490  RVQAYTSM------GAGPMSTPV  506


 Score = 38.1 bits (87),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 125/318 (39%), Gaps = 44/318 (14%)

Query  295   ILDNFKPNTTYFLRISGKNSIGNGQ-------TTQYPLGVNTLSFDPIFIPKVETTGSTA  347
             +  N + NT Y  R+      G G         T+  +G   +S        ++   ++ 
Sbjct  969   VFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMS--------LQAEATSE  1020

Query  348   STITIGWDPPPP--DLIEYIQYYELVVSESNKTIEEAIYQQNSRNLPYMFDKLKTATDYE  405
              T  I W+P      L+ Y  +Y +   E         +Q  +  L    D +      +
Sbjct  1021  QTAEIWWEPVTSRGKLLGYKIFYTMTAVEDLDD-----WQTKTVGLTESADLVNLEKFAQ  1075

Query  406   FKVRACSDLTKTCGPWSEIVNGTTMDGVATKPTNLTIHCHHDNVTRSNSISINWDVP--K  463
             + V   +      G  SE V       V  KP ++ ++    +V+ ++S++++W  P   
Sbjct  1076  YAVAIAARFKNGLGRLSEKVT------VRIKPEDVPLNLRAHDVS-THSMTLSWSPPIRL  1128

Query  464   TPNGKVVSY-----LIHLQGNPMSTVDREMWGPKIRRIDEPHHKT-LYESVSPNTNYTVT  517
             TP    +S+      +  QG   + +      PK   I + + KT     +SP T Y V 
Sbjct  1129  TPVNYKISFDAMKVFVDSQGFSQTQIV-----PKREIILKHYVKTHTINELSPFTTYNVN  1183

Query  518   VSAITRHKKNGEPAAGSCRMPVSTPDTIGRTMWTKVNLGSKYILKSYLPKISERNGPICC  577
             VSAI        P   +    ++ P  + +  +  V  G + ++   LP+ SE  GPI  
Sbjct  1184  VSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGEEILV--ILPQASEEYGPISH  1241

Query  578   YRLYLVRINNANNNELPE  595
             Y L +V  + +N +++P+
Sbjct  1242  YYLVVVPEDKSNLHKIPD  1259


>PTPR_CAEEL unnamed protein product
Length=1409

 Score = 385 bits (989),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 233/652 (36%), Positives = 353/652 (54%), Gaps = 87/652 (13%)

Query  866   FDAGPIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNRYPDIK  925
             F A P+   DL   Y  RH+DTD+ F +EYE LP+   D  T  S+ KENA KNRY DI+
Sbjct  770   FGAIPVD--DLPTEYVVRHRDTDFLFAQEYESLPHFQLD--TVASNRKENAIKNRYNDIR  825

Query  926   AYDQTRVKLSPVNGLQTADYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEI  985
             A+D TRVKL  +NG   +DYINANF+  +KE+K FI AQ P+++TI DFWRM+WEQ   +
Sbjct  826   AFDDTRVKLKKINGDDYSDYINANFIKSWKEKKLFIAAQAPVDATIGDFWRMVWEQESYL  885

Query  986   IVMLTNLEEYNKAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERILNVSKNKANAG  1045
             IVM+ NL E N+ +CAKYWP++     ++GDI+V+ A      DY  R  ++    A+ G
Sbjct  886   IVMVANLTEKNRQQCAKYWPDE--QITRYGDIIVEPASFSFHSDYAIRAFDI----AHIG  939

Query  1046  E------------------------EEDRRQITQYHYLTWKDFMAPEHPNGIIKFIRQIN  1081
             E                          + R+I QYH+  W D+ APE   G+++F+ ++ 
Sbjct  940   ECGPDVIPNGNGVEYANVPIVKGQFANNSRRILQYHFTNWNDYKAPECSTGLLRFMYRLR  999

Query  1082  SVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSL  1141
              +      P+++HCSAGVGRTGT +++DS++ Q   ED  +I+  VC+LR QRN +VQSL
Sbjct  1000  ELPQFNNSPVVIHCSAGVGRTGTFISIDSMLDQCLAEDKANIFEFVCNLRRQRNLMVQSL  1059

Query  1142  KQYIFLYRALLDTGTFGNTD---------------------IGIETMSSAIESLKRK---  1177
             +QY+F+Y+AL +   +G+TD                     +     SS   S+  +   
Sbjct  1060  EQYVFIYKALAEWHMYGDTDEDVRDFEDHYQRLCASNRDRAVSFNQQSSTNGSISPRVAI  1119

Query  1178  --------PNEGKCKLELEFEKLLAT-TDEISKSCCVGDTEENNMKNRSQEIIPYDRNRV  1228
                      + G+  LE EF+KL    T  +S +    D  EN +KNR +  +P+D+ RV
Sbjct  1120  VSSRESMTTSNGETGLEEEFKKLERNLTTPLSSNFAAKD--ENLLKNRYEAAVPFDKYRV  1177

Query  1229  ILTPLPLRDNSTYINASFIEGYDNSDTFIIAQDPL-ENTIGDFWRMVSEQSVTTLVMISE  1287
             IL P     +S+YINAS I+GY     +I AQDP+ E T  DFWRM+++Q+VTT+VM+S+
Sbjct  1178  ILPPTIGHADSSYINASHIKGYFFD--YIAAQDPVSEGTAFDFWRMIADQNVTTVVMLSD  1235

Query  1288  IGDGPRKCPRYWADD----EVQY----DHILVKYVHSESCPYYTRREFYVT---NCKIDD  1336
               D      +YW  D    E  +    + + V  V  E    +  R    +   N  +  
Sbjct  1236  ETDW-SDVEKYWPIDGSGTECHFGSERNSVNVTCVSEEHHQDFIIRNLSYSMKDNESMPA  1294

Query  1337  TLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNTGCRSPLTVHCSLGTDRS  1396
               +V Q+ Y GWP+ D  VP+    ++ L++      + +   G ++P+ VHC  G+  S
Sbjct  1295  NQEVVQYSYTGWPS-DSIVPKSANSLMNLIEMVLQ--RQSSLMGSQAPIVVHCRNGSSES  1351

Query  1397  SIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSYAQYEFLHRAIINY  1448
              IF+ + +L    + E+ +D+  T + L+S R  +   + QY F +RA+ +Y
Sbjct  1352  GIFICISLLWLRQKAEQRIDVFQTVKGLQSHRPMMFTRFEQYSFCYRALADY  1403


 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 60/225 (27%), Positives = 95/225 (42%), Gaps = 40/225 (18%)

Query  454  SISINWDVPKTPNGKVVSYLIHLQGN-------------PMST-VDREM--WGPK-----  492
            S  + W  P  PNG++  Y + ++G              P +  VD+    W        
Sbjct  386  SCEVEWKSPAEPNGRITKYFVSVRGAMRKSDGSLTPDDLPAAVEVDKRCANWDGDENTSK  445

Query  493  ---IRRID--EPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPAA--GSCRMPVSTPDTI  545
               I  ID     +   +  + PN NYTVTV A     ++  PA    +C    + PD +
Sbjct  446  HNGINPIDFANEFYSCKFGPLKPNRNYTVTVWAENSAGRS-LPAVFHKNCVTNYAQPDMV  504

Query  546  GRTMWTKVNLGSKYILKSYLPKISERNGPICCYRLYLVRI-NNANNNELPEPEKLNVATY  604
                    N  S + L    P   + NGPI CY + +V +  N + + LP+ E++ + ++
Sbjct  505  ETPQPLLSNNHSTFSLTFPQPP-DDINGPISCYYIAIVPLPANVSLDILPKSEEIVMHSF  563

Query  605  QQVHSDNVTRSS-------AYIAEMMSSKYFRPEVFLGDEVRFSE  642
             +V ++N+  SS       AYIAE  S      E  +GD VR S+
Sbjct  564  SKVFTNNLLPSSAEEKRFFAYIAE--SYVQLPEETTIGDGVRVSD  606



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016430.1 tyrosine-protein phosphatase 69D isoform X2
[Drosophila kikkawai]

Length=1459
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PTP69_DROME  unnamed protein product                                  2711    0.0   
PTPR_CAEEL  unnamed protein product                                   403     1e-117
LAR_DROME  unnamed protein product                                    394     8e-113


>PTP69_DROME unnamed protein product
Length=1462

 Score = 2711 bits (7028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1294/1465 (88%), Positives = 1374/1465 (94%), Gaps = 9/1465 (1%)

Query  1     MALLCRRMSTLLIIILAYIFLGTICVQGSVKREWVEIGKNLSLECASENEAAVWTLGNQT  60
             MALL RRMS LL IILAYIFL  ICVQGSVK+EW EIGKN+SLECASENEA  W LGNQT
Sbjct  1     MALLYRRMSMLLNIILAYIFLCAICVQGSVKQEWAEIGKNVSLECASENEAVAWKLGNQT  60

Query  61    IDKNTTRFELRTDPLNPNEGVSETNESPDFIKYKNVLTLRHINIKDSGKYTCTSPSGQNH  120
             I+KN TR+++RT+PL  N+  SE N+S DFIKYKNVL L  +NIKDSG YTCT+ +GQNH
Sbjct  61    INKNHTRYKIRTEPLKSNDDGSENNDSQDFIKYKNVLALLDVNIKDSGNYTCTAQTGQNH  120

Query  121   STEFHVEPYLPAKVLQSTADRIKRKVGQDVVLHCLIEMYPQNETTSKNMKWLKDGSPFEF  180
             STEF V PYLP+KVLQST DRIKRK+ QDV+L+CLIEMYPQNETT++N+KWLKDGS FEF
Sbjct  121   STEFQVRPYLPSKVLQSTPDRIKRKIKQDVMLYCLIEMYPQNETTNRNLKWLKDGSQFEF  180

Query  181   LDTFSSIAKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDTGLEAAFKEITLYVMEEPQVS  240
             LDTFSSI+KLNDTHLNFTLEFTEVYKKENGTYKCTVFDDTGLE   KEITL+VME PQVS
Sbjct  181   LDTFSSISKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDTGLEITSKEITLFVMEVPQVS  240

Query  241   IDFAKAVGSNKIYLNWTVNDGNDPVQKFFITFQEAGTPTFLYYKDIINGNQTSYILDNFK  300
             IDFAKAVG+NKIYLNWTVNDGNDP+QKFFIT QEAGTPTF Y+KD ING+ TSYILD+FK
Sbjct  241   IDFAKAVGANKIYLNWTVNDGNDPIQKFFITLQEAGTPTFTYHKDFINGSHTSYILDHFK  300

Query  301   PNTTYFLRISGKNSIGNGQTTQYPLGVNTLSFDPIFIPKVETTGSTASTITIGWDPPPPD  360
             PNTTYFLRI GKNSIGNGQ TQYP G+ TLS+DPIFIPKVETTGSTASTITIGW+PPPPD
Sbjct  301   PNTTYFLRIVGKNSIGNGQPTQYPQGITTLSYDPIFIPKVETTGSTASTITIGWNPPPPD  360

Query  361   LIEYIQYYELVVSESN---KTIEEAIYQQNSRNLPYMFDKLKTATDYEFKVRACSDLTKT  417
             LI+YIQYYEL+VSES    K IEEAIYQQNSRNLPYMFDKLKTATDYEF+VRACSDLTKT
Sbjct  361   LIDYIQYYELIVSESGEVPKVIEEAIYQQNSRNLPYMFDKLKTATDYEFRVRACSDLTKT  420

Query  418   CGPWSEIVNGTTMDGVATKPTNLTIHCHHDNVTRSNSISINWDVPKTPNGKVVSYLIHLQ  477
             CGPWSE VNGTTMDGVATKPTNL+I CHHDNVTR NSI+INWDVPKTPNGKVVSYLIHL 
Sbjct  421   CGPWSENVNGTTMDGVATKPTNLSIQCHHDNVTRGNSIAINWDVPKTPNGKVVSYLIHLL  480

Query  478   GNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPAAGSCRM  537
             GNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPA GSC M
Sbjct  481   GNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPATGSCLM  540

Query  538   PVSTPDTIGRTMWTKVNLGSKYILKSYLPKISERNGPICCYRLYLVRINNANNNELPEPE  597
             PVSTPD IGRTMW+KVNL SKY+LK YLPKISERNGPICCYRLYLVRINN +N ELP+PE
Sbjct  541   PVSTPDAIGRTMWSKVNLDSKYVLKLYLPKISERNGPICCYRLYLVRINN-DNKELPDPE  599

Query  598   KLNVATYQQVHSDNVTRSSAYIAEMMSSKYFRPEVFLGDEVRFSENNEIIRENDDICRRC  657
             KLN+ATYQ+VHSDNVTRSSAYIAEM+SSKYFRPE+FLGDE RFSENN+IIR+ND+ICR+C
Sbjct  600   KLNIATYQEVHSDNVTRSSAYIAEMISSKYFRPEIFLGDEKRFSENNDIIRDNDEICRKC  659

Query  658   LAGTTFLRKPETVHRPPPLSSLSNSDLEAG--DRDNNLIKGANLTEHALKILENKLRARR  715
             L GT FLRKPE +H PP   SLSNSD E       +NLIKGANLTEHALKILE+KLR +R
Sbjct  660   LEGTPFLRKPEIIHIPPQ-GSLSNSDSELPILSEKDNLIKGANLTEHALKILESKLRDKR  718

Query  716   NAVTSEESPVLSSSVNPTVPLLDTSRDVYDGQIDINSNYTGFLEIIVRDRDNVLMAYSKY  775
             NAVTS+E+P+LS+ VNP VPL D+SRDV+DG+IDINSNYTGFLEIIVRDR+N LMAYSKY
Sbjct  719   NAVTSDENPILSA-VNPNVPLHDSSRDVFDGEIDINSNYTGFLEIIVRDRNNALMAYSKY  777

Query  776   FDIITPATEAEPIPSLDNMDYYLNIGIKAGGILFGILIVIIVLWVFHHKKSKNALQGEDT  835
             FDIITPATEAEPI SL+NMDYYL+IG+KAG +L G+++V IVLWVFHHKK+KN LQGEDT
Sbjct  778   FDIITPATEAEPIQSLNNMDYYLSIGVKAGAVLLGVILVFIVLWVFHHKKTKNELQGEDT  837

Query  836   LTLRDSL-RAFFGRRSHNHSHFITSGSHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY  894
             LTLRDSL RA FGRR+HNHSHFITSG+HKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY
Sbjct  838   LTLRDSLSRALFGRRNHNHSHFITSGNHKGFDAGPIHRLDLENAYKNRHKDTDYGFLREY  897

Query  895   EMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLSPVNGLQTADYINANFVIGYK  954
             EMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKL+ +NGLQT DYINANFVIGYK
Sbjct  898   EMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLAVINGLQTTDYINANFVIGYK  957

Query  955   ERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG  1014
             ERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG
Sbjct  958   ERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYWPEKVFDTKQFG  1017

Query  1015  DILVKFAQERKTGDYIERILNVSKNKANAGEEEDRRQITQYHYLTWKDFMAPEHPNGIIK  1074
             DILVKFAQERKTGDYIER LNVSKNKAN GEEEDRRQITQYHYLTWKDFMAPEHP+GIIK
Sbjct  1018  DILVKFAQERKTGDYIERTLNVSKNKANVGEEEDRRQITQYHYLTWKDFMAPEHPHGIIK  1077

Query  1075  FIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRN  1134
             FIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRN
Sbjct  1078  FIRQINSVYSLQRGPILVHCSAGVGRTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRN  1137

Query  1135  FLVQSLKQYIFLYRALLDTGTFGNTDIGIETMSSAIESLKRKPNEGKCKLELEFEKLLAT  1194
             FLVQSLKQYIFLYRALLDTGTFGNTDI I+TM+SAIESLKRKPNEGKCKLE+EFEKLLAT
Sbjct  1138  FLVQSLKQYIFLYRALLDTGTFGNTDICIDTMASAIESLKRKPNEGKCKLEVEFEKLLAT  1197

Query  1195  TDEISKSCCVGDTEENNMKNRSQEIIPYDRNRVILTPLPLRDNSTYINASFIEGYDNSDT  1254
              DEISKSC VG+ EENNMKNRSQEIIPYDRNRVILTPLP+R+NSTYINASFIEGYDNS+T
Sbjct  1198  ADEISKSCSVGENEENNMKNRSQEIIPYDRNRVILTPLPMRENSTYINASFIEGYDNSET  1257

Query  1255  FIIAQDPLENTIGDFWRMVSEQSVTTLVMISEIGDGPRKCPRYWADDEVQYDHILVKYVH  1314
             FIIAQDPLENTIGDFWRM+SEQSVTTLVMISEIGDGPRKCPRYWADDEVQYDHILVKYVH
Sbjct  1258  FIIAQDPLENTIGDFWRMISEQSVTTLVMISEIGDGPRKCPRYWADDEVQYDHILVKYVH  1317

Query  1315  SESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKN  1374
             SESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKN
Sbjct  1318  SESCPYYTRREFYVTNCKIDDTLKVTQFQYNGWPTVDGEVPEVCRGIIELVDQAYNHYKN  1377

Query  1375  NKNTGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSY  1434
             NKN+GCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSY
Sbjct  1378  NKNSGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCVDICATTRKLRSQRTGLINSY  1437

Query  1435  AQYEFLHRAIINYSDLHHIAESTSD  1459
             AQYEFLHRAIINYSDLHHIAEST D
Sbjct  1438  AQYEFLHRAIINYSDLHHIAESTLD  1462


>PTPR_CAEEL unnamed protein product
Length=1409

 Score = 403 bits (1035),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 331/1113 (30%), Positives = 517/1113 (46%), Gaps = 214/1113 (19%)

Query  454   SISINWDVPKTPNGKVVSYLIHLQGN-------------PMST-VDREM--WGPK-----  492
             S  + W  P  PNG++  Y + ++G              P +  VD+    W        
Sbjct  386   SCEVEWKSPAEPNGRITKYFVSVRGAMRKSDGSLTPDDLPAAVEVDKRCANWDGDENTSK  445

Query  493   ---IRRID--EPHHKTLYESVSPNTNYTVTVSAITRHKKNGEPAA--GSCRMPVSTPDTI  545
                I  ID     +   +  + PN NYTVTV A     ++  PA    +C    + PD +
Sbjct  446   HNGINPIDFANEFYSCKFGPLKPNRNYTVTVWAENSAGRS-LPAVFHKNCVTNYAQPDMV  504

Query  546   GRTMWTKVNLGSKYILKSYLPKISERNGPICCYRLYLVRI-NNANNNELPEPEKLNVATY  604
                     N  S + L    P   + NGPI CY + +V +  N + + LP+ E++ + ++
Sbjct  505   ETPQPLLSNNHSTFSLTFPQPP-DDINGPISCYYIAIVPLPANVSLDILPKSEEIVMHSF  563

Query  605   QQVHSDNVTRSS-------AYIAEMMSSKYFRPEVFLGDEVRFSE----NNEIIRE---N  650
              +V ++N+  SS       AYIAE  S      E  +GD VR S+    N + +      
Sbjct  564   SKVFTNNLLPSSAEEKRFFAYIAE--SYVQLPEETTIGDGVRVSDLKACNVQYLSRYSSE  621

Query  651   DDICRRCLAGTTFLRKPETVHRPPPLSSLSNSDLEAGDRDNNLIKGANLTEHALKILENK  710
             D   RR L  T FL     + R      L+  D+  G  D N+                 
Sbjct  622   DLALRRGLKYTGFL-----IVRVDKEEELNRKDVRNG-ADPNIF----------------  659

Query  711   LRARRNAVTSEESPVLSSSVNPTVPLLDTSRDVYDGQIDINS---NYTGFLEIIVRDRDN  767
                 RN +    SP  +S      P+    R     Q+ ++     Y+ + + I+ D ++
Sbjct  660   ----RNLIDKSVSP--TSRTRTASPMSRHLR-----QLHLSGPAYGYSAYFKPILLDTES  708

Query  768   VLMAYSKYFDIITPATEAEPIPSLDNMDYYLNIGIKAGGILFGI--LIVIIVLW--VFHH  823
                 +  +  II P              + L +    G  +F +     ++  W  +F  
Sbjct  709   SSSGFGIFMKIILP--------------FLLFLAFATGVTMFFVNRKGHMLSTWCPLFTK  754

Query  824   KKSKNALQGEDTLTLRDSLRAFFGRRSHNHSHFITSGSHKGFDAGPIHRLDLENAYKNRH  883
               SK+ ++       R  L+  FG                   A P+   DL   Y  RH
Sbjct  755   MTSKDVVE-------RTLLKQTFG-------------------AIPVD--DLPTEYVVRH  786

Query  884   KDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQTRVKLSPVNGLQTAD  943
             +DTD+ F +EYE LP+   D  T  S+ KENA KNRY DI+A+D TRVKL  +NG   +D
Sbjct  787   RDTDFLFAQEYESLPHFQLD--TVASNRKENAIKNRYNDIRAFDDTRVKLKKINGDDYSD  844

Query  944   YINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVMLTNLEEYNKAKCAKYW  1003
             YINANF+  +KE+K FI AQ P+++TI DFWRM+WEQ   +IVM+ NL E N+ +CAKYW
Sbjct  845   YINANFIKSWKEKKLFIAAQAPVDATIGDFWRMVWEQESYLIVMVANLTEKNRQQCAKYW  904

Query  1004  PEKVFDTKQFGDILVKFAQERKTGDYIERILNVSKNKANAGE------------------  1045
             P++     ++GDI+V+ A      DY  R  ++    A+ GE                  
Sbjct  905   PDE--QITRYGDIIVEPASFSFHSDYAIRAFDI----AHIGECGPDVIPNGNGVEYANVP  958

Query  1046  ------EEDRRQITQYHYLTWKDFMAPEHPNGIIKFIRQINSVYSLQRGPILVHCSAGVG  1099
                     + R+I QYH+  W D+ APE   G+++F+ ++  +      P+++HCSAGVG
Sbjct  959   IVKGQFANNSRRILQYHFTNWNDYKAPECSTGLLRFMYRLRELPQFNNSPVVIHCSAGVG  1018

Query  1100  RTGTLVALDSLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNT  1159
             RTGT +++DS++ Q   ED  +I+  VC+LR QRN +VQSL+QY+F+Y+AL +   +G+T
Sbjct  1019  RTGTFISIDSMLDQCLAEDKANIFEFVCNLRRQRNLMVQSLEQYVFIYKALAEWHMYGDT  1078

Query  1160  D---------------------IGIETMSSAIESLKRK-----------PNEGKCKLELE  1187
             D                     +     SS   S+  +            + G+  LE E
Sbjct  1079  DEDVRDFEDHYQRLCASNRDRAVSFNQQSSTNGSISPRVAIVSSRESMTTSNGETGLEEE  1138

Query  1188  FEKLLAT-TDEISKSCCVGDTEENNMKNRSQEIIPYDRNRVILTPLPLRDNSTYINASFI  1246
             F+KL    T  +S +    D  EN +KNR +  +P+D+ RVIL P     +S+YINAS I
Sbjct  1139  FKKLERNLTTPLSSNFAAKD--ENLLKNRYEAAVPFDKYRVILPPTIGHADSSYINASHI  1196

Query  1247  EGYDNSDTFIIAQDPL-ENTIGDFWRMVSEQSVTTLVMISEIGDGPRKCPRYWADD----  1301
             +GY     +I AQDP+ E T  DFWRM+++Q+VTT+VM+S+  D      +YW  D    
Sbjct  1197  KGYFFD--YIAAQDPVSEGTAFDFWRMIADQNVTTVVMLSDETDW-SDVEKYWPIDGSGT  1253

Query  1302  EVQY----DHILVKYVHSESCPYYTRREFYVT---NCKIDDTLKVTQFQYNGWPTVDGEV  1354
             E  +    + + V  V  E    +  R    +   N  +    +V Q+ Y GWP+ D  V
Sbjct  1254  ECHFGSERNSVNVTCVSEEHHQDFIIRNLSYSMKDNESMPANQEVVQYSYTGWPS-DSIV  1312

Query  1355  PEVCRGIIELVDQAYNHYKNNKNTGCRSPLTVHCSLGTDRSSIFVAMCILVQHLRLEKCV  1414
             P+    ++ L++      + +   G ++P+ VHC  G+  S IF+ + +L    + E+ +
Sbjct  1313  PKSANSLMNLIEMVLQ--RQSSLMGSQAPIVVHCRNGSSESGIFICISLLWLRQKAEQRI  1370

Query  1415  DICATTRKLRSQRTGLINSYAQYEFLHRAIINY  1447
             D+  T + L+S R  +   + QY F +RA+ +Y
Sbjct  1371  DVFQTVKGLQSHRPMMFTRFEQYSFCYRALADY  1403


>LAR_DROME unnamed protein product
Length=2029

 Score = 394 bits (1013),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 206/582 (35%), Positives = 330/582 (57%), Gaps = 17/582 (3%)

Query  869   PIHRLDLENAYKNRHKDTDYGFLREYEMLPNRFSDRTTKNSDLKENACKNRYPDIKAYDQ  928
             PI   +  N  +    + +  F +EYE +       T  NS+L+ N  KNRY ++ AYD 
Sbjct  1453  PIPISEFANHIERLKSNDNQKFSQEYESI-EPGQQFTWDNSNLEHNKSKNRYANVTAYDH  1511

Query  929   TRVKLSPVNGLQTADYINANFVIGYKERKKFICAQGPMESTIDDFWRMIWEQHLEIIVML  988
             +RV+L  V G+  +DYINAN+  GY++   ++  QGP++ T  DFWRM WE     IVM+
Sbjct  1512  SRVQLPAVEGVVGSDYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMM  1571

Query  989   TNLEEYNKAKCAKYWPEKVFDTKQFGDILVKFAQERKTGDYIERILNVSKNKANAGEEED  1048
             T LEE  + KC +YWP +   T+ +G I V   + ++   Y  R   + +   N     D
Sbjct  1572  TRLEERTRIKCDQYWPTR--GTETYGQIFVTITETQELATYSIRTFQLCRQGFN-----D  1624

Query  1049  RRQITQYHYLTWKDFMAPEHPNGIIKFIRQINSVYSLQRGPILVHCSAGVGRTGTLVALD  1108
             RR+I Q  +  W D   P+HP   ++F+R+  ++   + GP++VHCSAGVGRTG  + +D
Sbjct  1625  RREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVID  1684

Query  1109  SLIQQLEEEDSVSIYNTVCDLRHQRNFLVQSLKQYIFLYRALLDTGTFGNTDIGIETMSS  1168
             S++++++ E  + IY  V  LR QRN++VQ+  QYIF++ A+L+    G T++    + +
Sbjct  1685  SMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHT  1744

Query  1169  AIESLK-RKPNEGKCKLELEFEKLLATTDEISKSCCVGDTEENNMKNRSQEIIPYDRNRV  1227
              ++ L   +P E    +E+EF+KL     + SK     +   N  KNR   I+PY+ +RV
Sbjct  1745  HLQKLLITEPGETISGMEVEFKKLSNVKMDSSK-FVTANLPCNKHKNRLVHILPYESSRV  1803

Query  1228  ILTPLPLRDNSTYINASFIEGYDNSDTFIIAQDPLENTIGDFWRMVSEQSVTTLVMISEI  1287
              LTP+   + S Y+NASFI+GY     +I AQ P+++   DFWRM+ E + T +VM++++
Sbjct  1804  YLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKL  1863

Query  1288  GD-GPRKCPRYWADDE-VQYDHILVKYVHSESCPYYTRREFYVTNCKIDDTLKVTQFQYN  1345
              + G  KC +YW  +  V+Y + +V  +   + P Y  REF VT+ +   +  V QFQ+ 
Sbjct  1864  KEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFI  1923

Query  1346  GWPTVDGEVPEVCRGIIELVDQAYNHYKNNKNTGCRSPLTVHCSLGTDRSSIFVAMCILV  1405
              WP  +  VP+   G I+ + Q    +K  +  G   P+TVHCS G  RS +F+ + I++
Sbjct  1924  DWP--EQGVPKSGEGFIDFIGQV---HKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVL  1978

Query  1406  QHLRLEKCVDICATTRKLRSQRTGLINSYAQYEFLHRAIINY  1447
             + ++ E  +D+  T R LRSQR  ++ +  QY F +RA + Y
Sbjct  1979  ERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEY  2020


 Score = 68.6 bits (166),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 68/265 (26%), Positives = 119/265 (45%), Gaps = 31/265 (12%)

Query  290  NQTSYILDNFKPNTTYFLRISGKNSIGNGQTTQYPLGVNTLSFDPIFIPK-VETTGSTAS  348
            N  +Y LD   P+T Y++ ++ ++  G G TT  P+ V T  + P   P+ +    ++++
Sbjct  567  NSEAYTLDGLYPDTLYYIWLAARSQRGEGATTP-PIPVRTKQYVPGAPPRNITAIATSST  625

Query  349  TITIGWDPPPPDLIE-YIQYYELVVSESNKTIEEAIYQQ-NSRNLPYMFDKLKTATDYEF  406
            TI++ W PPP +     I YY++   E  +  +EA     N  ++  + D+LK  T+Y+ 
Sbjct  626  TISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSI--VLDELKRWTEYKI  683

Query  407  KVRACSDLTKTCGPWSEIVNGTTMDGVATKPTNLTIHCHHDNVTRSNSISINWDVP--KT  464
             V A + +    GP S  +   T + V   P ++           S SI ++W  P  K 
Sbjct  684  WVLAGTSVGD--GPRSHPIILRTQEDVPGDPQDVKA-----TPLNSTSIHVSWKPPLEKD  736

Query  465  PNGKVVSYLIHLQGNPMSTVDREMWGPKIRRIDEPHHKTLYES-------VSPNTNYTVT  517
             NG +  Y IH Q         E+       ++EP    + ++       + P+T Y++ 
Sbjct  737  RNGIIRGYHIHAQ---------ELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQ  787

Query  518  VSAITRHKKNGEPAAGSCRMPVSTP  542
            V+A+TR       AA   + P   P
Sbjct  788  VAALTRKGDGDRSAAIVVKTPGGVP  812


 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 132/331 (40%), Gaps = 84/331 (25%)

Query  177   PFEF--LDT--FSSIAKLNDTHLNFTLEFTEVYKKENGTYKCTVFDDT-GLEAAFKEITL  231
             PF+F  +DT  F+      DT   ++++   + +K +G     +   T G       ++L
Sbjct  762   PFKFDVVDTLEFNVTGLQPDT--KYSIQVAALTRKGDGDRSAAIVVKTPGGVPVRPTVSL  819

Query  232   YVME-EPQVSIDF-----AKAVGSNKIY-LNWTVNDGNDPVQKFFITFQEAGTPTFLYYK  284
              +ME EP VSI+      A+  G  + Y L W V D                       +
Sbjct  820   KIMEREPIVSIELEWERPAQTYGELRGYRLRWGVKDQ-------------------ALKE  860

Query  285   DIINGNQ-TSYILDNFKPNTTYFLRISGKNSIGNGQTTQYPLGVNTLSFDPIFIPKVETT  343
             ++++G Q T    DN +    Y  R++G N IG GQ T             IF     T 
Sbjct  861   EMLSGPQMTKKRFDNLERGVEYEFRVAGSNHIGIGQETVK-----------IFQTPEGTP  909

Query  344   GSTASTITI----------GWDPPPPD-----LIEY-IQYYELV----VSESNKTIEEAI  383
             G   S ITI           WDPP  +     +  Y +Q+++ +     SE N T+ +A+
Sbjct  910   GGPPSNITIRFQTPDVLCVTWDPPTREHRNGIITRYDVQFHKKIDHGLGSERNMTLRKAV  969

Query  384   YQQNSRNLPYMFDKLKTATDYEFKVRACSDLTKTCGPWSEIVNGTTMDGVATKPTNLTIH  443
                        F  L+  T+Y F+VRA +   +  GP+S+ +   T   +   P +L   
Sbjct  970   -----------FTNLEENTEYIFRVRAYTK--QGAGPFSDKLIVETERDMGRAPMSL---  1013

Query  444   CHHDNVTRSNSISINWDVPKTPNGKVVSYLI  474
                   T   +  I W+ P T  GK++ Y I
Sbjct  1014  --QAEATSEQTAEIWWE-PVTSRGKLLGYKI  1041


 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 92/203 (45%), Gaps = 27/203 (13%)

Query  340  VETTGSTASTITIGWDPPPPDLIEY--IQYYELVVSESNKTIEEAIYQQNSRNLPYMFDK  397
            V+ +  TA+++ + W    P+ ++Y  IQY     +++   I   I       + Y+   
Sbjct  328  VQISEVTATSVRLEWSYKGPEDLQYYVIQYKPKNANQAFSEISGII------TMYYVVRA  381

Query  398  LKTATDYEFKVRACSDLTKTCGPWSEIVNGTTMD-GVATKPTNLTIHCHHDNVTRSNSIS  456
            L   T+YEF V A +++ +  GP S     TT +  + + P N+ +         S+++ 
Sbjct  382  LSPYTEYEFYVIAVNNIGR--GPPSAPATCTTGETKMESAPRNVQVRT-----LSSSTMV  434

Query  457  INWDVPKTPNGKVVSYLIHLQGNPMSTVDREMWGPKIRRIDEPHHKTLYESVSPNTNYTV  516
            I W+ P+TPNG+V  Y ++   N  S      W  ++  +D     T+ E ++P+  YTV
Sbjct  435  ITWEPPETPNGQVTGYKVYYTTN--SNQPEASWNSQM--VDNSELTTVSE-LTPHAIYTV  489

Query  517  TVSAITRHKKNGEPAAGSCRMPV  539
             V A T         AG    PV
Sbjct  490  RVQAYTSM------GAGPMSTPV  506


 Score = 38.1 bits (87),  Expect = 0.078, Method: Compositional matrix adjust.
 Identities = 68/318 (21%), Positives = 125/318 (39%), Gaps = 44/318 (14%)

Query  295   ILDNFKPNTTYFLRISGKNSIGNGQ-------TTQYPLGVNTLSFDPIFIPKVETTGSTA  347
             +  N + NT Y  R+      G G         T+  +G   +S        ++   ++ 
Sbjct  969   VFTNLEENTEYIFRVRAYTKQGAGPFSDKLIVETERDMGRAPMS--------LQAEATSE  1020

Query  348   STITIGWDPPPP--DLIEYIQYYELVVSESNKTIEEAIYQQNSRNLPYMFDKLKTATDYE  405
              T  I W+P      L+ Y  +Y +   E         +Q  +  L    D +      +
Sbjct  1021  QTAEIWWEPVTSRGKLLGYKIFYTMTAVEDLDD-----WQTKTVGLTESADLVNLEKFAQ  1075

Query  406   FKVRACSDLTKTCGPWSEIVNGTTMDGVATKPTNLTIHCHHDNVTRSNSISINWDVP--K  463
             + V   +      G  SE V       V  KP ++ ++    +V+ ++S++++W  P   
Sbjct  1076  YAVAIAARFKNGLGRLSEKVT------VRIKPEDVPLNLRAHDVS-THSMTLSWSPPIRL  1128

Query  464   TPNGKVVSY-----LIHLQGNPMSTVDREMWGPKIRRIDEPHHKT-LYESVSPNTNYTVT  517
             TP    +S+      +  QG   + +      PK   I + + KT     +SP T Y V 
Sbjct  1129  TPVNYKISFDAMKVFVDSQGFSQTQIV-----PKREIILKHYVKTHTINELSPFTTYNVN  1183

Query  518   VSAITRHKKNGEPAAGSCRMPVSTPDTIGRTMWTKVNLGSKYILKSYLPKISERNGPICC  577
             VSAI        P   +    ++ P  + +  +  V  G + ++   LP+ SE  GPI  
Sbjct  1184  VSAIPSDYSYRPPTKITVTTQMAAPQPMVKPDFYGVVNGEEILV--ILPQASEEYGPISH  1241

Query  578   YRLYLVRINNANNNELPE  595
             Y L +V  + +N +++P+
Sbjct  1242  YYLVVVPEDKSNLHKIPD  1259



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016431.1 probable small nuclear ribonucleoprotein Sm D1
[Drosophila kikkawai]

Length=124
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

SMD1_DROME  unnamed protein product                                   243     5e-85
SMD1_CAEEL  unnamed protein product                                   144     1e-45
Q8IIA8_PLAF7  unnamed protein product                                 125     5e-38


>SMD1_DROME unnamed protein product
Length=124

 Score = 243 bits (621),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/124 (99%), Positives = 124/124 (100%), Gaps = 0/124 (0%)

Query  1    MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSI  60
            MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSI
Sbjct  1    MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSI  60

Query  61   RGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRGGPRGRGRGRA  120
            RGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRGGPRGRGRGRA
Sbjct  61   RGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRGGPRGRGRGRA  120

Query  121  TGRR  124
            +GRR
Sbjct  121  SGRR  124


>SMD1_CAEEL unnamed protein product
Length=126

 Score = 144 bits (363),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)

Query  1   MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDPVHLETLSI  60
           MKLVRFLMKLSHETV IELKNGTQ+ GTI GVDVAMNTHL++V MT+KN++PV L+TLSI
Sbjct  1   MKLVRFLMKLSHETVNIELKNGTQVSGTIMGVDVAMNTHLRAVSMTVKNKEPVKLDTLSI  60

Query  61  RGNNIRYFILPDSLPLETLLIDDTPKSK  88
           RGNNIRY ILPD L L+TLLIDD P+ K
Sbjct  61  RGNNIRYIILPDPLALDTLLIDDEPRKK  88


>Q8IIA8_PLAF7 unnamed protein product
Length=126

 Score = 125 bits (313),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 10/120 (8%)

Query  1    MKLVRFLMKLSHETVTIELKNGTQIHGTITGVDVAMNTHLKSVRMTIKNRDP--------  52
            MKLV FLMKL++E VTIELKNGT I G IT VD+ MNTH+K+V++ IKN++         
Sbjct  1    MKLVHFLMKLTNENVTIELKNGTLITGIITAVDIKMNTHMKNVKVVIKNKNIAEYNVNTK  60

Query  53   --VHLETLSIRGNNIRYFILPDSLPLETLLIDDTPKSKTKKKDSGRVGNRGRGRGARGRG  110
              + LE ++IRGNNIRYFIL DSLPL++LL++DT   K  K  S    ++G  +GA+GRG
Sbjct  61   QFLSLEHVTIRGNNIRYFILSDSLPLDSLLVEDTTPKKISKDKSFLHRDKGMSKGAKGRG  120



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016433.1 uncharacterized protein LOC108070463 [Drosophila
kikkawai]

Length=775
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRY3_DROME  unnamed protein product                                 157     4e-42
Q960G6_DROME  unnamed protein product                                 164     3e-41
Q9U1I2_DROME  unnamed protein product                                 163     4e-41


>Q8MRY3_DROME unnamed protein product
Length=371

 Score = 157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 141/245 (58%), Gaps = 14/245 (6%)

Query  533  KIIGGRASRKGEWPWQVAILNRFKEA----FCGGTLIAPRWVLTAAHCV----RRVLYVR  584
            +++ G  +++G  PWQ  I  R +      +CG  +I+ R +LTAAHC+    +   +VR
Sbjct  125  RVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVR  184

Query  585  IGEHNLDYEDGTEVQLRVMKSFIHPNFDKRT-VDSDVALLRLPKPVNATNWIGYSCLPQP  643
            +G+H  +  + +EV   +   ++H NF K T +++D+AL+ L  P+  ++++   CLP  
Sbjct  185  VGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDK  244

Query  644  FQALPKNVDCTVIGWGKRRNRDATGTSVLHKATVPIIPMNNCRKV-YYDYTITKNMFCAG  702
               L ++  CT+ GWG  ++  +T   VL  A +PI+  + C++   Y   +++ MFCAG
Sbjct  245  NAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAG  304

Query  703  HKKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQKNKFGIYAKVSNYVDWV  762
                 +D C GDSGGPL+C D        T++G+ S+G  C  KN+ G+Y +V++Y+DW+
Sbjct  305  SMDESVDACEGDSGGPLVCSDDDGE----TLYGLISWGQHCGFKNRPGVYVRVNHYIDWI  360

Query  763  WSVVN  767
            +  +N
Sbjct  361  YEKIN  365


>Q960G6_DROME unnamed protein product
Length=2409

 Score = 164 bits (414),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 141/245 (58%), Gaps = 14/245 (6%)

Query  533   KIIGGRASRKGEWPWQVAILNRFKEAF----CGGTLIAPRWVLTAAHCV----RRVLYVR  584
             +++ G  +++G  PWQ  I  R +       CG  +I+ R +LTAAHC+    +   +VR
Sbjct  2163  RVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVR  2222

Query  585   IGEHNLDYEDGTEVQLRVMKSFIHPNFDKRT-VDSDVALLRLPKPVNATNWIGYSCLPQP  643
             +G+H  +  + +EV   +   ++H NF K T +++D+AL+ L  P+  ++++   CLP  
Sbjct  2223  VGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDK  2282

Query  644   FQALPKNVDCTVIGWGKRRNRDATGTSVLHKATVPIIPMNNCRKV-YYDYTITKNMFCAG  702
                L ++  CT+ GWG  ++  +T   VL  A +PI+  + C++   Y   +++ MFCAG
Sbjct  2283  NAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAG  2342

Query  703   HKKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQKNKFGIYAKVSNYVDWV  762
                  +D C GDSGGPL+C D    +   T++G+ S+G  C  KN+ G+Y +V++Y+DW+
Sbjct  2343  SMDESVDACEGDSGGPLVCSD----DDGETLYGLISWGQHCGFKNRPGVYVRVNHYIDWI  2398

Query  763   WSVVN  767
             +  +N
Sbjct  2399  YEKIN  2403


>Q9U1I2_DROME unnamed protein product
Length=1449

 Score = 163 bits (412),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/245 (33%), Positives = 141/245 (58%), Gaps = 14/245 (6%)

Query  533   KIIGGRASRKGEWPWQVAILNRFKEA----FCGGTLIAPRWVLTAAHCV----RRVLYVR  584
             +++ G  +++G  PWQ  I  R +      +CG  +I+ R +LTAAHC+    +   +VR
Sbjct  1203  RVVRGNVAQRGRHPWQATIRTRGRGGISSHWCGAVVISKRHLLTAAHCLYGSPKGAYFVR  1262

Query  585   IGEHNLDYEDGTEVQLRVMKSFIHPNFDKRT-VDSDVALLRLPKPVNATNWIGYSCLPQP  643
             +G+H  +  + +EV   +   ++H NF K T +++D+AL+ L  P+  ++++   CLP  
Sbjct  1263  VGDHYANIAESSEVDSFIENWYLHENFRKGTHMNNDIALVVLKTPLKFSDYVQPICLPDK  1322

Query  644   FQALPKNVDCTVIGWGKRRNRDATGTSVLHKATVPIIPMNNCRKV-YYDYTITKNMFCAG  702
                L ++  CT+ GWG  ++  +T   VL  A +PI+  + C++   Y   +++ MFCAG
Sbjct  1323  NAELVEDRKCTISGWGSIKSGVSTPAQVLGSAELPILADHVCKQSNVYGSAMSEGMFCAG  1382

Query  703   HKKGHIDTCAGDSGGPLLCRDTTKPNHPWTIFGITSFGDGCAQKNKFGIYAKVSNYVDWV  762
                  +D C GDSGGPL+C D        T++G+ S+G  C  KN+ G+Y +V++Y+DW+
Sbjct  1383  SMDESVDACEGDSGGPLVCSDDDGE----TLYGLISWGQHCGFKNRPGVYVRVNHYIDWI  1438

Query  763   WSVVN  767
             +  +N
Sbjct  1439  YEKIN  1443



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016434.1 protein odr-4 homolog [Drosophila kikkawai]

Length=492
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ODR4_DROME  unnamed protein product                                   764     0.0  
O96046_DROME  unnamed protein product                                 33.1    0.61 
Q9VDF4_DROME  unnamed protein product                                 32.7    0.67 


>ODR4_DROME unnamed protein product
Length=492

 Score = 764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/496 (82%), Positives = 448/496 (90%), Gaps = 8/496 (2%)

Query  1    MRTVLLSKADEVYLEKCAQENQFSYGIIVGHQADLSKSVVVHLARNNEEDADLEDLTDVR  60
            MRTVLLSK DE+YLEKCAQENQFSYGIIVGHQADL+KSVVVHLARNNEEDADLEDL++VR
Sbjct  1    MRTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEEDADLEDLSEVR  60

Query  61   LTIGDINAQALASQWLSASKMCPGSFDVIGIFVSSSSPDVSNEKSDDFKNAKKLFSDIYD  120
            LTI DIN+QALASQWLSASKMCPGSFDVIGIFVSS   DV NE+S +FKNAKKLFSDIYD
Sbjct  61   LTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVNEQSAEFKNAKKLFSDIYD  120

Query  121  LLLKSNSSFGVYTTDIAQTDFVFLAYSLVDKKVLCKNYSYGNGGTFSNMDHRFVDKPFEW  180
            LLLKSNSSFGVYTTDIAQTDFVFL+YSL DKKVLCKNYSYGNGGTF+NM+ RFVDKPFEW
Sbjct  121  LLLKSNSSFGVYTTDIAQTDFVFLSYSLADKKVLCKNYSYGNGGTFTNMEFRFVDKPFEW  180

Query  181  IQLESTYDLDDVLPILDASRRVNIEDQFQNIIKAVRRNLLASEVFLQNEIVEDTIDLQAY  240
            IQLE +YD DDVLPILD+SRRVNIEDQFQ++I +VR+NLLASEVFLQNE+VEDTIDLQAY
Sbjct  181  IQLECSYDFDDVLPILDSSRRVNIEDQFQSMIVSVRKNLLASEVFLQNEVVEDTIDLQAY  240

Query  241  IKKKRTKADKLNKPSSTGGGGSVSAGSTASGSLPELASDTGII--SDSIRASIVLPVKCQ  298
            IKKK+TK DKL +P+ST GG + ++ +T + SLP LAS+ GII  +++IRASIVLP+KCQ
Sbjct  241  IKKKKTKVDKL-QPTSTTGGTATASSNT-TDSLPRLASE-GIIGGTETIRASIVLPMKCQ  297

Query  299  LSKPSDIKVREFQGTLRMSGIIASKVFCSPRNSIADVKRFLRDDVLRSLITRIQVYCDGL  358
            LSKP+DIKVREF GTL MSGII SKVFC+PRNSIADVKRFLRDDVLRSLITRIQVYCDGL
Sbjct  298  LSKPTDIKVREFSGTLHMSGIITSKVFCNPRNSIADVKRFLRDDVLRSLITRIQVYCDGL  357

Query  359  TDPYVNNEALYVSEPPRRVFFNLPTETP--STGATVQFSEYLFRGEAPTVAVAQAKQILD  416
            TDPYV NEALY+SEPPRRVFF+LP+E P  S GA VQFSEYLFRGEAPTV VAQAKQILD
Sbjct  358  TDPYVTNEALYISEPPRRVFFSLPSEGPSASVGAVVQFSEYLFRGEAPTVVVAQAKQILD  417

Query  417  VELDPETISVEAEGLPDDSNFTNGANAGVDRTDDSRTLLSSMPKPELSRSLYMLGIAVAL  476
            V+LDPETISVEAEGLPDD++F N      D  DDS  + SSMPKPELSRSLYM+GIAVAL
Sbjct  418  VDLDPETISVEAEGLPDDTHF-NNCKMDADCIDDSGIMTSSMPKPELSRSLYMVGIAVAL  476

Query  477  LILLSSVVLHYVLGDR  492
            L+LLSSV LH+VL +R
Sbjct  477  LVLLSSVALHFVLAER  492


>O96046_DROME unnamed protein product
Length=559

 Score = 33.1 bits (74),  Expect = 0.61, Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 5/90 (6%)

Query  129  FGVYTTDIAQTDFVFLAYSLVDKKVLCKNYSYGNGGTFSNMDHRFVDKPFEWIQLESTYD  188
            FGV +  + ++   +     V+K    K+YS G GG F   + R       W   E+   
Sbjct  163  FGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQK  222

Query  189  L-----DDVLPILDASRRVNIEDQFQNIIK  213
                    V P+++ ++  N+  +F+N+ K
Sbjct  223  HASQVDHKVKPVIEGAKPSNLRAKFENLAK  252


>Q9VDF4_DROME unnamed protein product
Length=559

 Score = 32.7 bits (73),  Expect = 0.67, Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 39/90 (43%), Gaps = 5/90 (6%)

Query  129  FGVYTTDIAQTDFVFLAYSLVDKKVLCKNYSYGNGGTFSNMDHRFVDKPFEWIQLESTYD  188
            FGV +  + ++   +     V+K    K+YS G GG F   + R       W   E+   
Sbjct  163  FGVQSDRVDKSAVGWDHIEKVEKHESQKDYSKGFGGKFGVQEDRKDKSAVGWDHKEAPQK  222

Query  189  L-----DDVLPILDASRRVNIEDQFQNIIK  213
                    V P+++ ++  N+  +F+N+ K
Sbjct  223  HASQVDHKVKPVIEGAKPSNLRAKFENLAK  252



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016435.1 early endosome antigen 1 [Drosophila kikkawai]

Length=841
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VCD1_DROME  unnamed protein product                                 37.0    0.082
LVA_DROME  unnamed protein product                                    32.7    1.7  


>Q9VCD1_DROME unnamed protein product
Length=2048

 Score = 37.0 bits (84),  Expect = 0.082, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 88/182 (48%), Gaps = 12/182 (7%)

Query  354   VENLTLSLASLQLEKESLKENLQEAQKRLQKLEHEVRRLHGQHGEMRSMCEETKRQLEEE  413
             V NL   +A L+ EK+  K  L  A+K+LQ    +  R   + G++++M     R L+EE
Sbjct  1478  VRNLMHQVAQLEREKDDYKSQLGAAKKQLQDAADQQLRCDAKLGKLQAML----RNLQEE  1533

Query  414   QGLVEKFKKQSSLRESELIAKLNNYSDLCEQLRTDLAATESQMHDQSQQAEIWQQKLKVI  473
             +  +E  +K        L  KL + +D C+ LR  LA TE Q+   S++    +++L   
Sbjct  1534  KSNLETDRKMKISAIQALEEKLKHRNDECQMLRERLAQTEMQLAATSEENGQNEERL---  1590

Query  474   EESSQQKVKQCQNQTTQTDVEEPILLQRIETLEQQLADVKAQKKQTVSLLQQLLQQQDAK  533
              E S+Q+  +  N+  Q   E   +  R   LE Q   ++      ++ LQ  LQ++D  
Sbjct  1591  -EKSRQQCSKLDNEKRQLQEELAKVEGRASKLELQRVAMEG----DLTRLQMALQEKDCS  1645

Query  534   IK  535
             I+
Sbjct  1646  IR  1647


>LVA_DROME unnamed protein product
Length=2779

 Score = 32.7 bits (73),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 69/120 (58%), Gaps = 13/120 (11%)

Query  232  LRQVIAEL---NETLQT-----QEHLLALKE-QEFLDLKQYYQQKLTRESSVDVMHS---  279
            LR+ +AEL   N+ L+T     QE L   +E Q  L+L+Q  Q+K +R    +  H+   
Sbjct  307  LRERLAELENVNDLLETTRCELQEELTTARERQRNLELEQE-QEKASRSPQSEAAHTDAQ  365

Query  280  YSLKFHEEINSKTSEIAGLKNSLNELRSELLMMSQLKEENEEQQRQLEQLEFTLQAQLLE  339
             S +  +++   T+++A L+ +  ELR ++   ++L+  +E   ++LE+LE T+ AQLLE
Sbjct  366  VSAELAKQLQELTNQLADLQATNEELRQQVAAQAKLQVTDEIVSQRLEELEATIAAQLLE  425



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016437.1 uncharacterized protein LOC108070466 [Drosophila
kikkawai]

Length=145
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

C0PPK1_DROME  unnamed protein product                                 90.5    6e-24
M9PG65_DROME  unnamed protein product                                 88.2    6e-23
G5EGJ6_CAEEL  unnamed protein product                                 29.6    0.93 


>C0PPK1_DROME unnamed protein product
Length=133

 Score = 90.5 bits (223),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 82/137 (60%), Gaps = 4/137 (3%)

Query  1    MSFVQPLLLAALAALYIYTGSASRVSEDDLHKPKPEMLLTQVKKTKNGWYCAGVYCPIER  60
            M+    L+L  LA   I + +   V++ D H  + ++    VKKTK GW CAGV CPI+ 
Sbjct  1    MNIFISLILVVLA---ILSFADHTVADGDRHLNE-DLNRATVKKTKYGWQCAGVTCPIKF  56

Query  61   TESCKTTSILKPTINIDHDLVVLCLDGKNFPFCGITRSSRVENISVVELNDHGDMEYVRK  120
            T SCK T +LKP+     +L++LC+D  + P CGITR+ +     V++++++G+  Y +K
Sbjct  57   TASCKVTKVLKPSDLQHTELLILCMDKNDKPMCGITRTRKGVIQEVLDVDENGNTIYDKK  116

Query  121  ERVHTSEGISVPICAKR  137
            E +  ++G  +P C ++
Sbjct  117  EVISENDGTKIPRCPRK  133


>M9PG65_DROME unnamed protein product
Length=150

 Score = 88.2 bits (217),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 78/150 (52%), Gaps = 13/150 (9%)

Query  1    MSFVQPLLLAALAALYI-------------YTGSASRVSEDDLHKPKPEMLLTQVKKTKN  47
            M+    L+L  LA L               Y GS      D       ++    VKKTK 
Sbjct  1    MNIFISLILVVLAILSFADHTVVRVNPYMEYYGSYIYFKADGDRHLNEDLNRATVKKTKY  60

Query  48   GWYCAGVYCPIERTESCKTTSILKPTINIDHDLVVLCLDGKNFPFCGITRSSRVENISVV  107
            GW CAGV CPI+ T SCK T +LKP+     +L++LC+D  + P CGITR+ +     V+
Sbjct  61   GWQCAGVTCPIKFTASCKVTKVLKPSDLQHTELLILCMDKNDKPMCGITRTRKGVIQEVL  120

Query  108  ELNDHGDMEYVRKERVHTSEGISVPICAKR  137
            +++++G+  Y +KE +  ++G  +P C ++
Sbjct  121  DVDENGNTIYDKKEVISENDGTKIPRCPRK  150


>G5EGJ6_CAEEL unnamed protein product
Length=1626

 Score = 29.6 bits (65),  Expect = 0.93, Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 33/73 (45%), Gaps = 1/73 (1%)

Query  15   LYIYTGSASRVSEDDLHKPKPEMLLTQVKKTKNGWYCAGVYCPIERTESCKTTSILKPTI  74
            L +  G+  R   + + + + EM ++Q +K   G     V C +    SC   S+L    
Sbjct  125  LLVDNGTVGRYGAEVILRKRLEMYISQKQKIFGGTRSVPVVCVVLEGGSCTIRSVLDYVT  184

Query  75   NIDHDLVVLCLDG  87
            N+    VV+C DG
Sbjct  185  NVPRVPVVVC-DG  196



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


Query= XP_017016438.1 ATP-dependent RNA helicase Ddx1 [Drosophila kikkawai]

Length=730
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

DDX1_DROME  unnamed protein product                                   1338    0.0  
Q388E8_TRYB2  unnamed protein product                                 158     1e-40
Q4Q5P5_LEIMA  unnamed protein product                                 155     1e-39


>DDX1_DROME unnamed protein product
Length=727

 Score = 1338 bits (3463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/730 (89%), Positives = 684/730 (94%), Gaps = 3/730 (0%)

Query  1    MTAFEEFGVLPELGKATDEADWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPI  60
            MTAFEEFGVLPELG ATDE DWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPI
Sbjct  1    MTAFEEFGVLPELGMATDELDWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPI  60

Query  61   LQIVWETLRDIEEGKGGGKGGAGGAAGSVAPWTMSFYDRGNALAVTPDGLRCQAREFKEW  120
            LQIVWETLRD+EEGK    G  G   G+V PWTMSF+DRGNALAVTPDGLRCQ+REFKEW
Sbjct  61   LQIVWETLRDLEEGK---AGKGGAIGGAVTPWTMSFFDRGNALAVTPDGLRCQSREFKEW  117

Query  121  HGCRATTGVRGRGKFYFEATVTDEGLCRVGWSTQQANLDLGTCRMGFGFGGTGKKSNNRQ  180
            HGCRATTGVRG+GKFYFEATVTDEGLCRVGWSTQQANLDLGTCRMGFGFGGTGKKSNNRQ
Sbjct  118  HGCRATTGVRGKGKFYFEATVTDEGLCRVGWSTQQANLDLGTCRMGFGFGGTGKKSNNRQ  177

Query  181  FDDYGEAFGKADVIGCLLDLQRLEVSFTKNGQNLGLAFRVPDNLAKDTFYPAVVLKNAEM  240
            FDDYGEAFGKADVIGCLLDL+  EVSFTKNGQNLG+AFR+PDNLAK+TFYPAVVLKNAEM
Sbjct  178  FDDYGEAFGKADVIGCLLDLKNQEVSFTKNGQNLGVAFRLPDNLAKETFYPAVVLKNAEM  237

Query  241  LFNFGKTEFKYAPGNGFVAVCQAGAEHSKANPLASPTASSVSATPAPNAPQAIIIEPSRE  300
             FNFGKT+FKYAPGNGFV  CQAG EHSKANP+  P A + SA PAPNAPQAII+EPSRE
Sbjct  238  QFNFGKTDFKYAPGNGFVGACQAGPEHSKANPITGPAAGAPSAKPAPNAPQAIIMEPSRE  297

Query  301  LAEQTYSQIEKFKYHLSNPEVSSVLLIGGVRLEEQKGQLMQGAHIVVGTPGRLEEMINSG  360
            LAEQTY+QIEKFKYHLSNPEV S+LLIGGVRLEEQK QLMQG HIVVGTPGRLEEMINSG
Sbjct  298  LAEQTYNQIEKFKYHLSNPEVRSLLLIGGVRLEEQKAQLMQGTHIVVGTPGRLEEMINSG  357

Query  361  LVLLTHCRFFVLDEADGLLKSGYTELINRLHKQIPKITTDGRRLQMIVCSATLHDFEVKK  420
            LVLLTHCRFFVLDEAD LLK GYTELI+RLHKQIPKIT+DGRRLQM+VCSATLH FEVKK
Sbjct  358  LVLLTHCRFFVLDEADALLKQGYTELIDRLHKQIPKITSDGRRLQMVVCSATLHAFEVKK  417

Query  421  MAERLMHFPTWVDLKGEDAVPETVHHVVCLVDPKADTRWQSLRQAIPTDGIHDRDNVHPN  480
            MAERLMHFPTWVDLKGEDAVPETVHHVVCLVDP+ DT WQSLRQ I TDG+HDRDNVHP 
Sbjct  418  MAERLMHFPTWVDLKGEDAVPETVHHVVCLVDPQMDTTWQSLRQPIGTDGVHDRDNVHPG  477

Query  481  NPSEETYSQAVKLLKGEYCIHAIDKHKMDRALIFCRTKQDCDNLEKYFRQRGGQRYSCVC  540
            N S+ET SQAVKLLKGEYC+HAIDKH MDRA+IFCRTKQDCDNLE++ RQRGG+ YSCVC
Sbjct  478  NHSKETLSQAVKLLKGEYCVHAIDKHNMDRAIIFCRTKQDCDNLERFLRQRGGKHYSCVC  537

Query  541  LHGDRKPQERKQNLEMFKRQQVKFLICTDVAARGLDITGLPFMINVTMPDDKANYVHRIG  600
            LHGDRKPQERK+NLEMFKRQQVKFLICTDVAARGLDITGLPFMINVT+PDDK NYVHRIG
Sbjct  538  LHGDRKPQERKENLEMFKRQQVKFLICTDVAARGLDITGLPFMINVTLPDDKTNYVHRIG  597

Query  601  RVGRAERMGLAISLVSTVPEKVWYHGEWCKTRGRNCNNTNLTNVRGCCIWYNEPNLLAEV  660
            RVGRAERMGLAISLV+TVPEKVWYHGEWCK+RGR+CNNTNLT VRGCCIWYNEPNLLAEV
Sbjct  598  RVGRAERMGLAISLVATVPEKVWYHGEWCKSRGRSCNNTNLTEVRGCCIWYNEPNLLAEV  657

Query  661  EDHLNITIQQVDSAMDVPVNDFDGKVVYGQKNLSLGTGYEDHVEQLVPTVRKLTDLELQS  720
            EDHLNITIQQVD  MDVPVNDFDGKVVYGQKNL  G+GYEDHVEQLVPTVRKLT+LELQS
Sbjct  658  EDHLNITIQQVDKTMDVPVNDFDGKVVYGQKNLRTGSGYEDHVEQLVPTVRKLTELELQS  717

Query  721  QSLFLKRLKV  730
            QSLFLKRLKV
Sbjct  718  QSLFLKRLKV  727


>Q388E8_TRYB2 unnamed protein product
Length=660

 Score = 158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 106/331 (32%), Positives = 167/331 (50%), Gaps = 50/331 (15%)

Query  288  NAPQAIIIEPSRELAEQTYSQIEKFKYHLSNPEVSSVLLIGGVRLEEQKGQLMQGAHIVV  347
            ++PQA+I+ P+REL+ Q Y +  KF YH     V  V++ GG     Q  +L +G  ++V
Sbjct  235  SSPQALILAPTRELSLQIYGEARKFTYHTP---VRCVVVYGGADPRHQVHELSRGCKLLV  291

Query  348  GTPGRLEEMINSGLVLLTHCRFFVLDEADGLLKSGYTELINRLHKQIPK--ITTDGRRLQ  405
             TPGRL +M + G V  +  RF +LDEAD +L  G+   I R+  Q P   +   G+R Q
Sbjct  292  ATPGRLMDMFSRGYVRFSEIRFLILDEADRMLDMGFEPQI-RMIVQGPDSDMPRAGQR-Q  349

Query  406  MIVCSATLHDFEVKKMAERLMHFPTWVDLKGEDAVPETVHHVVCLVDPKADTRWQSLRQA  465
             ++ SAT    E++++A   M   +++ +    +  E +           D RW      
Sbjct  350  TLLYSATF-PVEIQRLAREFMCRHSFLQVGRVGSTTENI---------TQDVRW------  393

Query  466  IPTDGIHDRDNVHPNNPSEETYSQAVKLLKGEYCIHAIDKHKMDRALIFCRTKQDCDNLE  525
                 I D D                   K +  +  + +++    L+F   K+D D LE
Sbjct  394  -----IEDPD-------------------KRQALLTLLRENEGKLVLVFVEKKRDADYLE  429

Query  526  KYFRQRGGQRYSCVCLHGDRKPQERKQNLEMFKRQQVKFLICTDVAARGLDITGLPFMIN  585
            ++ R       +CV +HGDR  +ER++ L +FK    + L+ TDVA+RGLDI  +  +I 
Sbjct  430  RFLRN---SELACVSIHGDRVQREREEALRLFKSGACQVLVATDVASRGLDIPNVGVVIQ  486

Query  586  VTMPDDKANYVHRIGRVGRAERMGLAISLVS  616
              MP +  +YVHRIGR GRA ++G+AIS  +
Sbjct  487  YDMPSNIDDYVHRIGRTGRAGKVGVAISFFN  517


 Score = 46.6 bits (109),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/59 (36%), Positives = 34/59 (58%), Gaps = 0/59 (0%)

Query  3    AFEEFGVLPELGKATDEADWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPIL  61
            +F E  ++P L +      +T PT VQ+  IP  L   D++  A+TGSGKT ++ +P +
Sbjct  158  SFSEMNMVPVLLENVKRCGYTKPTPVQSLGIPTALNHRDLMACAQTGSGKTASYLIPAI  216


>Q4Q5P5_LEIMA unnamed protein product
Length=615

 Score = 155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 111/371 (30%), Positives = 173/371 (47%), Gaps = 56/371 (15%)

Query  254  GNGFVAVCQAGAEHSKA------NPLASPTASSVSATPAPNAPQAIIIEPSRELAEQTYS  307
            G+  +A  Q G+  + A      N +     +    T +  AP A+++ P+REL+ Q Y 
Sbjct  172  GSDLMACAQTGSGKTAAYLIPAINFMLVNNLNRAKPTNSQAAPSALVLSPTRELSIQIYE  231

Query  308  QIEKFKYHLSNPEVSSVLLIGGVRLEEQKGQLMQGAHIVVGTPGRLEEMINSGLVLLTHC  367
            +  KF Y         V++ GG     Q  +L +G  ++V TPGRL +M   G    +  
Sbjct  232  EGRKFTYRTG---FRCVVVYGGADPRHQIHELTRGCGLLVATPGRLSDMFTRGYTRYSDV  288

Query  368  RFFVLDEADGLLKSGYTELINRLHKQIP--KITTDGRRLQMIVCSATLHDFEVKKMAERL  425
            RF VLDEAD +L  G+   I R   Q P   +   G R Q ++ SAT    E+++MA   
Sbjct  289  RFLVLDEADRMLDMGFEPQI-RAIVQGPDSDMPPPGER-QTLLYSATFPK-EIQQMAREF  345

Query  426  MHFPTWVDLKGEDAVPETVHHVVCLVDPKADTRWQSLRQAIPTDGIHDRDNVHPNNPSEE  485
            ++   ++ +    +  E +           D RW           + D D          
Sbjct  346  LYHHHFLQVGRVGSTTENITQ---------DVRW-----------VEDMD----------  375

Query  486  TYSQAVKLLKGEYCIHAIDKHKMDRALIFCRTKQDCDNLEKYFRQRGGQRYSCVCLHGDR  545
                     K    +  + +H+ +R L+F   K+D D LE+Y RQ    R  C  +HGDR
Sbjct  376  ---------KRGCLLEVLKEHQGERVLVFVEKKRDADYLERYLRQ---SRIPCSSIHGDR  423

Query  546  KPQERKQNLEMFKRQQVKFLICTDVAARGLDITGLPFMINVTMPDDKANYVHRIGRVGRA  605
              +ER++ L++FK    + L+ TDVA+RGLDI  +  ++   +P +  +YVHRIGR GRA
Sbjct  424  VQREREEALDIFKSGVCRVLVATDVASRGLDIPNVAVVVQYDLPSNIDDYVHRIGRTGRA  483

Query  606  ERMGLAISLVS  616
             + G AIS  +
Sbjct  484  GKRGTAISFFN  494


 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/62 (34%), Positives = 34/62 (55%), Gaps = 0/62 (0%)

Query  3    AFEEFGVLPELGKATDEADWTLPTDVQAEAIPLILGGGDVLMAAETGSGKTGAFCLPILQ  62
            +F    + P L +  +   +  PT VQ   IP +L G D++  A+TGSGKT A+ +P + 
Sbjct  136  SFATMALAPALAENVNRCRYQKPTPVQKYGIPCVLNGSDLMACAQTGSGKTAAYLIPAIN  195

Query  63   IV  64
             +
Sbjct  196  FM  197



Lambda      K        H
   0.319    0.134    0.397 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 6801968780


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016439.1 GSK3-beta interaction protein [Drosophila kikkawai]

Length=157
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q22757_CAEEL  unnamed protein product                                 55.8    2e-10
D9PTP0_CAEEL  unnamed protein product                                 51.6    2e-08
B1V8J2_CAEEL  unnamed protein product                                 51.2    2e-08


>Q22757_CAEEL unnamed protein product
Length=156

 Score = 55.8 bits (133),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 68/125 (54%), Gaps = 15/125 (12%)

Query  20   DEANAIINDVKAHVAEICISSKLASDATQIFLNIRTIESATCCVQVTSRGFKIVSSQYDT  79
            +EA A + +    V  I +S  L   +  +F+N+ T E+ T C+++T +G+++ S++ D 
Sbjct  44   EEAMAAVRENAFAVNLIGVSEMLPRTSQLLFINVTTFENHTHCIELTQKGWRVASNRNDC  103

Query  80   IDEDKRISALLRNGGGSNSGDEEEEDEEIFETPYALLDKISPRYVESFGNQLCQQLRQLQ  139
            ++ D R               + +   + FE+ + LL  ISP + E+FG++L  +L +L+
Sbjct  104  MNGDFR---------------QLDIHTKYFESLHTLLMDISPLFRETFGSKLISKLSELK  148

Query  140  QMRTE  144
            + R++
Sbjct  149  KERSD  153


>D9PTP0_CAEEL unnamed protein product
Length=187

 Score = 51.6 bits (122),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 61/120 (51%), Gaps = 17/120 (14%)

Query  21   EANAIINDVKAHVAEICISSKLASDATQIFLNIRTIESATCCVQVTSRGFKIVSSQYDTI  80
            EA A ++++   V  I +S  L      IF+N+ T+E+   C+++T +G++I S + D +
Sbjct  29   EAIAAVHELSFAVQSISVSEMLPRTPDLIFVNVTTLEAQPYCLELTLKGWRITSLRSDCM  88

Query  81   DED-KRISALLRNGGGSNSGDEEEEDEEIFETPYALLDKISPRYVESFGNQLCQQLRQLQ  139
              D  R+                E   + +++ Y L+D ISP Y E F  +L Q+L+ ++
Sbjct  89   VGDFTRL----------------ELFTKYYDSLYLLMDDISPGYRERFSEKLVQRLKLIE  132


>B1V8J2_CAEEL unnamed protein product
Length=210

 Score = 51.2 bits (121),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/120 (28%), Positives = 61/120 (51%), Gaps = 17/120 (14%)

Query  21   EANAIINDVKAHVAEICISSKLASDATQIFLNIRTIESATCCVQVTSRGFKIVSSQYDTI  80
            EA A ++++   V  I +S  L      IF+N+ T+E+   C+++T +G++I S + D +
Sbjct  52   EAIAAVHELSFAVQSISVSEMLPRTPDLIFVNVTTLEAQPYCLELTLKGWRITSLRSDCM  111

Query  81   DED-KRISALLRNGGGSNSGDEEEEDEEIFETPYALLDKISPRYVESFGNQLCQQLRQLQ  139
              D  R+                E   + +++ Y L+D ISP Y E F  +L Q+L+ ++
Sbjct  112  VGDFTRL----------------ELFTKYYDSLYLLMDDISPGYRERFSEKLVQRLKLIE  155



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016440.1 ankyrin repeat and BTB/POZ domain-containing protein
2 isoform X1 [Drosophila kikkawai]

Length=1564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

K8F7T2_CAEEL  unnamed protein product                                 69.7    7e-12
MEL26_CAEEL  unnamed protein product                                  67.8    3e-11
RDX_DROME  unnamed protein product                                    56.2    2e-07


>K8F7T2_CAEEL unnamed protein product
Length=399

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 46/167 (28%), Positives = 83/167 (50%), Gaps = 6/167 (4%)

Query  1341  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1400
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1401  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1458
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1459  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLLQNMVA  1505
             L  + E    E ++++N  ++ I   +Y+A +L +     LLQ ++A
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTSLLQYILA  334


>MEL26_CAEEL unnamed protein product
Length=395

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 46/179 (26%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  1341  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1400
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1401  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1458
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1459  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLL---QNMVALLTYDDSVK  1514
             L  + E    E ++++N  ++ I   +Y+A +L +    ++L   +N+     ++D +K
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILK  346


>RDX_DROME unnamed protein product
Length=829

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 4/129 (3%)

Query  1363  FVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKLSEASSTPTVQINDIRYHIF  1422
               +N + SDVT  V G+ F  HK +L   S  F +M   ++ E      V I D+ + + 
Sbjct  648   LFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEE-RKLNRVAITDVDHEVL  706

Query  1423  QLVMQFLYSGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVAMYIH  1482
             + +++F+Y+G   +L+    D   L+AAA  + LE L    E      + V+      I 
Sbjct  707   KEMLRFIYTGKAPNLEKMADD---LLAAADKYALEKLKVMCEEALCVNLSVETAAETLIL  763

Query  1483  AKVYNANRL  1491
             A +++A++L
Sbjct  764   ADLHSADQL  772



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016441.1 ankyrin repeat and BTB/POZ domain-containing protein
2 isoform X2 [Drosophila kikkawai]

Length=1319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

K8F7T2_CAEEL  unnamed protein product                                 69.7    5e-12
MEL26_CAEEL  unnamed protein product                                  67.8    2e-11
RDX_DROME  unnamed protein product                                    56.2    1e-07


>K8F7T2_CAEEL unnamed protein product
Length=399

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/167 (28%), Positives = 83/167 (50%), Gaps = 6/167 (4%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLLQNMVA  1260
             L  + E    E ++++N  ++ I   +Y+A +L +     LLQ ++A
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTSLLQYILA  334


>MEL26_CAEEL unnamed protein product
Length=395

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/179 (26%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLL---QNMVALLTYDDSVK  1269
             L  + E    E ++++N  ++ I   +Y+A +L +    ++L   +N+     ++D +K
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILK  346


>RDX_DROME unnamed protein product
Length=829

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 4/129 (3%)

Query  1118  FVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKLSEASSTPTVQINDIRYHIF  1177
               +N + SDVT  V G+ F  HK +L   S  F +M   ++ E      V I D+ + + 
Sbjct  648   LFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEE-RKLNRVAITDVDHEVL  706

Query  1178  QLVMQFLYSGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVAMYIH  1237
             + +++F+Y+G   +L+    D   L+AAA  + LE L    E      + V+      I 
Sbjct  707   KEMLRFIYTGKAPNLEKMADD---LLAAADKYALEKLKVMCEEALCVNLSVETAAETLIL  763

Query  1238  AKVYNANRL  1246
             A +++A++L
Sbjct  764   ADLHSADQL  772



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016442.1 ankyrin repeat and BTB/POZ domain-containing protein
2 isoform X2 [Drosophila kikkawai]

Length=1319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

K8F7T2_CAEEL  unnamed protein product                                 69.7    5e-12
MEL26_CAEEL  unnamed protein product                                  67.8    2e-11
RDX_DROME  unnamed protein product                                    56.2    1e-07


>K8F7T2_CAEEL unnamed protein product
Length=399

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/167 (28%), Positives = 83/167 (50%), Gaps = 6/167 (4%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLLQNMVA  1260
             L  + E    E ++++N  ++ I   +Y+A +L +     LLQ ++A
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTSLLQYILA  334


>MEL26_CAEEL unnamed protein product
Length=395

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/179 (26%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLL---QNMVALLTYDDSVK  1269
             L  + E    E ++++N  ++ I   +Y+A +L +    ++L   +N+     ++D +K
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILK  346


>RDX_DROME unnamed protein product
Length=829

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 4/129 (3%)

Query  1118  FVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKLSEASSTPTVQINDIRYHIF  1177
               +N + SDVT  V G+ F  HK +L   S  F +M   ++ E      V I D+ + + 
Sbjct  648   LFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEE-RKLNRVAITDVDHEVL  706

Query  1178  QLVMQFLYSGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVAMYIH  1237
             + +++F+Y+G   +L+    D   L+AAA  + LE L    E      + V+      I 
Sbjct  707   KEMLRFIYTGKAPNLEKMADD---LLAAADKYALEKLKVMCEEALCVNLSVETAAETLIL  763

Query  1238  AKVYNANRL  1246
             A +++A++L
Sbjct  764   ADLHSADQL  772



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016443.1 ankyrin repeat and BTB/POZ domain-containing protein
2 isoform X2 [Drosophila kikkawai]

Length=1319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

K8F7T2_CAEEL  unnamed protein product                                 69.7    5e-12
MEL26_CAEEL  unnamed protein product                                  67.8    2e-11
RDX_DROME  unnamed protein product                                    56.2    1e-07


>K8F7T2_CAEEL unnamed protein product
Length=399

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/167 (28%), Positives = 83/167 (50%), Gaps = 6/167 (4%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLLQNMVA  1260
             L  + E    E ++++N  ++ I   +Y+A +L +     LLQ ++A
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTSLLQYILA  334


>MEL26_CAEEL unnamed protein product
Length=395

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/179 (26%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLL---QNMVALLTYDDSVK  1269
             L  + E    E ++++N  ++ I   +Y+A +L +    ++L   +N+     ++D +K
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILK  346


>RDX_DROME unnamed protein product
Length=829

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 4/129 (3%)

Query  1118  FVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKLSEASSTPTVQINDIRYHIF  1177
               +N + SDVT  V G+ F  HK +L   S  F +M   ++ E      V I D+ + + 
Sbjct  648   LFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEE-RKLNRVAITDVDHEVL  706

Query  1178  QLVMQFLYSGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVAMYIH  1237
             + +++F+Y+G   +L+    D   L+AAA  + LE L    E      + V+      I 
Sbjct  707   KEMLRFIYTGKAPNLEKMADD---LLAAADKYALEKLKVMCEEALCVNLSVETAAETLIL  763

Query  1238  AKVYNANRL  1246
             A +++A++L
Sbjct  764   ADLHSADQL  772



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016444.1 ankyrin repeat and BTB/POZ domain-containing protein
2 isoform X2 [Drosophila kikkawai]

Length=1319
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

K8F7T2_CAEEL  unnamed protein product                                 69.7    5e-12
MEL26_CAEEL  unnamed protein product                                  67.8    2e-11
RDX_DROME  unnamed protein product                                    56.2    1e-07


>K8F7T2_CAEEL unnamed protein product
Length=399

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 46/167 (28%), Positives = 83/167 (50%), Gaps = 6/167 (4%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLLQNMVA  1260
             L  + E    E ++++N  ++ I   +Y+A +L +     LLQ ++A
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTSLLQYILA  334


>MEL26_CAEEL unnamed protein product
Length=395

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 46/179 (26%), Positives = 88/179 (49%), Gaps = 9/179 (5%)

Query  1096  TLPPVKEQPTLQPVQGSRIDPKFVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLS  1155
             T  P++ +PT    Q      +  +   L D    V GKI   HK VL   SP F +ML+
Sbjct  172   TNEPIQFEPTNSEQQLIEDYQRLFSQELLCDFAINVNGKIIRAHKAVLAARSPVFNAMLT  231

Query  1156  SKLSEASSTPTVQINDIRYHIFQLVMQFLYSGGCSS--LDVAHGDVLELMAAASFFQLEG  1213
              + ++ + +  + IND+ Y +   ++ ++Y G C+    D+A      L+ AA  ++LE 
Sbjct  232   HQDTDEAKSSMMYINDMDYDVIYEMVYYIYCGRCNKDITDMATA----LLIAADKYRLEE  287

Query  1214  LLRYTEARCSEMVDVDNVVAMYIHAKVYNANRLLEYCQCFLL---QNMVALLTYDDSVK  1269
             L  + E    E ++++N  ++ I   +Y+A +L +    ++L   +N+     ++D +K
Sbjct  288   LKSHCEKYLVENINIENACSLLIIGDLYSAPKLRKRAVTYILARPKNVTGTPGWEDILK  346


>RDX_DROME unnamed protein product
Length=829

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 63/129 (49%), Gaps = 4/129 (3%)

Query  1118  FVNNPELSDVTFRVEGKIFYGHKIVLVTASPRFQSMLSSKLSEASSTPTVQINDIRYHIF  1177
               +N + SDVT  V G+ F  HK +L   S  F +M   ++ E      V I D+ + + 
Sbjct  648   LFDNEKFSDVTLSVGGREFQAHKAILAARSDVFAAMFEHEMEE-RKLNRVAITDVDHEVL  706

Query  1178  QLVMQFLYSGGCSSLDVAHGDVLELMAAASFFQLEGLLRYTEARCSEMVDVDNVVAMYIH  1237
             + +++F+Y+G   +L+    D   L+AAA  + LE L    E      + V+      I 
Sbjct  707   KEMLRFIYTGKAPNLEKMADD---LLAAADKYALEKLKVMCEEALCVNLSVETAAETLIL  763

Query  1238  AKVYNANRL  1246
             A +++A++L
Sbjct  764   ADLHSADQL  772



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016445.1 histone acetyltransferase KAT2A [Drosophila kikkawai]

Length=818
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTZ1_DROME  unnamed protein product                                 1517    0.0  
O76216_DROME  unnamed protein product                                 1516    0.0  
Q8IB67_PLAF7  unnamed protein product                                 274     2e-77


>Q9VTZ1_DROME unnamed protein product
Length=813

 Score = 1517 bits (3927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 755/818 (92%), Positives = 773/818 (94%), Gaps = 5/818 (1%)

Query  1    MSGGPSITLKSQPIDGNNTGNAAAAQQQQQSANGAASGSSAAAAAAGSQGQNHGNGGGVG  60
            MSGGPSIT+KSQPIDGNNTGNAAA QQQQ +   A +G+S AA +A    QN G+GG   
Sbjct  1    MSGGPSITIKSQPIDGNNTGNAAAQQQQQAANGAATAGASGAAGSA----QNPGHGGAAS  56

Query  61   GGASAPAEGTRQNSLQRIQQRKQKVFNLPVAQKLAKLSMYSSCQSEGCRCTGWKTPQENR  120
            G  S PAEGTRQNSLQRIQQRKQKVFNLPV QKLAKLSMYS+CQSEGCRCTGWKTPQENR
Sbjct  57   GAGSVPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENR  116

Query  121  HRDVESSYCPEFNEECRNSSCRHSLRTHIAHLDNISSSSMDELLGAIIDMENLFMSMQRV  180
            HRDVESSYCPEFNEECRN+SCRHSLR+HIAHLDNISSSSM+ELLGAIIDMENLFMSMQRV
Sbjct  117  HRDVESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRV  176

Query  181  EDEDTKKVYLYLFRLLRQCVLTRQQAVIRGPLGDPPFESPCITKAVLSLVFYKYNHLNPT  240
            EDEDTKKVY YLFRLLRQCVLTRQQAVIRGPLGDPPFE+PCITKAVLSLVFYKYNHL+  
Sbjct  177  EDEDTKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTP  236

Query  241  ELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLR  300
            ELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLR
Sbjct  237  ELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLR  296

Query  301  QFETSLVFGRTLLRTVFQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRAELLKD  360
            Q ETSLVFGRTLLRTVFQ MSQQLKKKCISERDRFPEDKRSIIT MPKFLE LRAELLKD
Sbjct  297  QCETSLVFGRTLLRTVFQCMSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKD  356

Query  361  DSPIWDPNYRPPNSFVIQQRKRHQEVAPAVAPGGIVASVGSAKRASVGEPLHKRIKKEPT  420
            DSPIWD +YRP NSFVIQQRKR+QEVA  V  G   AS+G  KR SVGEPLHKRIKKEPT
Sbjct  357  DSPIWDTSYRPSNSFVIQQRKRNQEVA-NVPIGPSAASIGGNKRTSVGEPLHKRIKKEPT  415

Query  421  DRSISENLDDLPTDVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVV  480
            DR  SENLDDLP DVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVV
Sbjct  416  DRPSSENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVV  475

Query  481  GNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGIC  540
            GNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGIC
Sbjct  476  GNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGIC  535

Query  541  FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK  600
            FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK
Sbjct  536  FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK  595

Query  601  QGFSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRNQSEILKELIAQRHN  660
            QGFSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIR+QSEILKELIAQRHN
Sbjct  596  QGFSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHN  655

Query  661  EVQKVRPGLTCFKEGLPSIPVESIPGLREIGWKPQMRPARSARPLEESSDPEKLATSFAS  720
            EVQKVRPGLTCFKEGLP IPVESIPGLREIGWKPQ RPARS+RPLEES+DPEKLATSFAS
Sbjct  656  EVQKVRPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFAS  715

Query  721  VLQSVRQHNTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMAR  780
            VLQSVRQH TAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMAR
Sbjct  716  VLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMAR  775

Query  781  IFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK  818
            IFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
Sbjct  776  IFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK  813


>O76216_DROME unnamed protein product
Length=813

 Score = 1516 bits (3925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 753/818 (92%), Positives = 774/818 (95%), Gaps = 5/818 (1%)

Query  1    MSGGPSITLKSQPIDGNNTGNAAAAQQQQQSANGAASGSSAAAAAAGSQGQNHGNGGGVG  60
            MSGGPSIT+KSQPIDGNNTGNAAA QQQQ +   A +G+S AA +A    QN G+GG   
Sbjct  1    MSGGPSITIKSQPIDGNNTGNAAAQQQQQAANGAATAGASGAAGSA----QNPGHGGAAS  56

Query  61   GGASAPAEGTRQNSLQRIQQRKQKVFNLPVAQKLAKLSMYSSCQSEGCRCTGWKTPQENR  120
            G  S PAEGTRQNSLQRIQQRKQKVFNLPV QKLAKLSMYS+CQSEGCRCTGWKTPQENR
Sbjct  57   GAGSVPAEGTRQNSLQRIQQRKQKVFNLPVPQKLAKLSMYSACQSEGCRCTGWKTPQENR  116

Query  121  HRDVESSYCPEFNEECRNSSCRHSLRTHIAHLDNISSSSMDELLGAIIDMENLFMSMQRV  180
            HRDVESSYCPEFNEECRN+SCRHSLR+HIAHLDNISSSSM+ELLGAIIDMENLFMSMQRV
Sbjct  117  HRDVESSYCPEFNEECRNTSCRHSLRSHIAHLDNISSSSMNELLGAIIDMENLFMSMQRV  176

Query  181  EDEDTKKVYLYLFRLLRQCVLTRQQAVIRGPLGDPPFESPCITKAVLSLVFYKYNHLNPT  240
            EDEDTKKVY YLFRLLRQCVLTRQQAVIRGPLGDPPFE+PCITKAVLSLVFYKYNHL+  
Sbjct  177  EDEDTKKVYQYLFRLLRQCVLTRQQAVIRGPLGDPPFETPCITKAVLSLVFYKYNHLSTP  236

Query  241  ELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLR  300
            ELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLR
Sbjct  237  ELQTMTEVAKTFLNFLNHYNFESPSTRRGDLTHEDASNYKINYTRWLVFCHVPAFCNSLR  296

Query  301  QFETSLVFGRTLLRTVFQYMSQQLKKKCISERDRFPEDKRSIITQMPKFLEALRAELLKD  360
            Q ETSLVFGRTLLRTVFQ +SQQLKKKCISERDRFPEDKRSIIT MPKFLE LRAELLKD
Sbjct  297  QCETSLVFGRTLLRTVFQCVSQQLKKKCISERDRFPEDKRSIITLMPKFLETLRAELLKD  356

Query  361  DSPIWDPNYRPPNSFVIQQRKRHQEVAPAVAPGGIVASVGSAKRASVGEPLHKRIKKEPT  420
            DSPIWD +YRP NSFVIQQRKR+QEVA +V  G   AS+G  KR SVGEPLHKRIKKEPT
Sbjct  357  DSPIWDTSYRPSNSFVIQQRKRNQEVA-SVPIGPSAASIGGNKRTSVGEPLHKRIKKEPT  415

Query  421  DRSISENLDDLPTDVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVV  480
            DR  SENLDDLP DVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVV
Sbjct  416  DRPSSENLDDLPADVVMRAMKSVSESKTTNKAEILFPVNVSRDENVKAEEQKRAIEFHVV  475

Query  481  GNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGIC  540
            GNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGIC
Sbjct  476  GNSLTKPVDKQTVLWLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGIC  535

Query  541  FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK  600
            FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK
Sbjct  536  FRPFPSQGFTEIVFCAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKK  595

Query  601  QGFSKDIKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRNQSEILKELIAQRHN  660
            QGFSKD+KLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIR+QSEILKELIAQRHN
Sbjct  596  QGFSKDVKLARPVYAGYIKEYDSATLMHCELHPSIVNTQFIAVIRSQSEILKELIAQRHN  655

Query  661  EVQKVRPGLTCFKEGLPSIPVESIPGLREIGWKPQMRPARSARPLEESSDPEKLATSFAS  720
            EVQKVRPGLTCFKEGLP IPVESIPGLREIGWKPQ RPARS+RPLEES+DPEKLATSFAS
Sbjct  656  EVQKVRPGLTCFKEGLPVIPVESIPGLREIGWKPQNRPARSSRPLEESTDPEKLATSFAS  715

Query  721  VLQSVRQHNTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMAR  780
            VLQSVRQH TAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMAR
Sbjct  716  VLQSVRQHTTAWPFLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMAR  775

Query  781  IFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK  818
            IFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK
Sbjct  776  IFSNCRFYNSPDTEYYRCANSLERYFQTKMRELGLWDK  813


>Q8IB67_PLAF7 unnamed protein product
Length=1465

 Score = 274 bits (701),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 217/370 (59%), Gaps = 16/370 (4%)

Query  440   MKSVSESKTTNKAEILFPVN-----VSRDENVKAEEQKRAIEFHVVGNSLTKPVDKQTVL  494
             M  ++ +K ++K + L P       + RD     EE    I F  + N      +   ++
Sbjct  1091  MLFINATKQSDKLQSLLPSETGLGYLHRDAGGAKEENMGIITFECITNDR----EPDHLI  1146

Query  495   WLLGLQLVFAYQLPEMPREYISQLVFDTKHKTLALIKENQPIGGICFRPFPSQGFTEIVF  554
              L+ L+ +F+ QLP+MPREYI +LVFD  H T  L+K+N  IGG+CFRP+  Q F EI F
Sbjct  1147  KLITLKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKNTVIGGVCFRPYFEQKFAEIAF  1206

Query  555   CAVTMSEQVKGYGTHLMNHLKDYSIQRGIKHLLTFADCDAIGYFKKQGFSKDIKLARPVY  614
              AVT +EQVKGYGT LMNHLK++  + GI++ LT+AD  AIGYF+KQGFS+ I + +  +
Sbjct  1207  LAVTSTEQVKGYGTRLMNHLKEHVKKFGIEYFLTYADNFAIGYFRKQGFSQKISMPKERW  1266

Query  615   AGYIKEYDSATLMHCELHPSIVNTQFIAVIRNQSEILKELIAQRHNEVQKVRPGLTCFKE  674
              GYIK+YD  TLM C + P+I   +   ++  Q + +K+ I     + Q +  G+  F +
Sbjct  1267  FGYIKDYDGGTLMECYIFPNINYLRLSEMLYEQKKAVKKAI--HFIKPQVIYKGINYFAD  1324

Query  675   GL-PSIPVESIPGLREIGWKPQMRPARSARPLEESSDPEKLATSFASVLQSVRQHNTAWP  733
                 ++   +IPGL E+GWK + R        +E     +L      VL  + +  +AWP
Sbjct  1325  NKGAALHPSTIPGLLEVGWKKETREITKKVQHKEV----QLKDQILGVLDYLEKQQSAWP  1380

Query  734   FLRPVTAAEVPDYYDHIKYPMDLKTMGERLKKGYYQTRRLFMADMARIFSNCRFYNSPDT  793
             FL+PV+ +E PDYYD IK P D+ TM  + + G Y+T+  F  ++ R+F NCR YN+P T
Sbjct  1381  FLKPVSLSEAPDYYDIIKEPTDILTMRRKARHGDYKTKEDFGIELKRMFDNCRLYNAPTT  1440

Query  794   EYYRCANSLE  803
              Y++ AN L+
Sbjct  1441  IYFKYANELQ  1450



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016446.1 kelch domain-containing protein 4 [Drosophila
kikkawai]

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

HCF_DROME  unnamed protein product                                    77.8    1e-14
LZTR1_DROME  unnamed protein product                                  65.5    6e-11
Q4GZD6_TRYB2  unnamed protein product                                 61.6    6e-10


>HCF_DROME unnamed protein product
Length=1500

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 81/314 (26%), Positives = 129/314 (41%), Gaps = 58/314 (18%)

Query  64   TPPSPRSNFTLVAHPEKEELIMFGGELYTGSKTTVYNDLYFYNIKSGEWRELRSPAGPTP  123
            T P PR      A   KE +++FGG         + ++L+ YN  + +W  +    G  P
Sbjct  67   TGPQPRPRHGHRAINIKELMVVFGG-----GNEGIVDELHVYNTVTNQWY-VPVLKGDVP  120

Query  124  RSCHQMVAVASNGGELWMFGGEHASPSQLQFHHY-KDLWKFSLKSRKWEKI--TSPNG--  178
              C     V   G  +++FGG       +++  Y  +L++      +W K+   SP+   
Sbjct  121  NGCAAYGFVV-EGTRMFVFGG------MIEYGKYSNELYELQATKWEWRKMYPESPDSGL  173

Query  179  -PSARSGHRMTVSKKRLFIFGGFHD-----NNQSYHYFNDLHIFSLESY-----QWLKVE  227
             P  R GH  T+  +++F+FGG  +      N    Y NDL+I           +W+  +
Sbjct  174  SPCPRLGHSFTMVGEKIFLFGGLANESDDPKNNIPKYLNDLYILDTRGVHSHNGKWIVPK  233

Query  228  IAGAVLPPPR---SGCCMAAAPDG--KIFVWGGYSRASMKKEVDRGVTHTDMFALTQDKN  282
              G   PPPR   +G   A   +G   + ++GG S          G    D++ L  D  
Sbjct  234  TYGDS-PPPRESHTGISFATKSNGNLNLLIYGGMS----------GCRLGDLWLLETD--  280

Query  283  AGDADNKYKWTAVKPGGYKPKPRSSVSYTVAANGKAYCFGG----VMDVNEDDEDVEGQF  338
                     W+  K  G  P PRS  S T+  N K Y FGG    V++ ++   + E + 
Sbjct  281  ------SMTWSKPKTSGEAPLPRSLHSSTMIGN-KMYVFGGWVPLVINDSKSTTEREWKC  333

Query  339  GDELLAFDLTAQTW  352
             + L   DL   TW
Sbjct  334  TNTLAVLDLETMTW  347


 Score = 46.2 bits (108),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/150 (25%), Positives = 67/150 (45%), Gaps = 24/150 (16%)

Query  66   PSPRSNFTLVAHPEKEE----LIMFGGELYTGSKTTVYNDLYFYNIKSGEWRELRSPA-G  120
            P PR + T ++   K      L+++GG   +G +     DL+     S  W + ++    
Sbjct  239  PPPRESHTGISFATKSNGNLNLLIYGG--MSGCR---LGDLWLLETDSMTWSKPKTSGEA  293

Query  121  PTPRSCHQMVAVASNGGELWMFGG-------EHASPSQLQFHHYKDLWKFSLKSRKWEKI  173
            P PRS H    +   G ++++FGG       +  S ++ ++     L    L++  WE +
Sbjct  294  PLPRSLHSSTMI---GNKMYVFGGWVPLVINDSKSTTEREWKCTNTLAVLDLETMTWENV  350

Query  174  T----SPNGPSARSGHRMTVSKKRLFIFGG  199
            T      N P AR+GH     + RL+++ G
Sbjct  351  TLDTVEENVPRARAGHCAVGIQSRLYVWSG  380


>LZTR1_DROME unnamed protein product
Length=975

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 80/339 (24%), Positives = 133/339 (39%), Gaps = 58/339 (17%)

Query  124  RSCHQMVAVASNGGELWMFGGEHASPSQLQFHHYKDLWKFSLKSRKWEKITSPNGPSA-R  182
            RS H +VA       +++FGG++        +   DL +F +K + W +  +   P A R
Sbjct  252  RSKHTVVAYKD---AMFVFGGDNGK------NMLNDLIRFGVKDKSWGRACATGTPPAPR  302

Query  183  SGHRMTVSKKRLFIFGGF----HDNNQSYHYFNDLHIFSLESYQWLKVEIAGAVLPPPRS  238
              H   V+   +FIFGG+    H N+   +  NDL  +  +S  W++ + +G   P PRS
Sbjct  303  YHHSAVVAGSSMFIFGGYTGDIHSNSNLTNK-NDLFEYKFQSAMWVEWKFSGR-QPVPRS  360

Query  239  GCCMAAAPDGKIFVWGGYSRASMKKEVDRGVTHTDMFALTQDKNAGDADNKYKWTAVKPG  298
                AA  D K++++ GY         D      DM+ L       +   + +W  V   
Sbjct  361  AHG-AAVYDNKMWIYAGY---------DGNARLNDMWTL-------NLTGENQWEEVDQL  403

Query  299  GYKPKPRSSVSYTVAANGKAYCFGGVMDVNEDDEDVEGQFGDELLAFDLTAQTWRLQEIQ  358
            G +P    +    VA +   Y F G   +         Q  + L  F    +TWR    +
Sbjct  404  GDRPPTCCNFPVAVARDA-MYVFSGQSGL---------QITNSLFEFHFKTRTWR----R  449

Query  359  TKASPAEKKEETNDVEMSTGPAQPVTTTTDGVFTVTVGGPSTSTTP-------YVSNIPS  411
                P  +   +       G     T      F    GG + ST P         S + S
Sbjct  450  ISNEPVLRGATSAPPSRRYGH----TMVHHDRFLYVFGGSADSTLPNDLHCYDLDSQVWS  505

Query  412  LFGKPKPTNVPSPRMNPGLCVCKGTLYLFGGILEEDAKQ  450
            +    + ++VPS R+     V    +Y+FGG ++   ++
Sbjct  506  VIQPEQNSDVPSGRVFHASAVICDAMYIFGGTVDNSVRR  544


 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 68/276 (25%), Positives = 116/276 (42%), Gaps = 46/276 (17%)

Query  64   TPPSPRSNFTLVAHPEKEELIMFGG---ELYTGSKTTVYNDLYFYNIKSGEWRELR-SPA  119
            TPP+PR + + V       + +FGG   ++++ S  T  NDL+ Y  +S  W E + S  
Sbjct  297  TPPAPRYHHSAVV--AGSSMFIFGGYTGDIHSNSNLTNKNDLFEYKFQSAMWVEWKFSGR  354

Query  120  GPTPRSCHQMVAVASNGGELWMFGGEHASPSQLQFHHYKDLWKFSLKSR-KWEKITSP-N  177
             P PRS H   AV  N  ++W++ G   +          D+W  +L    +WE++    +
Sbjct  355  QPVPRSAHG-AAVYDN--KMWIYAGYDGNA------RLNDMWTLNLTGENQWEEVDQLGD  405

Query  178  GPSARSGHRMTVSKKRLFIFGGFHDNNQSYHYFNDLHIFSLESYQWLKVE----IAGAVL  233
             P       + V++  +++F G           N L  F  ++  W ++     + GA  
Sbjct  406  RPPTCCNFPVAVARDAMYVFSG----QSGLQITNSLFEFHFKTRTWRRISNEPVLRGATS  461

Query  234  PPP--RSGCCMAAAPDGKIFVWGGYSRASMKKEVDRGVTHTDMFALTQDKNAGDADNKYK  291
             PP  R G  M    D  ++V+GG + ++                L  D +  D D++  
Sbjct  462  APPSRRYGHTM-VHHDRFLYVFGGSADST----------------LPNDLHCYDLDSQV-  503

Query  292  WTAVKPGGYKPKPRSSVSYTVAANGKA-YCFGGVMD  326
            W+ ++P      P   V +  A    A Y FGG +D
Sbjct  504  WSVIQPEQNSDVPSGRVFHASAVICDAMYIFGGTVD  539


>Q4GZD6_TRYB2 unnamed protein product
Length=426

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/257 (23%), Positives = 116/257 (45%), Gaps = 27/257 (11%)

Query  75   VAHPEKEELIMFGGELYTGSKTTVYNDLYFYNIKSGEW--RELRSPAGPTPRSCHQMVAV  132
            +A+ + E+LI+FGG    G+   ++ND+Y +++K+  W  +E  +     PR  H  V  
Sbjct  35   LANYKDEQLILFGG----GALHIIFNDVYCFDLKTSTWSYKETTNSEIVAPRISHSAVV-  89

Query  133  ASNGGELWMFGGEHA-SPSQLQFHHYKDLWKFSLKSRKWEKITSPNGPSARSGHRMTVSK  191
              +  +++++GG+    P++       DL  F+    + +   +P+GP  R  H   + +
Sbjct  90   --HEDKMYVYGGQDLYMPTRFADVLVLDLITFTWSLIQQQATPAPDGPGDRRLHTAHIYR  147

Query  192  KRLFIFGGFHDNNQSYHYFNDLHIFSLESYQWLKVEIAGAVLPPPRSGCCMAAAPDGK-I  250
              +++  G   N  +  +F D     L + +W  V  +G    P       +A  +G  +
Sbjct  148  NCMYVLMGEPCNISNSFWFLD-----LTTLEWHPVHSSGWFGKPILPLLGHSAQVEGDYL  202

Query  251  FVWGGYSRASMKKEVDRGVTHTDMFALTQDKNAGDADNKYKWTAVKP-GGYKPKPRSSVS  309
            +V+GGY   S ++     V +  +F+     N         W  V P  G +P PR + +
Sbjct  203  YVFGGYHADSARRN-GSPVYNNSLFSYHFPSNT--------WREVVPSSGPRPSPRYASA  253

Query  310  YTVAANGKAYCFGGVMD  326
              V   G+ + +GG +D
Sbjct  254  MAV-IRGRVFIYGGDVD  269


 Score = 45.4 bits (106),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 72/175 (41%), Gaps = 47/175 (27%)

Query  76   AHPEKEELIMFGGELYTGSK---TTVYND-LYFYNIKSGEWRELRSPAGPTPRSCHQMVA  131
            A  E + L +FGG     ++   + VYN+ L+ Y+  S  WRE+   +GP P S     A
Sbjct  195  AQVEGDYLYVFGGYHADSARRNGSPVYNNSLFSYHFPSNTWREVVPSSGPRP-SPRYASA  253

Query  132  VASNGGELWMFGGEHASPSQLQFHHYKDLWKFSLK-------------------------  166
            +A   G ++++GG+          ++ D W                              
Sbjct  254  MAVIRGRVFIYGGDVDGEV-----YFDDFWCIDTNIPSSAASQSSSSSSYTTSLVAAPPA  308

Query  167  -SRKWEKITSPNG---PSARSGHRMTVSKKRLFIFGG--------FHDNNQSYHY  209
             S +W  IT   G   PSARSGH   V++  LF+ GG         + +N++Y Y
Sbjct  309  ASSRWIDITLSCGRGRPSARSGHASAVAQGCLFVVGGELPGDRDVVYYSNRTYRY  363


 Score = 43.9 bits (102),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/222 (23%), Positives = 84/222 (38%), Gaps = 32/222 (14%)

Query  9    KKGKGAEKTAMKTDKKLAAKQKKMLEKLGE-----ANIADII--QLLESKEGKIQTITEN  61
            K+   +E  A +        + KM    G+        AD++   L+      IQ     
Sbjct  71   KETTNSEIVAPRISHSAVVHEDKMYVYGGQDLYMPTRFADVLVLDLITFTWSLIQQQATP  130

Query  62   ACTPPSPRSNFTLVAHPEKEELIMFGGELYTGSKTTVYNDLYFYNIKSGEWRELRS----  117
            A   P  R   T  AH  +  + +  GE        + N  +F ++ + EW  + S    
Sbjct  131  APDGPGDRRLHT--AHIYRNCMYVLMGE-----PCNISNSFWFLDLTTLEWHPVHSSGWF  183

Query  118  --PAGPTPRSCHQMVAVASNGGELWMFGGEHASPSQLQFH--HYKDLWKFSLKSRKWEKI  173
              P  P      Q+      G  L++FGG HA  ++      +   L+ +   S  W ++
Sbjct  184  GKPILPLLGHSAQV-----EGDYLYVFGGYHADSARRNGSPVYNNSLFSYHFPSNTWREV  238

Query  174  TSPNGP--SARSGHRMTVSKKRLFIFGGFHDNNQSYHYFNDL  213
               +GP  S R    M V + R+FI+GG  D      YF+D 
Sbjct  239  VPSSGPRPSPRYASAMAVIRGRVFIYGGDVDGEV---YFDDF  277


 Score = 32.3 bits (72),  Expect = 1.1, Method: Compositional matrix adjust.
 Identities = 62/302 (21%), Positives = 113/302 (37%), Gaps = 95/302 (31%)

Query  220  SYQWLKVEIAGAVLPPPRSGCC--MAAAPDGKIFVWGGYSRASMKKEVDRGVTHTDMFAL  277
            ++ W  V  +G +   P  GCC  +A   D ++ ++GG +   +  +V      T  ++ 
Sbjct  14   TFMWNSVPPSGDM---PLHGCCHSLANYKDEQLILFGGGALHIIFNDVYCFDLKTSTWSY  70

Query  278  TQDKNAGDADNKYKWTAVKPGGYKPKPRSSVSYTVAANGKAYCFGGVMDVNEDDEDVEGQ  337
             +  N+                    PR S S  V    K Y +GG       D  +  +
Sbjct  71   KETTNSEIV----------------APRISHS-AVVHEDKMYVYGG------QDLYMPTR  107

Query  338  FGDELLAFDLTAQTWRLQEIQTKASPA-----EKKEETNDV-------------------  373
            F D +L  DL   TW L  IQ +A+PA     +++  T  +                   
Sbjct  108  FAD-VLVLDLITFTWSL--IQQQATPAPDGPGDRRLHTAHIYRNCMYVLMGEPCNISNSF  164

Query  374  ---EMSTGPAQPVTTT----------------TDGVFTVTVGGPSTST-----TPYVSNI  409
               +++T    PV ++                 +G +    GG    +     +P  +N 
Sbjct  165  WFLDLTTLEWHPVHSSGWFGKPILPLLGHSAQVEGDYLYVFGGYHADSARRNGSPVYNN-  223

Query  410  PSLFGKPKPTNV-----------PSPRMNPGLCVCKGTLYLFGGILEEDAKQLTYNDFYS  458
             SLF    P+N            PSPR    + V +G ++++GG ++    ++ ++DF+ 
Sbjct  224  -SLFSYHFPSNTWREVVPSSGPRPSPRYASAMAVIRGRVFIYGGDVD---GEVYFDDFWC  279

Query  459  LD  460
            +D
Sbjct  280  ID  281



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016447.1 phosphomannomutase [Drosophila kikkawai]

Length=254
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

PMM_DROME  unnamed protein product                                    494     7e-180
Q38AW2_TRYB2  unnamed protein product                                 266     6e-90 
Q9U2G5_CAEEL  unnamed protein product                                 30.0    2.2   


>PMM_DROME unnamed protein product
Length=254

 Score = 494 bits (1271),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)

Query  1    MCTATLKRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSKVKPRATIGIVGGSDLEKMFEQ  60
            M TA LKRDEILLLFDVDGTLTMPRSVVTPEFEEFFYS+VKPRATIGIVGGSDLEKMFEQ
Sbjct  1    MTTAALKRDEILLLFDVDGTLTMPRSVVTPEFEEFFYSRVKPRATIGIVGGSDLEKMFEQ  60

Query  61   LSGQKILTEFDFIFPENGLVQIEGGKEVGKQNIIKHLGEKTLQRFINFVLRYLSELELPI  120
            L+G+KIL EFDFIFPENGLVQIEGGKEVGKQNII HLGE+T++RFINFVLRYLSEL++PI
Sbjct  61   LNGRKILNEFDFIFPENGLVQIEGGKEVGKQNIIMHLGEETVKRFINFVLRYLSELDVPI  120

Query  121  KRGTFIEFRNGMMNVCPIGRQCSREERNMFAAYDNEHKVREKMISDLKKEFADVDLTYSI  180
            KRGTFIEFRNGMMNVCPIGRQC+REERNMFA YD EHKVREKMI DLK+EFADVDLTYSI
Sbjct  121  KRGTFIEFRNGMMNVCPIGRQCTREERNMFAEYDIEHKVREKMIKDLKQEFADVDLTYSI  180

Query  181  GGQISFDVFPHGWDKTYCLRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYT  240
            GGQISFDVFPHGWDKTYCLRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYT
Sbjct  181  GGQISFDVFPHGWDKTYCLRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYT  240

Query  241  PKDTQRILTEILEL  254
            PKDTQRILTEILEL
Sbjct  241  PKDTQRILTEILEL  254


>Q38AW2_TRYB2 unnamed protein product
Length=245

 Score = 266 bits (680),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 171/244 (70%), Gaps = 3/244 (1%)

Query  11   ILLLFDVDGTLTMPRSVVTPEFEEFFYSKVKPRATIGIVGGSDLEKMFEQLSGQKILTEF  70
            +LLLFDVDGTLT PR   T E              +G VGGSD  K  EQL G+ +LT+F
Sbjct  4    VLLLFDVDGTLTPPRLCQTDEMRALIKRARGAGFCVGTVGGSDFAKQVEQL-GRDVLTQF  62

Query  71   DFIFPENGLVQIEGGKEVGKQNIIKHLGEKTLQRFINFVLRYLSELELPIKRGTFIEFRN  130
            D++F ENGL+    G E+ +Q+++  LG   + +F+   LR +++L++P++RGTF+E+RN
Sbjct  63   DYVFAENGLLAYRNGLEIHRQSLLNALGNDRIVKFVKKTLRLIADLDIPVQRGTFVEYRN  122

Query  131  GMMNVCPIGRQCSREERNMFAAYDNEHKVREKMISDLKKEFADVDLTYSIGGQISFDVFP  190
            GM+NV PIGR CS+ ER+ F  YDNEH+VR  +I++L+  F D  L YSIGGQISFDVFP
Sbjct  123  GMINVSPIGRNCSQAERDEFEVYDNEHRVRASLIAELENSFPDFGLKYSIGGQISFDVFP  182

Query  191  HGWDKTYCLRHIEAHYKFKEIHFFGDKTEPGGNDYEIYSDPRTISHRVYTPKDTQRILTE  250
             GWDKTYCL+ +E    F+EIHFFGDKT+ GGNDYEIY+D RTI H+V + KDT   + +
Sbjct  183  VGWDKTYCLQFVED--DFEEIHFFGDKTQEGGNDYEIYTDKRTIGHKVTSYKDTIAEVEK  240

Query  251  ILEL  254
            I+ +
Sbjct  241  IIAM  244


>Q9U2G5_CAEEL unnamed protein product
Length=1525

 Score = 30.0 bits (66),  Expect = 2.2, Method: Compositional matrix adjust.
 Identities = 12/39 (31%), Positives = 22/39 (56%), Gaps = 0/39 (0%)

Query  59   EQLSGQKILTEFDFIFPENGLVQIEGGKEVGKQNIIKHL  97
            E+ +G+K L + D   P N L+ + G    GK ++++ L
Sbjct  634  EEAAGEKTLQDVDLTAPRNSLIAVVGKVGSGKSSLLQAL  672



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016448.1 uncharacterized protein LOC108070475 [Drosophila
kikkawai]

Length=58
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

BRE1_CAEEL  unnamed protein product                                   26.6    1.3  
Q38B17_TRYB2  unnamed protein product                                 25.4    2.5  
WARTS_DROME  unnamed protein product                                  25.4    3.2  


>BRE1_CAEEL unnamed protein product
Length=837

 Score = 26.6 bits (57),  Expect = 1.3, Method: Composition-based stats.
 Identities = 9/27 (33%), Positives = 18/27 (67%), Gaps = 0/27 (0%)

Query  29   VDPMINTEKYKTLQEYSKIKRDELQHI  55
            VD ++N+E+YK L++Y  +   E + +
Sbjct  355  VDSIVNSEEYKNLKKYYSLAIKEYERV  381


>Q38B17_TRYB2 unnamed protein product
Length=478

 Score = 25.4 bits (54),  Expect = 2.5, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 1/37 (3%)

Query  19   AVGLTLYPVIVDPMINTEKY-KTLQEYSKIKRDELQH  54
            A GLT    IVDP+   EKY K L+    I   E +H
Sbjct  435  ATGLTTKDDIVDPLAELEKYQKRLERAVAIMALEREH  471


>WARTS_DROME unnamed protein product
Length=1105

 Score = 25.4 bits (54),  Expect = 3.2, Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 0/50 (0%)

Query  9    FVGFVSCIVGAVGLTLYPVIVDPMINTEKYKTLQEYSKIKRDELQHIKAK  58
            FV      VGA G       +D   +    KTL++   +KR+++ H+KA+
Sbjct  719  FVKLKPIGVGAFGEVTLVSKIDTSNHLYAMKTLRKADVLKRNQVAHVKAE  768



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016449.1 homeobox protein caupolican [Drosophila kikkawai]

Length=703
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CAUP_DROME  unnamed protein product                                   878     0.0   
ARA_DROME  unnamed protein product                                    413     1e-134
O01667_DROME  unnamed protein product                                 190     8e-52 


>CAUP_DROME unnamed protein product
Length=693

 Score = 878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/686 (79%), Positives = 561/686 (82%), Gaps = 62/686 (9%)

Query  1    MAAYAQFGYAGYPTANQLTTANTDSQSGHGGGSPLSGTNEASLSPSGGSTATGLTVGPLS  60
            MAAYAQFGYAGYPTANQLTTANTDSQSGHGGGSPLSGTNEASLSPSGGSTATGLT GPLS
Sbjct  1    MAAYAQFGYAGYPTANQLTTANTDSQSGHGGGSPLSGTNEASLSPSGGSTATGLTAGPLS  60

Query  61   PGAVSQSSHHAGHKGLSTSPVEDTVVGGAEVPGGLSSAAAAAAAQDMAGGRGGSCCENGR  120
            PGAVSQSSHHAGHKGLSTSP ED V  G +VP GLSSAA     QD+     GSCCENGR
Sbjct  61   PGAVSQSSHHAGHKGLSTSPAEDVV--GGDVPVGLSSAA-----QDLP--SRGSCCENGR  111

Query  121  PIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSAGVGVYGGPYP--SNDQNPYPSIGVD  178
            PIITDPVSGQTVCSCQYDPARLAIGGYSRMALPS GVGV     P  SN+QNPYPSIGVD
Sbjct  112  PIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGGVGVGVYGGPYPSNEQNPYPSIGVD  171

Query  179  NSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLAAYGYGPNYDLAARRK  238
            NSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLAAYGYGPNYDLAARRK
Sbjct  172  NSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLAAYGYGPNYDLAARRK  231

Query  239  NATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT  298
            NATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT
Sbjct  232  NATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRRLKKENKMT  291

Query  299  WEPKNKTEDDDDGLMSDDEKEKDASDGGKLASEAFDPGSQLIKSELGKTEKESESV-DQK  357
            WEPKNKTEDDDDG+MSDDEKEKDA DGGKL++EAFDPG+QLIKSELGK EKE +S  DQK
Sbjct  292  WEPKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSELGKAEKEVDSSGDQK  351

Query  358  LDLEREPHNLVAMRGLAPYATPPGAHPMHAAYSSYAQSHNTHTHPNPHPHSHPHAQQLQL  417
            LDL+REPHNLVAMRGLAPYATPPGAHPMHAAYSSYAQSHNTHT                 
Sbjct  352  LDLDREPHNLVAMRGLAPYATPPGAHPMHAAYSSYAQSHNTHT-----------------  394

Query  418  HQQQQHQQHQHQQQHQQLQQQQQLHQQQLEQPYYHP-GYGQDAESAGDFAAQKNPLSRDC  476
                  Q   HQQQ QQ Q QQQL   Q++QPYYHP GYGQ  E +G+FAAQKNPLSRDC
Sbjct  395  -HPHPQQMQHHQQQQQQQQNQQQLQHHQMDQPYYHPGGYGQ--EESGEFAAQKNPLSRDC  451

Query  477  GIPVPASKPKIWSVADTAACKTPPPTAAYLGQNFYPPAE---------------QLHHHS  521
            GIPVPASKPKIWSVADTAACKTPPPTAAYLGQNFYPP+                Q     
Sbjct  452  GIPVPASKPKIWSVADTAACKTPPPTAAYLGQNFYPPSSADQQLPHQPLQQHQQQQLQQL  511

Query  522  HSQHHHQQQQQQQQQLHSMELGSPLSMMSSYAGGSPYSRIPTAYTEAMGMHLPTSSSSHS  581
              Q  H          HSMELGSPLSMMSSYAGGSPYSRIPTAYTEAMGMHLP+S     
Sbjct  512  QQQQQHHHHPHHHHPHHSMELGSPLSMMSSYAGGSPYSRIPTAYTEAMGMHLPSS-----  566

Query  582  GSSSSSSSGKVAPTPISVHPHPRPVGFPEIQPDTPPQTPPTMKLGGGGHNSSSGSSSSGS  641
             SSSSSS+GK+ PT   +HP P+ VGFPEIQPDTPPQTPPTMKL      +SSG SSS S
Sbjct  567  -SSSSSSTGKLPPT--HIHPAPQRVGFPEIQPDTPPQTPPTMKL------NSSGGSSSSS  617

Query  642  SHSHSSSIHSAAPVTVASMVNILYSN  667
              SHSSS+HS  PVTVASMVNILYSN
Sbjct  618  GSSHSSSMHSVTPVTVASMVNILYSN  643


>ARA_DROME unnamed protein product
Length=717

 Score = 413 bits (1062),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 269/541 (50%), Positives = 318/541 (59%), Gaps = 80/541 (15%)

Query  1    MAAYAQFGYAGYPTANQL------TTANTDSQSGHGGGSPLSGTNEASLSPSGGSTATG-  53
            MAAY QFGY G+P+A+QL      TT +  +         L  TN  ++SP+GG    G 
Sbjct  1    MAAYTQFGYGGFPSASQLLPPSVQTTEDASANVNVNVNEALVMTNAPAMSPTGGQDCQGS  60

Query  54   ---------LTVGPLSPGAVSQSSHHAGHKGLSTSPVEDTVVGGAEVPGG-LSSAAAAAA  103
                      + G LSP A+SQ+S+ A   G                 GG L        
Sbjct  61   QPSGGAGGDASSGALSPNALSQNSNAATVVGAGGGSSAGGGGPADLATGGSLDGNGVGTT  120

Query  104  AQDMAGGRGGSCCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSAGVGVYGGP  163
                  G GGSCCENGRPI+TDPVSGQTVCSCQYD ARLA+  YSR  LP+A VGVYG P
Sbjct  121  PTAGGAGGGGSCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSR--LPAASVGVYGTP  178

Query  164  YPSNDQNPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLA  223
            YPS DQNPY SIGVD+SAFY+PLSNPYG+KDT    EM AWTSA LQ TTGYYSYDP ++
Sbjct  179  YPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDP-MS  237

Query  224  AYG--------YGPNYDLAARRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKM  275
            AYG        YG +YDLAARRKNATRESTATLKAWL+EHKKNPYPTKGEKIMLAIITKM
Sbjct  238  AYGGLLVSNSSYGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKM  297

Query  276  TLTQVSTWFANARRRLKKENKMTWEPKNKTEDDDDGLMSDDEKEKDASDGGKLASEAFDP  335
            TLTQVSTWFANARRRLKKENKMTWEPKN+T+DDDD L+SDDEK+K+  +  K        
Sbjct  298  TLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDALVSDDEKDKEDLEPSK--------  349

Query  336  GSQ----LIKSELGKTEKESESVDQKLDLEREPHNLVAMRGLAPYATPPGAHPMHAAYSS  391
            GSQ    L K E   T++E +++D+      + + L A           G     A   S
Sbjct  350  GSQGSVSLAKDE---TKEEEDAIDEDQKCLGQANILRA-----------GFGYPSAGSGS  395

Query  392  YAQSHNTHTHPNPHPHSHPHAQQLQLHQQQQHQQHQHQQQHQQLQQQQQLHQQQLEQPYY  451
                    +        HP+              HQH   +Q  QQ   L          
Sbjct  396  GGYPGGGGSSSGHPGGYHPY-------------HHQHPAYYQAGQQGGML----------  432

Query  452  HPGYGQDAESAGDFAAQKNPLSRDCGIPVPASKPKIWSVADTAACKTPPPTAAYLGQNFY  511
             P +G++++   D    KN L RDCG+P+PA+KPKIWS+ADT  CKTPPP  AY+G    
Sbjct  433  -PFHGENSKLQTDLGDPKNQLGRDCGVPIPATKPKIWSLADTVGCKTPPP--AYMGHQSM  489

Query  512  P  512
            P
Sbjct  490  P  490


>O01667_DROME unnamed protein product
Length=641

 Score = 190 bits (483),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 171/344 (50%), Gaps = 74/344 (22%)

Query  115  CCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSAGVGVYGGPYPSNDQNPYPS  174
            CC+ GR I TDPVSGQT+CSCQYD     +  Y R+A   A  GV  G YP         
Sbjct  119  CCDTGRTIYTDPVSGQTICSCQYD-----MLNYQRLA---AAGGVPLGVYPEGMSAYLSG  170

Query  175  IGVDNSAFYAPLSNPYGIK-DTSPSTEMSAWTSASLQSTTGYYSYDPTLAAY---GYGPN  230
            I  D   FYA   NP GI    +     S W   S+     Y+ YD   A Y    YG +
Sbjct  171  IAADQPPFYA---NPAGIDLKENLVAGASPWPYPSM-----YHPYDAAFAGYPFNSYGMD  222

Query  231  YDLAARRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR  290
             +  ARRKNATRE+T+TLKAWL+EHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR
Sbjct  223  LN-GARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANARRR  281

Query  291  LKKENKMTWEPKNKT---------------------EDDDDGLMSDDEKEKDASDGGKLA  329
            LKKENKMTWEP+N+                      +  D G+ S D+K++     G+L 
Sbjct  282  LKKENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDRS----GRLG  337

Query  330  SEAFDPGSQLIKSELGKTEKESESVDQKLDLEREPHNLVAMRGLAPYATPPGAHPMHAAY  389
                D   +   SE   +E    S +   DL   P ++           PPGAHP+    
Sbjct  338  DMMTDRPGESNNSEW--SESRPGSPNGSPDLYDRPGSM-----------PPGAHPLF---  381

Query  390  SSYAQSHNTHTHPNP-HPHSHPHAQQLQLHQQQQHQQHQHQQQH  432
                       HP   H H  P A          H Q Q  QQH
Sbjct  382  -----------HPAALHHHFRPPAGSPPDIAAYHHHQQQLLQQH  414



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016450.1 beta-1-syntrophin isoform X1 [Drosophila kikkawai]

Length=635
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VNY2_DROME  unnamed protein product                                 1242    0.0  
M9PGE3_DROME  unnamed protein product                                 1118    0.0  
Q9VNY4_DROME  unnamed protein product                                 1112    0.0  


>Q9VNY2_DROME unnamed protein product
Length=627

 Score = 1242 bits (3213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/637 (96%), Positives = 617/637 (97%), Gaps = 12/637 (2%)

Query  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGMRCGNLETRVRGAWYRVLVTLETDFLAVSLDE  60
            MVESSSLGRTPPAAQQPIPQQHSPSPSG+RCGN+ETRVRGAWYRVLVTLETDFLAVSLDE
Sbjct  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDE  60

Query  61   SCEAAQQTNDGQSTTLNGTLGSNHSGGGGGGAGGGGAGGSGQNGTLPSSASLQGM--QDT  118
            SCEAAQ +NDGQSTTLNGTLGSNHSGGGGGGAGGGG GG GQNGTLP+SASLQGM  QDT
Sbjct  61   SCEAAQPSNDGQSTTLNGTLGSNHSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDT  120

Query  119  ELDGSGSNDNNGDNRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178
            ELDGS SNDN   +RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS
Sbjct  121  ELDGSASNDNG--DRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178

Query  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238
            IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV
Sbjct  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238

Query  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298
            VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL
Sbjct  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298

Query  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRASDSAEALVWFNALHSAMGSSTQRALA  358
            QLTHLARNLKYIDPENRCFELHSPDGVHSCILRA+DSAEALVWFNALHSAMG+STQRALA
Sbjct  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALA  358

Query  359  EANRALTNLIGELKHIGWLSKRMSGGGGGGGGGSSGSAGGGAASGGSGTSNSGVAGELVS  418
            EANRALTNLIGELKHIGWLSKRMS      GGGSSGSAGGGAASGGSGTSNS VAGELVS
Sbjct  359  EANRALTNLIGELKHIGWLSKRMS------GGGSSGSAGGGAASGGSGTSNSVVAGELVS  412

Query  419  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  478
            PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN
Sbjct  413  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  472

Query  479  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARALVQGSHQAVNYQREFSFRC  538
            NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWAR+LVQGSHQAVNYQREFSFRC
Sbjct  473  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRC  532

Query  539  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPTAAVATTKTQLWQFAFDKLKGSADDGNRML  598
            LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT  VAT KTQLWQFAFDKLKGSADDG RML
Sbjct  533  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT--VATAKTQLWQFAFDKLKGSADDGARML  590

Query  599  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  635
            YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA
Sbjct  591  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  627


>M9PGE3_DROME unnamed protein product
Length=625

 Score = 1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/637 (96%), Positives = 616/637 (97%), Gaps = 14/637 (2%)

Query  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGMRCGNLETRVRGAWYRVLVTLETDFLAVSLDE  60
            MVESSSLGRTPPAAQQPIPQQHSPSPSG+RCGN+ETRVRGAWYRVLVTLETDFLAVSLDE
Sbjct  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDE  60

Query  61   SCEAAQQTNDGQSTTLNGTLGSNHSGGGGGGAGGGGAGGSGQNGTLPSSASLQGM--QDT  118
            SCEAAQ +NDGQSTTLNGTLGSNHSGGGGGGAGGGG GG GQNGTLP+SASLQGM  QDT
Sbjct  61   SCEAAQPSNDGQSTTLNGTLGSNHSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDT  120

Query  119  ELDGSGSNDNNGDNRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178
            ELDGS SNDN GD RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS
Sbjct  121  ELDGSASNDN-GD-RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178

Query  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238
            IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV
Sbjct  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238

Query  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298
            VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL
Sbjct  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298

Query  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRASDSAEALVWFNALHSAMGSSTQRALA  358
            QLTHLARNLKYIDPENRCFELHSPDGVHSCILRA+DSAEALVWFNALHSAMG+STQRALA
Sbjct  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALA  358

Query  359  EANRALTNLIGELKHIGWLSKRMSGGGGGGGGGSSGSAGGGAASGGSGTSNSGVAGELVS  418
            EANRALTNLIGELKHIGWLSKRMS      GGGSSGSAGGGAASGGSGTSNS VAGEL  
Sbjct  359  EANRALTNLIGELKHIGWLSKRMS------GGGSSGSAGGGAASGGSGTSNSVVAGEL--  410

Query  419  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  478
            PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN
Sbjct  411  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  470

Query  479  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARALVQGSHQAVNYQREFSFRC  538
            NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWAR+LVQGSHQAVNYQREFSFRC
Sbjct  471  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRC  530

Query  539  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPTAAVATTKTQLWQFAFDKLKGSADDGNRML  598
            LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT  VAT KTQLWQFAFDKLKGSADDG RML
Sbjct  531  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT--VATAKTQLWQFAFDKLKGSADDGARML  588

Query  599  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  635
            YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA
Sbjct  589  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  625


>Q9VNY4_DROME unnamed protein product
Length=624

 Score = 1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/637 (95%), Positives = 615/637 (97%), Gaps = 15/637 (2%)

Query  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGMRCGNLETRVRGAWYRVLVTLETDFLAVSLDE  60
            MVESSSLGRTPPAAQQPIPQQHSPSPSG+RCGN+ETRVRGAWYRVLVTLETDFLAVSLDE
Sbjct  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDE  60

Query  61   SCEAAQQTNDGQSTTLNGTLGSNHSGGGGGGAGGGGAGGSGQNGTLPSSASLQGM--QDT  118
            SCEAAQ +NDGQSTTLNGTLG NHSGGGGGGAGGGG GG GQNGTLP+SASLQGM  QDT
Sbjct  61   SCEAAQPSNDGQSTTLNGTLG-NHSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDT  119

Query  119  ELDGSGSNDNNGDNRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178
            ELDGS SNDN GD RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS
Sbjct  120  ELDGSASNDN-GD-RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  177

Query  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238
            IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV
Sbjct  178  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  237

Query  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298
            VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL
Sbjct  238  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  297

Query  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRASDSAEALVWFNALHSAMGSSTQRALA  358
            QLTHLARNLKYIDPENRCFELHSPDGVHSCILRA+DSAEALVWFNALHSAMG+STQRALA
Sbjct  298  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALA  357

Query  359  EANRALTNLIGELKHIGWLSKRMSGGGGGGGGGSSGSAGGGAASGGSGTSNSGVAGELVS  418
            EANRALTNLIGELKHIGWLSKRMS      GGGSSGSAGGGAASGGSGTSNS VAGEL  
Sbjct  358  EANRALTNLIGELKHIGWLSKRMS------GGGSSGSAGGGAASGGSGTSNSVVAGEL--  409

Query  419  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  478
            PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN
Sbjct  410  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  469

Query  479  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARALVQGSHQAVNYQREFSFRC  538
            NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWAR+LVQGSHQAVNYQREFSFRC
Sbjct  470  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRC  529

Query  539  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPTAAVATTKTQLWQFAFDKLKGSADDGNRML  598
            LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT  VAT KTQLWQFAFDKLKGSADDG RML
Sbjct  530  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT--VATAKTQLWQFAFDKLKGSADDGARML  587

Query  599  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  635
            YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA
Sbjct  588  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  624



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


Query= XP_017016452.1 beta-1-syntrophin isoform X2 [Drosophila kikkawai]

Length=633
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PGE3_DROME  unnamed protein product                                 1123    0.0  
Q9VNY2_DROME  unnamed protein product                                 1118    0.0  
Q9VNY4_DROME  unnamed protein product                                 1117    0.0  


>M9PGE3_DROME unnamed protein product
Length=625

 Score = 1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/635 (96%), Positives = 616/635 (97%), Gaps = 12/635 (2%)

Query  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGMRCGNLETRVRGAWYRVLVTLETDFLAVSLDE  60
            MVESSSLGRTPPAAQQPIPQQHSPSPSG+RCGN+ETRVRGAWYRVLVTLETDFLAVSLDE
Sbjct  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDE  60

Query  61   SCEAAQQTNDGQSTTLNGTLGSNHSGGGGGGAGGGGAGGSGQNGTLPSSASLQGM--QDT  118
            SCEAAQ +NDGQSTTLNGTLGSNHSGGGGGGAGGGG GG GQNGTLP+SASLQGM  QDT
Sbjct  61   SCEAAQPSNDGQSTTLNGTLGSNHSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDT  120

Query  119  ELDGSGSNDNNGDNRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178
            ELDGS SNDN GD RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS
Sbjct  121  ELDGSASNDN-GD-RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178

Query  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238
            IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV
Sbjct  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238

Query  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298
            VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL
Sbjct  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298

Query  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRASDSAEALVWFNALHSAMGSSTQRALA  358
            QLTHLARNLKYIDPENRCFELHSPDGVHSCILRA+DSAEALVWFNALHSAMG+STQRALA
Sbjct  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALA  358

Query  359  EANRALTNLIGELKHIGWLSKRMSGGGGGGGGGSSGSAGGGAASGGSGTSNSGVAGELPS  418
            EANRALTNLIGELKHIGWLSKRMS      GGGSSGSAGGGAASGGSGTSNS VAGELPS
Sbjct  359  EANRALTNLIGELKHIGWLSKRMS------GGGSSGSAGGGAASGGSGTSNSVVAGELPS  412

Query  419  GRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGNNS  478
            GRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGNNS
Sbjct  413  GRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGNNS  472

Query  479  SLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARALVQGSHQAVNYQREFSFRCLF  538
            SLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWAR+LVQGSHQAVNYQREFSFRCLF
Sbjct  473  SLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRCLF  532

Query  539  QGRQCQLVVHINRGFFLYDCGGFAPTTPTAAVATTKTQLWQFAFDKLKGSADDGNRMLYL  598
            QGRQCQLVVHINRGFFLYDCGGFAPTTPT  VAT KTQLWQFAFDKLKGSADDG RMLYL
Sbjct  533  QGRQCQLVVHINRGFFLYDCGGFAPTTPT--VATAKTQLWQFAFDKLKGSADDGARMLYL  590

Query  599  DFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  633
            DFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA
Sbjct  591  DFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  625


>Q9VNY2_DROME unnamed protein product
Length=627

 Score = 1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/637 (96%), Positives = 616/637 (97%), Gaps = 14/637 (2%)

Query  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGMRCGNLETRVRGAWYRVLVTLETDFLAVSLDE  60
            MVESSSLGRTPPAAQQPIPQQHSPSPSG+RCGN+ETRVRGAWYRVLVTLETDFLAVSLDE
Sbjct  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDE  60

Query  61   SCEAAQQTNDGQSTTLNGTLGSNHSGGGGGGAGGGGAGGSGQNGTLPSSASLQGM--QDT  118
            SCEAAQ +NDGQSTTLNGTLGSNHSGGGGGGAGGGG GG GQNGTLP+SASLQGM  QDT
Sbjct  61   SCEAAQPSNDGQSTTLNGTLGSNHSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDT  120

Query  119  ELDGSGSNDNNGDNRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178
            ELDGS SNDN GD RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS
Sbjct  121  ELDGSASNDN-GD-RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178

Query  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238
            IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV
Sbjct  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238

Query  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298
            VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL
Sbjct  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298

Query  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRASDSAEALVWFNALHSAMGSSTQRALA  358
            QLTHLARNLKYIDPENRCFELHSPDGVHSCILRA+DSAEALVWFNALHSAMG+STQRALA
Sbjct  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALA  358

Query  359  EANRALTNLIGELKHIGWLSKRMSGGGGGGGGGSSGSAGGGAASGGSGTSNSGVAGEL--  416
            EANRALTNLIGELKHIGWLSKRMS      GGGSSGSAGGGAASGGSGTSNS VAGEL  
Sbjct  359  EANRALTNLIGELKHIGWLSKRMS------GGGSSGSAGGGAASGGSGTSNSVVAGELVS  412

Query  417  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  476
            PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN
Sbjct  413  PSGRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGN  472

Query  477  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARALVQGSHQAVNYQREFSFRC  536
            NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWAR+LVQGSHQAVNYQREFSFRC
Sbjct  473  NSSLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRC  532

Query  537  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPTAAVATTKTQLWQFAFDKLKGSADDGNRML  596
            LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT  VAT KTQLWQFAFDKLKGSADDG RML
Sbjct  533  LFQGRQCQLVVHINRGFFLYDCGGFAPTTPT--VATAKTQLWQFAFDKLKGSADDGARML  590

Query  597  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  633
            YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA
Sbjct  591  YLDFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  627


>Q9VNY4_DROME unnamed protein product
Length=624

 Score = 1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/635 (96%), Positives = 615/635 (97%), Gaps = 13/635 (2%)

Query  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGMRCGNLETRVRGAWYRVLVTLETDFLAVSLDE  60
            MVESSSLGRTPPAAQQPIPQQHSPSPSG+RCGN+ETRVRGAWYRVLVTLETDFLAVSLDE
Sbjct  1    MVESSSLGRTPPAAQQPIPQQHSPSPSGLRCGNMETRVRGAWYRVLVTLETDFLAVSLDE  60

Query  61   SCEAAQQTNDGQSTTLNGTLGSNHSGGGGGGAGGGGAGGSGQNGTLPSSASLQGM--QDT  118
            SCEAAQ +NDGQSTTLNGTLG NHSGGGGGGAGGGG GG GQNGTLP+SASLQGM  QDT
Sbjct  61   SCEAAQPSNDGQSTTLNGTLG-NHSGGGGGGAGGGGTGGGGQNGTLPNSASLQGMNIQDT  119

Query  119  ELDGSGSNDNNGDNRDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  178
            ELDGS SNDN GD RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS
Sbjct  120  ELDGSASNDN-GD-RDPCLNNNNNAGDGGGMDMCDVPDHVANQKRHVRIIKSDNNGLGIS  177

Query  179  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  238
            IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV
Sbjct  178  IKGGRENRMPILISKIFRGMAADQAKGLYVGDAILTVNGEELRDATHDEAVRALKRSGRV  237

Query  239  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  298
            VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL
Sbjct  238  VDLEVKFLREVTPYFRKASIISEVGWELQRAFLCPLGPGVPTSPPAPKTTPRADTRYIPL  297

Query  299  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRASDSAEALVWFNALHSAMGSSTQRALA  358
            QLTHLARNLKYIDPENRCFELHSPDGVHSCILRA+DSAEALVWFNALHSAMG+STQRALA
Sbjct  298  QLTHLARNLKYIDPENRCFELHSPDGVHSCILRAADSAEALVWFNALHSAMGTSTQRALA  357

Query  359  EANRALTNLIGELKHIGWLSKRMSGGGGGGGGGSSGSAGGGAASGGSGTSNSGVAGELPS  418
            EANRALTNLIGELKHIGWLSKRMS      GGGSSGSAGGGAASGGSGTSNS VAGELPS
Sbjct  358  EANRALTNLIGELKHIGWLSKRMS------GGGSSGSAGGGAASGGSGTSNSVVAGELPS  411

Query  419  GRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGNNS  478
            GRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGNNS
Sbjct  412  GRSSSESSDESDKWLPIFVAVTEREFRIYESAPWSVEAWSRPLEIYALATTRLAGAGNNS  471

Query  479  SLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARALVQGSHQAVNYQREFSFRCLF  538
            SLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWAR+LVQGSHQAVNYQREFSFRCLF
Sbjct  472  SLNGQQTTVFCVRCGTARGVLVYWLRSETHRDMAAWARSLVQGSHQAVNYQREFSFRCLF  531

Query  539  QGRQCQLVVHINRGFFLYDCGGFAPTTPTAAVATTKTQLWQFAFDKLKGSADDGNRMLYL  598
            QGRQCQLVVHINRGFFLYDCGGFAPTTPT  VAT KTQLWQFAFDKLKGSADDG RMLYL
Sbjct  532  QGRQCQLVVHINRGFFLYDCGGFAPTTPT--VATAKTQLWQFAFDKLKGSADDGARMLYL  589

Query  599  DFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  633
            DFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA
Sbjct  590  DFGEDGEIELDMECCPKPVVFVVHNCLSAKVHNIA  624



Lambda      K        H
   0.310    0.129    0.354 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 934007886


  Database: /agbase_database/invertebrates_exponly.fa
    Posted date:  Oct 4, 2021  8:05 PM
  Number of letters in database: 17,197,330
  Number of sequences in database:  25,232



Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40
BLAST Search Results

BLASTP 2.7.1+


Reference:
Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schäffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database
search programs", Nucleic Acids Res. 25:3389-3402.


Reference for
composition-based statistics:
Alejandro A. Schäffer, L. Aravind, Thomas L. Madden, Sergei
Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and
Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST
protein database searches with composition-based statistics and
other refinements", Nucleic Acids Res. 29:2994-3005.



Database: /agbase_database/invertebrates_exponly.fa
           25,232 sequences; 17,197,330 total letters



Query= XP_017016453.1 zinc finger protein 761 [Drosophila kikkawai]

Length=395
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VR05_DROME  unnamed protein product                                 97.4    2e-22
M9PD94_DROME  unnamed protein product                                 85.1    2e-17
Q9W3J9_DROME  unnamed protein product                                 82.8    7e-17


>Q9VR05_DROME unnamed protein product
Length=346

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 150/352 (43%), Gaps = 52/352 (15%)

Query  41   ICRACLVLLGPQDAAYSLD--SEQDLARKYFGCTGADPGKDEDDVLAQLVVLKSICECCY  98
            ICR C+ + G     +     +   +A     CTG +  +   D+ +++     IC  CY
Sbjct  4    ICRVCMDISGKLVNIFDARRRTRVSIAEMIAQCTGFEVKRG--DLFSEM-----ICPQCY  56

Query  99   QLVQKFYAFQRMCEESSRNFQKLLQDIDLYCLKAQEDAVPALPDTPSESNESTNQEELAE  158
            + V+  Y  ++ CEES +           YC    E    AL     E +   +++E A 
Sbjct  57   EDVKSAYGIRQTCEESHQ----------FYCRVRDEGIEDALCALLEEEDWEISEDEDAR  106

Query  159  APSMESIEEIEEVYIIEDEGSKQDLGKEKVP--RIFAQYKRTTGQRKRRVRHTLD-----  211
                     I+     +D+G K D  K          +Y+R  G   R +R  +D     
Sbjct  107  ---------IDSASAADDDG-KSDSKKVAFECRECHKKYQRK-GTFLRHMRTHMDGQSFP  155

Query  212  CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRVTY  271
            C  C+R F     L+AH+K  H    PY C HC K++A+ + L +H R      +G   +
Sbjct  156  CPYCKRNFRLRVTLKAHMKT-HNAAKPYECSHCAKTFAQQSTLQSHER----THTGERPF  210

Query  272  PCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHKATHGKP  331
             C  CSK +  +  L+ H+ R H SE        + C +C K+F R+ HL  H  +H   
Sbjct  211  KCSQCSKTFIKSSDLRRHI-RTHGSERP------FKCSKCTKTFTRKFHLDNHFRSHTG-  262

Query  332  EERKYACEHCDHRFHTKENMTDHLQRRHGNRDLPRCRKCGRIFRERSDLGKH  383
             ER + C HC   F  K+++  H +    +R   RC  C + FR  S L +H
Sbjct  263  -ERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPF-RCSHCPKTFRLSSTLKEH  312


 Score = 41.6 bits (96),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 44/110 (40%), Gaps = 25/110 (23%)

Query  210  LDCGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYA---------RANLLDTHLRE  260
              C  C + F +   L+ H +  H G  P+ C HC K++A         R +L D   R 
Sbjct  238  FKCSKCTKTFTRKFHLDNHFRS-HTGERPFKCSHCPKAFAMKQHLKQHSRLHLPDRPFRC  296

Query  261  IHCNGSGRV---------------TYPCPSCSKVYTAARSLKYHVKRQHE  295
             HC  + R+               T+ CP C+  Y   ++L  H+   H+
Sbjct  297  SHCPKTFRLSSTLKEHKLVHNAERTFKCPHCASFYKQRKTLARHILEIHK  346


>M9PD94_DROME unnamed protein product
Length=907

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 90/196 (46%), Gaps = 18/196 (9%)

Query  192  FAQYKRTTGQRKRRVRHTLD----CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKS  247
            F  +   T   +   RH+ D    C ICQ+ F +   L+ H +  H G  P+ C +C K+
Sbjct  283  FNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRS-HTGETPFRCQYCAKT  341

Query  248  YARANLLDTHLREIHCNGSGRVTYPCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYI  307
            + R   +  H+R+     +G+  + C  C K YT    L  H++       S T++  + 
Sbjct  342  FTRKEHMVNHVRK----HTGQTPHQCDVCGKKYTRKEHLANHMR-------SHTNETPFR  390

Query  308  CEECGKSFGRRAHLTRHKATHGKPEERKYACEHCDHRFHTKENMTDHLQRRHGNRDLPRC  367
            CE CGKSF R+ H T H   H    E  + C+ C   F  KE++ +H+ R+H      RC
Sbjct  391  CEICGKSFSRKEHFTNHILWH-TAGETPHRCDFCSKTFTRKEHLLNHV-RQHTGESPHRC  448

Query  368  RKCGRIFRERSDLGKH  383
              C + F  +  L  H
Sbjct  449  SYCMKTFTRKEHLVNH  464


 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 85/174 (49%), Gaps = 14/174 (8%)

Query  212  CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRVTY  271
            C  C++ F +   L  HV+  H G +P+ C +C K++ R   L+ H+R+     S    +
Sbjct  504  CSYCKKTFTRKEHLTNHVRL-HTGDSPHKCEYCQKTFTRKEHLNNHMRQ----HSSDNPH  558

Query  272  PCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHKATH--G  329
             C  C+K +T    L  H+ R H      T D  + CE CGKSF  + +L  H+ +H  G
Sbjct  559  CCNVCNKPFTRKEHLINHMSRCH------TGDRPFTCETCGKSFPLKGNLLFHQRSHTKG  612

Query  330  KPEERKYACEHCDHRFHTKENMTDHLQRRHGNRDLPRCRKCGRIFRERSDLGKH  383
            +  ER +ACE C   F  K ++  H+ R H       C  C + F ER +L +H
Sbjct  613  QEMERPFACEKCPKNFICKGHLVSHM-RSHSGEKPHACTLCSKAFVERGNLKRH  665


 Score = 77.0 bits (188),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 84/175 (48%), Gaps = 15/175 (9%)

Query  212  CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRVTY  271
            C  C + F +   L  HV+Q H G +P+ C +C K++ R   L  H+R+     +G   +
Sbjct  420  CDFCSKTFTRKEHLLNHVRQ-HTGESPHRCSYCMKTFTRKEHLVNHIRQ----HTGESPH  474

Query  272  PCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHKATHGKP  331
             C  C+K +T    L  HV RQH      T D  + C  C K+F R+ HLT H   H   
Sbjct  475  KCTYCTKTFTRKEHLTNHV-RQH------TGDSPHRCSYCKKTFTRKEHLTNHVRLHTG-  526

Query  332  EERKYACEHCDHRFHTKENMTDHLQRRHGNRDLPRCRKCGRIFRERSDLGKHSCR  386
             +  + CE+C   F  KE++ +H+ R+H + +   C  C + F  +  L  H  R
Sbjct  527  -DSPHKCEYCQKTFTRKEHLNNHM-RQHSSDNPHCCNVCNKPFTRKEHLINHMSR  579


 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 80/170 (47%), Gaps = 16/170 (9%)

Query  212  CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRVTY  271
            C  C + F +   L  H++Q H G +P+ C +C K++ R   L  H+R+     +G   +
Sbjct  448  CSYCMKTFTRKEHLVNHIRQ-HTGESPHKCTYCTKTFTRKEHLTNHVRQ----HTGDSPH  502

Query  272  PCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHKATHGKP  331
             C  C K +T    L  HV+         T D  + CE C K+F R+ HL  H   H   
Sbjct  503  RCSYCKKTFTRKEHLTNHVRLH-------TGDSPHKCEYCQKTFTRKEHLNNHMRQHS--  553

Query  332  EERKYACEHCDHRFHTKENMTDHLQRRH-GNRDLPRCRKCGRIFRERSDL  380
             +  + C  C+  F  KE++ +H+ R H G+R    C  CG+ F  + +L
Sbjct  554  SDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPF-TCETCGKSFPLKGNL  602


 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/190 (26%), Positives = 80/190 (42%), Gaps = 15/190 (8%)

Query  194  QYKRTTGQRKRRVRHTLDCGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANL  253
            +Y+    +R    R    C +C +GF  S  L  H K  H G   +TC+ C   +A    
Sbjct  233  RYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLTRHGKI-HIGGPMFTCIVCFNVFANNTS  291

Query  254  LDTHLREIHCNGSGRVTYPCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGK  313
            L+ H++      S    + C  C K +     L  H +       S T +  + C+ C K
Sbjct  292  LERHMKR----HSTDKPFACTICQKTFARKEHLDNHFR-------SHTGETPFRCQYCAK  340

Query  314  SFGRRAHLTRHKATHGKPEERKYACEHCDHRFHTKENMTDHLQRRHGNRDLPRCRKCGRI  373
            +F R+ H+  H   H    +  + C+ C  ++  KE++ +H+ R H N    RC  CG+ 
Sbjct  341  TFTRKEHMVNHVRKHTG--QTPHQCDVCGKKYTRKEHLANHM-RSHTNETPFRCEICGKS  397

Query  374  FRERSDLGKH  383
            F  +     H
Sbjct  398  FSRKEHFTNH  407


 Score = 57.8 bits (138),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 68/148 (46%), Gaps = 9/148 (6%)

Query  212  CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRVTY  271
            C  CQ+ F +   L  H++Q H   NP+ C  C K + R   L  H+   H   +G   +
Sbjct  532  CEYCQKTFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEHLINHMSRCH---TGDRPF  587

Query  272  PCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHKATHGKP  331
             C +C K +    +L +H +R H        +  + CE+C K+F  + HL  H  +H   
Sbjct  588  TCETCGKSFPLKGNLLFH-QRSHTK--GQEMERPFACEKCPKNFICKGHLVSHMRSHSG-  643

Query  332  EERKYACEHCDHRFHTKENMTDHLQRRH  359
             E+ +AC  C   F  + N+  H++  H
Sbjct  644  -EKPHACTLCSKAFVERGNLKRHMKMNH  670


 Score = 34.7 bits (78),  Expect = 0.14, Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 53/140 (38%), Gaps = 34/140 (24%)

Query  270  TYPCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHKATH-  328
            T+ C  C K++     L  H  R++ SE        ++C+ CG+ F     LTRH   H 
Sbjct  220  THVCDICGKMFQFRYQLIVH--RRYHSERKP-----FMCQVCGQGFTTSQDLTRHGKIHI  272

Query  329  GKP-------------------------EERKYACEHCDHRFHTKENMTDHLQRRHGNRD  363
            G P                          ++ +AC  C   F  KE++ +H  R H    
Sbjct  273  GGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF-RSHTGET  331

Query  364  LPRCRKCGRIFRERSDLGKH  383
              RC+ C + F  +  +  H
Sbjct  332  PFRCQYCAKTFTRKEHMVNH  351


 Score = 31.2 bits (69),  Expect = 1.7, Method: Compositional matrix adjust.
 Identities = 20/72 (28%), Positives = 30/72 (42%), Gaps = 4/72 (6%)

Query  191  IFAQYKRTTGQRKRRVRHTLDCGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYAR  250
            +F Q   T GQ   R      C  C + F     L +H++  H G  P+ C  C K++  
Sbjct  603  LFHQRSHTKGQEMER---PFACEKCPKNFICKGHLVSHMRS-HSGEKPHACTLCSKAFVE  658

Query  251  ANLLDTHLREIH  262
               L  H++  H
Sbjct  659  RGNLKRHMKMNH  670


>Q9W3J9_DROME unnamed protein product
Length=598

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 89/176 (51%), Gaps = 15/176 (9%)

Query  210  LDCGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRV  269
            ++CGIC    +KS L + H      G N Y C++C ++Y     L  H R       G  
Sbjct  254  VECGICPDVMHKSKLSKHHKTHLVPGTNRYACIYCTETYRDCKYLAGHAR----RHMGIR  309

Query  270  TYPCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHK-ATH  328
             Y C  C+  ++  + L+ H +R+H  +       ++ICE CGK+F +   L RH+ ATH
Sbjct  310  PYVCELCTLYFSTKQDLRVHNQRRHLEK-------EHICEVCGKTFAQNTQLKRHREATH  362

Query  329  GKPEERKYACEHCDHRFHTKENMTDHLQRRH-GNRDLPRCRKCGRIFRERSDLGKH  383
             K  +R++ CE+C   ++   ++ +H++  H G R + +C  CG   R+   + +H
Sbjct  363  EK--KRRFQCEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCPFCGMQCRDAHKMARH  416


 Score = 47.4 bits (111),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 50/114 (44%), Gaps = 8/114 (7%)

Query  212  CGICQRGFYKSSLLEAHVKQQHEGVNPYTCVHCGKSYARANLLDTHLREIHCNGSGRVTY  271
            C +C + F +++ L+ H +  HE    + C +C K+Y +   L  H+R +H     R   
Sbjct  341  CEVCGKTFAQNTQLKRHREATHEKKRRFQCEYCQKAYYKNFSLQEHIRNVHM--GKRRML  398

Query  272  PCPSCSKVYTAARSLKYHVKRQHESEFSSTDDCQYICEECGKSFGRRAHLTRHK  325
             CP C      A  +  H K  H S+ +      Y+C  C + F   ++   HK
Sbjct  399  KCPFCGMQCRDAHKMARHRKEMHLSQGT------YVCHLCQEEFTDISYFDAHK  446


 Score = 31.6 bits (70),  Expect = 1.4, Method: Compositional matrix adjust.
 Identities = 25/115 (22%), Positives = 41/115 (36%), Gaps = 40/115 (35%)

Query  190  RIFAQ------YKRTTGQRKRRVRHTLDCGICQRGFYKSSLLEAHVKQQHEG--------  235
            + FAQ      ++  T ++KRR +    C  CQ+ +YK+  L+ H++  H G        
Sbjct  346  KTFAQNTQLKRHREATHEKKRRFQ----CEYCQKAYYKNFSLQEHIRNVHMGKRRMLKCP  401

Query  236  ----------------------VNPYTCVHCGKSYARANLLDTHLREIHCNGSGR  268
                                     Y C  C + +   +  D H R I C  + R
Sbjct  402  FCGMQCRDAHKMARHRKEMHLSQGTYVCHLCQEEFTDISYFDAHKRSIQCRSNTR  456



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016454.1 ubiquitin-conjugating enzyme E2 C [Drosophila
kikkawai]

Length=178
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

UBE2C_DROME  unnamed protein product                                  364     6e-131
UBC1_CAEEL  unnamed protein product                                   125     1e-36 
UBC13_CAEEL  unnamed protein product                                  122     1e-35 


>UBE2C_DROME unnamed protein product
Length=178

 Score = 364 bits (934),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 171/178 (96%), Positives = 175/178 (98%), Gaps = 0/178 (0%)

Query  1    MAQNISPEQSGGAGAGGTKHSDDSLPVKDNHAVSKRLHKELMNLMMANEKGISAFPDGEN  60
            MAQNISPEQSGGAG GG+KHSDDS+PVKDNHAVSKRLHKELMNLMMANE+GISAFPDGEN
Sbjct  1    MAQNISPEQSGGAGGGGSKHSDDSMPVKDNHAVSKRLHKELMNLMMANERGISAFPDGEN  60

Query  61   IFKWVGTIAGPLNTVYAGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDIL  120
            IFKWVGTIAGP NTVY+GQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDIL
Sbjct  61   IFKWVGTIAGPRNTVYSGQTYRLSLDFPNSYPYAAPVVKFLTSCFHPNVDLQGAICLDIL  120

Query  121  KDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYKKYLDVFYEKHKDT  178
            KDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYKKYLD FYEKHKDT
Sbjct  121  KDKWSALYDVRTILLSIQSLLGEPNNESPLNAQAAMMWNDQKEYKKYLDAFYEKHKDT  178


>UBC1_CAEEL unnamed protein product
Length=192

 Score = 125 bits (315),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 1/141 (1%)

Query  35   KRLHKELMNLMMANEKGISAFPDGENIFKWVGTIAGPLNTVYAGQTYRLSLDFPNSYPYA  94
            +RL ++   L      G+S  P  +NI  W   I GP  T +   T++LSL+F   YP  
Sbjct  7    RRLMRDFKKLQEDPPAGVSGAPTEDNILTWEAIIFGPQETPFEDGTFKLSLEFTEEYPNK  66

Query  95   APVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNAQA  154
             P VKF++  FHPNV   G+ICLDIL+++WS  YDV  IL SIQSLL EPN  SP N+ A
Sbjct  67   PPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSPANSLA  126

Query  155  AMMWND-QKEYKKYLDVFYEK  174
            A ++ + ++EY+K +    E+
Sbjct  127  AQLYQENRREYEKRVQQIVEQ  147


>UBC13_CAEEL unnamed protein product
Length=151

 Score = 122 bits (305),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 77/127 (61%), Gaps = 0/127 (0%)

Query  33   VSKRLHKELMNLMMANEKGISAFPDGENIFKWVGTIAGPLNTVYAGQTYRLSLDFPNSYP  92
            + +R+ KE   L+     GISA PD  N   +   IAGP ++ +AG  ++L L  P  YP
Sbjct  5    LPRRIIKETQRLLADPVPGISANPDESNARYFHVMIAGPDDSPFAGGVFKLELFLPEEYP  64

Query  93   YAAPVVKFLTSCFHPNVDLQGAICLDILKDKWSALYDVRTILLSIQSLLGEPNNESPLNA  152
             AAP V+F+T  +HPN+D  G ICLDILKDKWS    +RT+LLSIQ+LL  PN E PL  
Sbjct  65   MAAPKVRFMTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPEDPLAT  124

Query  153  QAAMMWN  159
              A  W 
Sbjct  125  DVAEQWK  131



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016455.1 uncharacterized protein LOC108070480 [Drosophila
kikkawai]

Length=670
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

GRM_DROME  unnamed protein product                                    71.2    2e-12
A1Z7F5_DROME  unnamed protein product                                 56.2    7e-08
A1Z7F6_DROME  unnamed protein product                                 56.2    7e-08


>GRM_DROME unnamed protein product
Length=976

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/278 (25%), Positives = 115/278 (41%), Gaps = 63/278 (23%)

Query  212  IFVLFKAWRTSPSRRH--LFLGQMLLLGLFACASLGAIITAQPTLLSCGAIRFGVGVAYA  269
            + VLF     +P  R     L   LL G+  C      + A+PT+ SC   RFG+GV ++
Sbjct  644  VIVLFAKNHDTPLVRASGRELSYTLLFGILVCYCNTFALIAKPTIGSCVLQRFGIGVGFS  703

Query  270  LVFAALLVKC-----VFLISLNGGVYLP--APYQGLLLLFALL-IQVAIGGQWLLTQPPE  321
            ++++ALL K      +F  +      L   +P   +++  +L+ IQV I   W++ +PP 
Sbjct  704  IIYSALLTKTNRISRIFHSASKSAQRLKYISPQSQVVITTSLIAIQVLITMIWMVVEPP-  762

Query  322  VYTTSVPVMGSGFLSTTVASQTNYSALFYPTSYTTLDGTPEIYTRIAAVSTVLIPLCKTQ  381
                     G+ F              +YP                      +I  CK Q
Sbjct  763  ---------GTRF--------------YYPDRRE------------------VILKCKIQ  781

Query  382  FSELLFSLIYIVFLIVFIAVLAIKSRGIRDNYREATYIGLAIGGAIPIWLGWMLCGLAVA  441
                LFS +Y + LI    + AIK+R I +N+ E+ +IG  +     IWL ++       
Sbjct  782  DMSFLFSQLYNMILITICTIYAIKTRKIPENFNESKFIGFTMYTTCIIWLAFVPIYFGTG  841

Query  442  ERHK----DACIAFGLVATSA-------TVFLVMFMPK  468
              ++      CI+  L A+ A        V++++F P 
Sbjct  842  NSYEVQTTTLCISISLSASVALVCLYSPKVYILVFHPD  879


>A1Z7F5_DROME unnamed protein product
Length=1248

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/214 (23%), Positives = 84/214 (39%), Gaps = 51/214 (24%)

Query  230  LGQMLLLGLFACASLGAIITAQPTLLSCGAIRFGVGVAYALVFAALLVKCVFLISLNGGV  289
            L  +LL G+F C  +   +  +PT + C   RFGVG  + +V+AALL K   +  +    
Sbjct  804  LSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAG  863

Query  290  YLPA-------PYQGLLLLFALL-IQVAIGGQWLLTQPPEVYTTSVPVMGSGFLSTTVAS  341
               A       P   L++   L+ +Q+ I G W++  P                      
Sbjct  864  KQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAP----------------------  901

Query  342  QTNYSALFYPTSYTTLDGTPEIYTRIAAVSTVLIPLCKTQFS-ELLFSLIYIVFLIVFIA  400
              +++   YPT    L                   +C +      + +  Y +FLIV   
Sbjct  902  --SHAMHHYPTREDNL------------------LVCDSYIDASYMIAFSYPIFLIVICT  941

Query  401  VLAIKSRGIRDNYREATYIGLAIGGAIPIWLGWM  434
            V A+ +R I + + E+ +IG  +     IWL ++
Sbjct  942  VYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFV  975


>A1Z7F6_DROME unnamed protein product
Length=780

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 49/214 (23%), Positives = 84/214 (39%), Gaps = 51/214 (24%)

Query  230  LGQMLLLGLFACASLGAIITAQPTLLSCGAIRFGVGVAYALVFAALLVKCVFLISLNGGV  289
            L  +LL G+F C  +   +  +PT + C   RFGVG  + +V+AALL K   +  +    
Sbjct  336  LSYILLAGIFMCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAG  395

Query  290  YLPA-------PYQGLLLLFALL-IQVAIGGQWLLTQPPEVYTTSVPVMGSGFLSTTVAS  341
               A       P   L++   L+ +Q+ I G W++  P                      
Sbjct  396  KQSAKRPSFISPKSQLVICACLVSVQILINGVWMVIAP----------------------  433

Query  342  QTNYSALFYPTSYTTLDGTPEIYTRIAAVSTVLIPLCKTQFS-ELLFSLIYIVFLIVFIA  400
              +++   YPT    L                   +C +      + +  Y +FLIV   
Sbjct  434  --SHAMHHYPTREDNL------------------LVCDSYIDASYMIAFSYPIFLIVICT  473

Query  401  VLAIKSRGIRDNYREATYIGLAIGGAIPIWLGWM  434
            V A+ +R I + + E+ +IG  +     IWL ++
Sbjct  474  VYAVLTRKIPEAFNESKHIGFTMYTTCVIWLAFV  507



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016456.1 uncharacterized protein LOC108070481 [Drosophila
kikkawai]

Length=1352
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

RPB1_CAEEL  unnamed protein product                                   48.5    5e-05
M9PC41_DROME  unnamed protein product                                 33.9    1.5  
M9PB30_DROME  unnamed protein product                                 33.9    1.5  


>RPB1_CAEEL unnamed protein product
Length=1856

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 76/155 (49%), Gaps = 12/155 (8%)

Query  431   TVGPTSTTEEPTTTPTPTTVPSTTEESTTEESTTESSSSSALPTTVSSTTEEPSSTTEAP  490
             T  PTS T  PT+     T P+ +  S + ES    S SS    + SS T  P+S + +P
Sbjct  1685  TYSPTSPTYSPTSPTYSPTSPTYSPTSPSYESGGGYSPSSPK-YSPSSPTYSPTSPSYSP  1743

Query  491   TTSTATPTEETTSSTATPTEEPSSSTATPTE---------EPTSSTATPTEEPTSSTAAP  541
             T+   +PT    S + +PT  PSS T  PT           PTS T +PT  P+ + ++P
Sbjct  1744  TSPQYSPTSPQYSPS-SPTYTPSSPTYNPTSPRGFSSPQYSPTSPTYSPTS-PSYTPSSP  1801

Query  542   TEEPTSSTATPTEEPTSTSSSSSTTTSPPVTTSSP  576
                PTS T TP+      +S+  + TSP  + SSP
Sbjct  1802  QYSPTSPTYTPSPSEQPGTSAQYSPTSPTYSPSSP  1836


 Score = 38.9 bits (89),  Expect = 0.041, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query  477   SSTTEEPSSTTEAPTTST--ATPTEETTSSTATPTEEPSSSTATPTEEPTSSTAT--PTE  532
             SS T  PSS T  PT+    ++P    TS T +PT  PS + ++P   PTS T T  P+E
Sbjct  1758  SSPTYTPSSPTYNPTSPRGFSSPQYSPTSPTYSPT-SPSYTPSSPQYSPTSPTYTPSPSE  1816

Query  533   EPTSSTAAPTEEPTSSTATPT  553
             +P +S       PT S ++PT
Sbjct  1817  QPGTSAQYSPTSPTYSPSSPT  1837


 Score = 37.0 bits (84),  Expect = 0.16, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 52/117 (44%), Gaps = 26/117 (22%)

Query  487   TEAPTTSTATPTEETTSSTATPTEEPSS-----------------------STATPTEEP  523
             T +PT+ T +PT  T S T +PT  P+S                       S  +P+  P
Sbjct  1685  TYSPTSPTYSPTSPTYSPT-SPTYSPTSPSYESGGGYSPSSPKYSPSSPTYSPTSPSYSP  1743

Query  524   TSSTATPTEEPTSSTAAPTEEPTSSTATPTEEPTSTSSSSSTTTSPPVTTSSPIANP  580
             TS   +PT  P  S ++PT  P+S T  PT  P   SS   + TSP  + +SP   P
Sbjct  1744  TSPQYSPT-SPQYSPSSPTYTPSSPTYNPT-SPRGFSSPQYSPTSPTYSPTSPSYTP  1798


 Score = 33.1 bits (74),  Expect = 2.4, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 62/127 (49%), Gaps = 13/127 (10%)

Query  431   TVGPTSTTEEPTTTPTPTTVPSTTEESTTEESTTESSSS--SALPTTVSSTTEEPSSTTE  488
             T  PTS +  PT+   P   P++ + S +  + T SS +     P   SS    P+S T 
Sbjct  1733  TYSPTSPSYSPTS---PQYSPTSPQYSPSSPTYTPSSPTYNPTSPRGFSSPQYSPTSPTY  1789

Query  489   APTTSTATPTEETTSSTA-----TPTEEPSSSTATPTEEPTSSTATPTEEPTSSTAAP--  541
             +PT+ + TP+    S T+     +P+E+P +S       PT S ++PT  P S + +P  
Sbjct  1790  SPTSPSYTPSSPQYSPTSPTYTPSPSEQPGTSAQYSPTSPTYSPSSPTYSPASPSYSPSS  1849

Query  542   -TEEPTS  547
              T +P S
Sbjct  1850  PTYDPNS  1856


>M9PC41_DROME unnamed protein product
Length=22743

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 74/155 (48%), Gaps = 30/155 (19%)

Query  443   TTPTP----TTVPSTTEESTTEESTTESSSSSALPTTVSSTTEEPSSTTEAPT-----TS  493
             +TPTP    TTV S T ESTT E  T      + PT VS  T  PS T E  T     T+
Sbjct  4055  STPTPSHLETTVASITSESTTREVYTIKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTT  4114

Query  494   TATPTEETTSSTATPTEE-----------PSSST--ATPTEEPTSSTATPTEEPTSSTAA  540
                 TE+TTSS   P+E+           PS ST   TP+E P + T  P++  T + + 
Sbjct  4115  RGQVTEQTTSS---PSEKRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSD  4171

Query  541   PTEEPTSSTATPTEEP---TSTSSSSSTTTSPPVT  572
              T E  S+   PT  P   ++ S +S  TT P VT
Sbjct  4172  QTTE--STRDVPTTRPFEASTPSPASLETTVPSVT  4204


 Score = 32.3 bits (72),  Expect = 3.9, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 28/135 (21%)

Query  424   LGLDDVTTVGPTSTTEEPTTTP-TPTTVPS---------TTEESTTEESTTE-----SSS  468
             +GL++ T    ++    P+ +P TPTT+PS          T EST +  TT      + S
Sbjct  6928  IGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  6987

Query  469   SSALPTTVSSTTEEPSSTTEAPTTSTATP-TEETTSS-----TATPTEE---PSSST--A  517
             S++L TTV S T E  +TT  P  ST    TE+TTSS     T    EE   PS ST   
Sbjct  6988  SASLETTVPSVTLE--TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT  7045

Query  518   TPTEEPTSSTATPTE  532
             TP+E P + T  P++
Sbjct  7046  TPSESPETPTTLPSD  7060


 Score = 31.6 bits (70),  Expect = 6.8, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 86/180 (48%), Gaps = 37/180 (21%)

Query  424   LGLDDVTTVGPTSTTEEPTTTP-TPTTVPS---------TTEESTTEESTTE-----SSS  468
             +GL++ T    ++    P+ +P TPTT+PS          T EST +  TT      + S
Sbjct  4235  IGLEESTLPSRSTDRTTPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  4294

Query  469   SSALPTTVSSTTEEPSSTTEAPTTSTATP-TEETTSS-----TATPTEE---PSSST--A  517
             S++L TTV S T E  +TT  P  ST    TE+TTSS     T    EE   PS S    
Sbjct  4295  SASLETTVPSVTLE--TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT  4352

Query  518   TPTEEPTSSTATPTEEPTSSTAAPTEEPT--SSTATPTEEP---TSTSSSSSTTTSPPVT  572
             TP+E P     TPT  P+  T  P  E T  S+   PT  P   ++ S +S  TT P VT
Sbjct  4353  TPSESP----ETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVT  4408


>M9PB30_DROME unnamed protein product
Length=22949

 Score = 33.9 bits (76),  Expect = 1.5, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 74/155 (48%), Gaps = 30/155 (19%)

Query  443   TTPTP----TTVPSTTEESTTEESTTESSSSSALPTTVSSTTEEPSSTTEAPT-----TS  493
             +TPTP    TTV S T ESTT E  T      + PT VS  T  PS T E  T     T+
Sbjct  4055  STPTPSHLETTVASITSESTTREVYTIKPFDRSTPTPVSPDTTVPSITFETTTNIPIGTT  4114

Query  494   TATPTEETTSSTATPTEE-----------PSSST--ATPTEEPTSSTATPTEEPTSSTAA  540
                 TE+TTSS   P+E+           PS ST   TP+E P + T  P++  T + + 
Sbjct  4115  RGQVTEQTTSS---PSEKRTTIRVEESTLPSRSTDRTTPSESPETPTILPSDSTTRTYSD  4171

Query  541   PTEEPTSSTATPTEEP---TSTSSSSSTTTSPPVT  572
              T E  S+   PT  P   ++ S +S  TT P VT
Sbjct  4172  QTTE--STRDVPTTRPFEASTPSPASLETTVPSVT  4204


 Score = 32.3 bits (72),  Expect = 4.0, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 68/135 (50%), Gaps = 28/135 (21%)

Query  424   LGLDDVTTVGPTSTTEEPTTTP-TPTTVPS---------TTEESTTEESTTE-----SSS  468
             +GL++ T    ++    P+ +P TPTT+PS          T EST +  TT      + S
Sbjct  6928  IGLEESTLPSRSTDRTSPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  6987

Query  469   SSALPTTVSSTTEEPSSTTEAPTTSTATP-TEETTSS-----TATPTEE---PSSST--A  517
             S++L TTV S T E  +TT  P  ST    TE+TTSS     T    EE   PS ST   
Sbjct  6988  SASLETTVPSVTLE--TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSTDRT  7045

Query  518   TPTEEPTSSTATPTE  532
             TP+E P + T  P++
Sbjct  7046  TPSESPETPTTLPSD  7060


 Score = 31.6 bits (70),  Expect = 7.1, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 86/180 (48%), Gaps = 37/180 (21%)

Query  424   LGLDDVTTVGPTSTTEEPTTTP-TPTTVPS---------TTEESTTEESTTE-----SSS  468
             +GL++ T    ++    P+ +P TPTT+PS          T EST +  TT      + S
Sbjct  4235  IGLEESTLPSRSTDRTTPSESPETPTTLPSDFITRPHSDQTTESTRDVPTTRPFEASTPS  4294

Query  469   SSALPTTVSSTTEEPSSTTEAPTTSTATP-TEETTSS-----TATPTEE---PSSST--A  517
             S++L TTV S T E  +TT  P  ST    TE+TTSS     T    EE   PS S    
Sbjct  4295  SASLETTVPSVTLE--TTTNVPIGSTGGQVTEQTTSSPSEVRTTIRVEESTLPSRSADRT  4352

Query  518   TPTEEPTSSTATPTEEPTSSTAAPTEEPT--SSTATPTEEP---TSTSSSSSTTTSPPVT  572
             TP+E P     TPT  P+  T  P  E T  S+   PT  P   ++ S +S  TT P VT
Sbjct  4353  TPSESP----ETPTTLPSDFTTRPHSEQTTESTRDVPTTRPFEASTPSPASLETTVPSVT  4408



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016457.1 zinc finger protein OZF [Drosophila kikkawai]

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRK4_DROME  unnamed protein product                                 176     5e-47
O61360_DROME  unnamed protein product                                 173     5e-46
O61361_DROME  unnamed protein product                                 172     5e-46


>Q8MRK4_DROME unnamed protein product
Length=878

 Score = 176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 152/324 (47%), Gaps = 18/324 (6%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C   F   T L+RHM  HS ++P  C  C K++ +  +L NH   +H     F C  
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFR-SHTGETPFRCQY  337

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE +  H+R H+GE P+ C +C K F R      H + H  T      C  CS
Sbjct  338  CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH--TGETPHRCDFCS  395

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   +  +C  C KT 
Sbjct  396  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGESPHKCTYCTKTF  454

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF    
Sbjct  455  TRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKE  514

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K  
Sbjct  515  HLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  391  LQAHSEQ------------CAKCP  402
            L  H               C KCP
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCP  596


 Score = 172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 153/324 (47%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T   C+ C KT    E L  H+++H     H C  C   FT+K     H+R HTG
Sbjct  382  WHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTG+ P RC  C+    F++  HL NH+ ++H   
Sbjct  442  ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKK--TFTRKEHLTNHV-RLHTGD  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ CE C + F  K  L  H  Q
Sbjct  499  SPHKCEYCQKTFTRKEHLNNHMRQ  522


 Score = 155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/336 (33%), Positives = 157/336 (47%), Gaps = 38/336 (11%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHR----  143
            C+ C K F  K  L  H   H+ E P +C+ C K++ +  ++ NH+   T    HR    
Sbjct  307  CTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDIC  366

Query  144  -KQFS-------------------CSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKF  183
             K F+                   C  C K+F  KE L  H+R H+GE P+ C+ C K F
Sbjct  367  KKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  426

Query  184  ARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFAN  243
             R   L  H+  H  T      CT C+ +F+   +L  H+ +H     HRCS C+  F  
Sbjct  427  TRKEHLVNHIRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTR  484

Query  244  ELALRAHINQEHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQ  303
            +  L  H+ + H   +  +CE C KT    E L  HM++H++   H C VCN  FT+K  
Sbjct  485  KEHLTNHV-RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEH  543

Query  304  YNVHM-RMHTGERPYQCRICHQTFAHSSVLKLHIRKHTG----EKPFRCQLCEDEVAFSQ  358
               HM R HTG+RP+ C  C ++F     L  H R HT     E+PF C+ C     F  
Sbjct  544  LINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKN--FIC  601

Query  359  LAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVELQAH  394
              HL +HM+  H  +KP+ C  C + F  +  L+ H
Sbjct  602  KGHLVSHMRS-HSGEKPHACTLCSKAFVERGNLKRH  636


 Score = 152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H       C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGETPHRCDF  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T      CT C+
Sbjct  394  CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGESPHKCTYCT  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  452  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  511  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  570

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  571  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  628

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  629  ERGNLKRHMKMNH  641


 Score = 130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  CSK F  K  L  H+  H+ E PH+C  C K++ +  +L NHI   H       C
Sbjct  389  HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR-QHTGESPHKC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  448  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  506  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  565

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  566  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  625

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  626  AFVERGNLKRHMK  638


 Score = 114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 104/228 (46%), Gaps = 11/228 (5%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E PHKC  C K++ +  +L NH+   H       C
Sbjct  417  HRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRC  475

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            S C K+F  KE L  H+RLH+G+ P+ C  C K F R   L  HM  H  +S     C  
Sbjct  476  SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH--SSDNPHCCNV  533

Query  209  CSASFSTNANLRVHMER-HEQGMEHRCSICESQFANELALRAHINQEHHKLTQ-----FE  262
            C+  F+   +L  HM R H       C  C   F  +  L  H  Q  H   Q     F 
Sbjct  534  CNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH--QRSHTKGQEMERPFA  591

Query  263  CEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRM  310
            CE C K       L +HM+ H+  K H C +C+  F ++     HM+M
Sbjct  592  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  639


 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  529  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  588

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  589  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  645


>O61360_DROME unnamed protein product
Length=962

 Score = 173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 152/309 (49%), Gaps = 8/309 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKVELQAH  394
              K  L +H
Sbjct  684  ICKGHLVSH  692


 Score = 159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C K F  K     H+L H+ E PH+C  C K++ +  +L NH+   H       CS 
Sbjct  419  CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVR-QHTGESPHRCSY  477

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C  C K F R   +  H+  H  T      CT C+
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCT  535

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  536  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  594

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  595  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  712

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  713  ERGNLKRHMKMNH  725


 Score = 127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E P KC  C K++ +  ++ NH+   H       C
Sbjct  473  HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVR-QHTGESPHKC  531

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  532  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  589

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  590  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  649

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  650  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  709

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  710  AFVERGNLKRHMK  722


 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 82/170 (48%), Gaps = 4/170 (2%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+ +H+ + PHKC+ C K++ +  +L NH+   H       C
Sbjct  557  HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-RQHSSDNPHCC  615

Query  149  SQCPKSFALKERLRLHM-RLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQ--FN  205
            + C K F  KE L  HM R H+G++P+ C  C K F   G L  H  SH K    +  F 
Sbjct  616  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA  675

Query  206  CTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEH  255
            C KC  +F    +L  HM  H     H C++C   F     L+ H+   H
Sbjct  676  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  613  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  672

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  673  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  729


>O61361_DROME unnamed protein product
Length=891

 Score = 172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 150/304 (49%), Gaps = 8/304 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKV  389
              KV
Sbjct  684  ICKV  687



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016458.1 zinc finger protein OZF [Drosophila kikkawai]

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRK4_DROME  unnamed protein product                                 176     5e-47
O61360_DROME  unnamed protein product                                 173     5e-46
O61361_DROME  unnamed protein product                                 172     5e-46


>Q8MRK4_DROME unnamed protein product
Length=878

 Score = 176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 152/324 (47%), Gaps = 18/324 (6%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C   F   T L+RHM  HS ++P  C  C K++ +  +L NH   +H     F C  
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFR-SHTGETPFRCQY  337

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE +  H+R H+GE P+ C +C K F R      H + H  T      C  CS
Sbjct  338  CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH--TGETPHRCDFCS  395

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   +  +C  C KT 
Sbjct  396  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGESPHKCTYCTKTF  454

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF    
Sbjct  455  TRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKE  514

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K  
Sbjct  515  HLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  391  LQAHSEQ------------CAKCP  402
            L  H               C KCP
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCP  596


 Score = 172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 153/324 (47%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T   C+ C KT    E L  H+++H     H C  C   FT+K     H+R HTG
Sbjct  382  WHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTG+ P RC  C+    F++  HL NH+ ++H   
Sbjct  442  ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKK--TFTRKEHLTNHV-RLHTGD  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ CE C + F  K  L  H  Q
Sbjct  499  SPHKCEYCQKTFTRKEHLNNHMRQ  522


 Score = 155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/336 (33%), Positives = 157/336 (47%), Gaps = 38/336 (11%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHR----  143
            C+ C K F  K  L  H   H+ E P +C+ C K++ +  ++ NH+   T    HR    
Sbjct  307  CTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDIC  366

Query  144  -KQFS-------------------CSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKF  183
             K F+                   C  C K+F  KE L  H+R H+GE P+ C+ C K F
Sbjct  367  KKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  426

Query  184  ARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFAN  243
             R   L  H+  H  T      CT C+ +F+   +L  H+ +H     HRCS C+  F  
Sbjct  427  TRKEHLVNHIRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTR  484

Query  244  ELALRAHINQEHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQ  303
            +  L  H+ + H   +  +CE C KT    E L  HM++H++   H C VCN  FT+K  
Sbjct  485  KEHLTNHV-RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEH  543

Query  304  YNVHM-RMHTGERPYQCRICHQTFAHSSVLKLHIRKHTG----EKPFRCQLCEDEVAFSQ  358
               HM R HTG+RP+ C  C ++F     L  H R HT     E+PF C+ C     F  
Sbjct  544  LINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKN--FIC  601

Query  359  LAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVELQAH  394
              HL +HM+  H  +KP+ C  C + F  +  L+ H
Sbjct  602  KGHLVSHMRS-HSGEKPHACTLCSKAFVERGNLKRH  636


 Score = 152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H       C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGETPHRCDF  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T      CT C+
Sbjct  394  CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGESPHKCTYCT  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  452  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  511  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  570

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  571  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  628

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  629  ERGNLKRHMKMNH  641


 Score = 130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  CSK F  K  L  H+  H+ E PH+C  C K++ +  +L NHI   H       C
Sbjct  389  HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR-QHTGESPHKC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  448  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  506  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  565

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  566  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  625

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  626  AFVERGNLKRHMK  638


 Score = 114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 104/228 (46%), Gaps = 11/228 (5%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E PHKC  C K++ +  +L NH+   H       C
Sbjct  417  HRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRC  475

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            S C K+F  KE L  H+RLH+G+ P+ C  C K F R   L  HM  H  +S     C  
Sbjct  476  SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH--SSDNPHCCNV  533

Query  209  CSASFSTNANLRVHMER-HEQGMEHRCSICESQFANELALRAHINQEHHKLTQ-----FE  262
            C+  F+   +L  HM R H       C  C   F  +  L  H  Q  H   Q     F 
Sbjct  534  CNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH--QRSHTKGQEMERPFA  591

Query  263  CEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRM  310
            CE C K       L +HM+ H+  K H C +C+  F ++     HM+M
Sbjct  592  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  639


 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  529  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  588

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  589  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  645


>O61360_DROME unnamed protein product
Length=962

 Score = 173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 152/309 (49%), Gaps = 8/309 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKVELQAH  394
              K  L +H
Sbjct  684  ICKGHLVSH  692


 Score = 159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C K F  K     H+L H+ E PH+C  C K++ +  +L NH+   H       CS 
Sbjct  419  CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVR-QHTGESPHRCSY  477

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C  C K F R   +  H+  H  T      CT C+
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCT  535

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  536  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  594

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  595  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  712

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  713  ERGNLKRHMKMNH  725


 Score = 127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E P KC  C K++ +  ++ NH+   H       C
Sbjct  473  HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVR-QHTGESPHKC  531

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  532  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  589

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  590  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  649

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  650  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  709

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  710  AFVERGNLKRHMK  722


 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 82/170 (48%), Gaps = 4/170 (2%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+ +H+ + PHKC+ C K++ +  +L NH+   H       C
Sbjct  557  HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-RQHSSDNPHCC  615

Query  149  SQCPKSFALKERLRLHM-RLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQ--FN  205
            + C K F  KE L  HM R H+G++P+ C  C K F   G L  H  SH K    +  F 
Sbjct  616  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA  675

Query  206  CTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEH  255
            C KC  +F    +L  HM  H     H C++C   F     L+ H+   H
Sbjct  676  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  613  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  672

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  673  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  729


>O61361_DROME unnamed protein product
Length=891

 Score = 172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 150/304 (49%), Gaps = 8/304 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKV  389
              KV
Sbjct  684  ICKV  687



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016459.1 zinc finger protein OZF [Drosophila kikkawai]

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRK4_DROME  unnamed protein product                                 176     5e-47
O61360_DROME  unnamed protein product                                 173     5e-46
O61361_DROME  unnamed protein product                                 172     5e-46


>Q8MRK4_DROME unnamed protein product
Length=878

 Score = 176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 152/324 (47%), Gaps = 18/324 (6%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C   F   T L+RHM  HS ++P  C  C K++ +  +L NH   +H     F C  
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFR-SHTGETPFRCQY  337

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE +  H+R H+GE P+ C +C K F R      H + H  T      C  CS
Sbjct  338  CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH--TGETPHRCDFCS  395

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   +  +C  C KT 
Sbjct  396  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGESPHKCTYCTKTF  454

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF    
Sbjct  455  TRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKE  514

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K  
Sbjct  515  HLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  391  LQAHSEQ------------CAKCP  402
            L  H               C KCP
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCP  596


 Score = 172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 153/324 (47%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T   C+ C KT    E L  H+++H     H C  C   FT+K     H+R HTG
Sbjct  382  WHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTG+ P RC  C+    F++  HL NH+ ++H   
Sbjct  442  ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKK--TFTRKEHLTNHV-RLHTGD  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ CE C + F  K  L  H  Q
Sbjct  499  SPHKCEYCQKTFTRKEHLNNHMRQ  522


 Score = 155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/336 (33%), Positives = 157/336 (47%), Gaps = 38/336 (11%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHR----  143
            C+ C K F  K  L  H   H+ E P +C+ C K++ +  ++ NH+   T    HR    
Sbjct  307  CTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDIC  366

Query  144  -KQFS-------------------CSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKF  183
             K F+                   C  C K+F  KE L  H+R H+GE P+ C+ C K F
Sbjct  367  KKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  426

Query  184  ARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFAN  243
             R   L  H+  H  T      CT C+ +F+   +L  H+ +H     HRCS C+  F  
Sbjct  427  TRKEHLVNHIRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTR  484

Query  244  ELALRAHINQEHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQ  303
            +  L  H+ + H   +  +CE C KT    E L  HM++H++   H C VCN  FT+K  
Sbjct  485  KEHLTNHV-RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEH  543

Query  304  YNVHM-RMHTGERPYQCRICHQTFAHSSVLKLHIRKHTG----EKPFRCQLCEDEVAFSQ  358
               HM R HTG+RP+ C  C ++F     L  H R HT     E+PF C+ C     F  
Sbjct  544  LINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKN--FIC  601

Query  359  LAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVELQAH  394
              HL +HM+  H  +KP+ C  C + F  +  L+ H
Sbjct  602  KGHLVSHMRS-HSGEKPHACTLCSKAFVERGNLKRH  636


 Score = 152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H       C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGETPHRCDF  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T      CT C+
Sbjct  394  CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGESPHKCTYCT  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  452  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  511  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  570

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  571  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  628

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  629  ERGNLKRHMKMNH  641


 Score = 130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  CSK F  K  L  H+  H+ E PH+C  C K++ +  +L NHI   H       C
Sbjct  389  HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR-QHTGESPHKC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  448  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  506  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  565

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  566  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  625

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  626  AFVERGNLKRHMK  638


 Score = 114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 104/228 (46%), Gaps = 11/228 (5%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E PHKC  C K++ +  +L NH+   H       C
Sbjct  417  HRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRC  475

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            S C K+F  KE L  H+RLH+G+ P+ C  C K F R   L  HM  H  +S     C  
Sbjct  476  SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH--SSDNPHCCNV  533

Query  209  CSASFSTNANLRVHMER-HEQGMEHRCSICESQFANELALRAHINQEHHKLTQ-----FE  262
            C+  F+   +L  HM R H       C  C   F  +  L  H  Q  H   Q     F 
Sbjct  534  CNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH--QRSHTKGQEMERPFA  591

Query  263  CEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRM  310
            CE C K       L +HM+ H+  K H C +C+  F ++     HM+M
Sbjct  592  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  639


 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  529  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  588

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  589  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  645


>O61360_DROME unnamed protein product
Length=962

 Score = 173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 152/309 (49%), Gaps = 8/309 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKVELQAH  394
              K  L +H
Sbjct  684  ICKGHLVSH  692


 Score = 159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C K F  K     H+L H+ E PH+C  C K++ +  +L NH+   H       CS 
Sbjct  419  CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVR-QHTGESPHRCSY  477

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C  C K F R   +  H+  H  T      CT C+
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCT  535

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  536  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  594

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  595  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  712

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  713  ERGNLKRHMKMNH  725


 Score = 127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E P KC  C K++ +  ++ NH+   H       C
Sbjct  473  HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVR-QHTGESPHKC  531

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  532  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  589

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  590  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  649

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  650  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  709

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  710  AFVERGNLKRHMK  722


 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 82/170 (48%), Gaps = 4/170 (2%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+ +H+ + PHKC+ C K++ +  +L NH+   H       C
Sbjct  557  HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-RQHSSDNPHCC  615

Query  149  SQCPKSFALKERLRLHM-RLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQ--FN  205
            + C K F  KE L  HM R H+G++P+ C  C K F   G L  H  SH K    +  F 
Sbjct  616  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA  675

Query  206  CTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEH  255
            C KC  +F    +L  HM  H     H C++C   F     L+ H+   H
Sbjct  676  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  613  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  672

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  673  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  729


>O61361_DROME unnamed protein product
Length=891

 Score = 172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 150/304 (49%), Gaps = 8/304 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKV  389
              KV
Sbjct  684  ICKV  687



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016460.1 zinc finger protein OZF [Drosophila kikkawai]

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q8MRK4_DROME  unnamed protein product                                 176     5e-47
O61360_DROME  unnamed protein product                                 173     5e-46
O61361_DROME  unnamed protein product                                 172     5e-46


>Q8MRK4_DROME unnamed protein product
Length=878

 Score = 176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 152/324 (47%), Gaps = 18/324 (6%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C   F   T L+RHM  HS ++P  C  C K++ +  +L NH   +H     F C  
Sbjct  279  CIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFR-SHTGETPFRCQY  337

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE +  H+R H+GE P+ C +C K F R      H + H  T      C  CS
Sbjct  338  CAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYMWH--TGETPHRCDFCS  395

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   +  +C  C KT 
Sbjct  396  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGESPHKCTYCTKTF  454

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF    
Sbjct  455  TRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKE  514

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K  
Sbjct  515  HLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGN  572

Query  391  LQAHSEQ------------CAKCP  402
            L  H               C KCP
Sbjct  573  LLFHQRSHTKGQEMERPFACEKCP  596


 Score = 172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 108/324 (33%), Positives = 153/324 (47%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T   C+ C KT    E L  H+++H     H C  C   FT+K     H+R HTG
Sbjct  382  WHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTG+ P RC  C+    F++  HL NH+ ++H   
Sbjct  442  ESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKK--TFTRKEHLTNHV-RLHTGD  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ CE C + F  K  L  H  Q
Sbjct  499  SPHKCEYCQKTFTRKEHLNNHMRQ  522


 Score = 155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 110/336 (33%), Positives = 157/336 (47%), Gaps = 38/336 (11%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHR----  143
            C+ C K F  K  L  H   H+ E P +C+ C K++ +  ++ NH+   T    HR    
Sbjct  307  CTICQKTFARKEHLDNHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDIC  366

Query  144  -KQFS-------------------CSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKF  183
             K F+                   C  C K+F  KE L  H+R H+GE P+ C+ C K F
Sbjct  367  KKSFTRKEHYVNHYMWHTGETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTF  426

Query  184  ARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFAN  243
             R   L  H+  H  T      CT C+ +F+   +L  H+ +H     HRCS C+  F  
Sbjct  427  TRKEHLVNHIRQH--TGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTR  484

Query  244  ELALRAHINQEHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQ  303
            +  L  H+ + H   +  +CE C KT    E L  HM++H++   H C VCN  FT+K  
Sbjct  485  KEHLTNHV-RLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEH  543

Query  304  YNVHM-RMHTGERPYQCRICHQTFAHSSVLKLHIRKHTG----EKPFRCQLCEDEVAFSQ  358
               HM R HTG+RP+ C  C ++F     L  H R HT     E+PF C+ C     F  
Sbjct  544  LINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFACEKCPKN--FIC  601

Query  359  LAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVELQAH  394
              HL +HM+  H  +KP+ C  C + F  +  L+ H
Sbjct  602  KGHLVSHMRS-HSGEKPHACTLCSKAFVERGNLKRH  636


 Score = 152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 103/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H       C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGETPHRCDF  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T      CT C+
Sbjct  394  CSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGESPHKCTYCT  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  452  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  511  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  570

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  571  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  628

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  629  ERGNLKRHMKMNH  641


 Score = 130 bits (327),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 82/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  CSK F  K  L  H+  H+ E PH+C  C K++ +  +L NHI   H       C
Sbjct  389  HRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIR-QHTGESPHKC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  448  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  506  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  565

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  566  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  625

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  626  AFVERGNLKRHMK  638


 Score = 114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/228 (34%), Positives = 104/228 (46%), Gaps = 11/228 (5%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E PHKC  C K++ +  +L NH+   H       C
Sbjct  417  HRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVR-QHTGDSPHRC  475

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            S C K+F  KE L  H+RLH+G+ P+ C  C K F R   L  HM  H  +S     C  
Sbjct  476  SYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQH--SSDNPHCCNV  533

Query  209  CSASFSTNANLRVHMER-HEQGMEHRCSICESQFANELALRAHINQEHHKLTQ-----FE  262
            C+  F+   +L  HM R H       C  C   F  +  L  H  Q  H   Q     F 
Sbjct  534  CNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFH--QRSHTKGQEMERPFA  591

Query  263  CEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRM  310
            CE C K       L +HM+ H+  K H C +C+  F ++     HM+M
Sbjct  592  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKM  639


 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  529  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  588

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  589  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  645


>O61360_DROME unnamed protein product
Length=962

 Score = 173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (428),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 103/309 (33%), Positives = 152/309 (49%), Gaps = 8/309 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKVELQAH  394
              K  L +H
Sbjct  684  ICKGHLVSH  692


 Score = 159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 143/313 (46%), Gaps = 39/313 (12%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C  C K F  K     H+L H+ E PH+C  C K++ +  +L NH+   H       CS 
Sbjct  419  CEICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVR-QHTGESPHRCSY  477

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K+F  KE L  H+R H+GE P+ C  C K F R   +  H+  H  T      CT C+
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQH--TGESPHKCTYCT  535

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C+  F  +  L  H+ + H   +  +CE C KT 
Sbjct  536  KTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHV-RLHTGDSPHKCEYCQKTF  594

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHM-RMHTGERPYQCRICHQTFAHS  329
               E L  HM++H++   H C VCN  FT+K     HM R HTG+RP+ C  C ++F   
Sbjct  595  TRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  330  SVLKLH--------------------------------IRKHTGEKPFRCQLCEDEVAFS  357
              L  H                                +R H+GEKP  C LC    AF 
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK--AFV  712

Query  358  QLAHLKNHMKKIH  370
            +  +LK HMK  H
Sbjct  713  ERGNLKRHMKMNH  725


 Score = 127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/253 (32%), Positives = 118/253 (47%), Gaps = 7/253 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+  H+ E P KC  C K++ +  ++ NH+   H       C
Sbjct  473  HRCSYCMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVR-QHTGESPHKC  531

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
            + C K+F  KE L  H+R H+G+ P+ C+ C K F R   L  H+  H  T      C  
Sbjct  532  TYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLH--TGDSPHKCEY  589

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  HM +H     H C++C   F  +  L  H+++ H     F CE C K
Sbjct  590  CQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGK  649

Query  269  TIEPDEDLATHMQKHAAV----KTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQ  324
            +     +L  H + H       +   CE C   F  K     HMR H+GE+P+ C +C +
Sbjct  650  SFPLKGNLLFHQRSHTKGQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK  709

Query  325  TFAHSSVLKLHIR  337
             F     LK H++
Sbjct  710  AFVERGNLKRHMK  722


 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 82/170 (48%), Gaps = 4/170 (2%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H CS+C K F  K  L  H+ +H+ + PHKC+ C K++ +  +L NH+   H       C
Sbjct  557  HRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHM-RQHSSDNPHCC  615

Query  149  SQCPKSFALKERLRLHM-RLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQ--FN  205
            + C K F  KE L  HM R H+G++P+ C  C K F   G L  H  SH K    +  F 
Sbjct  616  NVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA  675

Query  206  CTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEH  255
            C KC  +F    +L  HM  H     H C++C   F     L+ H+   H
Sbjct  676  CEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNH  725


 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/117 (42%), Positives = 65/117 (56%), Gaps = 4/117 (3%)

Query  89   HICSHCSKEFGGKTDLQRHM-LIHSDERPHKCKDCGKSYRQAVNLKNHI---TTAHEHRK  144
            H C+ C+K F  K  L  HM   H+ +RP  C+ CGKS+    NL  H    T   E  +
Sbjct  613  HCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMER  672

Query  145  QFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSI  201
             F+C +CPK+F  K  L  HMR HSGEKP+ C LC K F   G L++HM  +H  ++
Sbjct  673  PFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAM  729


>O61361_DROME unnamed protein product
Length=891

 Score = 172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 152/326 (47%), Gaps = 18/326 (6%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K F  K     H + H+ + PH+C  CGK Y +  +L NH+  +H +   F C
Sbjct  361  HRCDICKKSFTRKEHYVNHYMWHTGQTPHQCDVCGKKYTRKEHLANHMR-SHTNETPFRC  419

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C KSF+ KE    H+  H+GE P+ C  C K F R   L  H+  H  T      C+ 
Sbjct  420  EICGKSFSRKEHFTNHILWHTGETPHRCDFCSKTFTRKEHLLNHVRQH--TGESPHRCSY  477

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C  +F+   +L  H+ +H      +C+ C   F  +  +  H+ Q H   +  +C  C K
Sbjct  478  CMKTFTRKEHLVNHIRQHTGETPFKCTYCTKAFTRKDHMVNHVRQ-HTGESPHKCTYCTK  536

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H+++H     H C  C   FT+K     H+R+HTG+ P++C  C +TF  
Sbjct  537  TFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTR  596

Query  329  SSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIK  388
               L  H+R+H+ + P  C +C     F++  HL NHM + H   +P+ CE C + F +K
Sbjct  597  KEHLNNHMRQHSSDNPHCCNVCNK--PFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLK  654

Query  389  VELQAHSEQ------------CAKCP  402
              L  H               C KCP
Sbjct  655  GNLLFHQRSHTKGQEMERPFACEKCP  680


 Score = 171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 150/308 (49%), Gaps = 7/308 (2%)

Query  91   CSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSCSQ  150
            C +C+K F  K  +  H+  H+ E PH+C  C KS+ +  +  NH    H  +    C  
Sbjct  335  CQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHYM-WHTGQTPHQCDV  393

Query  151  CPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCS  210
            C K +  KE L  HMR H+ E P+ C +C K F+R      H++ H  T      C  CS
Sbjct  394  CGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWH--TGETPHRCDFCS  451

Query  211  ASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHKTI  270
             +F+   +L  H+ +H     HRCS C   F  +  L  HI Q H   T F+C  C K  
Sbjct  452  KTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQ-HTGETPFKCTYCTKAF  510

Query  271  EPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSS  330
               + +  H+++H     H C  C   FT+K     H+R HTG+ P++C  C +TF    
Sbjct  511  TRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTFTRKE  570

Query  331  VLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQKPYMCEGCHEFFKIKVE  390
             L  H+R HTG+ P +C+ C+    F++  HL NHM++ H    P+ C  C++ F  K  
Sbjct  571  HLTNHVRLHTGDSPHKCEYCQK--TFTRKEHLNNHMRQ-HSSDNPHCCNVCNKPFTRKEH  627

Query  391  LQAHSEQC  398
            L  H  +C
Sbjct  628  LINHMSRC  635


 Score = 169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/324 (33%), Positives = 154/324 (48%), Gaps = 12/324 (4%)

Query  74   PKKSPRKVETGKRKHHICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLK  133
            P  +P  + TG    H+C  C K F  +  L  H   HS+ +P  C+ CG+ +  + +L 
Sbjct  211  PDGTP--IATGT---HVCDICGKMFQFRYQLIVHRRYHSERKPFMCQVCGQGFTTSQDLT  265

Query  134  NHITTAHEHRKQFSCSQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHM  193
             H    H     F+C  C   FA    L  HM+ HS +KP+ C +C K FAR   L  H 
Sbjct  266  RH-GKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHF  324

Query  194  VSHHKTSIQQFNCTKCSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQ  253
             SH  T    F C  C+ +F+   ++  H+ +H     HRC IC+  F  +     H   
Sbjct  325  RSH--TGETPFRCQYCAKTFTRKEHMVNHVRKHTGETPHRCDICKKSFTRKEHYVNHY-M  381

Query  254  EHHKLTQFECEICHKTIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTG  313
             H   T  +C++C K     E LA HM+ H       CE+C   F++K  +  H+  HTG
Sbjct  382  WHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHILWHTG  441

Query  314  ERPYQCRICHQTFAHSSVLKLHIRKHTGEKPFRCQLCEDEVAFSQLAHLKNHMKKIHKQQ  373
            E P++C  C +TF     L  H+R+HTGE P RC  C     F++  HL NH+++ H  +
Sbjct  442  ETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMK--TFTRKEHLVNHIRQ-HTGE  498

Query  374  KPYMCEGCHEFFKIKVELQAHSEQ  397
             P+ C  C + F  K  +  H  Q
Sbjct  499  TPFKCTYCTKAFTRKDHMVNHVRQ  522


 Score = 163 bits (413),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 102/304 (34%), Positives = 150/304 (49%), Gaps = 8/304 (3%)

Query  89   HICSHCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFSC  148
            H C  C K++  K  L  HM  H++E P +C+ CGKS+ +  +  NHI   H       C
Sbjct  389  HQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSFSRKEHFTNHIL-WHTGETPHRC  447

Query  149  SQCPKSFALKERLRLHMRLHSGEKPYPCALCDKKFARGGQLQQHMVSHHKTSIQQFNCTK  208
              C K+F  KE L  H+R H+GE P+ C+ C K F R   L  H+  H  T    F CT 
Sbjct  448  DFCSKTFTRKEHLLNHVRQHTGESPHRCSYCMKTFTRKEHLVNHIRQH--TGETPFKCTY  505

Query  209  CSASFSTNANLRVHMERHEQGMEHRCSICESQFANELALRAHINQEHHKLTQFECEICHK  268
            C+ +F+   ++  H+ +H     H+C+ C   F  +  L  H+ Q H   +   C  C K
Sbjct  506  CTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFTRKEHLTNHVRQ-HTGDSPHRCSYCKK  564

Query  269  TIEPDEDLATHMQKHAAVKTHVCEVCNSYFTQKSQYNVHMRMHTGERPYQCRICHQTFAH  328
            T    E L  H++ H     H CE C   FT+K   N HMR H+ + P+ C +C++ F  
Sbjct  565  TFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTR  624

Query  329  SSVLKLHI-RKHTGEKPFRCQLCEDEVAF--SQLAHLKNHMKKIHKQQKPYMCEGCHEFF  385
               L  H+ R HTG++PF C+ C        + L H ++H K   + ++P+ CE C + F
Sbjct  625  KEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKG-QEMERPFACEKCPKNF  683

Query  386  KIKV  389
              KV
Sbjct  684  ICKV  687



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016461.1 uncharacterized protein LOC108070484 isoform X1
[Drosophila kikkawai]

Length=489


***** No hits found *****



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016462.1 uncharacterized protein LOC108070484 isoform X2
[Drosophila kikkawai]

Length=482


***** No hits found *****



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016463.1 cullin homolog 1 [Drosophila kikkawai]

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CUL1_DROME  unnamed protein product                                   221     4e-62
CUL1_CAEEL  unnamed protein product                                   179     2e-47
CUL1_DICDI  unnamed protein product                                   177     7e-47


>CUL1_DROME unnamed protein product
Length=774

 Score = 221 bits (562),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/472 (31%), Positives = 250/472 (53%), Gaps = 26/472 (6%)

Query  220  FERILLTKRYSALKPFLKYACLAMPEIEEGEKFKAFLKSHIAPQLKDAIAK------SLG  273
            F+ +L   R   LK       L+   + +    K+ L++HI  Q  +AIAK      +  
Sbjct  306  FQNLLNADRNDDLKRMYSLVALSSKNLTD---LKSILENHILHQGTEAIAKCCTTDAAND  362

Query  274  GKDYVQAICGLR---HGPLERGLREHKKLLFVIDQVCETAINSCEI---NSKMTATELLV  327
             K YVQ I  +    +  +          +  +D+ C   INS  +   NS   + ELL 
Sbjct  363  PKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVTIANSASKSPELLA  422

Query  328  RYCHQLM--TTKHPSEEALKDELKRIVEVVEFIFDKDLFLMRYRAALQNRQINETSTSDD  385
            +YC  L+  ++K+P ++ L+D L +++ V ++I DKD+F   Y   L  R +N TS SDD
Sbjct  423  KYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDD  482

Query  386  LEVTMISLLAKRFGHEATTNLSKQLEEMQKSNVIKDQFDSYLVDRDIKLGYDFRLKCFNA  445
             E  MIS L +  G+E T  L +  +++  S  +   F  YL ++++ +  DF ++  ++
Sbjct  483  AEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSS  542

Query  446  RDIASNIG--LILPFELQRTVDIFRAFFLNAYKRRKLEFNIQKSSGEIIINIDR--SSPY  501
                  +    +LP EL+R+V  F  F+   +  RKL +  Q   GE+I+N++R  SS Y
Sbjct  543  GSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTY  602

Query  502  FVKVGMLQMALLLQFNQKDRYTVEELAVSLGTQIETIIPILEGCIRERILVCGE---PLT  558
             ++    QM++LLQFN +  +TV++L  +  TQ E +I +L+  ++ ++L   +    LT
Sbjct  603  TLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVLTSSDNENSLT  662

Query  559  TNCTVEVAREFTRRKRHLNINTVSTKQRKIEPKYHDKELKEKRSIQLRCVMVRIMKKRMT  618
               TVE+  ++  +KR +NIN     + K+E +   K ++E R + ++  +VRIMK R  
Sbjct  663  PESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKR  722

Query  619  MNHIQLIGEVIEELKNHFKPDTRLIKEEIEYLIEKSILERSDN--NSYTYLS  668
            +NH  LI EV+ +L   FKP   +IK+ I+ LIEK  LER +   ++Y+YL+
Sbjct  723  LNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA  774


 Score = 110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 104/192 (54%), Gaps = 14/192 (7%)

Query  10   SLDGIWKMECEFLDQIFNQGISLETKQQMQFHDYIYRHCSSFVNNGSVR-------AQDP  62
            +LD IW    E + Q+F    SL   Q M+F+ ++Y +C+S     S R       AQ  
Sbjct  15   NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSVSAAPSGRSSGKTGGAQLV  74

Query  63   GKHLYESLTIFLTARLREMAAELETITEYEELLIVYHRKWQPYQKACAELDLMCRYFNVN  122
            GK LY+ L  FL + L E+  + + I+  E LL  Y ++W+ YQ +   LD +C Y N N
Sbjct  75   GKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRN  134

Query  123  WVKRERQVGHSNIYEVYPMAMHLWMEHVFRPIDRSLVDAII------RQRKYAS-SLVYE  175
            WVKRE + G   IY++Y +A+  W  H+F+ ++  +  A++      RQ K  + SLV +
Sbjct  135  WVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRD  194

Query  176  VLQSIVQLYAND  187
            V++  V+L  N+
Sbjct  195  VIECYVELSFNE  206


>CUL1_CAEEL unnamed protein product
Length=780

 Score = 179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 186/775 (24%), Positives = 331/775 (43%), Gaps = 130/775 (17%)

Query  14   IWKMECEFLDQIFNQGISLETKQQMQFHDYIYRHCSSFVNNGSVRAQDPGKHLYESLTIF  73
            +WK   + LD  + +  ++  K  M  +  +Y +C+S   + S R  + G+   ES T  
Sbjct  16   VWKKLQDGLDVAYRRE-NMAPKDYMTLYTSVYDYCTSITLSTSRRDGEDGRA--ESSTPA  72

Query  74   LTARLREMAAEL-ETITEY-----------------EELLIVYHRKWQPYQKACAELDLM  115
             TA    +  E+ + + EY                 E+LL  Y  +W+ ++ +   +D +
Sbjct  73   RTAGADFVGHEMYQRVEEYVKAYVIAVCEKGAELSGEDLLKYYTTEWENFRISSKVMDGI  132

Query  116  CRYFNVNWVKRERQVGHSNIYEVYPMAMHLWMEHVFRPIDRSLVDA---IIRQRKYASSL  172
              Y N +W++RE   GH NIY VY +A+ +W  ++F  +   ++DA   +IR  +  S +
Sbjct  133  FAYLNRHWIRRELDEGHENIYMVYTLALVVWKRNLFNDLKDKVIDAMLELIRSERTGSMI  192

Query  173  ----VYEVLQSIVQLYANDVRQET------------------------------------  192
                +  V++ +V+L  +D   +                                     
Sbjct  193  NSRYISGVVECLVELGVDDSETDAKKDAETKKLAVYKEFFEVKFLEATRGFYTQEAANFL  252

Query  193  ----TVRDKLINI---FGMESGVLQLYAKQTTEL---------------------FERIL  224
                 V D +I +      E    QLY   +T+                      F  +L
Sbjct  253  SNGGNVTDYMIKVETRLNQEDDRCQLYLNSSTKTPLATCCESVLISNQLDFLQRHFGGLL  312

Query  225  LTKRYSALKPFLKYACLAMPEIEEG-EKFKAFLKSHIAPQLKDAIAK-----SLGGKDYV  278
            + KR   L    K  C  +P    G ++ +  L++HIA +   A+ +     +   K YV
Sbjct  313  VDKRDDDLSRMFKL-CDRVPN---GLDELRKSLENHIAKEGHQALERVAMEAATDAKLYV  368

Query  279  QAICGL--RHGPL-ERGLREHKKLLFVIDQVCETAINSCEINSKMT-------ATELLVR  328
            + +  +  R+  L  R  +     +  +D+   + IN+  +  +         + ELL R
Sbjct  369  KTLLEVHERYQSLVNRSFKNEPGFMQSLDKAATSFINNNAVTKRAPPQAQLTKSAELLAR  428

Query  329  YCHQLM--TTKHPSEEALKDELKRIVEVVEFIFDKDLFLMRYRAALQNRQINETSTSDDL  386
            YC QL+  ++K P E  L++   +I+ V ++I DKD+F   Y      R I+E S SD+ 
Sbjct  429  YCDQLLRKSSKMPDEAELEELQTKIMVVFKYIDDKDVFSKFYTKMFSKRLISELSASDEA  488

Query  387  EVTMISLLAKRFGHEATTNLSKQLEEMQKSNVIKDQFDSYLVDRDIKLGYDFRLKCFNAR  446
            E   I+ L    G+E T  LSK + + Q S  +   F     D   +   +F +   ++ 
Sbjct  489  EANFITKLKSMCGYEYTARLSKMVNDTQVSKDLTADFKEKKADMLGQKSVEFNVLVLSSG  548

Query  447  DIAS--NIGLILPFELQRTVDIFRAFFLNAYKRRKLEFNIQKSSGEIIINIDRSSPYFVK  504
               +     + LP +L +T++IF  F+   +  R+L +   +S GE I +      Y   
Sbjct  549  SWPTFPTTPITLPQQLSKTIEIFGQFYNEKFNGRRLTWVYSQSRGE-ITSTAFPKKYVFT  607

Query  505  VGMLQMALLLQFNQKDRYTVEELAVSLGTQIETIIPILEGCIRERILVCGE--------P  556
                QM  +L FN++D YTVE++A +     ++   I+   I+  +L            P
Sbjct  608  ATTAQMCTMLLFNEQDSYTVEQIAAATKMDEKSAPAIVGSLIKNLVLKADTELQKEDEVP  667

Query  557  LTTNCTVEVAREFTRRKRHLNINTVSTKQRKI-EPKYHDKELKEKRSIQLRCVMVRIMKK  615
            +T   TV + + +  +K  ++++  + KQ  + + +   K ++E R   +   +VRIMK 
Sbjct  668  MT--ATVSLNKAYMNKKVRVDLSKFTMKQDAVRDTENVQKNVEEDRKSVISACIVRIMKT  725

Query  616  RMTMNHIQLIGEVIEELKNHFKPDTRLIKEEIEYLIEKSILERSDNNS--YTYLS  668
            R  + H QL+ EVI +L   FKP   +IK  I  LIEK  + R++     Y YL+
Sbjct  726  RKRVQHQQLMTEVITQLSGRFKPKVEMIKRCIGSLIEKEYMLRTEGQKDLYEYLA  780


>CUL1_DICDI unnamed protein product
Length=770

 Score = 177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 194/764 (25%), Positives = 341/764 (45%), Gaps = 114/764 (15%)

Query  11   LDGIWKMECEFLDQI---FNQGISLETKQQMQFHDYIYRHCSSFVNNGSVRAQDP-----  62
            LD IW    E + +I    N+G     ++ +  + ++Y +C++  +  S +   P     
Sbjct  15   LDDIWPELEEGIYKIITDLNKG--FPKQKWIALYTHVYDYCAASQSKSSAKVGMPKQQAS  72

Query  63   -----GKHLYESLTIFLTARLREMAAELETITEYEELLIVYHRKWQPYQKACAELDLMCR  117
                 G+ LY  L +FL   + ++    ET  + E LL  Y+ +W  Y  A   ++ + +
Sbjct  73   GANYVGEDLYNRLNLFLKKHMSQLLKLTETKMD-EPLLNYYYTEWDRYTSAMKYINNIFQ  131

Query  118  YFNVNWVKRERQVGHSNIYEVYPMAMHLWMEHVFRPIDR----SLVDAIIRQR---KYAS  170
            Y N  W+KRE   G   +YE++ +++ +W + +F P+ +    SL+D I  +R   +  +
Sbjct  132  YMNRYWIKREIDDGKKEVYEIFILSLVIWRDCLFTPLKQRLTNSLLDIIESERNGYQINT  191

Query  171  SLVYEVL--------------QSIVQLYANDVRQ-------------------ETTVRDK  197
             L+  V+              ++I+Q+Y +   +                   E +V D 
Sbjct  192  HLIKGVINGYVSLGLNREKPKETILQVYKSGFEELFLTATENYYTNESAKFISENSVADY  251

Query  198  LINI---FGMESGVLQLYAKQTTEL-----FERILLTKRYSALK------------PFLK  237
            +  +      E   +Q Y  Q TE       E++L+ K    +             P L 
Sbjct  252  MKKVETRLNEEVKRVQQYLHQNTESELIAKCEKVLIEKHVEVIWNEFQTLLEKDKIPDLT  311

Query  238  YACLAMPEIEEG-EKFKAFLKSHI---APQLKDAIAKS--LGGKDYVQAICGL--RHGPL  289
                 +  I  G E  +  L+ H+     Q   +IA +  +  K Y++ +  +  ++  L
Sbjct  312  RMYSLLSRIPRGLEPLRTTLEKHVQNVGLQAVSSIATNGVIEPKVYIETLLKVFKKYNEL  371

Query  290  ERG-LREHKKLLFVIDQVCETAINSCEIN----SKMTATELLVRYCHQLM--TTKHPSEE  342
              G  R     +  +D+ C   IN   +     S   + ELL R+   L+  +  +P E 
Sbjct  372  VTGAFRSDTGFVASLDKACRRFINENAVTIAAKSSSKSPELLARFTDFLLKKSPNNPEES  431

Query  343  ALKDELKRIVEVVEFIFDKDLFLMRYRAALQNRQINETSTSDDLEVTMISLLAKRFGHEA  402
             ++  L  ++ V ++I DKD+F   Y   L  R I+ TSTS+DLE TMI  L    G+E 
Sbjct  432  EMEQLLNDVMIVFKYIEDKDVFQDFYSKMLAKRLIHGTSTSEDLEGTMIGKLKSTCGYEY  491

Query  403  TTNLSKQLEEMQKSNVIKDQFDSYL--VDRDIKLGYDFRLKCFNARDIA---SNIGLILP  457
            T+ L +   +M  S  + D+F++++  V+R   L  DF +             +    +P
Sbjct  492  TSKLQRMFTDMSLSRELLDRFNNHIEQVERS-SLNIDFSVLVLATGSWPLQPPSTNFSIP  550

Query  458  FELQRTVDIFRAFFLNAYKRRKLEFNIQKSSGEIIINIDRSSP--YFVKVGMLQMALLLQ  515
             ELQ    +F+ F+ N +  RKL +    S GE+     ++S   Y ++    Q+ +LLQ
Sbjct  551  KELQACEQLFQKFYQNQHSGRKLNWLHHLSKGELKTKYLQTSKSGYTLQCSTYQIGVLLQ  610

Query  516  FNQKDRYTVEELAVSLGTQIETIIPILEGCI----RERILVCGEPL-----TTNCTVEVA  566
            FNQ +  T EE+  S  TQ+  I  +L+G +    + +IL+   PL            + 
Sbjct  611  FNQYETLTSEEIQES--TQL--IDSVLKGTLTSLAKSKILLADPPLDDEEIAKTTKFSLN  666

Query  567  REFTRRKRHLNINTVSTKQRKIEPKYHDKELKEKRSIQLRCVMVRIMKKRMTMNHIQLIG  626
            ++F  +K  + IN     Q K E     K ++E R +Q++  +VRIMK R  + H  L+ 
Sbjct  667  KQFKNKKTKIFINVPVLTQVKEEIDSIHKTVEEDRKLQIQAAIVRIMKMRKQLAHSGLMT  726

Query  627  EVIEELKNHFKPDTRLIKEEIEYLIEKSILERSDN--NSYTYLS  668
            EVI +L+  F P   +IK+ I+ LIEK  L R +   + Y+Y++
Sbjct  727  EVISQLQTRFNPKVNIIKKCIDILIEKEYLMRVEGKKDHYSYVA  770



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016465.1 cullin homolog 1 [Drosophila kikkawai]

Length=668
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

CUL1_DROME  unnamed protein product                                   221     4e-62
CUL1_CAEEL  unnamed protein product                                   179     2e-47
CUL1_DICDI  unnamed protein product                                   177     7e-47


>CUL1_DROME unnamed protein product
Length=774

 Score = 221 bits (562),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 148/472 (31%), Positives = 250/472 (53%), Gaps = 26/472 (6%)

Query  220  FERILLTKRYSALKPFLKYACLAMPEIEEGEKFKAFLKSHIAPQLKDAIAK------SLG  273
            F+ +L   R   LK       L+   + +    K+ L++HI  Q  +AIAK      +  
Sbjct  306  FQNLLNADRNDDLKRMYSLVALSSKNLTD---LKSILENHILHQGTEAIAKCCTTDAAND  362

Query  274  GKDYVQAICGLR---HGPLERGLREHKKLLFVIDQVCETAINSCEI---NSKMTATELLV  327
             K YVQ I  +    +  +          +  +D+ C   INS  +   NS   + ELL 
Sbjct  363  PKTYVQTILDVHKKYNALVLTAFNNDNGFVAALDKACGKFINSNVVTIANSASKSPELLA  422

Query  328  RYCHQLM--TTKHPSEEALKDELKRIVEVVEFIFDKDLFLMRYRAALQNRQINETSTSDD  385
            +YC  L+  ++K+P ++ L+D L +++ V ++I DKD+F   Y   L  R +N TS SDD
Sbjct  423  KYCDLLLKKSSKNPEDKELEDNLNQVMVVFKYIEDKDVFQKYYSKMLAKRLVNHTSASDD  482

Query  386  LEVTMISLLAKRFGHEATTNLSKQLEEMQKSNVIKDQFDSYLVDRDIKLGYDFRLKCFNA  445
             E  MIS L +  G+E T  L +  +++  S  +   F  YL ++++ +  DF ++  ++
Sbjct  483  AEAMMISKLKQTCGYEYTVKLQRMFQDIGVSKDLNSYFKQYLAEKNLTMEIDFGIEVLSS  542

Query  446  RDIASNIG--LILPFELQRTVDIFRAFFLNAYKRRKLEFNIQKSSGEIIINIDR--SSPY  501
                  +    +LP EL+R+V  F  F+   +  RKL +  Q   GE+I+N++R  SS Y
Sbjct  543  GSWPFQLSNNFLLPSELERSVRQFNEFYAARHSGRKLNWLYQMCKGELIMNVNRNNSSTY  602

Query  502  FVKVGMLQMALLLQFNQKDRYTVEELAVSLGTQIETIIPILEGCIRERILVCGE---PLT  558
             ++    QM++LLQFN +  +TV++L  +  TQ E +I +L+  ++ ++L   +    LT
Sbjct  603  TLQASTFQMSVLLQFNDQLSFTVQQLQDNTQTQQENLIQVLQILLKAKVLTSSDNENSLT  662

Query  559  TNCTVEVAREFTRRKRHLNINTVSTKQRKIEPKYHDKELKEKRSIQLRCVMVRIMKKRMT  618
               TVE+  ++  +KR +NIN     + K+E +   K ++E R + ++  +VRIMK R  
Sbjct  663  PESTVELFLDYKNKKRRININQPLKTELKVEQETVHKHIEEDRKLLIQAAIVRIMKMRKR  722

Query  619  MNHIQLIGEVIEELKNHFKPDTRLIKEEIEYLIEKSILERSDN--NSYTYLS  668
            +NH  LI EV+ +L   FKP   +IK+ I+ LIEK  LER +   ++Y+YL+
Sbjct  723  LNHTNLISEVLNQLSTRFKPKVPVIKKCIDILIEKEYLERMEGHKDTYSYLA  774


 Score = 110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 104/192 (54%), Gaps = 14/192 (7%)

Query  10   SLDGIWKMECEFLDQIFNQGISLETKQQMQFHDYIYRHCSSFVNNGSVR-------AQDP  62
            +LD IW    E + Q+F    SL   Q M+F+ ++Y +C+S     S R       AQ  
Sbjct  15   NLDDIWSELVEGIMQVFEHEKSLTRSQYMRFYTHVYDYCTSVSAAPSGRSSGKTGGAQLV  74

Query  63   GKHLYESLTIFLTARLREMAAELETITEYEELLIVYHRKWQPYQKACAELDLMCRYFNVN  122
            GK LY+ L  FL + L E+  + + I+  E LL  Y ++W+ YQ +   LD +C Y N N
Sbjct  75   GKKLYDRLEQFLKSYLSELLTKFKAISGEEVLLSRYTKQWKSYQFSSTVLDGICNYLNRN  134

Query  123  WVKRERQVGHSNIYEVYPMAMHLWMEHVFRPIDRSLVDAII------RQRKYAS-SLVYE  175
            WVKRE + G   IY++Y +A+  W  H+F+ ++  +  A++      RQ K  + SLV +
Sbjct  135  WVKRECEEGQKGIYKIYRLALVAWKGHLFQVLNEPVTKAVLKSIEEERQGKLINRSLVRD  194

Query  176  VLQSIVQLYAND  187
            V++  V+L  N+
Sbjct  195  VIECYVELSFNE  206


>CUL1_CAEEL unnamed protein product
Length=780

 Score = 179 bits (454),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 186/775 (24%), Positives = 331/775 (43%), Gaps = 130/775 (17%)

Query  14   IWKMECEFLDQIFNQGISLETKQQMQFHDYIYRHCSSFVNNGSVRAQDPGKHLYESLTIF  73
            +WK   + LD  + +  ++  K  M  +  +Y +C+S   + S R  + G+   ES T  
Sbjct  16   VWKKLQDGLDVAYRRE-NMAPKDYMTLYTSVYDYCTSITLSTSRRDGEDGRA--ESSTPA  72

Query  74   LTARLREMAAEL-ETITEY-----------------EELLIVYHRKWQPYQKACAELDLM  115
             TA    +  E+ + + EY                 E+LL  Y  +W+ ++ +   +D +
Sbjct  73   RTAGADFVGHEMYQRVEEYVKAYVIAVCEKGAELSGEDLLKYYTTEWENFRISSKVMDGI  132

Query  116  CRYFNVNWVKRERQVGHSNIYEVYPMAMHLWMEHVFRPIDRSLVDA---IIRQRKYASSL  172
              Y N +W++RE   GH NIY VY +A+ +W  ++F  +   ++DA   +IR  +  S +
Sbjct  133  FAYLNRHWIRRELDEGHENIYMVYTLALVVWKRNLFNDLKDKVIDAMLELIRSERTGSMI  192

Query  173  ----VYEVLQSIVQLYANDVRQET------------------------------------  192
                +  V++ +V+L  +D   +                                     
Sbjct  193  NSRYISGVVECLVELGVDDSETDAKKDAETKKLAVYKEFFEVKFLEATRGFYTQEAANFL  252

Query  193  ----TVRDKLINI---FGMESGVLQLYAKQTTEL---------------------FERIL  224
                 V D +I +      E    QLY   +T+                      F  +L
Sbjct  253  SNGGNVTDYMIKVETRLNQEDDRCQLYLNSSTKTPLATCCESVLISNQLDFLQRHFGGLL  312

Query  225  LTKRYSALKPFLKYACLAMPEIEEG-EKFKAFLKSHIAPQLKDAIAK-----SLGGKDYV  278
            + KR   L    K  C  +P    G ++ +  L++HIA +   A+ +     +   K YV
Sbjct  313  VDKRDDDLSRMFKL-CDRVPN---GLDELRKSLENHIAKEGHQALERVAMEAATDAKLYV  368

Query  279  QAICGL--RHGPL-ERGLREHKKLLFVIDQVCETAINSCEINSKMT-------ATELLVR  328
            + +  +  R+  L  R  +     +  +D+   + IN+  +  +         + ELL R
Sbjct  369  KTLLEVHERYQSLVNRSFKNEPGFMQSLDKAATSFINNNAVTKRAPPQAQLTKSAELLAR  428

Query  329  YCHQLM--TTKHPSEEALKDELKRIVEVVEFIFDKDLFLMRYRAALQNRQINETSTSDDL  386
            YC QL+  ++K P E  L++   +I+ V ++I DKD+F   Y      R I+E S SD+ 
Sbjct  429  YCDQLLRKSSKMPDEAELEELQTKIMVVFKYIDDKDVFSKFYTKMFSKRLISELSASDEA  488

Query  387  EVTMISLLAKRFGHEATTNLSKQLEEMQKSNVIKDQFDSYLVDRDIKLGYDFRLKCFNAR  446
            E   I+ L    G+E T  LSK + + Q S  +   F     D   +   +F +   ++ 
Sbjct  489  EANFITKLKSMCGYEYTARLSKMVNDTQVSKDLTADFKEKKADMLGQKSVEFNVLVLSSG  548

Query  447  DIAS--NIGLILPFELQRTVDIFRAFFLNAYKRRKLEFNIQKSSGEIIINIDRSSPYFVK  504
               +     + LP +L +T++IF  F+   +  R+L +   +S GE I +      Y   
Sbjct  549  SWPTFPTTPITLPQQLSKTIEIFGQFYNEKFNGRRLTWVYSQSRGE-ITSTAFPKKYVFT  607

Query  505  VGMLQMALLLQFNQKDRYTVEELAVSLGTQIETIIPILEGCIRERILVCGE--------P  556
                QM  +L FN++D YTVE++A +     ++   I+   I+  +L            P
Sbjct  608  ATTAQMCTMLLFNEQDSYTVEQIAAATKMDEKSAPAIVGSLIKNLVLKADTELQKEDEVP  667

Query  557  LTTNCTVEVAREFTRRKRHLNINTVSTKQRKI-EPKYHDKELKEKRSIQLRCVMVRIMKK  615
            +T   TV + + +  +K  ++++  + KQ  + + +   K ++E R   +   +VRIMK 
Sbjct  668  MT--ATVSLNKAYMNKKVRVDLSKFTMKQDAVRDTENVQKNVEEDRKSVISACIVRIMKT  725

Query  616  RMTMNHIQLIGEVIEELKNHFKPDTRLIKEEIEYLIEKSILERSDNNS--YTYLS  668
            R  + H QL+ EVI +L   FKP   +IK  I  LIEK  + R++     Y YL+
Sbjct  726  RKRVQHQQLMTEVITQLSGRFKPKVEMIKRCIGSLIEKEYMLRTEGQKDLYEYLA  780


>CUL1_DICDI unnamed protein product
Length=770

 Score = 177 bits (450),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 194/764 (25%), Positives = 341/764 (45%), Gaps = 114/764 (15%)

Query  11   LDGIWKMECEFLDQI---FNQGISLETKQQMQFHDYIYRHCSSFVNNGSVRAQDP-----  62
            LD IW    E + +I    N+G     ++ +  + ++Y +C++  +  S +   P     
Sbjct  15   LDDIWPELEEGIYKIITDLNKG--FPKQKWIALYTHVYDYCAASQSKSSAKVGMPKQQAS  72

Query  63   -----GKHLYESLTIFLTARLREMAAELETITEYEELLIVYHRKWQPYQKACAELDLMCR  117
                 G+ LY  L +FL   + ++    ET  + E LL  Y+ +W  Y  A   ++ + +
Sbjct  73   GANYVGEDLYNRLNLFLKKHMSQLLKLTETKMD-EPLLNYYYTEWDRYTSAMKYINNIFQ  131

Query  118  YFNVNWVKRERQVGHSNIYEVYPMAMHLWMEHVFRPIDR----SLVDAIIRQR---KYAS  170
            Y N  W+KRE   G   +YE++ +++ +W + +F P+ +    SL+D I  +R   +  +
Sbjct  132  YMNRYWIKREIDDGKKEVYEIFILSLVIWRDCLFTPLKQRLTNSLLDIIESERNGYQINT  191

Query  171  SLVYEVL--------------QSIVQLYANDVRQ-------------------ETTVRDK  197
             L+  V+              ++I+Q+Y +   +                   E +V D 
Sbjct  192  HLIKGVINGYVSLGLNREKPKETILQVYKSGFEELFLTATENYYTNESAKFISENSVADY  251

Query  198  LINI---FGMESGVLQLYAKQTTEL-----FERILLTKRYSALK------------PFLK  237
            +  +      E   +Q Y  Q TE       E++L+ K    +             P L 
Sbjct  252  MKKVETRLNEEVKRVQQYLHQNTESELIAKCEKVLIEKHVEVIWNEFQTLLEKDKIPDLT  311

Query  238  YACLAMPEIEEG-EKFKAFLKSHI---APQLKDAIAKS--LGGKDYVQAICGL--RHGPL  289
                 +  I  G E  +  L+ H+     Q   +IA +  +  K Y++ +  +  ++  L
Sbjct  312  RMYSLLSRIPRGLEPLRTTLEKHVQNVGLQAVSSIATNGVIEPKVYIETLLKVFKKYNEL  371

Query  290  ERG-LREHKKLLFVIDQVCETAINSCEIN----SKMTATELLVRYCHQLM--TTKHPSEE  342
              G  R     +  +D+ C   IN   +     S   + ELL R+   L+  +  +P E 
Sbjct  372  VTGAFRSDTGFVASLDKACRRFINENAVTIAAKSSSKSPELLARFTDFLLKKSPNNPEES  431

Query  343  ALKDELKRIVEVVEFIFDKDLFLMRYRAALQNRQINETSTSDDLEVTMISLLAKRFGHEA  402
             ++  L  ++ V ++I DKD+F   Y   L  R I+ TSTS+DLE TMI  L    G+E 
Sbjct  432  EMEQLLNDVMIVFKYIEDKDVFQDFYSKMLAKRLIHGTSTSEDLEGTMIGKLKSTCGYEY  491

Query  403  TTNLSKQLEEMQKSNVIKDQFDSYL--VDRDIKLGYDFRLKCFNARDIA---SNIGLILP  457
            T+ L +   +M  S  + D+F++++  V+R   L  DF +             +    +P
Sbjct  492  TSKLQRMFTDMSLSRELLDRFNNHIEQVERS-SLNIDFSVLVLATGSWPLQPPSTNFSIP  550

Query  458  FELQRTVDIFRAFFLNAYKRRKLEFNIQKSSGEIIINIDRSSP--YFVKVGMLQMALLLQ  515
             ELQ    +F+ F+ N +  RKL +    S GE+     ++S   Y ++    Q+ +LLQ
Sbjct  551  KELQACEQLFQKFYQNQHSGRKLNWLHHLSKGELKTKYLQTSKSGYTLQCSTYQIGVLLQ  610

Query  516  FNQKDRYTVEELAVSLGTQIETIIPILEGCI----RERILVCGEPL-----TTNCTVEVA  566
            FNQ +  T EE+  S  TQ+  I  +L+G +    + +IL+   PL            + 
Sbjct  611  FNQYETLTSEEIQES--TQL--IDSVLKGTLTSLAKSKILLADPPLDDEEIAKTTKFSLN  666

Query  567  REFTRRKRHLNINTVSTKQRKIEPKYHDKELKEKRSIQLRCVMVRIMKKRMTMNHIQLIG  626
            ++F  +K  + IN     Q K E     K ++E R +Q++  +VRIMK R  + H  L+ 
Sbjct  667  KQFKNKKTKIFINVPVLTQVKEEIDSIHKTVEEDRKLQIQAAIVRIMKMRKQLAHSGLMT  726

Query  627  EVIEELKNHFKPDTRLIKEEIEYLIEKSILERSDN--NSYTYLS  668
            EVI +L+  F P   +IK+ I+ LIEK  L R +   + Y+Y++
Sbjct  727  EVISQLQTRFNPKVNIIKKCIDILIEKEYLMRVEGKKDHYSYVA  770



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016466.1 protein Exd1 homolog [Drosophila kikkawai]

Length=282
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

EXD1_BOMMO  unnamed protein product                                   68.2    5e-13
EGAL1_CAEEL  unnamed protein product                                  46.6    1e-05
P92030_DROME  unnamed protein product                                 30.8    1.6  


>EXD1_BOMMO unnamed protein product
Length=315

 Score = 68.2 bits (165),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 89/176 (51%), Gaps = 13/176 (7%)

Query  45   IFIQQTDATYHKALRDMRDQNSLSLLVEPSFYGRYQTTSVLAVATSNKTYIFDVRALG--  102
            IFI Q D ++H+A+ D+  Q+ +++  + +  GR      L ++T ++ YIFD++ +   
Sbjct  93   IFINQVDKSFHEAVDDLNQQDFIAVSGDGANMGRKCKMPFLVLSTDHQIYIFDIQVMQYH  152

Query  103  TIFKELAAILEAERPRKVVHYSHRIADHLHHRYTIKLGGVCDSFVVLCVARQEKSPCSLP  162
                 L  ILE + P+K+ H   +++D L+H++ +KL  V D+ V   +  + K   +LP
Sbjct  153  AFESGLKKILEGDSPKKIAHDCRKLSDCLYHKHNVKLKSVFDTQVGDLIITKNKK-VTLP  211

Query  163  EAIS-----LVFGLPLQELLCEEVTGGSESRRNFSARPLTQSQIRYLAR-MAILQH  212
              +      L   L LQ+   +E     +S    + RPL+      LAR +A L H
Sbjct  212  NKVKSLGECLTNYLGLQQNTIDEKLDIVQS----TERPLSVKIKDSLARNIAFLHH  263


>EGAL1_CAEEL unnamed protein product
Length=574

 Score = 46.6 bits (109),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query  83   SVLAVATSNKTYIFDVRALGTIFKE--LAAILEAERPRKVVHYSHRIADHLHHRYTIKLG  140
            S+  +AT+++  IFD+ +   I  E     ILE+E+  KV+H + R+A  L H+Y + + 
Sbjct  336  SLGVIATTSQIGIFDLASSDVIILESGFKGILESEKVVKVIHDARRVASLLAHKYAVHMR  395

Query  141  GVCDSFVVLCVARQEKSPCSLPEAISLVFGLPLQE------LLCEEVTGGSESR-RNFSA  193
             V D+ V   + + EK   SL E   + F + LQ       ++  +VT    S   N+  
Sbjct  396  NVFDTQVAHSLLQHEKFNKSLNEMRPISF-INLQRVYYPQSIMLSDVTPRKMSMCPNWGV  454

Query  194  RPLTQ  198
            RP+T+
Sbjct  455  RPITE  459


>P92030_DROME unnamed protein product
Length=993

 Score = 30.8 bits (68),  Expect = 1.6, Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 73/159 (46%), Gaps = 28/159 (18%)

Query  88   ATSNKTYIFDVRALGTIFKE--LAAILEAERPRKVVHYSHRIADHLHHRYTIKLGGVCDS  145
             T  + ++FDV++   +  +  L  +LE ++  KV+H     A +L+ ++ I L  V D+
Sbjct  569  TTRGEAFLFDVQSCPAMVTDGGLKTVLEHDQVIKVIHDCRNDAANLYLQFGILLRNVFDT  628

Query  146  FVVLCVARQEKSPCSLPEA--ISLVFGLPLQELLCEEVTGGSES---------RRN---F  191
                 + + ++S   + +A  ISL         LCE+                RR+   +
Sbjct  629  QAAHAILQYQESGKQVYKAKYISL-------NSLCEQYNAPCNPIKDQLKQIYRRDQKFW  681

Query  192  SARPLTQSQIRYLARMAILQHRMHDHLHLMYGNICSELQ  230
            + RPLT+  + Y A   ++   +HD L   +GN+  +++
Sbjct  682  AKRPLTREMMLYAAGDVLV--LIHDQL---FGNLARQIK  715



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016467.1 homeobox protein araucan isoform X1 [Drosophila
kikkawai]

Length=737
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARA_DROME  unnamed protein product                                    855     0.0   
CAUP_DROME  unnamed protein product                                   390     1e-125
Q9VU01_DROME  unnamed protein product                                 198     3e-54 


>ARA_DROME unnamed protein product
Length=717

 Score = 855 bits (2208),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/775 (73%), Positives = 591/775 (76%), Gaps = 96/775 (12%)

Query  1    MAAYTQFGYGGFPTASQLLPPSAQPAEDSSANVN----DSLVMTNAPAMSPAGGADCQAS  56
            MAAYTQFGYGGFP+ASQLLPPS Q  ED+SANVN    ++LVMTNAPAMSP GG DCQ S
Sbjct  1    MAAYTQFGYGGFPSASQLLPPSVQTTEDASANVNVNVNEALVMTNAPAMSPTGGQDCQGS  60

Query  57   QPSGGVAGAGGDASSGALSPNALSQNSQNAPTGGSVVAGAGSGPGGADLVTGGGSLDGNG  116
            QPSGG  G    ASSGALSPNALSQNS  A   G+    +  G G ADL TGG SLDGNG
Sbjct  61   QPSGGAGGD---ASSGALSPNALSQNSNAATVVGAGGGSSAGGGGPADLATGG-SLDGNG  116

Query  117  VGTTPTAGGGSG--SCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYG  174
            VGTTPTAGG  G  SCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYG
Sbjct  117  VGTTPTAGGAGGGGSCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYG  176

Query  175  TPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPM  234
            TPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPM
Sbjct  177  TPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPM  236

Query  235  SAYG--------YGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITK  286
            SAYG        YGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITK
Sbjct  237  SAYGGLLVSNSSYGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITK  296

Query  287  MTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDAMVSDDEKDKEDLEPGSKGSQSGS  346
            MTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDA+VSDDEKDKEDLEP SKGSQ   
Sbjct  297  MTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDALVSDDEKDKEDLEP-SKGSQGSV  355

Query  347  GLAKGIGLGSHSPGLSTQSRPFFEPDETKEEEDAIDEDQKCLGQQANILRAGF----GYP  402
             LAK                     DETKEEEDAIDEDQKCLG QANILRAGF       
Sbjct  356  SLAK---------------------DETKEEEDAIDEDQKCLG-QANILRAGFGYPSAGS  393

Query  403  SAGSGGYHGGGGGSAAGGYHPYHHQHPAYYQPGQQ-GMLPFHEGSGSGSKLHGDNGEPKN  461
             +G     GG      GGYHPYHHQHPAYYQ GQQ GMLPFH   G  SKL  D G+PKN
Sbjct  394  GSGGYPGGGGSSSGHPGGYHPYHHQHPAYYQAGQQGGMLPFH---GENSKLQTDLGDPKN  450

Query  462  QLGRDCGVPIPATKPKIWSLADTVGCKTPPPAYMGHQGHP--------NHSIPLQQQYPP  513
            QLGRDCGVPIPATKPKIWSLADTVGCKTPPPAYMGHQ  P              Q QYPP
Sbjct  451  QLGRDCGVPIPATKPKIWSLADTVGCKTPPPAYMGHQSMPLQQQQQQQQQQQQAQHQYPP  510

Query  514  VQQEAAGRD-QMFNGAAAPYLRPHTTAYGGFLGATTQQLHTTNSSNSMPYTSSSMPQQQQ  572
             +   AGRD Q+FNGAAAPYLRPHTTAYGGFLGATTQQLHTTN  NS+PY  S+MP QQQ
Sbjct  511  SE---AGRDQQLFNGAAAPYLRPHTTAYGGFLGATTQQLHTTN--NSIPY--SNMPPQQQ  563

Query  573  SQLEQLHPQQLAGGLRSSGSSSSSGTHTPTILTTGSSSGAQQLQLQFQRQQ-------FQ  625
               +Q    Q  G                TI TTGSSSG   + LQF  +         Q
Sbjct  564  QPQQQQQQLQQGG----------------TIHTTGSSSGP-IIPLQFHNRHPQQQQQLQQ  606

Query  626  QSQSTASQRAMGFPEAQPDTPPQTPPNMKVLNGALSLLPTATPAPTIATCRSSNAAQY--  683
            QSQSTASQRAMGF EAQPDTPPQTPPNMKVL+GALSLLPTAT  P  ATCRSSNA  +  
Sbjct  607  QSQSTASQRAMGFLEAQPDTPPQTPPNMKVLSGALSLLPTATQVPMTATCRSSNAFGFPA  666

Query  684  NGYPMNFS-RIGEYSPREDYGSGNSSSSSTSSSSSPLQLQRNEAMFRPLFKKFVN  737
            +GYPMNFS R+GEYSPR+DY SGNSSSSS+SS     QLQRNEAMF+PLFKKF N
Sbjct  667  SGYPMNFSARLGEYSPRDDYSSGNSSSSSSSSP----QLQRNEAMFKPLFKKFTN  717


>CAUP_DROME unnamed protein product
Length=693

 Score = 390 bits (1003),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 258/537 (48%), Positives = 314/537 (58%), Gaps = 86/537 (16%)

Query  1    MAAYTQFGYGGFPTASQLLPPSAQPAEDSSANVNDSLVMTNAPAMSPAGGADCQASQPSG  60
            MAAY QFGY G+PTA+QL          ++AN +     +     SP  G +  +  PSG
Sbjct  1    MAAYAQFGYAGYPTANQL----------TTANTDS---QSGHGGGSPLSGTNEASLSPSG  47

Query  61   GVAGAGGDASSGALSPNALSQNSQNAPTGGSVVAGAGSGPGGADLVTGGGSLDGNGVGTT  120
            G    G   ++G LSP A+SQ+S +A   G   + A       D+V G   +   G+ + 
Sbjct  48   GSTATG--LTAGPLSPGAVSQSSHHAGHKGLSTSPA------EDVVGGDVPV---GLSSA  96

Query  121  PTAGGGSGSCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYGTPYP--  178
                   GSCCENGRPI+TDPVSGQTVCSCQYD ARLA+  YSR+   S GV    Y   
Sbjct  97   AQDLPSRGSCCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGGVGVGVYGGP  156

Query  179  --STDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDP-MS  235
              S +QNPY SIGVD+SAFY+PLSNPYG+KDT    EM AWTSA LQ TTGYYSYDP ++
Sbjct  157  YPSNEQNPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLA  216

Query  236  AYGYGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTW  295
            AYGYG +YDLAARRKNATRESTATLKAWL+EHKKNPYPTKGEKIMLAIITKMTLTQVSTW
Sbjct  217  AYGYGPNYDLAARRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTW  276

Query  296  FANARRRLKKENKMTWEPKNRTDDDDDAMVSDDEKDKEDLEPGSKGSQSGSGLAKGIGLG  355
            FANARRRLKKENKMTWEPKN+T+DDDD M+SDDEK+K+    G  G  S      G  L 
Sbjct  277  FANARRRLKKENKMTWEPKNKTEDDDDGMMSDDEKEKDA---GDGGKLSTEAFDPGNQLI  333

Query  356  SHSPGLSTQSRPFFEPDETKEEEDAIDEDQKCLGQQANILRAGFGYPSAGSGGYHGGGGG  415
                G + +     E D + +++  +D +   L     +  A +  P             
Sbjct  334  KSELGKAEK-----EVDSSGDQKLDLDREPHNLVAMRGL--APYATPP------------  374

Query  416  SAAGGYHPYHHQHPAYYQ-----------------------------PGQQGMLPFHEGS  446
                G HP H  + +Y Q                                Q   P++   
Sbjct  375  ----GAHPMHAAYSSYAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQHHQMDQPYYHPG  430

Query  447  GSGSKLHGDNGEPKNQLGRDCGVPIPATKPKIWSLADTVGCKTPPP--AYMGHQGHP  501
            G G +  G+    KN L RDCG+P+PA+KPKIWS+ADT  CKTPPP  AY+G   +P
Sbjct  431  GYGQEESGEFAAQKNPLSRDCGIPVPASKPKIWSVADTAACKTPPPTAAYLGQNFYP  487


>Q9VU01_DROME unnamed protein product
Length=641

 Score = 198 bits (503),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 138/234 (59%), Gaps = 51/234 (22%)

Query  130  CCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYGTPYPSTDQNPYQSIG  189
            CC+ GR I TDPVSGQT+CSCQYD     + +Y RL AA+ GV    YP         I 
Sbjct  119  CCDTGRTIYTDPVSGQTICSCQYD-----MLNYQRL-AAAGGVPLGVYPEGMSAYLSGIA  172

Query  190  VDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQP---TTGYYSYD------PMSAYGYG  240
             D   FY+   NP G+       ++     AG  P    + Y+ YD      P ++YG  
Sbjct  173  ADQPPFYA---NPAGI-------DLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGM-  221

Query  241  ASYDL-AARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA  299
               DL  ARRKNATRE+T+TLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA
Sbjct  222  ---DLNGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA  278

Query  300  RRRLKKENKMTWEPKNRT---------------------DDDDDAMVSDDEKDK  332
            RRRLKKENKMTWEP+NR                      D  D  + S D+KD+
Sbjct  279  RRRLKKENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDR  332



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016468.1 homeobox protein araucan isoform X2 [Drosophila
kikkawai]

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ARA_DROME  unnamed protein product                                    866     0.0   
CAUP_DROME  unnamed protein product                                   402     3e-130
Q9VU01_DROME  unnamed protein product                                 198     2e-54 


>ARA_DROME unnamed protein product
Length=717

 Score = 866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/754 (75%), Positives = 591/754 (78%), Gaps = 75/754 (10%)

Query  1    MAAYTQFGYGGFPTASQLLPPSAQPAEDSSANVN----DSLVMTNAPAMSPAGGADCQAS  56
            MAAYTQFGYGGFP+ASQLLPPS Q  ED+SANVN    ++LVMTNAPAMSP GG DCQ S
Sbjct  1    MAAYTQFGYGGFPSASQLLPPSVQTTEDASANVNVNVNEALVMTNAPAMSPTGGQDCQGS  60

Query  57   QPSGGVAGAGGDASSGALSPNALSQNSQNAPTGGSVVAGAGSGPGGADLVTGGGSLDGNG  116
            QPSGG  G    ASSGALSPNALSQNS  A   G+    +  G G ADL TGG SLDGNG
Sbjct  61   QPSGGAGGD---ASSGALSPNALSQNSNAATVVGAGGGSSAGGGGPADLATGG-SLDGNG  116

Query  117  VGTTPTAGGGSG--SCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYG  174
            VGTTPTAGG  G  SCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYG
Sbjct  117  VGTTPTAGGAGGGGSCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYG  176

Query  175  TPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPM  234
            TPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPM
Sbjct  177  TPYPSTDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDPM  236

Query  235  SAYG--------YGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITK  286
            SAYG        YGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITK
Sbjct  237  SAYGGLLVSNSSYGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITK  296

Query  287  MTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDAMVSDDEKDKEDLEPGSKGSQSGS  346
            MTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDA+VSDDEKDKEDLEP SKGSQ   
Sbjct  297  MTLTQVSTWFANARRRLKKENKMTWEPKNRTDDDDDALVSDDEKDKEDLEP-SKGSQGSV  355

Query  347  GLAKDETKEEEDAIDEDQKCLGQQANILRAGF----GYPSAGSGGYHGGGGGSAAGGYHP  402
             LAKDETKEEEDAIDEDQKCLG QANILRAGF        +G     GG      GGYHP
Sbjct  356  SLAKDETKEEEDAIDEDQKCLG-QANILRAGFGYPSAGSGSGGYPGGGGSSSGHPGGYHP  414

Query  403  YHHQHPAYYQPGQQ-GMLPFHEGSGSGSKLHGDNGEPKNQLGRDCGVPIPATKPKIWSLA  461
            YHHQHPAYYQ GQQ GMLPFH   G  SKL  D G+PKNQLGRDCGVPIPATKPKIWSLA
Sbjct  415  YHHQHPAYYQAGQQGGMLPFH---GENSKLQTDLGDPKNQLGRDCGVPIPATKPKIWSLA  471

Query  462  DTVGCKTPPPAYMGHQGHP--------NHSIPLQQQYPPVQQEAAGRD-QMFNGAAAPYL  512
            DTVGCKTPPPAYMGHQ  P              Q QYPP +   AGRD Q+FNGAAAPYL
Sbjct  472  DTVGCKTPPPAYMGHQSMPLQQQQQQQQQQQQAQHQYPPSE---AGRDQQLFNGAAAPYL  528

Query  513  RPHTTAYGGFLGATTQQLHTTNSSNSMPYTSSSMPQQQQSQLEQLHPQQLAGGLRSSGSS  572
            RPHTTAYGGFLGATTQQLHTTN  NS+PY  S+MP QQQ   +Q    Q  G        
Sbjct  529  RPHTTAYGGFLGATTQQLHTTN--NSIPY--SNMPPQQQQPQQQQQQLQQGG--------  576

Query  573  SSSGTHTPTILTTGSSSGAQQLQLQFQRQQ-------FQQSQSTASQRAMGFPEAQPDTP  625
                    TI TTGSSSG   + LQF  +         QQSQSTASQRAMGF EAQPDTP
Sbjct  577  --------TIHTTGSSSGP-IIPLQFHNRHPQQQQQLQQQSQSTASQRAMGFLEAQPDTP  627

Query  626  PQTPPNMKVLNGALSLLPTATPAPTIATCRSSNAAQY--NGYPMNFS-RIGEYSPREDYG  682
            PQTPPNMKVL+GALSLLPTAT  P  ATCRSSNA  +  +GYPMNFS R+GEYSPR+DY 
Sbjct  628  PQTPPNMKVLSGALSLLPTATQVPMTATCRSSNAFGFPASGYPMNFSARLGEYSPRDDYS  687

Query  683  SGNSSSSSTSSSSSPLQLQRNEAMFRPLFKKFVN  716
            SGNSSSSS+SS     QLQRNEAMF+PLFKKF N
Sbjct  688  SGNSSSSSSSSP----QLQRNEAMFKPLFKKFTN  717


>CAUP_DROME unnamed protein product
Length=693

 Score = 402 bits (1032),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 260/522 (50%), Positives = 317/522 (61%), Gaps = 77/522 (15%)

Query  1    MAAYTQFGYGGFPTASQLLPPSAQPAEDSSANVNDSLVMTNAPAMSPAGGADCQASQPSG  60
            MAAY QFGY G+PTA+QL          ++AN +     +     SP  G +  +  PSG
Sbjct  1    MAAYAQFGYAGYPTANQL----------TTANTDS---QSGHGGGSPLSGTNEASLSPSG  47

Query  61   GVAGAGGDASSGALSPNALSQNSQNAPTGGSVVAGAGSGPGGADLVTGGGSLDGNGVGTT  120
            G    G   ++G LSP A+SQ+S +A   G   + A       D+V G   +   G+ + 
Sbjct  48   GSTATG--LTAGPLSPGAVSQSSHHAGHKGLSTSPA------EDVVGGDVPV---GLSSA  96

Query  121  PTAGGGSGSCCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYGTPYP--  178
                   GSCCENGRPI+TDPVSGQTVCSCQYD ARLA+  YSR+   S GV    Y   
Sbjct  97   AQDLPSRGSCCENGRPIITDPVSGQTVCSCQYDPARLAIGGYSRMALPSGGVGVGVYGGP  156

Query  179  --STDQNPYQSIGVDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQPTTGYYSYDP-MS  235
              S +QNPY SIGVD+SAFY+PLSNPYG+KDT    EM AWTSA LQ TTGYYSYDP ++
Sbjct  157  YPSNEQNPYPSIGVDNSAFYAPLSNPYGIKDTSPSTEMSAWTSASLQSTTGYYSYDPTLA  216

Query  236  AYGYGASYDLAARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTW  295
            AYGYG +YDLAARRKNATRESTATLKAWL+EHKKNPYPTKGEKIMLAIITKMTLTQVSTW
Sbjct  217  AYGYGPNYDLAARRKNATRESTATLKAWLSEHKKNPYPTKGEKIMLAIITKMTLTQVSTW  276

Query  296  FANARRRLKKENKMTWEPKNRTDDDDDAMVSDDEKDKEDLEPGSKGSQS---GSGLAKDE  352
            FANARRRLKKENKMTWEPKN+T+DDDD M+SDDEK+K+  + G   +++   G+ L K E
Sbjct  277  FANARRRLKKENKMTWEPKNKTEDDDDGMMSDDEKEKDAGDGGKLSTEAFDPGNQLIKSE  336

Query  353  TKEEEDAIDE--DQKC-LGQQANILRAGFGYPSAGSGGYHGGGGGSAAGGYHPYHHQHPA  409
              + E  +D   DQK  L ++ + L A             G    +   G HP H  + +
Sbjct  337  LGKAEKEVDSSGDQKLDLDREPHNLVA-----------MRGLAPYATPPGAHPMHAAYSS  385

Query  410  YYQ-----------------------------PGQQGMLPFHEGSGSGSKLHGDNGEPKN  440
            Y Q                                Q   P++   G G +  G+    KN
Sbjct  386  YAQSHNTHTHPHPQQMQHHQQQQQQQQNQQQLQHHQMDQPYYHPGGYGQEESGEFAAQKN  445

Query  441  QLGRDCGVPIPATKPKIWSLADTVGCKTPPP--AYMGHQGHP  480
             L RDCG+P+PA+KPKIWS+ADT  CKTPPP  AY+G   +P
Sbjct  446  PLSRDCGIPVPASKPKIWSVADTAACKTPPPTAAYLGQNFYP  487


>Q9VU01_DROME unnamed protein product
Length=641

 Score = 198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 138/234 (59%), Gaps = 51/234 (22%)

Query  130  CCENGRPIMTDPVSGQTVCSCQYDSARLALSSYSRLPAASVGVYGTPYPSTDQNPYQSIG  189
            CC+ GR I TDPVSGQT+CSCQYD     + +Y RL AA+ GV    YP         I 
Sbjct  119  CCDTGRTIYTDPVSGQTICSCQYD-----MLNYQRL-AAAGGVPLGVYPEGMSAYLSGIA  172

Query  190  VDSSAFYSPLSNPYGLKDTGAGPEMGAWTSAGLQP---TTGYYSYD------PMSAYGYG  240
             D   FY+   NP G+       ++     AG  P    + Y+ YD      P ++YG  
Sbjct  173  ADQPPFYA---NPAGI-------DLKENLVAGASPWPYPSMYHPYDAAFAGYPFNSYGM-  221

Query  241  ASYDL-AARRKNATRESTATLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA  299
               DL  ARRKNATRE+T+TLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA
Sbjct  222  ---DLNGARRKNATRETTSTLKAWLNEHKKNPYPTKGEKIMLAIITKMTLTQVSTWFANA  278

Query  300  RRRLKKENKMTWEPKNRT---------------------DDDDDAMVSDDEKDK  332
            RRRLKKENKMTWEP+NR                      D  D  + S D+KD+
Sbjct  279  RRRLKKENKMTWEPRNRVDDDDANIDDDDDKNTEDNDLLDAKDSGVGSTDDKDR  332



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016469.1 ADP-ribosylation factor GTPase-activating protein 1
isoform X1 [Drosophila kikkawai]

Length=471
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

Q9VTX5_DROME  unnamed protein product                                 731     0.0  
O18358_DROME  unnamed protein product                                 729     0.0  
M9PFF1_DROME  unnamed protein product                                 684     0.0  


>Q9VTX5_DROME unnamed protein product
Length=468

 Score = 731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/477 (84%), Positives = 431/477 (90%), Gaps = 15/477 (3%)

Query  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60
            MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR
Sbjct  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60

Query  61   SVTMDKWKDIELEKMKAGGNRNAREFFEDQADWNERAPITQRYNSKAAALYRDKISTLAQ  120
            SVTMDKWKDIELEKMKAGGNRNAREF EDQ DWNERAPITQRYNSKAAALYRDKI+TLAQ
Sbjct  61   SVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ  120

Query  121  GKSWDQKEAETRVGNTNSFSSGGGGGGGGGSNSSQSRNSSTGYGGGGGGYQNGGGAGEIG  180
            GKSWD KEA+ RVG+ NSFSSGG       ++S QSR S+TGYGG GG     GG  E G
Sbjct  121  GKSWDLKEAQGRVGSNNSFSSGGSS-----NSSYQSRPSATGYGGNGG--YQNGGGAEPG  173

Query  181  GYQQYQTQEFKDQKEEFFSRRQADNASRPDHLPPSQGGKYAGFGFTREPPPKTQSQELFD  240
            GYQQYQTQEFKDQKEEFFSRRQ +NASRP++LPPSQGGKYAGFGFTREPPPKTQSQELFD
Sbjct  174  GYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFD  233

Query  241  TTLSTLASGWSLFSTNASKLANTAKEKAVTTVNLASTKIKDGTLLDSVQSGVTDVASKVT  300
            +TLSTLASGWSLFSTNASKLA+TAKEKAVTTVNLASTKIK+GTLLDSVQ GVTDVASKVT
Sbjct  234  STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVT  293

Query  301  DMGKRGWNNLAGSNISSPQGGYNDPNFEDNAAYQQRSNSV-----GALGQQSGVSDSDWG  355
            DMGKRGWNNLAGSNISSPQGGYNDPNFED++AY QRSNSV     G LGQQSGVSDSDWG
Sbjct  294  DMGKRGWNNLAGSNISSPQGGYNDPNFEDSSAY-QRSNSVGGNLAGGLGQQSGVSDSDWG  352

Query  356  GWQENANNKTHLTSSSSYHNQLSGNSMGGTATAGLTHDADWSGFESSSNYQSAEASYQNA  415
            GWQ+N N+K+H+TSSSSYHNQLS +S GGTA+AGLT DADWSGFE ++NYQS+E SYQNA
Sbjct  353  GWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFE-ATNYQSSETSYQNA  411

Query  416  PSGGSTARRNMKLQDTSQKLSEGFDNLDVKNVKAK-PVAAGGNKATAEDDAWDLLMN  471
             SGGSTARRNMKLQDTSQKLSEGF++LDVK+VK K   A+  NK TAEDDAW+LLMN
Sbjct  412  SSGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTATASSANKGTAEDDAWNLLMN  468


>O18358_DROME unnamed protein product
Length=468

 Score = 729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/477 (84%), Positives = 430/477 (90%), Gaps = 15/477 (3%)

Query  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60
            MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR
Sbjct  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60

Query  61   SVTMDKWKDIELEKMKAGGNRNAREFFEDQADWNERAPITQRYNSKAAALYRDKISTLAQ  120
            SVTMDKWKDIELEKMKAGGNRNAREF EDQ DWNERAPITQRYNSKAAALYRDKI+TLAQ
Sbjct  61   SVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ  120

Query  121  GKSWDQKEAETRVGNTNSFSSGGGGGGGGGSNSSQSRNSSTGYGGGGGGYQNGGGAGEIG  180
            GKSWD KEA+ RVG+ NSFSSGG       ++S QSR S+TGYGG GG     GG  E G
Sbjct  121  GKSWDLKEAQGRVGSNNSFSSGGSS-----NSSYQSRPSATGYGGNGG--YQNGGGAEPG  173

Query  181  GYQQYQTQEFKDQKEEFFSRRQADNASRPDHLPPSQGGKYAGFGFTREPPPKTQSQELFD  240
            GYQQYQTQEFKDQKEEFFSRRQ +NASRP++LPPSQGGKYAGFGFTREPPPKTQSQELFD
Sbjct  174  GYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFD  233

Query  241  TTLSTLASGWSLFSTNASKLANTAKEKAVTTVNLASTKIKDGTLLDSVQSGVTDVASKVT  300
            +TLSTLASGWSLFSTNASKLA+TAKEKAVTTVNLASTKIK+GTLLDSVQ GVTDVASKVT
Sbjct  234  STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVT  293

Query  301  DMGKRGWNNLAGSNISSPQGGYNDPNFEDNAAYQQRSNSV-----GALGQQSGVSDSDWG  355
            DMGKRGWNNLAGSNISS QGGYNDPNFED++AY QRSNSV     G LGQQSGVSDSDWG
Sbjct  294  DMGKRGWNNLAGSNISSRQGGYNDPNFEDSSAY-QRSNSVGGNLAGGLGQQSGVSDSDWG  352

Query  356  GWQENANNKTHLTSSSSYHNQLSGNSMGGTATAGLTHDADWSGFESSSNYQSAEASYQNA  415
            GWQ+N N+K+H+TSSSSYHNQLS +S GGTA+AGLT DADWSGFE ++NYQS+E SYQNA
Sbjct  353  GWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFE-ATNYQSSETSYQNA  411

Query  416  PSGGSTARRNMKLQDTSQKLSEGFDNLDVKNVKAK-PVAAGGNKATAEDDAWDLLMN  471
            PSGGSTARRNMKLQDTSQKLSEGF++LDVK+VK K   A+  NK TA DDAW+LLMN
Sbjct  412  PSGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTATASSANKGTARDDAWNLLMN  468


>M9PFF1_DROME unnamed protein product
Length=448

 Score = 684 bits (1766),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/477 (80%), Positives = 410/477 (86%), Gaps = 35/477 (7%)

Query  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60
            MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR
Sbjct  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60

Query  61   SVTMDKWKDIELEKMKAGGNRNAREFFEDQADWNERAPITQRYNSKAAALYRDKISTLAQ  120
            SVTMDKWKDIELEKMKAGGNRNAREF EDQ DWNERAPITQRYNSKAAALYRDKI+TLAQ
Sbjct  61   SVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ  120

Query  121  GKSWDQKEAETRVGNTNSFSSGGGGGGGGGSNSSQSRNSSTGYGGGGGGYQNGGGAGEIG  180
            GKSWD KEA+ RVG+ NSFSS     GG  ++S QSR S+T  G GG G    GG  E G
Sbjct  121  GKSWDLKEAQGRVGSNNSFSS-----GGSSNSSYQSRPSAT--GYGGNGGYQNGGGAEPG  173

Query  181  GYQQYQTQEFKDQKEEFFSRRQADNASRPDHLPPSQGGKYAGFGFTREPPPKTQSQELFD  240
            GYQQYQTQEFKDQKEEFFSRRQ +NASRP++LPPSQGGKYAGFGFTREPPPKTQSQELFD
Sbjct  174  GYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFD  233

Query  241  TTLSTLASGWSLFSTNASKLANTAKEKAVTTVNLASTKIKDGTLLDSVQSGVTDVASKVT  300
            +TLSTLASGWSLFSTNASKLA+TAKEKAVTTVNLAST                    KVT
Sbjct  234  STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLAST--------------------KVT  273

Query  301  DMGKRGWNNLAGSNISSPQGGYNDPNFEDNAAYQQRSNSV-----GALGQQSGVSDSDWG  355
            DMGKRGWNNLAGSNISSPQGGYNDPNFED++AY QRSNSV     G LGQQSGVSDSDWG
Sbjct  274  DMGKRGWNNLAGSNISSPQGGYNDPNFEDSSAY-QRSNSVGGNLAGGLGQQSGVSDSDWG  332

Query  356  GWQENANNKTHLTSSSSYHNQLSGNSMGGTATAGLTHDADWSGFESSSNYQSAEASYQNA  415
            GWQ+N N+K+H+TSSSSYHNQLS +S GGTA+AGLT DADWSGFE ++NYQS+E SYQNA
Sbjct  333  GWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFE-ATNYQSSETSYQNA  391

Query  416  PSGGSTARRNMKLQDTSQKLSEGFDNLDVKNVKAK-PVAAGGNKATAEDDAWDLLMN  471
             SGGSTARRNMKLQDTSQKLSEGF++LDVK+VK K   A+  NK TAEDDAW+LLMN
Sbjct  392  SSGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTATASSANKGTAEDDAWNLLMN  448



Lambda      K        H
   0.319    0.132    0.405 

Gapped
Lambda      K        H
   0.267   0.0410    0.140 

Effective search space used: 4240801782


Query= XP_017016470.1 ADP-ribosylation factor GTPase-activating protein 1
isoform X2 [Drosophila kikkawai]

Length=451
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

M9PFF1_DROME  unnamed protein product                                 696     0.0  
Q9VTX5_DROME  unnamed protein product                                 684     0.0  
O18358_DROME  unnamed protein product                                 682     0.0  


>M9PFF1_DROME unnamed protein product
Length=448

 Score = 696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/457 (84%), Positives = 410/457 (90%), Gaps = 15/457 (3%)

Query  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60
            MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR
Sbjct  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60

Query  61   SVTMDKWKDIELEKMKAGGNRNAREFFEDQADWNERAPITQRYNSKAAALYRDKISTLAQ  120
            SVTMDKWKDIELEKMKAGGNRNAREF EDQ DWNERAPITQRYNSKAAALYRDKI+TLAQ
Sbjct  61   SVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ  120

Query  121  GKSWDQKEAETRVGNTNSFSSGGGGGGGGGSNSSQSRNSSTGYGGGGGGYQNGGGAGEIG  180
            GKSWD KEA+ RVG+ NSFSS     GG  ++S QSR S+T  G GG G    GG  E G
Sbjct  121  GKSWDLKEAQGRVGSNNSFSS-----GGSSNSSYQSRPSAT--GYGGNGGYQNGGGAEPG  173

Query  181  GYQQYQTQEFKDQKEEFFSRRQADNASRPDHLPPSQGGKYAGFGFTREPPPKTQSQELFD  240
            GYQQYQTQEFKDQKEEFFSRRQ +NASRP++LPPSQGGKYAGFGFTREPPPKTQSQELFD
Sbjct  174  GYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFD  233

Query  241  TTLSTLASGWSLFSTNASKLANTAKEKAVTTVNLASTKVTDMGKRGWNNLAGSNISSPQG  300
            +TLSTLASGWSLFSTNASKLA+TAKEKAVTTVNLASTKVTDMGKRGWNNLAGSNISSPQG
Sbjct  234  STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKVTDMGKRGWNNLAGSNISSPQG  293

Query  301  GYNDPNFEDNAAYQQRSNSV-----GALGQQSGVSDSDWGGWQENANNKTHLTSSSSYHN  355
            GYNDPNFED++AY QRSNSV     G LGQQSGVSDSDWGGWQ+N N+K+H+TSSSSYHN
Sbjct  294  GYNDPNFEDSSAY-QRSNSVGGNLAGGLGQQSGVSDSDWGGWQDNGNSKSHMTSSSSYHN  352

Query  356  QLSGNSMGGTATAGLTHDADWSGFESSSNYQSAEASYQNAPSGGSTARRNMKLQDTSQKL  415
            QLS +S GGTA+AGLT DADWSGFE ++NYQS+E SYQNA SGGSTARRNMKLQDTSQKL
Sbjct  353  QLSSSSGGGTASAGLTRDADWSGFE-ATNYQSSETSYQNASSGGSTARRNMKLQDTSQKL  411

Query  416  SEGFDNLDVKNVKAK-PVAAGGNKATAEDDAWDLLMN  451
            SEGF++LDVK+VK K   A+  NK TAEDDAW+LLMN
Sbjct  412  SEGFESLDVKSVKPKTATASSANKGTAEDDAWNLLMN  448


>Q9VTX5_DROME unnamed protein product
Length=468

 Score = 684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/477 (80%), Positives = 410/477 (86%), Gaps = 35/477 (7%)

Query  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60
            MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR
Sbjct  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60

Query  61   SVTMDKWKDIELEKMKAGGNRNAREFFEDQADWNERAPITQRYNSKAAALYRDKISTLAQ  120
            SVTMDKWKDIELEKMKAGGNRNAREF EDQ DWNERAPITQRYNSKAAALYRDKI+TLAQ
Sbjct  61   SVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ  120

Query  121  GKSWDQKEAETRVGNTNSFSSGGGGGGGGGSNSSQSRNSSTGYGGGGGGYQNGGGAGEIG  180
            GKSWD KEA+ RVG+ NSFSS     GG  ++S QSR S+T  G GG G    GG  E G
Sbjct  121  GKSWDLKEAQGRVGSNNSFSS-----GGSSNSSYQSRPSAT--GYGGNGGYQNGGGAEPG  173

Query  181  GYQQYQTQEFKDQKEEFFSRRQADNASRPDHLPPSQGGKYAGFGFTREPPPKTQSQELFD  240
            GYQQYQTQEFKDQKEEFFSRRQ +NASRP++LPPSQGGKYAGFGFTREPPPKTQSQELFD
Sbjct  174  GYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFD  233

Query  241  TTLSTLASGWSLFSTNASKLANTAKEKAVTTVNLAST--------------------KVT  280
            +TLSTLASGWSLFSTNASKLA+TAKEKAVTTVNLAST                    KVT
Sbjct  234  STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVT  293

Query  281  DMGKRGWNNLAGSNISSPQGGYNDPNFEDNAAYQQRSNSV-----GALGQQSGVSDSDWG  335
            DMGKRGWNNLAGSNISSPQGGYNDPNFED++AY QRSNSV     G LGQQSGVSDSDWG
Sbjct  294  DMGKRGWNNLAGSNISSPQGGYNDPNFEDSSAY-QRSNSVGGNLAGGLGQQSGVSDSDWG  352

Query  336  GWQENANNKTHLTSSSSYHNQLSGNSMGGTATAGLTHDADWSGFESSSNYQSAEASYQNA  395
            GWQ+N N+K+H+TSSSSYHNQLS +S GGTA+AGLT DADWSGFE ++NYQS+E SYQNA
Sbjct  353  GWQDNGNSKSHMTSSSSYHNQLSSSSGGGTASAGLTRDADWSGFE-ATNYQSSETSYQNA  411

Query  396  PSGGSTARRNMKLQDTSQKLSEGFDNLDVKNVKAK-PVAAGGNKATAEDDAWDLLMN  451
             SGGSTARRNMKLQDTSQKLSEGF++LDVK+VK K   A+  NK TAEDDAW+LLMN
Sbjct  412  SSGGSTARRNMKLQDTSQKLSEGFESLDVKSVKPKTATASSANKGTAEDDAWNLLMN  468


>O18358_DROME unnamed protein product
Length=468

 Score = 682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/477 (80%), Positives = 409/477 (86%), Gaps = 35/477 (7%)

Query  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60
            MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR
Sbjct  1    MASPRTRRVLQELKPQDENSKCFECGTHNPQWVSVTYGIWICLECSGKHRSLGVHLSFVR  60

Query  61   SVTMDKWKDIELEKMKAGGNRNAREFFEDQADWNERAPITQRYNSKAAALYRDKISTLAQ  120
            SVTMDKWKDIELEKMKAGGNRNAREF EDQ DWNERAPITQRYNSKAAALYRDKI+TLAQ
Sbjct  61   SVTMDKWKDIELEKMKAGGNRNAREFLEDQEDWNERAPITQRYNSKAAALYRDKIATLAQ  120

Query  121  GKSWDQKEAETRVGNTNSFSSGGGGGGGGGSNSSQSRNSSTGYGGGGGGYQNGGGAGEIG  180
            GKSWD KEA+ RVG+ NSFSS     GG  ++S QSR S+T  G GG G    GG  E G
Sbjct  121  GKSWDLKEAQGRVGSNNSFSS-----GGSSNSSYQSRPSAT--GYGGNGGYQNGGGAEPG  173

Query  181  GYQQYQTQEFKDQKEEFFSRRQADNASRPDHLPPSQGGKYAGFGFTREPPPKTQSQELFD  240
            GYQQYQTQEFKDQKEEFFSRRQ +NASRP++LPPSQGGKYAGFGFTREPPPKTQSQELFD
Sbjct  174  GYQQYQTQEFKDQKEEFFSRRQVENASRPENLPPSQGGKYAGFGFTREPPPKTQSQELFD  233

Query  241  TTLSTLASGWSLFSTNASKLANTAKEKAVTTVNLAST--------------------KVT  280
            +TLSTLASGWSLFSTNASKLA+TAKEKAVTTVNLAST                    KVT
Sbjct  234  STLSTLASGWSLFSTNASKLASTAKEKAVTTVNLASTKIKEGTLLDSVQCGVTDVASKVT  293

Query  281  DMGKRGWNNLAGSNISSPQGGYNDPNFEDNAAYQQRSNSV-----GALGQQSGVSDSDWG  335
            DMGKRGWNNLAGSNISS QGGYNDPNFED++AY QRSNSV     G LGQQSGVSDSDWG
Sbjct  294  DMGKRGWNNLAGSNISSRQGGYNDPNFEDSSAY-QRSNSVGGNLAGGLGQQSGVSDSDWG  352

Query  336  GWQENANNKTHLTSSSSYHNQLSGNSMGGTATAGLTHDADWSGFESSSNYQSAEASYQNA  395
            GWQ+N N+K+H+TSSSSYHNQLS +S GGTA+AGLT DADWSGFE ++NYQS+E SYQNA
Sbjct  353  GWQDNGNSKSHMT